BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32893_g1_i1 len=2029 path=[2007:0-2028]

Length=2029
                                                                      Score     E

ref|XP_009591578.1|  PREDICTED: (-)-germacrene D synthase-like          686   0.0      
ref|XP_006363570.1|  PREDICTED: (-)-germacrene D synthase-like          679   0.0      
emb|CAN83470.1|  hypothetical protein VITISV_030783                     633   0.0      Vitis vinifera
emb|CDP05817.1|  unnamed protein product                                632   0.0      
emb|CBI20483.3|  unnamed protein product                                632   0.0      
emb|CAN68620.1|  hypothetical protein VITISV_013313                     631   0.0      Vitis vinifera
ref|NP_001268204.1|  uncharacterized protein LOC100257265               624   0.0      
ref|NP_001268213.1|  (-)-germacrene D synthase                          624   0.0      
ref|XP_009623875.1|  PREDICTED: (-)-germacrene D synthase-like          620   0.0      
gb|AEP17005.1|  (E)-beta-caryophyllene synthase                         620   0.0      
gb|AFE56211.1|  terpene synthase                                        619   0.0      
emb|CDP05818.1|  unnamed protein product                                608   0.0      
ref|XP_009804030.1|  PREDICTED: (-)-germacrene D synthase-like          607   0.0      
ref|XP_006367561.1|  PREDICTED: germacrene C synthase-like              606   0.0      
gb|AEP82784.1|  terpene synthase                                        601   0.0      
emb|CBI20482.3|  unnamed protein product                                602   0.0      
ref|XP_007021115.1|  Delta-cadinene synthase isozyme A, putative        596   0.0      
ref|XP_004288818.1|  PREDICTED: (-)-germacrene D synthase-like          594   0.0      
ref|NP_001234766.1|  caryophyllene/alpha-humulene synthase              592   0.0      
ref|XP_006356724.1|  PREDICTED: (E,E)-germacrene B synthase-like        590   0.0      
gb|AGS16741.1|  sesquiterpene synthase                                  590   0.0      
sp|Q9FQ27.1|TPSGB_SOLHA  RecName: Full=(E,E)-germacrene B synthase      588   0.0      Solanum habrochaites
gb|AAG41892.1|AF279456_1  sesquiterpene synthase 2                      588   0.0      Solanum habrochaites
ref|XP_011090538.1|  PREDICTED: germacrene-D synthase-like              586   0.0      
ref|NP_001289542.1|  germacrene C synthase-like                         587   0.0      
gb|AAS46038.1|  cyclase                                                 585   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001289541.1|  germacrene C synthase-like                         585   0.0      
gb|AAK95517.1|AF401234_1  cyclase                                       585   0.0      Nicotiana tabacum [American tobacco]
gb|AAX16121.1|  germacrene-D synthase                                   583   0.0      Actinidia deliciosa [Chinese gooseberry]
gb|ADK94034.1|  alpha-copaene synthase                                  582   0.0      
ref|XP_009594549.1|  PREDICTED: germacrene C synthase-like              582   0.0      
gb|AGB05614.1|  sesquiterpene synthase 5                                580   0.0      
ref|XP_009793508.1|  PREDICTED: germacrene C synthase-like isofor...    582   0.0      
gb|AEM23825.1|  sesquiterpene synthase                                  579   0.0      
ref|XP_011095305.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caryoph...    579   0.0      
ref|XP_010092286.1|  (-)-germacrene D synthase                          579   0.0      
gb|AEM23826.1|  sesquiterpene synthase                                  577   0.0      
ref|XP_010092292.1|  (-)-germacrene D synthase                          576   0.0      
ref|XP_010644711.1|  PREDICTED: (-)-germacrene D synthase               575   0.0      
ref|XP_011095786.1|  PREDICTED: germacrene-D synthase-like              574   0.0      
ref|NP_001234481.1|  sesquiterpene synthase 1                           572   0.0      
gb|AAG41890.1|AF279454_1  sesquiterpene synthase 2                      572   0.0      Solanum lycopersicum
ref|NP_001234060.1|  germacrene C synthase                              569   0.0      
emb|CDP18846.1|  unnamed protein product                                570   0.0      
ref|XP_002282488.1|  PREDICTED: (-)-germacrene D synthase               567   0.0      Vitis vinifera
ref|XP_009609204.1|  PREDICTED: LOW QUALITY PROTEIN: germacrene C...    569   0.0      
emb|CDP18843.1|  unnamed protein product                                566   0.0      
ref|XP_006365934.1|  PREDICTED: germacrene C synthase-like              563   0.0      
ref|XP_006472987.1|  PREDICTED: (-)-germacrene D synthase-like          565   0.0      
ref|XP_006365530.1|  PREDICTED: germacrene C synthase-like              563   0.0      
ref|XP_006475286.1|  PREDICTED: (-)-germacrene D synthase-like is...    562   0.0      
gb|AEM23828.1|  sesquiterpene synthase                                  561   0.0      
ref|XP_004242295.1|  PREDICTED: germacrene C synthase-like              563   0.0      
emb|CAN82172.1|  hypothetical protein VITISV_040547                     561   0.0      Vitis vinifera
ref|XP_011100634.1|  PREDICTED: germacrene-D synthase-like              559   0.0      
gb|KDP36230.1|  hypothetical protein JCGZ_09950                         559   0.0      
gb|AGW18162.1|  terpene synthase 4-2                                    559   0.0      
ref|XP_006353135.1|  PREDICTED: (-)-germacrene D synthase-like          559   0.0      
ref|NP_001289493.1|  germacrene C synthase-like                         560   0.0      
gb|KDP39015.1|  hypothetical protein JCGZ_00772                         559   0.0      
ref|NP_001239041.1|  sesquiterpene synthase                             558   0.0      
gb|AAR99061.1|  (-)-germacrene D synthase                               558   0.0      Populus trichocarpa x Populus deltoides
ref|XP_006475285.1|  PREDICTED: (-)-germacrene D synthase-like is...    558   0.0      
gb|AAL25826.1|  cyclase                                                 558   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006370591.1|  hypothetical protein POPTR_0001s44080g             555   0.0      
ref|XP_002275408.3|  PREDICTED: valencene synthase                      554   0.0      Vitis vinifera
ref|XP_002522812.1|  (+)-delta-cadinene synthase isozyme A, putative    554   0.0      Ricinus communis
gb|AEI52901.1|  terpene synthase 1                                      554   0.0      
gb|KDO45658.1|  hypothetical protein CISIN_1g039366mg                   553   0.0      
ref|XP_009803139.1|  PREDICTED: germacrene C synthase-like isofor...    552   0.0      
gb|AGW18157.1|  terpene synthase 4                                      554   0.0      
gb|KHG04103.1|  (-)-germacrene D synthase                               552   0.0      
gb|KDO69460.1|  hypothetical protein CISIN_1g044370mg                   552   0.0      
ref|NP_001268063.1|  uncharacterized protein LOC100267145               552   0.0      
gb|AAX40666.1|  sesquiterpene synthase                                  552   0.0      Fabiana imbricata [pichi]
emb|CAN75099.1|  hypothetical protein VITISV_019788                     551   0.0      Vitis vinifera
ref|XP_002283076.1|  PREDICTED: (-)-germacrene D synthase               551   0.0      Vitis vinifera
gb|AFQ23183.1|  sesquiterpene synthase                                  550   0.0      
sp|B5A435.1|STPS1_SANAL  RecName: Full=Sesquiterpene synthase; Sh...    550   0.0      Santalum album
gb|ADR74194.1|  (E)-beta-caryophyllene synthase                         550   0.0      
emb|CBI20475.3|  unnamed protein product                                551   0.0      
ref|XP_002321642.1|  hypothetical protein POPTR_0015s09710g             550   0.0      Populus trichocarpa [western balsam poplar]
dbj|BAJ46125.1|  sesquiterpene synthase                                 550   0.0      
ref|XP_011095783.1|  PREDICTED: germacrene-D synthase-like              552   0.0      
ref|XP_009794478.1|  PREDICTED: germacrene C synthase-like              549   0.0      
ref|XP_006476905.1|  PREDICTED: (-)-germacrene D synthase-like          549   0.0      
sp|J7LJN5.1|TPS6_PHYDL  RecName: Full=Beta-caryophyllene synthase...    548   0.0      
emb|CAN81129.1|  hypothetical protein VITISV_002911                     549   0.0      Vitis vinifera
gb|AII32471.1|  terpene synthase                                        548   0.0      
ref|XP_006473872.1|  PREDICTED: (-)-germacrene D synthase-like          548   0.0      
ref|XP_011095787.1|  PREDICTED: germacrene-D synthase-like              547   0.0      
ref|XP_011048258.1|  PREDICTED: (-)-germacrene D synthase-like          548   0.0      
ref|XP_008347229.1|  PREDICTED: (-)-germacrene D synthase-like          547   0.0      
ref|XP_009358866.1|  PREDICTED: (-)-germacrene D synthase-like          547   0.0      
emb|CAN78342.1|  hypothetical protein VITISV_000109                     547   0.0      Vitis vinifera
ref|XP_007021123.1|  Delta-cadinene synthase isozyme A                  547   0.0      
ref|XP_006478792.1|  PREDICTED: (-)-germacrene D synthase-like          547   0.0      
ref|XP_009334624.1|  PREDICTED: (-)-germacrene D synthase-like          546   0.0      
gb|AGB14624.1|  beta-caryophyllene synthase                             546   0.0      
emb|CBI20174.3|  unnamed protein product                                546   0.0      
emb|CAN62603.1|  hypothetical protein VITISV_009665                     547   0.0      Vitis vinifera
ref|XP_009338863.1|  PREDICTED: (-)-germacrene D synthase-like          545   0.0      
ref|XP_004168174.1|  PREDICTED: (+)-gamma-cadinene synthase-like        545   0.0      
dbj|BAM24405.1|  sesquiterpene synthase                                 545   0.0      
gb|AIC76495.1|  terpene synthase                                        543   0.0      
ref|XP_011095304.1|  PREDICTED: germacrene-D synthase-like              544   0.0      
sp|F6M8H7.1|SMST_SANMU  RecName: Full=Probable sesquiterpene synt...    544   0.0      
emb|CBI31274.3|  unnamed protein product                                550   0.0      
gb|ADR66821.1|  germacrene A synthase                                   543   0.0      
sp|J9R5V4.1|TPS2_VALOF  RecName: Full=Valerena-4,7(11)-diene synt...    543   0.0      
ref|XP_006478794.1|  PREDICTED: (-)-germacrene D synthase-like is...    543   0.0      
ref|XP_011035527.1|  PREDICTED: (-)-germacrene D synthase-like          543   0.0      
gb|AGB05610.1|  sesquiterpene synthase 1                                543   0.0      
gb|KDO52415.1|  hypothetical protein CISIN_1g008620mg                   542   0.0      
ref|XP_006475284.1|  PREDICTED: (-)-germacrene D synthase-like          543   0.0      
ref|XP_006364906.1|  PREDICTED: (-)-germacrene D synthase-like          542   0.0      
ref|XP_002283070.1|  PREDICTED: (-)-germacrene D synthase               542   0.0      Vitis vinifera
gb|KGN56190.1|  hypothetical protein Csa_3G097540                       541   0.0      
gb|ADK73619.1|  terpene synthase 3                                      541   0.0      
ref|XP_011005622.1|  PREDICTED: valencene synthase-like isoform X1      541   0.0      
ref|XP_009344725.1|  PREDICTED: (-)-germacrene D synthase-like          541   0.0      
sp|E3W207.1|SAUSS_SANAS  RecName: Full=Sesquiterpene synthase; Sh...    541   0.0      
ref|NP_001284382.1|  (+)-gamma-cadinene synthase                        541   0.0      
ref|XP_006363765.1|  PREDICTED: (-)-germacrene D synthase-like          540   0.0      
sp|F6M8H6.1|SPIST_SANSP  RecName: Full=Probable sesquiterpene syn...    540   0.0      
ref|XP_006469889.1|  PREDICTED: (-)-germacrene D synthase-like          540   0.0      
dbj|BAP75561.1|  linalool synthase                                      540   0.0      
sp|F6M8H4.1|SAST_SANAL  RecName: Full=Probable sesquiterpene synt...    540   0.0      
ref|NP_001268024.1|  valencene synthase-like                            541   0.0      
ref|XP_006374233.1|  hypothetical protein POPTR_0015s05270g             539   0.0      
dbj|BAP74389.1|  delta-elemene synthase                                 540   0.0      
ref|XP_011015484.1|  PREDICTED: valencene synthase-like                 538   0.0      
gb|AGB14625.1|  germacrene-D synthase                                   538   0.0      
emb|CBI31262.3|  unnamed protein product                                540   0.0      
gb|ADX01384.1|  germacrene D synthase                                   538   0.0      
emb|CBI31305.3|  unnamed protein product                                541   0.0      
ref|XP_006364159.1|  PREDICTED: (-)-germacrene D synthase-like          538   0.0      
gb|ACF94469.1|  germacrene B synthase                                   538   1e-180   Cistus creticus subsp. creticus
ref|NP_001268028.1|  valencene synthase-like                            537   1e-180   
ref|XP_004243482.2|  PREDICTED: (-)-germacrene D synthase               536   2e-180   
ref|XP_002274781.1|  PREDICTED: valencene synthase                      537   2e-180   Vitis vinifera
sp|J9RLZ7.1|TPS1_VALOF  RecName: Full=Germacrene C/D synthase; Al...    536   4e-180   
gb|AAV36464.1|  wound-inducible putative cytosolic terpene syntha...    536   4e-180   Medicago truncatula
sp|E3W208.1|SPISS_SANSP  RecName: Full=Sesquiterpene synthase; Sh...    536   5e-180   
ref|XP_002274445.2|  PREDICTED: valencene synthase-like                 535   8e-180   Vitis vinifera
ref|XP_002523635.1|  (+)-delta-cadinene synthase isozyme A, putative    535   9e-180   Ricinus communis
emb|CBI31294.3|  unnamed protein product                                536   1e-179   
ref|XP_011095784.1|  PREDICTED: germacrene-D synthase-like              535   1e-179   
ref|XP_010057304.1|  PREDICTED: (-)-germacrene D synthase-like          535   1e-179   
gb|AGW18161.1|  terpene synthase 4-1                                    535   2e-179   
ref|XP_009785126.1|  PREDICTED: germacrene C synthase-like              535   2e-179   
gb|AGB05616.1|  sesquiterpene synthase 7                                535   2e-179   
ref|NP_001268015.1|  (-)-germacrene D synthase-like                     534   3e-179   
ref|XP_009757762.1|  PREDICTED: (-)-germacrene D synthase-like is...    533   3e-179   
ref|XP_010645872.1|  PREDICTED: LOW QUALITY PROTEIN: valencene sy...    533   4e-179   
ref|NP_001268215.1|  valencene synthase                                 533   5e-179   
ref|XP_011005621.1|  PREDICTED: (-)-germacrene D synthase-like          533   6e-179   
gb|ADR74199.1|  gamma-cadinene synthase                                 534   6e-179   
ref|XP_010258444.1|  PREDICTED: (-)-germacrene D synthase-like          533   9e-179   
ref|XP_006367836.1|  PREDICTED: germacrene C synthase-like              532   1e-178   
ref|XP_008232170.1|  PREDICTED: (-)-germacrene D synthase-like          532   2e-178   
sp|Q5SBP6.1|GDS_OCIBA  RecName: Full=Germacrene-D synthase; AltNa...    531   3e-178   Ocimum basilicum [basil]
ref|XP_003541022.1|  PREDICTED: (-)-germacrene D synthase-like is...    531   4e-178   
ref|NP_001239042.1|  sesquiterpene synthase                             531   4e-178   
sp|Q6Q3H2.1|TPSVS_VITVI  RecName: Full=Valencene synthase; Short=...    531   4e-178   Vitis vinifera
gb|KHN11075.1|  (-)-germacrene D synthase                               530   9e-178   
ref|XP_008452330.1|  PREDICTED: (+)-gamma-cadinene synthase-like        531   1e-177   
ref|XP_002283344.1|  PREDICTED: (-)-germacrene D synthase               530   1e-177   Vitis vinifera
ref|XP_006592517.1|  PREDICTED: (-)-germacrene D synthase-like is...    530   1e-177   
ref|XP_011030746.1|  PREDICTED: (-)-germacrene D synthase-like is...    530   1e-177   
gb|AGL98419.1|  B-caryophyllene synthase                                529   2e-177   
gb|AEP82781.1|  TPS16                                                   529   2e-177   
ref|XP_011030745.1|  PREDICTED: (-)-germacrene D synthase-like is...    529   2e-177   
ref|XP_009768421.1|  PREDICTED: (-)-germacrene D synthase-like is...    528   3e-177   
ref|XP_010038257.1|  PREDICTED: (-)-germacrene D synthase-like          529   3e-177   
gb|AGV28055.1|  sesquiterpene synthase                                  528   5e-177   
ref|XP_006592518.1|  PREDICTED: (-)-germacrene D synthase-like is...    528   8e-177   
sp|F6M8H5.1|SAUST_SANAS  RecName: Full=Probable sesquiterpene syn...    528   9e-177   
ref|XP_009349849.1|  PREDICTED: (-)-germacrene D synthase-like          527   2e-176   
ref|XP_008371257.1|  PREDICTED: (-)-germacrene D synthase-like is...    526   4e-176   
ref|XP_006592520.1|  PREDICTED: (-)-germacrene D synthase-like is...    526   5e-176   
gb|AEM23830.1|  sesquiterpene synthase                                  525   5e-176   
ref|XP_006473871.1|  PREDICTED: (-)-germacrene D synthase-like          525   6e-176   
ref|XP_008371258.1|  PREDICTED: (-)-germacrene D synthase-like is...    525   8e-176   
gb|AII32473.1|  terpene synthase                                        526   8e-176   
gb|AJD19682.1|  sesquiterpene synthase Tps1                             526   9e-176   
ref|XP_010042263.1|  PREDICTED: (-)-germacrene D synthase-like          525   2e-175   
ref|XP_009757760.1|  PREDICTED: (-)-germacrene D synthase-like is...    524   2e-175   
ref|XP_009338866.1|  PREDICTED: (-)-germacrene D synthase-like          524   2e-175   
ref|XP_010241001.1|  PREDICTED: (-)-germacrene D synthase-like          524   2e-175   
gb|AGL98420.1|  germacrene-D synthase                                   523   2e-175   
gb|KGN56189.1|  hypothetical protein Csa_3G097040                       524   3e-175   
gb|KCW52014.1|  hypothetical protein EUGRSUZ_J01453                     524   3e-175   
ref|XP_003614996.1|  (+)-delta-cadinene synthase isozyme A              523   4e-175   
ref|XP_010032599.1|  PREDICTED: (-)-germacrene D synthase-like          524   4e-175   
ref|XP_004505471.1|  PREDICTED: (-)-germacrene D synthase-like          523   5e-175   
emb|CAN62114.1|  hypothetical protein VITISV_032023                     522   5e-175   Vitis vinifera
gb|AAU05952.1|  beta-caryophyllene synthase                             523   7e-175   Cucumis sativus [cucumbers]
ref|XP_007021117.1|  Delta-cadinene synthase isozyme A                  522   9e-175   
ref|XP_010061274.1|  PREDICTED: (-)-germacrene D synthase-like          523   1e-174   
sp|K4LMW2.1|STS2_THAGA  RecName: Full=Sesquiterpene synthase 2; A...    522   1e-174   
gb|AES74575.2|  sesquiterpene synthase                                  522   1e-174   
ref|XP_008226738.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    522   1e-174   
gb|ABB01625.1|  terpene synthase                                        521   2e-174   Medicago truncatula
gb|KEH29688.1|  sesquiterpene synthase                                  521   3e-174   
ref|XP_009338882.1|  PREDICTED: (-)-germacrene D synthase-like          520   3e-174   
gb|AAX44033.1|  (+)-delta-cadinene synthase                             521   3e-174   Gossypium hirsutum [American cotton]
ref|XP_006370589.1|  hypothetical protein POPTR_0001s44080g             519   3e-174   
gb|AAF74977.1|AF270425_1  (+)-delta-cadinene synthase                   521   4e-174   Gossypium hirsutum [American cotton]
gb|EYU19193.1|  hypothetical protein MIMGU_mgv1a018094mg                521   4e-174   
gb|KHG04498.1|  (+)-delta-cadinene synthase isozyme A                   520   5e-174   
ref|XP_007021120.1|  Delta-cadinene synthase isozyme A                  520   6e-174   
sp|O49853.1|DCS4_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    520   6e-174   Gossypium arboreum [tree cotton]
emb|CAA77191.1|  (+)-delta-cadinene synthase                            520   6e-174   Gossypium arboreum [tree cotton]
ref|XP_006370590.1|  hypothetical protein POPTR_0001s44080g             519   1e-173   
gb|KDO83772.1|  hypothetical protein CISIN_1g035568mg                   518   1e-173   
ref|XP_006358819.1|  PREDICTED: germacrene C synthase-like              520   2e-173   
ref|XP_009785131.1|  PREDICTED: (E,E)-germacrene B synthase-like        521   2e-173   
ref|XP_008226737.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    519   2e-173   
ref|XP_002317018.2|  hypothetical protein POPTR_0011s14600g             519   3e-173   Populus trichocarpa [western balsam poplar]
ref|XP_007021067.1|  Delta-cadinene synthase isozyme A, putative        518   3e-173   
sp|Q43714.1|DCS3_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    518   3e-173   Gossypium arboreum [tree cotton]
ref|XP_006592519.1|  PREDICTED: (-)-germacrene D synthase-like is...    519   3e-173   
ref|XP_007021121.1|  Delta-cadinene synthase isozyme A                  518   8e-173   
emb|CAN60658.1|  hypothetical protein VITISV_029939                     516   8e-173   Vitis vinifera
ref|XP_010062944.1|  PREDICTED: (-)-germacrene D synthase-like is...    518   8e-173   
ref|XP_008388200.1|  PREDICTED: (-)-germacrene D synthase-like          517   1e-172   
emb|CAN72015.1|  hypothetical protein VITISV_010524                     516   1e-172   Vitis vinifera
sp|Q39760.1|DCS2_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    517   1e-172   Gossypium arboreum [tree cotton]
ref|XP_003618357.1|  (+)-delta-cadinene synthase isozyme A              516   2e-172   
gb|ABK63808.1|  sesquiterpene cyclase                                   516   2e-172   Centella asiatica [Asiatic pennywort]
ref|XP_006475310.1|  PREDICTED: (-)-germacrene D synthase-like          531   2e-172   
sp|E2E2N7.1|BCGS_ORIVU  RecName: Full=Bicyclogermacrene synthase;...    516   3e-172   
sp|P93665.1|DCS1_GOSHI  RecName: Full=(+)-delta-cadinene synthase...    516   3e-172   Gossypium hirsutum [American cotton]
gb|AIK19227.1|  sesquiterpene synthase                                  516   5e-172   
sp|Q39761.1|DCS1_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    515   6e-172   Gossypium arboreum [tree cotton]
ref|XP_010062945.1|  PREDICTED: (-)-germacrene D synthase-like          515   9e-172   
ref|XP_004308569.1|  PREDICTED: (-)-germacrene D synthase-like          514   1e-171   
ref|XP_006475306.1|  PREDICTED: (E)-beta-farnesene synthase-like        514   1e-171   
ref|XP_006592521.1|  PREDICTED: (-)-germacrene D synthase-like is...    514   2e-171   
ref|XP_004301355.1|  PREDICTED: (-)-germacrene D synthase-like          514   2e-171   
ref|XP_010062943.1|  PREDICTED: (-)-germacrene D synthase-like is...    514   2e-171   
gb|KHG14851.1|  (+)-delta-cadinene synthase isozyme C2                  514   2e-171   
ref|XP_007028200.1|  Delta-cadinene synthase isozyme A, putative        513   3e-171   
ref|XP_009338867.1|  PREDICTED: (-)-germacrene D synthase-like          513   4e-171   
ref|XP_006367763.1|  PREDICTED: germacrene C synthase-like              514   5e-171   
ref|XP_009355684.1|  PREDICTED: (-)-alpha-pinene synthase-like          513   6e-171   
gb|KHG05331.1|  delta-cadinene synthase isozyme XC14                    512   7e-171   
ref|XP_010247958.1|  PREDICTED: (-)-germacrene D synthase-like          512   1e-170   
gb|KDO74408.1|  hypothetical protein CISIN_1g008427mg                   512   1e-170   
ref|XP_006365542.1|  PREDICTED: germacrene C synthase-like              511   1e-170   
ref|XP_009617778.1|  PREDICTED: (-)-germacrene D synthase-like          512   2e-170   
emb|CBI31290.3|  unnamed protein product                                532   2e-170   
gb|KCW70095.1|  hypothetical protein EUGRSUZ_F03400                     512   2e-170   
gb|KCW70094.1|  hypothetical protein EUGRSUZ_F03400                     511   3e-170   
ref|XP_009342460.1|  PREDICTED: (-)-alpha-pinene synthase-like          511   4e-170   
ref|XP_008226803.1|  PREDICTED: (-)-alpha-pinene synthase-like          510   5e-170   
ref|XP_010055474.1|  PREDICTED: (-)-germacrene D synthase-like          511   6e-170   
gb|ADK73616.1|  terpene synthase 6                                      510   6e-170   
ref|XP_002275351.1|  PREDICTED: valencene synthase                      510   7e-170   Vitis vinifera
ref|XP_010055487.1|  PREDICTED: (-)-germacrene D synthase-like          511   7e-170   
ref|NP_001281061.1|  (-)-alpha-pinene synthase-like                     510   8e-170   
ref|XP_006477783.1|  PREDICTED: (-)-germacrene D synthase-like          509   9e-170   
ref|XP_007133005.1|  hypothetical protein PHAVU_011G143200g             509   1e-169   
gb|KEH26009.1|  sesquiterpene synthase                                  509   1e-169   
ref|XP_008245781.1|  PREDICTED: (-)-alpha-pinene synthase-like          509   1e-169   
ref|XP_010055485.1|  PREDICTED: (-)-germacrene D synthase-like          510   1e-169   
ref|XP_010055490.1|  PREDICTED: (-)-germacrene D synthase-like          510   2e-169   
gb|AAV36467.1|  wound-inducible putative cytosolic terpene syntha...    509   2e-169   Medicago truncatula
gb|AEP82782.1|  TPS14                                                   509   3e-169   
ref|XP_004294317.1|  PREDICTED: (-)-germacrene D synthase-like          508   3e-169   
gb|KCW71948.1|  hypothetical protein EUGRSUZ_E00404                     509   4e-169   
gb|AES98824.2|  sesquiterpene synthase                                  508   5e-169   
ref|XP_008374195.1|  PREDICTED: (-)-alpha-pinene synthase-like          508   5e-169   
ref|XP_004247892.1|  PREDICTED: germacrene C synthase-like              507   6e-169   
gb|KCW44806.1|  hypothetical protein EUGRSUZ_L01631                     508   6e-169   
gb|KCW71961.1|  hypothetical protein EUGRSUZ_E00415                     508   8e-169   
gb|KCW71959.1|  hypothetical protein EUGRSUZ_E00414                     509   8e-169   
ref|XP_004497487.1|  PREDICTED: (-)-germacrene D synthase-like          507   1e-168   
ref|XP_006494713.1|  PREDICTED: (-)-germacrene D synthase-like is...    507   1e-168   
ref|XP_008366487.1|  PREDICTED: (-)-alpha-pinene synthase-like          507   1e-168   
ref|XP_007021122.1|  Delta-cadinene synthase isozyme A, putative        511   2e-168   
emb|CBI31313.3|  unnamed protein product                                508   3e-168   
ref|XP_002273624.2|  PREDICTED: valencene synthase                      506   3e-168   
gb|KHG16315.1|  delta-cadinene synthase isozyme XC1                     506   3e-168   
gb|AAX44034.1|  (+)-delta-cadinene synthase                             506   3e-168   
ref|NP_001275785.1|  valencene synthase                                 505   3e-168   
emb|CBI20287.3|  unnamed protein product                                507   3e-168   
ref|XP_008226805.1|  PREDICTED: (-)-alpha-pinene synthase-like          505   6e-168   
ref|XP_010062946.1|  PREDICTED: (-)-germacrene D synthase-like          505   1e-167   
ref|XP_010041348.1|  PREDICTED: (-)-germacrene D synthase-like          507   1e-167   
ref|XP_002275058.1|  PREDICTED: valencene synthase                      504   1e-167   
ref|XP_008226801.1|  PREDICTED: (-)-alpha-pinene synthase-like          504   1e-167   
ref|XP_008371259.1|  PREDICTED: (-)-germacrene D synthase-like is...    503   1e-167   
ref|XP_006475262.1|  PREDICTED: (-)-germacrene D synthase-like          504   1e-167   
ref|XP_007132996.1|  hypothetical protein PHAVU_011G142500g             504   2e-167   
gb|AAQ04608.1|AF441124_1  valencene synthase                            503   2e-167   
gb|KDO38264.1|  hypothetical protein CISIN_1g008206mg                   504   2e-167   
sp|K4L9M2.1|STS1_THAGA  RecName: Full=Sesquiterpene synthase 1; A...    504   2e-167   
ref|XP_010042602.1|  PREDICTED: (-)-germacrene D synthase-like          503   2e-167   
gb|KDP31579.1|  hypothetical protein JCGZ_14804                         504   3e-167   
ref|XP_007132999.1|  hypothetical protein PHAVU_011G142700g             503   4e-167   
gb|KCW44424.1|  hypothetical protein EUGRSUZ_L02082                     504   4e-167   
gb|KCW62335.1|  hypothetical protein EUGRSUZ_H04977                     503   5e-167   
gb|ADR74200.1|  beta-curcumene synthase                                 503   6e-167   
dbj|BAN81914.1|  beta-caryophyllene synthase                            502   7e-167   
ref|XP_002523475.1|  (+)-delta-cadinene synthase isozyme A, putative    501   1e-166   
emb|CDP16459.1|  unnamed protein product                                499   1e-166   
gb|KEH34289.1|  sesquiterpene synthase                                  501   1e-166   
ref|XP_010644187.1|  PREDICTED: (-)-germacrene D synthase-like          501   1e-166   
ref|XP_004308410.1|  PREDICTED: (-)-germacrene D synthase-like          501   2e-166   
ref|XP_006358783.1|  PREDICTED: germacrene C synthase-like              501   2e-166   
ref|XP_009346480.1|  PREDICTED: (-)-alpha-pinene synthase-like          501   2e-166   
gb|ADK73615.1|  terpene synthase 6                                      501   3e-166   
ref|XP_002277351.2|  PREDICTED: valencene synthase                      501   3e-166   
ref|NP_001267972.1|  valencene synthase-like                            501   3e-166   
sp|Q8SA63.1|CARS_ARTAN  RecName: Full=Beta-caryophyllene synthase       500   4e-166   
gb|KCW71947.1|  hypothetical protein EUGRSUZ_E00404                     501   4e-166   
gb|AEM23829.1|  sesquiterpene synthase                                  499   6e-166   
ref|XP_008244606.1|  PREDICTED: (-)-germacrene D synthase-like          499   7e-166   
gb|AAM00426.1|AF411120_1  putative terpene synthase                     499   1e-165   
ref|XP_006494712.1|  PREDICTED: (-)-germacrene D synthase-like is...    500   1e-165   
gb|KDO41091.1|  hypothetical protein CISIN_1g008817mg                   499   1e-165   
gb|KCW70103.1|  hypothetical protein EUGRSUZ_F03413                     498   1e-165   
ref|XP_008244326.1|  PREDICTED: (-)-germacrene D synthase-like          499   1e-165   
ref|XP_010059288.1|  PREDICTED: (-)-germacrene D synthase-like          505   1e-165   
ref|XP_008386098.1|  PREDICTED: (-)-alpha-pinene synthase-like          499   2e-165   
ref|XP_009349778.1|  PREDICTED: (-)-alpha-pinene synthase-like          499   2e-165   
gb|KDP39020.1|  hypothetical protein JCGZ_00777                         498   3e-165   
emb|CBI31291.3|  unnamed protein product                                500   3e-165   
ref|XP_004490338.1|  PREDICTED: (-)-germacrene D synthase-like          498   3e-165   
ref|XP_004287071.1|  PREDICTED: (-)-alpha-pinene synthase-like          497   6e-165   
ref|XP_004514757.1|  PREDICTED: (-)-germacrene D synthase-like          497   9e-165   
ref|XP_004294324.1|  PREDICTED: (-)-alpha-pinene synthase-like          496   2e-164   
ref|XP_003541032.1|  PREDICTED: probable terpene synthase 2-like        496   2e-164   
gb|KDO38263.1|  hypothetical protein CISIN_1g008206mg                   496   2e-164   
gb|KHG01539.1|  delta-cadinene synthase isozyme XC1                     496   3e-164   
ref|XP_008226800.1|  PREDICTED: (-)-alpha-pinene synthase-like          495   5e-164   
ref|XP_006475307.1|  PREDICTED: (E)-beta-farnesene synthase-like ...    495   5e-164   
gb|AET00670.2|  sesquiterpene synthase                                  494   5e-164   
gb|AGR40502.1|  caryophyllene synthase                                  494   8e-164   
ref|XP_002306399.2|  hypothetical protein POPTR_0005s09830g             494   1e-163   
gb|KCW44164.1|  hypothetical protein EUGRSUZ_L02418                     492   1e-163   
gb|AIC76497.1|  terpene synthase                                        494   2e-163   
ref|XP_004295289.1|  PREDICTED: (-)-germacrene D synthase-like          493   2e-163   
ref|XP_010099818.1|  (-)-germacrene D synthase                          492   2e-163   
ref|XP_006358818.1|  PREDICTED: germacrene C synthase-like              493   3e-163   
ref|XP_006475314.1|  PREDICTED: (E)-beta-farnesene synthase-like        495   3e-163   
ref|XP_006490721.1|  PREDICTED: (E)-beta-farnesene synthase-like        493   4e-163   
gb|KCW76750.1|  hypothetical protein EUGRSUZ_D01105                     492   9e-163   
ref|XP_008227046.1|  PREDICTED: (-)-alpha-pinene synthase-like          493   9e-163   
gb|AIK19226.1|  sesquiterpene synthase                                  493   9e-163   
emb|CAN71873.1|  hypothetical protein VITISV_002877                     491   1e-162   
gb|AII32469.1|  terpene synthase                                        491   1e-162   
gb|KDO62844.1|  hypothetical protein CISIN_1g008767mg                   491   2e-162   
ref|XP_004517081.1|  PREDICTED: (-)-germacrene D synthase-like          491   2e-162   
emb|CAD90835.1|  (+)-delta-cadinene synthase                            491   2e-162   
ref|XP_004516888.1|  PREDICTED: (-)-germacrene D synthase-like          491   2e-162   
emb|CAC12732.1|  putative sesquiterpene cyclase                         490   3e-162   
ref|XP_003615866.1|  (+)-delta-cadinene synthase isozyme C2             489   4e-162   
ref|XP_007133006.1|  hypothetical protein PHAVU_011G143300g             490   4e-162   
gb|KHG27356.1|  delta-cadinene synthase isozyme XC14                    489   6e-162   
gb|AEM23827.1|  sesquiterpene synthase                                  489   8e-162   
ref|XP_008366777.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-germacre...    487   2e-161   
gb|AIK19228.1|  sesquiterpene synthase                                  489   2e-161   
gb|AEH41845.1|  E-beta-caryophyllene synthase                           487   3e-161   
gb|AAG01339.1|  terpene synthase                                        487   7e-161   
gb|KDP31577.1|  hypothetical protein JCGZ_14802                         485   9e-161   
gb|AGZ84810.1|  beta-caryophyllene synthase                             486   9e-161   
gb|KCW76745.1|  hypothetical protein EUGRSUZ_D01100                     487   1e-160   
ref|XP_004516887.1|  PREDICTED: (-)-germacrene D synthase-like          486   1e-160   
emb|CAN69555.1|  hypothetical protein VITISV_013102                     485   2e-160   
sp|O23945.2|PINS_FRAVE  RecName: Full=(-)-alpha-pinene synthase; ...    486   2e-160   
emb|CAN71964.1|  hypothetical protein VITISV_034218                     506   2e-160   
ref|XP_010058977.1|  PREDICTED: (-)-germacrene D synthase-like          483   2e-160   
emb|CBI31269.3|  unnamed protein product                                484   3e-160   
ref|XP_004303538.1|  PREDICTED: (-)-alpha-pinene synthase-like          485   4e-160   
ref|XP_009355680.1|  PREDICTED: (-)-alpha-pinene synthase-like          486   6e-160   
ref|XP_010049987.1|  PREDICTED: (-)-germacrene D synthase-like          484   7e-160   
gb|KCW44753.1|  hypothetical protein EUGRSUZ_L01686                     484   8e-160   
gb|KCW81098.1|  hypothetical protein EUGRSUZ_C02474                     484   8e-160   
ref|XP_010046229.1|  PREDICTED: (-)-germacrene D synthase-like          483   1e-159   
ref|XP_010040951.1|  PREDICTED: (-)-germacrene D synthase-like          484   1e-159   
ref|XP_004298302.1|  PREDICTED: (-)-germacrene D synthase-like          483   2e-159   
ref|XP_007133004.1|  hypothetical protein PHAVU_011G143100g             483   4e-159   
emb|CAN77700.1|  hypothetical protein VITISV_036209                     481   4e-159   
ref|XP_010049989.1|  PREDICTED: (-)-germacrene D synthase-like          483   5e-159   
ref|XP_010066141.1|  PREDICTED: (-)-germacrene D synthase-like          483   5e-159   
gb|AGX84976.1|  terpene synthase                                        482   7e-159   
ref|XP_011022083.1|  PREDICTED: probable terpene synthase 3             481   7e-159   
gb|KDO41838.1|  hypothetical protein CISIN_1g041926mg                   479   7e-159   
ref|XP_010054518.1|  PREDICTED: (-)-germacrene D synthase-like          482   9e-159   
gb|KCW70093.1|  hypothetical protein EUGRSUZ_F03398                     479   1e-158   
ref|XP_011082247.1|  PREDICTED: vetispiradiene synthase 3-like          479   4e-158   
emb|CDP12281.1|  unnamed protein product                                480   4e-158   
ref|XP_011082248.1|  PREDICTED: vetispiradiene synthase 3-like          479   5e-158   
ref|XP_008240971.1|  PREDICTED: (-)-germacrene D synthase-like          479   6e-158   
emb|CDP12283.1|  unnamed protein product                                479   8e-158   
ref|XP_010027310.1|  PREDICTED: (-)-germacrene D synthase-like          482   8e-158   
ref|XP_003617711.1|  (+)-delta-cadinene synthase isozyme A              478   9e-158   
gb|AES98818.2|  sesquiterpene synthase                                  478   1e-157   
ref|XP_008226806.1|  PREDICTED: (-)-alpha-pinene synthase-like          476   3e-157   
gb|KCW62136.1|  hypothetical protein EUGRSUZ_H04797                     475   5e-157   
ref|XP_006469943.1|  PREDICTED: (-)-germacrene D synthase-like          473   1e-156   
ref|XP_006478795.1|  PREDICTED: (-)-germacrene D synthase-like is...    473   1e-156   
gb|KDO62845.1|  hypothetical protein CISIN_1g008767mg                   474   1e-156   
gb|AIC76500.1|  terpene synthase                                        476   2e-156   
gb|KCW74591.1|  hypothetical protein EUGRSUZ_E03311                     473   2e-156   
ref|XP_003615860.1|  (+)-delta-cadinene synthase isozyme C2             475   2e-156   
ref|XP_010040899.1|  PREDICTED: (-)-germacrene D synthase-like          477   3e-156   
sp|Q5SBP7.1|SELS_OCIBA  RecName: Full=Selinene synthase                 474   3e-156   
ref|XP_006478796.1|  PREDICTED: (-)-germacrene D synthase-like is...    472   4e-156   
ref|XP_011011288.1|  PREDICTED: (-)-germacrene D synthase-like          470   5e-156   
emb|CAN66799.1|  hypothetical protein VITISV_037341                     473   6e-156   
sp|I6RAQ6.1|TPS1_MATCR  RecName: Full=(-)-beta-caryophyllene synt...    474   6e-156   
gb|KDO38269.1|  hypothetical protein CISIN_1g008206mg                   473   1e-155   
gb|AIC76494.1|  terpene synthase                                        474   2e-155   
emb|CBI31266.3|  unnamed protein product                                478   6e-155   
gb|KCW85107.1|  hypothetical protein EUGRSUZ_B01942                     469   1e-154   
ref|XP_008448865.1|  PREDICTED: (-)-germacrene D synthase-like          471   1e-154   
ref|XP_010045915.1|  PREDICTED: (-)-germacrene D synthase-like          472   2e-154   
gb|KHN47556.1|  (-)-germacrene D synthase                               470   3e-154   
gb|AGV40227.1|  putative (-)-germacrene-D synthase                      468   6e-154   
ref|XP_010092294.1|  (-)-germacrene D synthase                          467   6e-154   
sp|B3TPQ6.1|BCUSY_MAGGA  RecName: Full=Beta-cubebene synthase; Sh...    468   9e-154   
ref|XP_010092295.1|  Pinene synthase                                    467   3e-153   
ref|XP_004302393.1|  PREDICTED: (-)-alpha-pinene synthase-like          468   4e-153   
gb|KCW63955.1|  hypothetical protein EUGRSUZ_G01636                     466   7e-153   
emb|CAN62604.1|  hypothetical protein VITISV_009666                     464   1e-152   
ref|XP_010644316.1|  PREDICTED: (-)-germacrene D synthase-like          459   2e-152   
ref|XP_009785132.1|  PREDICTED: germacrene C synthase-like              462   3e-152   
ref|XP_010049988.1|  PREDICTED: (-)-germacrene D synthase-like          465   3e-152   
gb|AHF22834.1|  drimenol synthase                                       464   3e-152   
ref|XP_006365293.1|  PREDICTED: uncharacterized protein LOC102599254    484   5e-152   
gb|KDO62846.1|  hypothetical protein CISIN_1g008767mg                   462   6e-152   
gb|KCW62336.1|  hypothetical protein EUGRSUZ_H04978                     464   9e-152   
sp|Q94JS8.1|FARS_CITJU  RecName: Full=(E)-beta-farnesene synthase...    463   1e-151   
sp|J7LP58.1|TPS1_PHYDL  RecName: Full=Bifunctional sesquiterpene ...    463   1e-151   
ref|XP_009768422.1|  PREDICTED: (-)-germacrene D synthase-like is...    461   2e-151   
gb|AAR31145.1|  (-)-germacrene D synthase                               461   4e-151   
gb|AIG92847.1|  sesquiterpene synthase 6                                462   5e-151   
gb|ADJ67476.1|  (E)-beta-farnesene synthase                             461   7e-151   
emb|CAE47440.1|  germacrene D synthase                                  461   8e-151   
gb|KGN55876.1|  hypothetical protein Csa_3G021130                       461   9e-151   
ref|XP_007133018.1|  hypothetical protein PHAVU_011G144200g             461   9e-151   
gb|ADR71055.1|  Tps2-1                                                  461   9e-151   
emb|CAC36896.1|  germacrene A synthase                                  461   1e-150   
ref|XP_007133012.1|  hypothetical protein PHAVU_011G143700g             460   1e-150   
emb|CBI31315.3|  unnamed protein product                                470   4e-150   
sp|I6QPS5.1|TPS5_MATCR  RecName: Full=(-)-germacrene D synthase; ...    459   5e-150   
ref|XP_010098604.1|  (-)-germacrene D synthase                          458   5e-150   
dbj|BAG50433.1|  sesquiterpene synthase 3                               459   5e-150   
gb|AIG92848.1|  sesquiterpene synthase 4                                458   7e-150   
ref|XP_009410179.1|  PREDICTED: alpha-humulene synthase-like            458   8e-150   
ref|XP_008449182.1|  PREDICTED: (-)-germacrene D synthase-like          470   2e-149   
ref|XP_010694277.1|  PREDICTED: probable sesquiterpene synthase         457   3e-149   
emb|CDP12296.1|  unnamed protein product                                456   1e-148   
ref|XP_010248057.1|  PREDICTED: probable terpene synthase 2             458   1e-148   
ref|XP_004298303.1|  PREDICTED: (-)-germacrene D synthase-like          454   4e-148   
gb|ADT64310.1|  E-beta-farnesene synthase 4                             453   1e-147   
gb|ADT64306.1|  E-beta-farnesene synthase 1                             453   2e-147   
gb|AIW60869.1|  E-beta-farnesene synthase                               453   2e-147   
gb|AGV40228.1|  sesquiterpene synthase                                  452   2e-147   
sp|J7LMP2.1|TPS5_PHYDL  RecName: Full=Bicyclogermacrene synthase;...    452   3e-147   
ref|XP_011073749.1|  PREDICTED: vetispiradiene synthase 3-like          452   3e-147   
ref|XP_006370594.1|  hypothetical protein POPTR_0001s44080g             449   3e-147   
gb|ADT64307.1|  E-beta-farnesene synthase 2                             452   6e-147   
gb|ACI32639.1|  STS1                                                    451   6e-147   
ref|XP_010051026.1|  PREDICTED: (-)-germacrene D synthase-like          449   8e-147   
gb|AAX39387.1|  (E)-beta-farnesene synthase                             451   8e-147   
gb|AIT75876.1|  sesquiterpene synthase                                  449   2e-146   
gb|ADT64308.1|  E-beta-farnesene synthase 1                             450   2e-146   
ref|XP_010259732.1|  PREDICTED: (-)-germacrene D synthase-like          447   3e-146   
gb|AIT75875.1|  putative delta-guaiene synthase                         449   5e-146   
ref|XP_010041906.1|  PREDICTED: (-)-germacrene D synthase-like is...    447   6e-146   
ref|XP_002513369.1|  Casbene synthase, chloroplast precursor, put...    447   2e-145   
ref|XP_009388236.1|  PREDICTED: (S)-beta-bisabolene synthase-like       446   2e-145   
ref|XP_011009447.1|  PREDICTED: probable terpene synthase 6             446   3e-145   
gb|ADT64309.1|  E-beta-farnesene synthase 3                             447   3e-145   
ref|XP_004147250.1|  PREDICTED: (-)-germacrene D synthase-like          444   4e-145   
gb|AIG92846.1|  sesquiterpene synthase 1                                446   5e-145   
gb|AII32475.1|  terpene synthase                                        446   7e-145   
ref|XP_011082260.1|  PREDICTED: vetispiradiene synthase 3-like          446   7e-145   
gb|AAG24640.2|AF304444_1  sesquiterpene cyclase                         446   8e-145   
gb|AGZ84811.1|  germacrene D synthase                                   445   8e-145   
emb|CAN76978.1|  hypothetical protein VITISV_044295                     444   1e-144   
ref|XP_004169937.1|  PREDICTED: (-)-germacrene D synthase-like          443   1e-144   
ref|XP_011009443.1|  PREDICTED: probable terpene synthase 6 isofo...    444   2e-144   
ref|XP_006371082.1|  hypothetical protein POPTR_0019s03330g             444   2e-144   
ref|XP_006358528.1|  PREDICTED: vetispiradiene synthase 1-like          444   2e-144   
gb|AIW00681.1|  a-bisabolol synthase                                    444   3e-144   
ref|XP_011015428.1|  PREDICTED: probable terpene synthase 6             444   3e-144   
ref|XP_006358531.1|  PREDICTED: viridiflorene synthase-like             444   4e-144   
ref|XP_011009446.1|  PREDICTED: probable terpene synthase 6             444   4e-144   
ref|XP_011009444.1|  PREDICTED: probable terpene synthase 6 isofo...    444   4e-144   
gb|AIW00680.1|  sesquiterpene cyclase                                   443   8e-144   
sp|B1B1U3.1|ZSS1_ZINZE  RecName: Full=Alpha-humulene synthase           442   1e-143   
ref|NP_001239040.1|  viridiflorene synthase                             442   1e-143   
gb|AAX16077.1|  valencene synthase                                      442   2e-143   
gb|AJD19683.1|  sesquiterpene synthase Tps3                             441   2e-143   



>ref|XP_009591578.1| PREDICTED: (-)-germacrene D synthase-like [Nicotiana tomentosiformis]
Length=552

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/552 (58%), Positives = 427/552 (77%), Gaps = 9/552 (2%)
 Frame = -2

Query  1992  MDVN--VNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPP  1819
             M+VN  V+   RRSV YHP+VWGDYFLAYDS LTEI P EE+EV+ LKEEVRK+L++   
Sbjct  1     MEVNNIVHKPTRRSVDYHPSVWGDYFLAYDSSLTEIYPDEEQEVEVLKEEVRKMLVSDHA  60

Query  1818  ASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE----NNLYVVSLRFR  1651
              S +KLEL+D IQRLGV YHFENEI+ S++HI   Y++C + DD     N L  V+LRFR
Sbjct  61    VSTQKLELIDMIQRLGVSYHFENEIEESLKHI---YNSCSEFDDNDEDHNMLETVALRFR  117

Query  1650  LLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTA  1471
             LLRQ G+++ C V E+F+D +GKFK+ L  DV+G+LSLYEA+++GV GE  L+EAL FT 
Sbjct  118   LLRQAGYNVPCDVLEEFMDDEGKFKEVLVSDVKGILSLYEAAHVGVEGENILEEALAFTT  177

Query  1470  SHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDF  1291
             + L+S++P L+ L  A+V+HALK+PI+RTL RV A++Y+ IY+    HN++LLRFA+LDF
Sbjct  178   TRLKSVVPNLSGLLLAQVAHALKMPIQRTLERVAARQYINIYKDSPKHNELLLRFARLDF  237

Query  1290  NLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             N+LQKVHQ+EL GITRWWKDL V +   FAR+R+ E YFWILGVYFEPQY  +R  TT++
Sbjct  238   NMLQKVHQKELCGITRWWKDLDVERNFSFARNRVVEAYFWILGVYFEPQYCRARIFTTKV  297

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
             I + S+LDDLYDVYGT DEL++FT+AI+R+D +AS ++P YLK +Y  ILD+  EMEE++
Sbjct  298   ISLASILDDLYDVYGTLDELKMFTDAIERWDINASKQLPPYLKLLYHYILDVFAEMEELL  357

Query  930   AKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLV  751
               ENK + + Y   E+KK  + YYQEF W+   ++P FEEYLK++LV++C+M+++T  LV
Sbjct  358   VNENKSYRIHYAKAELKKVCKAYYQEFKWYDAGYIPTFEEYLKMALVTACHMLLSTISLV  417

Query  750   GMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVS  571
             GMG+I+TKE  DW+TSEPL VKA+  +CRLMDD +GH+FEQERGHVASAVE YMK +  S
Sbjct  418   GMGEIVTKENFDWITSEPLMVKASSIVCRLMDDRVGHQFEQERGHVASAVESYMKEFGGS  477

Query  570   KQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVK  391
             KQEAY + EKL++  W+D+N+ECL+ +P P  +LLRVLNL R I L+YKD D+YT S+ K
Sbjct  478   KQEAYAKFEKLVANGWEDVNKECLYSVPAPRPILLRVLNLTRVINLLYKDEDLYTNSKTK  537

Query  390   FKSLITTTLVQP  355
              K +IT  LV+P
Sbjct  538   LKDIITKVLVEP  549



>ref|XP_006363570.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=555

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/551 (58%), Positives = 422/551 (77%), Gaps = 3/551 (1%)
 Frame = -2

Query  1989  DVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL  1810
             +VNV  S RR V YHP+VWGDYFLAYDS +T+ID  EE EV++L++EV+K+LI A  A+ 
Sbjct  5     NVNVPKSARRYVDYHPSVWGDYFLAYDSSITDIDHEEEGEVERLRDEVKKMLIEAHHATS  64

Query  1809  EK--LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQE  1636
              +  LEL+D  QRLGV YHFE EI+ S++HI++N       DD+NNL +V+LRFRLLRQ 
Sbjct  65    TRKLLELIDNTQRLGVSYHFEKEIEESLKHIYNNMSCGEFDDDDNNLDIVALRFRLLRQV  124

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             G+++SC V E+F D +G FK  L  DV+G+LSLYEA++LG+ GE  L+EAL FT   L+S
Sbjct  125   GYNVSCDVIERFKDDEGNFKKELASDVKGILSLYEAAHLGISGENILEEALVFTTKCLKS  184

Query  1455  ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
             ++P L+      + HALK+PIRRTL RV A++Y+ +Y+ +  H+KVLL+FA+LDFN+LQK
Sbjct  185   MVPKLSGYVVTHIVHALKMPIRRTLARVAARQYINMYQDNPEHSKVLLQFARLDFNMLQK  244

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQ+ELSGITRWWK L V +   FAR RL E Y W++GVYFEPQY  +RR TTQII + S
Sbjct  245   LHQKELSGITRWWKGLDVERNFSFARDRLVEAYLWMIGVYFEPQYCRARRFTTQIISLAS  304

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             +LDDLYDVYGT DEL++FT+AIQR+D +AS ++P YLK +Y  I D   EMEE++AKEN 
Sbjct  305   ILDDLYDVYGTHDELEMFTDAIQRWDINASQQLPPYLKLLYQYIFDTYAEMEELLAKENI  364

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGM-GD  739
              + V Y   E+KK +R Y+QEF W+++ +VP FEEYLKV+LV++CYMM++TT LVGM  +
Sbjct  365   SYRVHYAKNELKKLVRAYHQEFKWYHSGYVPTFEEYLKVALVTACYMMLSTTSLVGMEEE  424

Query  738   IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEA  559
             ++++E   W+TSEPL VKA+  +CRLMDD IGH+FEQERGHVASAVE Y+K +  SKQEA
Sbjct  425   LVSEENFKWITSEPLMVKASSIVCRLMDDRIGHKFEQERGHVASAVESYVKEFECSKQEA  484

Query  558   YVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSL  379
             YV++EKL+  AW+D+N++ L P+P PM VL+RVLN ARAI LIYKD DIYT S+ K K +
Sbjct  485   YVKLEKLVVNAWQDLNKDSLQPMPAPMLVLMRVLNFARAINLIYKDEDIYTNSKTKLKDI  544

Query  378   ITTTLVQPVTI  346
             IT  LVQP  I
Sbjct  545   ITKVLVQPFKI  555



>emb|CAN83470.1| hypothetical protein VITISV_030783 [Vitis vinifera]
Length=557

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/541 (54%), Positives = 393/541 (73%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   +HP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S +KL L+D
Sbjct  21    GRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSAQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI   ++H+FD   + +    E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEVLKHMFDG--SVVSA--EEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D +G FK+SL+ DV GMLSLYEA++  VHGE  LDEAL FT +HL+S     +   
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEALAFTTTHLQSATKYSSNPL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HALK PIR+ LPR+ A+ Y  +Y+ D +HNK LL+ AKLDFNLLQK+HQ+ELS I
Sbjct  197   AEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLAKLDFNLLQKLHQKELSDI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             + WWKDL     LPFAR R+ ECYFWILGVYFEPQ+ F+RRI T++I + S++DD+YDVY
Sbjct  257   SAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRILTKVIAMTSIIDDIYDVY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT A++R+D SA +++P+Y++  Y A+L + +E+EE MAKE + + + Y   
Sbjct  317   GTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEIEEEMAKEGRSYRLYYAKE  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R YY+E  W   + +P  EEY+ V+LV+S Y M+ATT LVGMGD +TKE  DW+
Sbjct  377   AMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSLVGMGDAVTKETFDWI  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  V+A+  +CRLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE + E  K +  
Sbjct  437   FSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQETHNEFNKQVRD  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P  VPM +L+RVLNLAR I +IYK+ D YT S    K  +T+ L+ PV 
Sbjct  497   AWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHSGTVLKDFVTSMLIDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>emb|CDP05817.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/540 (56%), Positives = 397/540 (74%), Gaps = 1/540 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HP+VWGD+FLAY S+  E     E E+Q+L+EEVRK+L   P     KL+++D 
Sbjct  12    RRSANFHPSVWGDHFLAYASQHKENFFEGEGELQRLREEVRKMLTETPDEFPGKLDMIDT  71

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHFE+EI+AS+Q IFD Y   +   D N+L+ ++LRFRLLRQ+G H SC VF+
Sbjct  72    VQRLGVSYHFESEIEASLQKIFDAYSE-LNHKDGNDLHTIALRFRLLRQKGFHASCDVFD  130

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF + +G FK+SL +D  GMLSLYEA+  GVHGE  LDEAL FT+ +LES++P L+   A
Sbjct  131   KFKNPEGDFKESLARDARGMLSLYEAANFGVHGEKVLDEALKFTSDNLESMVPNLSNFLA  190

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             A+V  ALK PI++TL R+GA++Y+ +Y+Q ++H+K+LL+FAKLDFN LQK+HQ+ELSG+T
Sbjct  191   AQVVQALKAPIQKTLTRLGARQYISLYQQHESHDKLLLKFAKLDFNKLQKLHQKELSGLT  250

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             +WWK L V   LPFAR RL ECYFWI GVYFEP+Y F+R + T++  I S++DD+YDVY 
Sbjct  251   KWWKGLDVATNLPFARDRLVECYFWIFGVYFEPKYCFAREVLTKVASITSIIDDIYDVYA  310

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T DEL +FT+AI+R+  +  + +P  LK  Y A+LDI  E EE +AKE K   V+Y+  E
Sbjct  311   TLDELIVFTDAIERWHVNELDRLPSCLKHCYRALLDIYKEFEEKLAKEGKSDRVNYSKLE  370

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK  + Y QE +WF+  +VP  EE+LKVSLV++ YMM+ TT +VGMGD +T +  DWVT
Sbjct  371   MKKLAKGYLQEAIWFHNGYVPKVEEHLKVSLVTAGYMMLGTTSMVGMGDSLTAQTFDWVT  430

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             +EPL V+A   ICRLMDDM GHEFEQERGHVASAVECY+  Y V+K+EA+ E  K ++ A
Sbjct  431   NEPLIVRAASVICRLMDDMAGHEFEQERGHVASAVECYVNEYGVTKREAFDEFNKQVANA  490

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN ECL+   VP  VL RV+NLA+ I L+YK+ D YT S  K K  ITT L+ P+ +
Sbjct  491   WKDINGECLNSNAVPRAVLERVVNLAKVINLLYKEEDWYTHSATKLKDTITTALIDPIPM  550



>emb|CBI20483.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 392/541 (72%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   +HP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S +KL L+D
Sbjct  21    GRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSAQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI   ++H+FD   + +    E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEVLKHMFDG--SVVSA--EEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D +G FK+SL+ DV GMLSLYEA++  VHGE  LDEAL FT +HL+S     +   
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEALAFTTTHLQSATKHSSNPL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HALK PIR+ LPR+ A+ Y  +Y+ D +HNK LL+ AKLDFNLLQK+HQ+ELS I
Sbjct  197   AEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLAKLDFNLLQKLHQKELSDI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             + WWKDL     LPFAR R+ ECYFWILGVYFEPQ+ F+RRI T++I + S++DD+YDVY
Sbjct  257   SAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRILTKVIAMTSIIDDIYDVY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT A++R+D SA +++P+Y++  Y A+L + +E+EE MAKE + + + Y   
Sbjct  317   GTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEIEEEMAKEGRSYRLYYAKE  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R YY+E  W   + +P  EEY+ V+LV+S Y M+ATT  VGMGD +TKE  DW+
Sbjct  377   AMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDWI  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  V+A+  +CRLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE + E  K +  
Sbjct  437   FSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQETHNEFHKQVRD  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P  VPM +L+RVLNLAR I +IYK+ D YT S    K  +T+ L+ PV 
Sbjct  497   AWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHSGTVLKDFVTSMLIDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>emb|CAN68620.1| hypothetical protein VITISV_013313 [Vitis vinifera]
Length=557

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 392/541 (72%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   +HP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S +KL L+D
Sbjct  21    GRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSAQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI   ++H+FD   + +    E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEVLKHMFDG--SVVSA--EEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D +G FK+SL+ DV GMLSLYEA++  VHGE  LDEAL FT +HL+S     +   
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEALAFTTTHLQSATKYSSNPL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HALK PIR+ LPR+ A+ Y  +Y+ D +HNK LL+ AKLDFNLLQK+HQ+ELS I
Sbjct  197   AEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLAKLDFNLLQKLHQKELSDI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             + WWKDL     LPFAR R+ ECYFWILGVYFEPQ+ F+RRI T++I + S++DD+YDVY
Sbjct  257   SAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRILTKVIAMTSIIDDIYDVY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT A++R+D SA +++P+Y++  Y A+L + +E+EE MAKE + + + Y   
Sbjct  317   GTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEIEEEMAKEGRSYRLYYAKE  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R YY+E  W   + +P  EEY+ V+LV+S Y M+ATT  VGMGD +TKE  DW+
Sbjct  377   AMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDWI  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  V+A+  +CRLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE + E  K +  
Sbjct  437   FSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQETHNEFNKQVRD  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P  VPM +L+RVLNLAR I +IYK+ D YT S    K  +T+ L+ PV 
Sbjct  497   AWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHSGTVLKDFVTSMLIDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>ref|NP_001268204.1| uncharacterized protein LOC100257265 [Vitis vinifera]
 ref|XP_010644042.1| PREDICTED: uncharacterized protein LOC100257265 isoform X1 [Vitis 
vinifera]
 gb|ADR74193.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/542 (54%), Positives = 390/542 (72%), Gaps = 6/542 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   YHP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S++KL L+D
Sbjct  21    GRRCANYHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSVQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI  +++H+FD          E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEALKHMFDGS----VASAEEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLNEL  1432
               F D +G FK+SL+ DV GMLSLYEA++L VHGE  LDEAL FT +HL+S     LN L
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSLYEATHLRVHGEDILDEALAFTTTHLQSAAKYSLNPL  196

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
             A  +V HALK PIR+ LPR+ A+ Y  IY+ D +H+K LL+ AKLDFNLLQK+HQ+ELS 
Sbjct  197   AE-QVVHALKQPIRKGLPRLEARHYFSIYQADDSHHKALLKLAKLDFNLLQKLHQKELSD  255

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I+ WWKDL     LPFAR R+ ECYFWILGVYFEPQ+  +RRI T++I + S +DD+YDV
Sbjct  256   ISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFLARRILTKVITMTSTIDDIYDV  315

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LFT A++R+D S  +++P+Y++  Y A+LD+ +E+EE MAKE + +   Y  
Sbjct  316   YGTLEELELFTEAVERWDISVIDQLPEYMRVCYRALLDVYSEIEEEMAKEGRSYRFYYAK  375

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MKKQ+R YY+E  W   + +P  EEY+ V+  +S Y M+ATT  + MGD++TKE  DW
Sbjct  376   EAMKKQVRAYYEEAQWLQAQQIPTMEEYMPVASATSGYPMLATTSFIAMGDVVTKETFDW  435

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V SEP  V+A+ ++ RLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE   E +K + 
Sbjct  436   VFSEPKIVRASATVSRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQETRDEFKKQVR  495

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDINQECL P  VPM VL+R+LNLAR + ++YK  D YT S    K L+T+ L+  V
Sbjct  496   DAWKDINQECLMPTAVPMTVLMRILNLARVMDVVYKHEDGYTHSGTFLKDLVTSLLIDSV  555

Query  351   TI  346
              I
Sbjct  556   PI  557



>ref|NP_001268213.1| (-)-germacrene D synthase [Vitis vinifera]
 sp|Q6Q3H3.1|TPSGD_VITVI RecName: Full=(-)-germacrene D synthase [Vitis vinifera]
 gb|AAS66357.1| (-)-germacrene D synthase [Vitis vinifera]
Length=557

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/541 (54%), Positives = 391/541 (72%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   +HP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S +KL L+D
Sbjct  21    GRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSAQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI   ++H+FD   + +    E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEVLKHMFDG--SVVSA--EEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D +G FK+SL+ DV GMLSLYEA++  VHGE  LDEAL FT +HL+S     +   
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEALAFTTTHLQSATKHSSNPL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HALK PIR+ LPR+ A+ Y  +Y+ D +HNK LL+ AKLDFNLLQK+HQ+ELS I
Sbjct  197   AEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLAKLDFNLLQKLHQKELSDI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             + WWKDL     LPFAR R+ ECYFWILGVYFEPQ+ F+RRI T++I + S++DD+YDVY
Sbjct  257   SAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRILTKVIAMTSIIDDIYDVY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT A++R+D SA +++P+Y++  Y A+L + +E+EE MAKE + + + Y   
Sbjct  317   GTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEIEEEMAKEGRSYRLYYAKE  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R YY+E  W   + +P  EEY+ V+LV+S Y M+ATT  VGMGD +TKE  DW+
Sbjct  377   AMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDWI  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  V+A+  +CRLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE   E  + + +
Sbjct  437   FSKPKIVRASAIVCRLMDDMVFHKFEQKRGHVASAVECYMKQHGASEQETPNEFPQPVRE  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P  VPM +L+RVLNLAR I +IYK+ D YT      K  +T+ L+ PV 
Sbjct  497   AWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHFGAVLKDFVTSMLIDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>ref|XP_009623875.1| PREDICTED: (-)-germacrene D synthase-like [Nicotiana tomentosiformis]
Length=555

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/551 (55%), Positives = 402/551 (73%), Gaps = 7/551 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             + V V+   RR   YHP++WGDYFL   S  T I+P E+++VQ L+EEVRK+L+     S
Sbjct  7     LPVGVHEISRRPANYHPSIWGDYFLDCVSDSTIINPLEQKQVQDLREEVRKMLMEVHDTS  66

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNC--IKGDDENNLYVVSLRFRLLRQ  1639
              EKLEL+DKIQRLGV YHFE EI+AS+Q +++ Y  C  I GDD   LY+V+L FRLLRQ
Sbjct  67    SEKLELIDKIQRLGVSYHFEEEIEASLQRMYEAYRECNNIYGDD---LYLVALGFRLLRQ  123

Query  1638  EGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLE  1459
             +GH +SC VFEKF D +G F+ +LT +V  MLSLYEA+++ V GE  L+EAL F ++HL+
Sbjct  124   QGHFVSCDVFEKFKDNEGNFEKALTTNVPAMLSLYEAAHMRVDGEDILEEALVFISNHLK  183

Query  1458  SILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQ  1279
             S++P L++    +V HAL  PI  +L RV A+ ++  Y    T N++LL FAKLDFNLLQ
Sbjct  184   SMIPILSDSFREQVMHALNQPIHMSLTRVEARIFLSRYRSYDTKNELLLEFAKLDFNLLQ  243

Query  1278  KVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIW  1099
             K H++ELS ITRWWKDL +    PFAR RL E YFW LGVYFEP++  +RR+  ++I + 
Sbjct  244   KEHRKELSSITRWWKDLDIVTKCPFARDRLVESYFWALGVYFEPKFAIARRMLAKVIGLA  303

Query  1098  SVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN  919
             +++DD+YDVYGT DEL  FT AI+R+D SA +++P Y+K  YLAILD+  EMEE +AK  
Sbjct  304   TIIDDIYDVYGTYDELMCFTEAIERWDVSAIDKLPPYMKSCYLAILDVYAEMEEELAKRG  363

Query  918   KLFHVSYTIGEMKKQIRTYYQEFMWFYTK-HVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
             + + V Y   EMKK  R Y++E  W ++  +VP FEEY+KV+LVSS YMM+ATT LVG+ 
Sbjct  364   ESYRVDYAKNEMKKLTRAYFEEAKWSHSACYVPTFEEYMKVALVSSGYMMVATTSLVGID  423

Query  741   D-IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQ  565
             D +I K V+DWVT +PL V+A+  I RLMDDM GHEFEQERGH  SAVECYMK +  SK+
Sbjct  424   DNLINKNVMDWVTHKPLIVQASTVIARLMDDMAGHEFEQERGHEPSAVECYMKQHGTSKE  483

Query  564   EAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
             E ++E++KL+S AWKDIN++CL+P  VPM +L+RVLNLAR I L+YKD D +T S  K K
Sbjct  484   EVFLELQKLVSNAWKDINRQCLYPREVPMLILMRVLNLARVIDLLYKDEDAFTHSTTKLK  543

Query  384   SLITTTLVQPV  352
             ++IT+ LV PV
Sbjct  544   NIITSILVDPV  554



>gb|AEP17005.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/541 (54%), Positives = 389/541 (72%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   +HP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S +KL L+D
Sbjct  21    GRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSAQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI   ++H+FD   + +    E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEVLKHMFDG--SVVSA--EEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D +G FK+SL+ DV GMLS YEA++  VHGE  LDEAL FT +HL+S     +   
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSSYEATHFRVHGEDILDEALAFTTTHLQSATKYSSNPL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HALK PIR+ LPR+ A+ Y  +Y+   +HNK LL+ AKLDFNLLQK+HQ+ELS I
Sbjct  197   AEQVVHALKQPIRKGLPRLEARHYFSVYQAYDSHNKALLKLAKLDFNLLQKLHQKELSDI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             + WWKDL     LPFAR R+ ECYFWILGVYFEPQ+  +RRI T++I + S++DD+YD Y
Sbjct  257   SAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFLARRILTKVIAMTSIIDDIYDAY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT A++R+D SA +++P+Y++  Y A+L + +E+EE MA+E + + + Y   
Sbjct  317   GTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEIEEEMAREGRSYRLYYAKE  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R YY+E  W   + +P  EEY+ V+LV+S Y M+ATT  VGMGD +TKE LDW+
Sbjct  377   AMKNQVRAYYEEAKWPQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDALTKETLDWI  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              SEP  V+A+  +CRLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE + E  K +  
Sbjct  437   FSEPKIVRASAIVCRLMDDMVPHKFEQKRGHVASAVECYMKQHGASEQETHNEFNKQVRD  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P  VPM +L+RVLNLAR I +IYK+ D YT S    K  +T+ L+ PV 
Sbjct  497   AWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHSGTVLKDFVTSMLIDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>gb|AFE56211.1| terpene synthase [Camellia sinensis]
Length=567

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/538 (54%), Positives = 396/538 (74%), Gaps = 6/538 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  YHP++WGD+FL Y S   E+D    +++QQ KEEVRK+L+AA     +KL   D 
Sbjct  23    RRSANYHPSIWGDHFLTYASHAVEVDVKMGQQLQQQKEEVRKMLVAANDQPSQKLNFTDA  82

Query  1785  IQRLGVDYHFENEIQASIQHIFD-NYDNCIKGDDENN--LYVVSLRFRLLRQEGHHISCG  1615
             IQRLGV YHFE+E++ ++QHI++ +YD+    DD+ N  LY V+L FRLLRQ+G+ ISC 
Sbjct  83    IQRLGVSYHFESEMETALQHIYETDYDH---HDDKANDDLYTVALMFRLLRQQGYPISCD  139

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF KF D +GK ++SL  DV GMLSLYEA++L V GE  LDEAL+FT +HLES +P L+ 
Sbjct  140   VFNKFKDDNGKIRESLIGDVRGMLSLYEAAHLRVRGEDILDEALSFTITHLESAVPNLSN  199

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
             L   +V HAL  PI   L R+ A  Y   YEQD +HN+VLL FAKLDFNLLQK+HQ ELS
Sbjct  200   LVQEQVIHALNQPIHMGLTRLEATRYFFFYEQDDSHNEVLLNFAKLDFNLLQKMHQWELS  259

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              ITRWWK+    K + FAR R+ ECYFWILGVYFEPQY  +RR+ T++I + S++DD+YD
Sbjct  260   EITRWWKEFDFAKKMCFARDRIVECYFWILGVYFEPQYLLARRMLTKVIALTSIIDDIYD  319

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VY T +EL LFT+AI+R++ SA++++P+Y+K  Y A+LD+   ++E MA++ + + + Y 
Sbjct  320   VYATLEELVLFTDAIERWEISATDQLPEYMKPCYQALLDVYNMIDEEMARKGRSYCIHYA  379

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MK  +R Y++E  WF+  +VP  EEY++V+LV+  Y M+ATT LVGMG++++KE  D
Sbjct  380   KSAMKILVRAYFEEAKWFHQGNVPSIEEYMRVALVTGAYTMLATTSLVGMGEVVSKEAFD  439

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             WV+S+PL V+A+  +CRLMDDM+GH+FEQ+RGH+ SAVEC+MK Y  S++EA VE++K +
Sbjct  440   WVSSDPLIVQASSVVCRLMDDMVGHKFEQKRGHIVSAVECHMKQYGASEEEALVELKKRV  499

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
             + AWKDINQECL P  VPM +LLRV+NLAR I ++YKD D YT S  K K  +T+ L+
Sbjct  500   TNAWKDINQECLRPTAVPMPLLLRVVNLARVINVLYKDEDGYTHSGTKLKGFVTSVLI  557



>emb|CDP05818.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/541 (55%), Positives = 396/541 (73%), Gaps = 2/541 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  YHP+VWGD+FLAY  +  E     E E+Q+L+EEVRK+L   P     KL+++D 
Sbjct  12    RRSANYHPSVWGDHFLAYAPQHKENFFEGEGELQRLREEVRKMLTETPDEFPGKLDMIDT  71

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE+EI+AS+Q IFD Y   +   D N+L+  +LRFRLLRQ+G H SC VF+
Sbjct  72    IQRLGVSYHFESEIEASLQKIFDAYSE-LNHKDGNDLHTTALRFRLLRQKGFHASCDVFD  130

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF + +G FK+SL  D  GMLSLYEA+  GVHGE  LDEAL FT+ +LES++P L+   A
Sbjct  131   KFKNPEGDFKESLASDARGMLSLYEAANFGVHGEKVLDEALKFTSDNLESMVPNLSNFLA  190

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             A+V  AL+ PI++TL R+GA++Y+ +Y+Q ++H+K+LL+FAKLDFN LQK+HQ+ELSG+T
Sbjct  191   AQVVQALRAPIQKTLTRLGARQYISLYQQHESHDKLLLKFAKLDFNKLQKLHQKELSGLT  250

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             +WWK L V   LPFAR RL ECYFW+LGVYFEP+Y F+R + T++I I S++DD+YDVY 
Sbjct  251   KWWKGLDVATNLPFARDRLVECYFWVLGVYFEPKYCFAREVLTKVISITSIIDDIYDVYA  310

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T DEL +FT+AI+R+  +  + +P Y+K  Y A+LDI  E EE +AKE +   V+Y+  E
Sbjct  311   TPDELIVFTDAIERWHINELDRLPSYMKHCYRALLDIYKEFEEKLAKEGQSDRVNYSKLE  370

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK  + Y QE +WF+  +VP  EEY+KV+LV++ YMM+ATT +VGMGD +T +  DWVT
Sbjct  371   MKKLAKGYLQEAIWFHNGYVPKVEEYMKVALVTAGYMMLATTSMVGMGDSLTAQTFDWVT  430

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             +EPL V+A   I RLMDDM GHE EQE GHVA+AVECY+  Y V+K+EA+ E  K ++ A
Sbjct  431   NEPLIVRAASVIGRLMDDMAGHELEQEGGHVATAVECYVNEYGVTKREAFDEFNKQVANA  490

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKSLITTTLVQPVT  349
             WKDIN ECL+   VPM VL RV+NLA+ I L+YKD  D YT S  K K  ITT L+ P+ 
Sbjct  491   WKDINGECLNSNAVPMAVLERVVNLAKVINLLYKDEEDWYTHSATKLKDTITTALIDPIP  550

Query  348   I  346
             +
Sbjct  551   M  551



>ref|XP_009804030.1| PREDICTED: (-)-germacrene D synthase-like [Nicotiana sylvestris]
Length=554

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/550 (54%), Positives = 397/550 (72%), Gaps = 6/550 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             + V V+   R S  YH ++WGDYFL   S  T I+P E ++VQ L+EEVRK+L+A    S
Sbjct  7     LPVGVHEVSRPSANYHRSIWGDYFLDCVSDSTIINPLERKQVQDLREEVRKMLMAVHDTS  66

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNC-IKGDDENNLYVVSLRFRLLRQE  1636
              EK+EL+DKIQRLGV YHFE EI+AS+Q +++ Y  C + GDD   LY+V++ FRLLRQ+
Sbjct  67    SEKVELIDKIQRLGVSYHFEEEIEASLQRMYEAYRECNMYGDD---LYLVAIGFRLLRQQ  123

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             GH +SC VF+KF D +G F  +LT +V  MLSLYEA+++ VHGE  L+EAL F ++HL+S
Sbjct  124   GHFVSCDVFKKFKDNEGNFDKALTSNVPAMLSLYEAAHMRVHGEDILEEALVFISNHLKS  183

Query  1455  ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
             ++P L++    +V HAL  PI  +L RV A+ ++  Y+   T N++LL FAKLDFNLLQK
Sbjct  184   MIPILSDSFRVQVLHALNQPIHMSLTRVEARRFLSTYQSYDTKNELLLEFAKLDFNLLQK  243

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             VH++ELS ITRWWKDL +    PFAR RL E YFW LGVYFEP++  +RR+  ++I + +
Sbjct  244   VHRKELSSITRWWKDLDIVTKCPFARDRLVESYFWALGVYFEPKFVIARRMLAKVIALAT  303

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             ++DD+YD YG+ DE   FT A++R+D SA + +P Y+K  YLAIL +  EMEE +AK  +
Sbjct  304   IIDDIYDAYGSYDEHMCFTEALERWDVSAIDGLPPYMKSCYLAILGVYAEMEEELAKRGE  363

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYT-KHVPPFEEYLKVSLVSSCYMMIATTCLVGMGD  739
              + V Y   EMKK  R Y++E  W ++  ++P FEEY+KV+L SS YMM ATT LVG+GD
Sbjct  364   SYRVDYAKNEMKKLTRAYFEEAKWSHSASYIPTFEEYMKVALDSSGYMMAATTSLVGIGD  423

Query  738   -IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
              +I K V+DWVT EPL V+A+  I RLMDDM GHEFEQERGH  SAVECYMK +  SK+E
Sbjct  424   NLINKNVMDWVTHEPLIVQASTVIARLMDDMAGHEFEQERGHEPSAVECYMKQHGTSKEE  483

Query  561   AYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
               +E++KL+S AWK++N++CL+P  VPM +L+RVLNLAR I L+YKD D +T S  K K+
Sbjct  484   VLLELQKLVSNAWKEVNRQCLYPREVPMLILMRVLNLARVIELLYKDGDAFTHSTTKLKN  543

Query  381   LITTTLVQPV  352
             +IT+ LV PV
Sbjct  544   IITSILVDPV  553



>ref|XP_006367561.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=549

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/553 (52%), Positives = 401/553 (73%), Gaps = 8/553 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +  +  R    +H T+WG +FL+Y  +LTE    E+ EV + KE +RK+L+ AP  S
Sbjct  1     MTTSSPNKSRPLANFHSTIWGYHFLSYTPQLTETTNQEKVEVDEYKERIRKMLVEAPEGS  60

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L+KL L+D +QRLGV YHF+N+I+ SIQ+IFD      K +D++NL+VVSL FRL+RQ+G
Sbjct  61    LQKLVLIDAMQRLGVAYHFDNQIETSIQNIFD----AFKQNDDDNLHVVSLYFRLVRQQG  116

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H++S  VF+KF ++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI
Sbjct  117   HYMSSDVFKKFTEQDGKFKETLTNDVQGLLSLYEASHLRVRDEEILEEALTFTTTHLESI  176

Query  1452  LPGL--NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQ  1279
             +  L  N     +V+ AL  PIR TLPRVGAK+Y+ IYE +  HN +LL+FAKLDFN+LQ
Sbjct  177   VSNLSNNNSLKVEVTEALSQPIRMTLPRVGAKKYISIYENNDAHNHLLLKFAKLDFNMLQ  236

Query  1278  KVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIW  1099
             K HQRELS +TRWWKDL     +P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ I 
Sbjct  237   KFHQRELSELTRWWKDLDFANKIPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLKIT  296

Query  1098  SVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN  919
             SV+DD +D Y T DEL  FT+AIQR+D +A + +P Y++  Y A+LDI +EME+V++KE 
Sbjct  297   SVIDDTFDAYATYDELVTFTDAIQRWDANAIDSIPPYMRPAYQALLDIYSEMEQVLSKEG  356

Query  918   KLFHVSYTIGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
             KL  V Y   EMKK +R Y++E  W     H+P +EE+++ ++VS+ YMM AT CLVGM 
Sbjct  357   KLDRVYYAKYEMKKLVRAYFKEAQWLNDDNHIPKYEEHMENAIVSAGYMMGATNCLVGME  416

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
             + I+KE  +W+ ++PL V+A+  I R MDD++GHEFEQERGHVAS +ECYMK Y  SK+E
Sbjct  417   EFISKETFEWLMNDPLIVRASSLIGRAMDDIVGHEFEQERGHVASIIECYMKEYGASKEE  476

Query  561   AYVEIEKLISKAWKDINQE-CLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
              Y++ +K ++ AWKDIN+E  + P  VPM VL RVLNL R I  +YK+ D YT ++ K +
Sbjct  477   TYIKFQKEVTNAWKDINKEFVVRPTEVPMFVLERVLNLTRVIDTLYKEEDEYTNAKGKLR  536

Query  384   SLITTTLVQPVTI  346
             ++I + L++ + +
Sbjct  537   NMINSILIESIKL  549



>gb|AEP82784.1| terpene synthase [Solanum lycopersicum]
Length=555

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/548 (53%), Positives = 397/548 (72%), Gaps = 7/548 (1%)
 Frame = -2

Query  1974  SSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
             +  R    +HPTVWG +FL+Y  + TEI   E+ EV + KE +RK+L+ AP  SL+KL L
Sbjct  8     NKSRPLANFHPTVWGYHFLSYTPQFTEITNQEKVEVNEYKERIRKMLVKAPEGSLQKLVL  67

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D +QRLGV YHF+NEI+ SIQ+IFD   +  + D++NNLYVVSLRFRL+RQ+GH++S  
Sbjct  68    IDAMQRLGVAYHFDNEIETSIQNIFDA--SSKQNDNDNNLYVVSLRFRLVRQQGHYMSSD  125

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESIL----P  1447
             VF++F+++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI+     
Sbjct  126   VFKQFINQDGKFKETLTNDVQGLLSLYEASHLRVRDEEILEEALTFTTTHLESIIVSNLS  185

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
               N     +VS AL  PIR+TLPRVGA++Y+ IYE +  HN VLL+FAKLDFN+LQK+HQ
Sbjct  186   NNNNSLKVEVSEALTQPIRKTLPRVGARKYISIYENNVAHNHVLLKFAKLDFNVLQKLHQ  245

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             REL+ +TRWWKDL     +P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ I SV+D
Sbjct  246   RELNELTRWWKDLDFANKIPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLKITSVID  305

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D +D Y T DEL  FT+AIQR+D SA + +  Y++ +Y A+LDI +EME+V++ E KL  
Sbjct  306   DTFDAYATYDELVAFTDAIQRWDASAIDSISPYMRPLYQALLDIYSEMEQVLSNEGKLDR  365

Query  906   VSYTIGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIIT  730
             V Y   E+KK +R Y++E  W     ++P +EE++++SLV++ YMM AT CLVG+ + I+
Sbjct  366   VYYGKHEIKKIVRAYFKEAQWLNDANYIPKYEEHMEISLVTAGYMMGATNCLVGVEEFIS  425

Query  729   KEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVE  550
             K+  +W+ +EPL V+A   I R MDD++GHE EQ+RGHVAS +ECYMK Y  SKQEAY +
Sbjct  426   KDTFEWLKNEPLIVRAASLISRAMDDIVGHEDEQKRGHVASIIECYMKEYGASKQEAYAK  485

Query  549   IEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITT  370
              +K ++  WKDIN+E   P  VPM VL R LN AR I  +Y++ D YT S+   K L+ +
Sbjct  486   FKKEVTNVWKDINKEFFRPTEVPMFVLERALNFARVIDTLYQEVDGYTNSKGLLKDLVNS  545

Query  369   TLVQPVTI  346
              L++ V I
Sbjct  546   LLIESVKI  553



>emb|CBI20482.3| unnamed protein product [Vitis vinifera]
Length=725

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/511 (55%), Positives = 373/511 (73%), Gaps = 6/511 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   YHP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S++KL L+D
Sbjct  21    GRRCANYHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSVQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE+EI  +++H+FD          E ++Y  SLRFRLLRQ+G+H+SC +F
Sbjct  81    AIQRLGVAYHFESEIDEALKHMFDGS----VASAEEDVYTASLRFRLLRQQGYHVSCDLF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLNEL  1432
               F D +G FK+SL+ DV GMLSLYEA++L VHGE  LDEAL FT +HL+S     LN L
Sbjct  137   NNFKDNEGNFKESLSSDVRGMLSLYEATHLRVHGEDILDEALAFTTTHLQSAAKYSLNPL  196

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
             A  +V HALK PIR+ LPR+ A+ Y  IY+ D +H+K LL+ AKLDFNLLQK+HQ+ELS 
Sbjct  197   AE-QVVHALKQPIRKGLPRLEARHYFSIYQADDSHHKALLKLAKLDFNLLQKLHQKELSD  255

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I+ WWKDL     LPFAR R+ ECYFWILGVYFEPQ+  +RRI T++I + S +DD+YDV
Sbjct  256   ISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFLARRILTKVITMTSTIDDIYDV  315

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LFT A++R+D S  +++P+Y++  Y A+LD+ +E+EE MAKE + +   Y  
Sbjct  316   YGTLEELELFTEAVERWDISVIDQLPEYMRVCYRALLDVYSEIEEEMAKEGRSYRFYYAK  375

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MKKQ+R YY+E  W   + +P  EEY+ V+  +S Y M+ATT  + MGD++TKE  DW
Sbjct  376   EAMKKQVRAYYEEAQWLQAQQIPTMEEYMPVASATSGYPMLATTSFIAMGDVVTKETFDW  435

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V SEP  V+A+ ++ RLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE   E +K + 
Sbjct  436   VFSEPKIVRASATVSRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQETRDEFKKQVR  495

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAI  439
              AWKDINQECL P  VPM VL+R+LNLAR +
Sbjct  496   DAWKDINQECLMPTAVPMTVLMRILNLARVM  526



>ref|XP_007021115.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY12640.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=566

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/544 (52%), Positives = 391/544 (72%), Gaps = 3/544 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSE--EREVQQLKEEVRKVLIAAP-PASLEKLE  1798
              RRS  YHPT+WGD+FL+Y S   E D  +  ++E Q+L  E+RK+L+A      LEKL+
Sbjct  23    SRRSAGYHPTIWGDHFLSYASNSLENDGDDNNKQEHQKLNNELRKMLMADQVDKPLEKLK  82

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
             L+D IQRLG  YHFE EI   +Q +  ++D+C  G ++ +LY +SL+FRLLRQ G+ +S 
Sbjct  83    LIDAIQRLGFSYHFEKEIDLVLQQMHSSHDDCDIGVNDEDLYTISLKFRLLRQNGYKMSS  142

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
               F KF D +GKFK+ L  DV+GMLSLYEA++L VHGE  LD+AL FT +HLE++   LN
Sbjct  143   DAFNKFRDSEGKFKECLINDVQGMLSLYEATHLRVHGEDILDQALAFTTTHLETMATCLN  202

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                AA++S AL+ PIR+ LPR+ A+ Y+ +YE+D +H++ +L FAKLDFN+LQ++H+ E+
Sbjct  203   SSLAAQISQALRQPIRKGLPRIEARHYIPVYEEDPSHSEAVLTFAKLDFNMLQRLHREEV  262

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             S I +WWKDL   + LPF R R+ ECYFWILGVYFEP+Y  +RRI T++I + SV+DD+Y
Sbjct  263   SEIAKWWKDLDFSRKLPFIRDRVIECYFWILGVYFEPEYRLARRILTKVIAMTSVIDDIY  322

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DVYGT +EL LFT+A++R+D S  + +P+Y++  Y A+LD+  E EE M +E KL+ + Y
Sbjct  323   DVYGTLEELALFTSAVERWDISEKDHLPEYMQICYQALLDVYKETEETMTEEGKLYRLDY  382

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
              I  MK Q+R Y++E  WF+  HVP  EEY+ V+LV+S Y M+ATT  VGMGD+ TKEV 
Sbjct  383   AIEAMKNQVRAYFREAEWFHNHHVPTMEEYMAVALVTSAYAMLATTSFVGMGDVATKEVF  442

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ S+P  V A+  +CRLMDD++ H+FEQ+RGHVASA+ECY K +  +++EA  E  K 
Sbjct  443   EWLFSDPKMVTASSIVCRLMDDIVSHKFEQKRGHVASAIECYTKQHGATEEEAVKEFRKQ  502

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             I+ AWKDIN+ECL+P  VPM +L R+LNLAR I ++YK  D YT + V  K  + + L+ 
Sbjct  503   IADAWKDINEECLYPTTVPMPLLTRILNLARVIDVVYKTEDGYTHAGVMLKDFVASLLID  562

Query  357   PVTI  346
             PV I
Sbjct  563   PVPI  566



>ref|XP_004288818.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=560

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/546 (51%), Positives = 388/546 (71%), Gaps = 5/546 (1%)
 Frame = -2

Query  1977  NSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAP-PASLEKL  1801
             N+  RRS  YHP++WGD FL+Y++ +      +++ +QQLKEEV+++L+A P    L KL
Sbjct  18    NADTRRSAKYHPSIWGDRFLSYNNTMETNMQGKQQVIQQLKEEVKRMLMAPPVETGLGKL  77

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
             EL+D IQRLGV YHFE EI  ++Q I +N +      D+++L+  +LRFRLLRQ G+++S
Sbjct  78    ELIDDIQRLGVSYHFEYEIDQTMQQIHENLNGTY---DDDDLHTCALRFRLLRQHGYNVS  134

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C +F KF D DGKF +SL  DV G+ SLYEA++L V GE  L+EAL FT +HL+S    L
Sbjct  135   CDMFNKFKDCDGKFDESLHHDVAGLQSLYEATHLRVRGEDFLEEALAFTTTHLQSAANRL  194

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQR  1264
             +   + +V HAL  P+R+ LPR+ A+ YM ++++   + N VLLRFAKLDFNLLQ+VHQ+
Sbjct  195   SPPLSKQVRHALNQPLRKGLPRLEARHYMSLHQELHGSRNHVLLRFAKLDFNLLQQVHQK  254

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ELS I RWWK L     LPFAR R+ ECYFWILGVYFEP+Y+F+RR  T++I + S++DD
Sbjct  255   ELSDIARWWKKLDFASKLPFARDRVIECYFWILGVYFEPKYYFARRTLTKVIAMTSIIDD  314

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL LFT AI+R+D SA + +P+Y+K  Y A+LD+  E E+ +A E K + +
Sbjct  315   IYDVYGTLEELDLFTRAIERWDISAMDVLPEYMKFCYEALLDVYAEAEQGLASEGKSYRI  374

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK+Q+R Y+ E  WF+  + P  +EY++V+LV+S Y M+ATT  VGMGDI+TK+
Sbjct  375   DYAKEAMKRQVRAYHAEAKWFHNNYTPTMDEYMEVALVTSAYSMLATTSFVGMGDIVTKD  434

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
               +W+ S+P  VKA+  +CRLMDD++ H+FEQ+RGHVASAVECYM  Y  +++E  +E  
Sbjct  435   SFEWIFSDPKMVKASAVVCRLMDDIVSHKFEQKRGHVASAVECYMIQYGATEEETIIEFR  494

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +S AWKDIN+ECLHP  V M +L+RVLNL R I ++YK  D YT +    K  + + L
Sbjct  495   KQVSDAWKDINEECLHPTSVNMPLLMRVLNLTRVIDVLYKSEDGYTHAGTILKDFVASLL  554

Query  363   VQPVTI  346
             V PVT+
Sbjct  555   VDPVTV  560



>ref|NP_001234766.1| caryophyllene/alpha-humulene synthase [Solanum lycopersicum]
 gb|ADD96698.1| caryophyllene/alpha-humulene synthase [Solanum lycopersicum]
 gb|AEP82783.1| beta caryophyllene/humulene synthase [Solanum lycopersicum]
Length=548

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/544 (53%), Positives = 392/544 (72%), Gaps = 9/544 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HPTVWG +FL+Y  ++T     E+ EV + KE +RK+L+ AP  S +KL L+D 
Sbjct  10    RPLANFHPTVWGYHFLSYTHEITN---QEKVEVDEYKETIRKMLVEAPEGSEQKLVLIDA  66

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF+NEI+ SIQ+IFD   +  + D++NNLYVVSLRFRL+RQ+GH++S  VF+
Sbjct  67    MQRLGVAYHFDNEIETSIQNIFDA--SSKQNDNDNNLYVVSLRFRLVRQQGHYMSSDVFK  124

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL--NEL  1432
             +F+++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLES +  L  N  
Sbjct  125   QFINQDGKFKETLTNDVQGLLSLYEASHLRVRDEEILEEALTFTTTHLESTVSNLSNNNS  184

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
               A+V+ A   PIR TLPRVGA++Y+ IYE +  HN +LL+FAKLDFN+LQK+HQRELS 
Sbjct  185   LKAEVTEAFSQPIRMTLPRVGARKYISIYENNDAHNHLLLKFAKLDFNMLQKLHQRELSD  244

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T++I + S  DD +D 
Sbjct  245   LTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVIQMASFFDDTFDA  304

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             Y T DEL+ F NAIQR+D +A + VP YL+  Y A+LDI +EME+ +AKE K   V Y  
Sbjct  305   YATFDELEPFNNAIQRWDINAIDSVPPYLRHAYQALLDIYSEMEQALAKEFKSDRVYYAK  364

Query  891   GEMKKQIRTYYQEFMWFYT-KHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
              EMKK +R Y++E  W     H+P +EE+++ ++VS+ YMM ATTCLVG+ + I+KE  +
Sbjct  365   YEMKKLVRAYFKEAQWLNNDNHIPKYEEHMENAMVSAGYMMGATTCLVGVEEFISKETFE  424

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+ +EPL V+A+  I R MDD++GHE EQ+R H AS +ECYMK Y VSKQEAYV+ +K +
Sbjct  425   WMINEPLIVRASSLIARAMDDIVGHEVEQQREHGASLIECYMKDYGVSKQEAYVKFQKEV  484

Query  534   SKAWKDINQECLHP-LPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             +  W DIN+E   P + VP  VL RVLN  R I  +YK+ D YT S+ KFK++I + LV+
Sbjct  485   TNGWMDINREFFCPDVEVPKFVLERVLNFTRVINTLYKEKDEYTNSKGKFKNMIISLLVE  544

Query  357   PVTI  346
              V I
Sbjct  545   SVEI  548



>ref|XP_006356724.1| PREDICTED: (E,E)-germacrene B synthase-like [Solanum tuberosum]
Length=547

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/552 (53%), Positives = 397/552 (72%), Gaps = 8/552 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +  +  R    +H T+WG +FL+Y  +LTEI   E+ EV++ KE +RK+L+ AP  S
Sbjct  1     MTTSSPNKSRPLANFHSTIWGYHFLSYTPQLTEITNQEKVEVEEYKERIRKMLVEAPEGS  60

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L+KL L+D +QRLGV YHF+NEI+ SIQ+IF  Y +  K D   NL+VVSL FRL+RQ+G
Sbjct  61    LQKLVLIDAMQRLGVAYHFDNEIETSIQNIF--YASKQKDD---NLHVVSLHFRLVRQQG  115

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H++S  VF++F  +DGKFK++LT DV+G+ SLYEAS+L V  E  L+EALTFT +HLESI
Sbjct  116   HYMSSDVFKQFTAQDGKFKETLTNDVQGLFSLYEASHLRVRDEEILEEALTFTTNHLESI  175

Query  1452  LPG--LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQ  1279
                   N     + + AL  PIR T PRVGA++Y+ IYE +  HN +LL+FAKLDFN+LQ
Sbjct  176   AVSNLSNNSLKVEATEALSQPIRMTSPRVGARKYISIYENNDAHNHLLLKFAKLDFNMLQ  235

Query  1278  KVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIW  1099
             K+HQRELS +TRWWKDL     +P+AR RL ECYFWILGVYFEP+Y+ +R++ T+++ I 
Sbjct  236   KLHQRELSDLTRWWKDLDFANKIPYARDRLVECYFWILGVYFEPKYNRARKMMTKVLKIT  295

Query  1098  SVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN  919
             SV+DD +D Y T DEL  FT+AIQR+D +A + +P Y++ +Y A+LDI  EME+V++KE 
Sbjct  296   SVIDDTFDAYATYDELVTFTDAIQRWDANAIDSIPPYMRPVYQALLDIYIEMEQVLSKEG  355

Query  918   KLFHVSYTIGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
             KL HV Y   EMKK +R Y++E  W     H+P +EE++++SLVS+ YMM +TT LVGM 
Sbjct  356   KLDHVYYAKYEMKKLVRAYFKEAQWLNDDNHIPKYEEHMEISLVSAAYMMGSTTSLVGME  415

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
             + I+K+  +W+ +EPL V+A   I R M+D++GHE EQERGHVAS +ECYMK Y  SKQE
Sbjct  416   EFISKDTFEWLMNEPLIVRAASLISRAMNDIVGHEVEQERGHVASIIECYMKEYGASKQE  475

Query  561   AYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
             AY++ +K +S AWKDIN+E   P  VPM VL RVLNL R I  +YK+ D YT ++ K K+
Sbjct  476   AYIKFQKEVSTAWKDINKEFFRPTKVPMFVLERVLNLTRVIDTLYKEEDEYTNAKGKLKN  535

Query  381   LITTTLVQPVTI  346
             +I + L++ V I
Sbjct  536   MINSILIESVKI  547



>gb|AGS16741.1| sesquiterpene synthase [Panax ginseng]
Length=568

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/568 (52%), Positives = 393/568 (69%), Gaps = 19/568 (3%)
 Frame = -2

Query  1992  MDVNV-NSSG---------------RRSVTYHPTVWGDYFLAY-DSKLTEIDPSEEREVQ  1864
             MDVN+  SSG               RR+  +HP+VWGD+FLAY  S L   D   E + Q
Sbjct  1     MDVNILASSGSFSAKNNAVVPSTIVRRTANFHPSVWGDHFLAYTSSDLLRADDDTEGKCQ  60

Query  1863  QLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE  1684
              LKEEV+K+L+AA     + L L+  IQ LGV YHFE EI A++QH+   +   +    +
Sbjct  61    LLKEEVKKMLLAATDKPQKLLNLISDIQLLGVAYHFEAEIDAALQHVNATFHEYVASKKD  120

Query  1683  NNLYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGE  1504
             ++L+ VSL FRLLRQ+GHH+S  VF KF D DGKFK+ LTKDV GMLSL+EA++L VHGE
Sbjct  121   HDLHFVSLCFRLLRQDGHHVSSDVFCKFKDNDGKFKECLTKDVRGMLSLFEATHLRVHGE  180

Query  1503  TTLDEALTFTASHLESILPGL-NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTH  1327
               L+EAL FT S L  +   L N   AA V+HALK+PIR+ L R+ A+ Y+ IY +  +H
Sbjct  181   DILEEALAFTTSQLHHLKSHLQNHPLAAHVTHALKMPIRKGLTRLEARRYISIYHEHDSH  240

Query  1326  NKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEP  1147
             +KVLL FAKLDFN LQKVHQ ELS ITRWWKDL   + L FAR R+ ECYFW LGVYFEP
Sbjct  241   DKVLLEFAKLDFNKLQKVHQGELSYITRWWKDLNFAEKLSFARDRMVECYFWTLGVYFEP  300

Query  1146  QYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLA  967
             QY  +RR+ T+ I + S++DD+YD +GT +EL +FT+AI+R+D SA +++P Y++  Y A
Sbjct  301   QYLLARRLMTKTISMLSIIDDIYDAFGTFEELVIFTDAIERWDISALDQLPVYMRLCYQA  360

Query  966   ILDITTEMEEVMAKENK-LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLV  790
             +LD+ TEMEE MA+  + L+ V Y   E+K+ ++ Y++E  W +  ++P  EE+++V+LV
Sbjct  361   LLDVYTEMEEEMARAGRPLYRVHYAKYELKRLVKAYFEEAKWLHKGYIPTMEEHMEVALV  420

Query  789   SSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVA  610
             S+ YMMI+TT  VGM D+ TKE  +WV+++PL V+A+  I RL DD++GHE EQERGHVA
Sbjct  421   SAGYMMISTTSFVGMTDLATKEAFEWVSNDPLIVRASSVINRLTDDIVGHEIEQERGHVA  480

Query  609   SAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLI  430
             S VECYMK + V K++ Y E +K I  AWKD+NQECL P  V M +L RV NLAR I L+
Sbjct  481   SGVECYMKQHGVPKEDVYAEFQKQIVNAWKDMNQECLRPTAVAMPLLTRVFNLARVINLL  540

Query  429   YKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             Y D D Y+ S+ + K LIT+ L+ PV I
Sbjct  541   YDDFDGYSNSKTRTKDLITSVLIDPVPI  568



>sp|Q9FQ27.1|TPSGB_SOLHA RecName: Full=(E,E)-germacrene B synthase [Solanum habrochaites]
 gb|AAG41891.1|AF279455_1 sesquiterpene synthase 1 [Solanum habrochaites]
Length=544

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/553 (51%), Positives = 389/553 (70%), Gaps = 13/553 (2%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +  +  R    +HPTVWG +FL+Y  ++T     E+ EV + KE +RK+L+ AP  S
Sbjct  1     MAASSANKSRPLANFHPTVWGYHFLSYTHEITN---QEKVEVDEYKETIRKMLVEAPEGS  57

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
              +KL L+D +QRLGV YHF NEI+ SIQ+IFD           NNL++VSLRFRL+RQ+G
Sbjct  58    EQKLVLIDAMQRLGVAYHFHNEIETSIQNIFD------APKQNNNLHIVSLRFRLVRQQG  111

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H++S  VF++F ++DGKFK++LT DV+G+LSLYEASYL V  E  L+EAL FT +HL+SI
Sbjct  112   HYMSSDVFKQFTNQDGKFKETLTNDVQGLLSLYEASYLRVRDEEILEEALAFTTTHLKSI  171

Query  1452  LPGL---NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             +  +   N     +VS AL  PIR TLPR+ A+ Y+ IYE +  HN +LL+FAKLDFN+L
Sbjct  172   VSTMSNNNNSLKVEVSEALTQPIRMTLPRMEARRYISIYENNDAHNHLLLKFAKLDFNML  231

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QK+HQRELS +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ +
Sbjct  232   QKLHQRELSDLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLKM  291

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE  922
              S++DD +D Y T DEL+ F +AIQR+D +A + +P Y++  Y A LDI +EME+V++K+
Sbjct  292   TSIIDDTFDAYATFDELEPFNDAIQRWDANAIDSIPPYMRPAYQAFLDIYSEMEQVLSKK  351

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFYT-KHVPPFEEYLKVSLVSSCYMMIATTCLVGM  745
              KL  V Y   EMKK +R Y++E  W     H+P +EE+++ SLVS  YMMI TTCLVGM
Sbjct  352   GKLDRVYYAKNEMKKLVRAYFKETQWLNDCDHIPKYEEHMENSLVSGGYMMIPTTCLVGM  411

Query  744   GDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQ  565
              + I+ E  +W+ ++PL V+A+  I R M+D++GHE EQERGHVAS +ECYMK Y  SKQ
Sbjct  412   EEFISIETFEWLMNDPLIVRASSLIARAMNDIVGHEVEQERGHVASLIECYMKDYGASKQ  471

Query  564   EAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
             EAY + +K ++ AWKDIN+E   P  VPM VL RVLNL RA   +YK+ D YT ++ K K
Sbjct  472   EAYAKFKKDVTNAWKDINKEFFRPTEVPMFVLERVLNLTRAAEPLYKEKDAYTNAKGKLK  531

Query  384   SLITTTLVQPVTI  346
             ++I + L++ V I
Sbjct  532   NMINSILIESVKI  544



>gb|AAG41892.1|AF279456_1 sesquiterpene synthase 2 [Solanum habrochaites]
Length=546

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/553 (51%), Positives = 393/553 (71%), Gaps = 11/553 (2%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +  +  R    +HPTVWG +FL Y+ ++T     E+ EV + KE +RK+L+ AP  S
Sbjct  1     MAASFANKCRPLANFHPTVWGYHFLYYNPEITN---QEKIEVDEYKETIRKMLVEAPEGS  57

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
              +KL L+D +QRLGV YHF NEI+ SIQ+IFD      K ++++NL++VSLRFRL+RQ+G
Sbjct  58    EQKLVLIDAMQRLGVAYHFHNEIETSIQNIFD----APKQNNDDNLHIVSLRFRLVRQQG  113

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H++S  VF++F ++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI
Sbjct  114   HYMSSDVFKQFTNQDGKFKETLTNDVQGLLSLYEASHLRVRNEEILEEALTFTTTHLESI  173

Query  1452  LPGL---NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             +  L   N     +VS AL  PIR TLPR+GA++Y+ IYE +  HN +LL+FAKLDFN+L
Sbjct  174   VSNLSNKNNSLKVEVSEALSQPIRMTLPRIGARKYISIYENNDAHNHLLLKFAKLDFNML  233

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QK HQRELS +TRWWKDL     +P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ +
Sbjct  234   QKFHQRELSDLTRWWKDLDFANKIPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLKM  293

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE  922
              S++DD +D Y   DEL  F +AIQR+D +A + +P Y++ IY A+LDI  EM++V++KE
Sbjct  294   TSIIDDTFDAYANFDELVPFNDAIQRWDANAIDSIPPYMRPIYQALLDIYGEMDQVLSKE  353

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGM  745
              KL  V Y   EMKK +R Y++E  W     H+P +EE+++ ++V+  YMM AT CLVGM
Sbjct  354   GKLDRVYYAKYEMKKLVRAYFKESQWLNDDNHIPKYEEHMENAIVTVGYMMGATNCLVGM  413

Query  744   GDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQ  565
              + I+KE  +W+ SEP+ V+A+  I R MDD++GHE EQERGHVAS +ECYMK Y  SKQ
Sbjct  414   EEFISKETFEWLMSEPVIVRASSLIGRAMDDIVGHEVEQERGHVASIIECYMKDYGASKQ  473

Query  564   EAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
             EAY + +K ++ AWKDIN+E   P  VPM VL R LN  R I  +Y++ D YT ++ K K
Sbjct  474   EAYAKFKKDVTNAWKDINKEFFRPTEVPMFVLERALNFTRVIDTLYQEEDEYTNAKGKLK  533

Query  384   SLITTTLVQPVTI  346
             ++I + L++ V I
Sbjct  534   NMIHSILIESVKI  546



>ref|XP_011090538.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=552

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/541 (51%), Positives = 382/541 (71%), Gaps = 8/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
               RSV YHP+VWGDYFLAYDS  TE+  +E+ E+Q+ KE VRK+L   P  SL KL+L+D
Sbjct  20    ASRSVKYHPSVWGDYFLAYDS--TEVSTAEKEELQRQKETVRKLLAGTPDDSLHKLQLID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV+YHFE EI  S+  +   +  C   D  N+L +V+LRFRLLRQ+G+ +SC VF
Sbjct  78    AIQRLGVNYHFEEEIDKSLGCMHGTHLECSNKD--NDLRIVALRFRLLRQQGYRVSCDVF  135

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF+D  G FK+SLT +V+GML LYEA++ G  GE  LD+AL  ++S+L+S     +   
Sbjct  136   NKFMDDQGNFKNSLTTNVQGMLELYEAAHFGASGEEILDKALELSSSYLQSYASDTSSSL  195

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
              A V+ AL+ PIR+ L R+ AK+++ IY++D + N++LL FAKLDFN++QK+HQ+ELS I
Sbjct  196   FALVNLALEFPIRKNLIRLAAKKFISIYQEDASRNEILLNFAKLDFNVVQKIHQKELSDI  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK L       FAR+R+ ECYFWILGVYFE +Y+ +RR+ T++I + SV+DD+YDVY
Sbjct  256   TRWWKALDFENKFSFARNRVVECYFWILGVYFERKYNVARRMLTKVIALTSVIDDIYDVY  315

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT D+LQLFT+ +QR+D +   ++P Y++  Y A++D   EME  +      + V Y   
Sbjct  316   GTLDDLQLFTDVVQRWDVNDPEQLPPYIRICYKALIDAYLEMEAEVESGGGSYRVQYAKE  375

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK +R Y +E  W Y+K++P  +EY+KV+LVS  YMM++TT LVGMG+++TKE  DWV
Sbjct  376   EMKKLVRAYLEEAKWVYSKYMPTTKEYMKVALVSGAYMMLSTTSLVGMGNLVTKEDFDWV  435

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             TSEPL V+A+  ICRLMDDM+G  FEQ+     +AV+CYM  Y  SK++ + E  K + K
Sbjct  436   TSEPLIVRASSIICRLMDDMVGFGFEQK----VTAVDCYMNEYGASKKDTFAEFRKQVKK  491

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P PV M VL+RV+NLAR I L+Y+  D Y+ S  K K ++   LV+PV 
Sbjct  492   AWKDINEECLQPTPVSMPVLMRVVNLARVINLLYERGDEYSNSNTKTKKVVRYVLVEPVA  551

Query  348   I  346
             +
Sbjct  552   V  552



>ref|NP_001289542.1| germacrene C synthase-like [Nicotiana sylvestris]
 gb|ADI87446.1| cembratrienol synthase 2a [Nicotiana sylvestris]
Length=598

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/547 (52%), Positives = 385/547 (70%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++++SS R    +  T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+  P  S +
Sbjct  53    MDLSSSSRHLADFPSTIWGDHFLSYNSEITEITTQEKNEHEMLKEIVRKMLVETPDNSTQ  112

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + DDE+NLYV +LRFRL RQ+G++
Sbjct  113   KLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-EDDDEHNLYVAALRFRLARQQGYY  171

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  172   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEEILEEALIFTTTHLESVIP  231

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+ +PRVGA++Y+ IYE   THN +LL+FAKLDFN+LQK+H+
Sbjct  232   NLSNSLKVQVTEALSHPIRKAIPRVGARKYIHIYENIGTHNDLLLKFAKLDFNMLQKLHR  291

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY  SR + T+++ + S++D
Sbjct  292   KELNELTSWWKDLDRANKFPYAKDRLVEAYFWTVGIYFEPQYSRSRSLVTKVVKMNSIID  351

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEV+AKE K  H
Sbjct  352   DTYDAYATFDELVLFTDAIQRWDEGAMDLLPTYLRPIYQGLLDVFNEMEEVLAKEGKADH  411

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK    Y++E  W    ++P  EEY+K  LVSS   M     LV M +IITK
Sbjct  412   IYYAKKEMKKVAEVYFKEAEWLNANYIPKCEEYMKNGLVSSTGPMYGIISLVVMEEIITK  471

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+T+EPL ++A  +ICRLMDDM  HE EQ+RGHVAS VECYMK Y VSKQEAYVE+
Sbjct  472   EAFEWLTNEPLILRAASTICRLMDDMADHEVEQQRGHVASFVECYMKEYGVSKQEAYVEM  531

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ AWKDIN+E L P  VPM +L R LN +R      KD+D YT  + K K LI + 
Sbjct  532   RKKITNAWKDINKELLRPTAVPMFILERSLNFSRLADTFLKDDDGYTNPKSKVKDLIASL  591

Query  366   LVQPVTI  346
              V+ V I
Sbjct  592   FVESVDI  598



>gb|AAS46038.1| cyclase [Nicotiana tabacum]
Length=598

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/547 (52%), Positives = 384/547 (70%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++++SS R    +  T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+  P  S +
Sbjct  53    MDLSSSSRHLADFPSTIWGDHFLSYNSEITEITTQEKNEHEMLKEIVRKMLVETPDNSTQ  112

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + DDE+NLYV +LRFRL RQ+G++
Sbjct  113   KLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-EDDDEHNLYVAALRFRLARQQGYY  171

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  172   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEEILEEALIFTTTHLESVIP  231

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+ +PRVGA++Y+ IYE   THN +LL+FAKLDFN+LQK+H+
Sbjct  232   NLSNSLKVQVTEALSHPIRKAIPRVGARKYIHIYENIGTHNDLLLKFAKLDFNMLQKLHR  291

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY  SR + T+++ + S++D
Sbjct  292   KELNELTSWWKDLDRANKFPYAKDRLVEAYFWTVGIYFEPQYSRSRSLVTKVVKMNSIID  351

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEV+AKE K  H
Sbjct  352   DTYDAYATFDELVLFTDAIQRWDEGAMDLLPTYLRPIYQGLLDVFNEMEEVLAKEGKADH  411

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK    Y++E  W    ++P  EEY+K  LVSS   M     LV M +IITK
Sbjct  412   IYYAKKEMKKVAEVYFKEAEWLNANYIPKCEEYMKNGLVSSTGPMYGIISLVVMEEIITK  471

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+T+EPL ++A  +ICRLMDDM  HE EQ+RGHVAS VECYMK Y VSKQE YVE+
Sbjct  472   EAFEWLTNEPLILRAASTICRLMDDMADHEVEQQRGHVASFVECYMKEYGVSKQETYVEM  531

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ AWKDIN+E L P  VPM +L R LN +R      KD+D YT  + K K LI + 
Sbjct  532   RKKITNAWKDINKELLRPTAVPMFILERSLNFSRLADTFLKDDDGYTNPKSKVKDLIASL  591

Query  366   LVQPVTI  346
              V+ V I
Sbjct  592   FVESVDI  598



>ref|NP_001289541.1| germacrene C synthase-like [Nicotiana sylvestris]
 gb|ADI87447.1| cembratrienol synthase 2b [Nicotiana sylvestris]
Length=598

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/547 (52%), Positives = 384/547 (70%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++++SS R    +  T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+  P  S +
Sbjct  53    MDLSSSSRHLADFPSTIWGDHFLSYNSEITEITTQEKNEHEMLKEIVRKMLVETPDNSTQ  112

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + DDE+NLYV +LRFRL RQ+G++
Sbjct  113   KLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-EDDDEHNLYVAALRFRLARQQGYY  171

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  172   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEEILEEALIFTTTHLESVIP  231

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+ +PRVGA++Y+ IYE   THN +LL+FAKLDFN+LQK+H+
Sbjct  232   NLSNSLKVQVTEALSHPIRKAIPRVGARKYIHIYENIGTHNDLLLKFAKLDFNMLQKLHR  291

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY  SR + T+++ + S++D
Sbjct  292   KELNELTSWWKDLDRANKFPYAKDRLVEAYFWTVGIYFEPQYSRSRSLVTKVVKMNSIID  351

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEV+AKE K  H
Sbjct  352   DTYDAYATFDELVLFTDAIQRWDEDAMDLLPTYLRPIYQGLLDVFNEMEEVLAKEGKADH  411

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK    Y++E  W    ++P  EEY+K  LVSS   M     LV M +IITK
Sbjct  412   IYYAKKEMKKVAAVYFKEAEWLNANYIPKCEEYMKNGLVSSTGPMYGIISLVVMEEIITK  471

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+ +EPL ++A  +ICRLMDDM  HE EQ+RGHVAS VECYMK Y VSKQEAYVE+
Sbjct  472   EAFEWLANEPLILRAASTICRLMDDMADHEVEQQRGHVASFVECYMKEYGVSKQEAYVEM  531

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ AWKDIN+E L P  VPM +L R LN +R      KD+D YT  + K K LI + 
Sbjct  532   RKKITNAWKDINKELLRPTAVPMFILERSLNFSRLADTFLKDDDGYTNPKSKVKDLIASL  591

Query  366   LVQPVTI  346
              V+ V I
Sbjct  592   FVESVDI  598



>gb|AAK95517.1|AF401234_1 cyclase [Nicotiana tabacum]
Length=598

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/547 (52%), Positives = 384/547 (70%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++++SS R    +  T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+  P  S +
Sbjct  53    MDLSSSSRHLADFPSTIWGDHFLSYNSEITEITTQEKNEHEMLKEIVRKMLVETPDNSTQ  112

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + DDE+NLYV +LRFRL RQ+G++
Sbjct  113   KLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-EDDDEHNLYVAALRFRLARQQGYY  171

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  172   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEEILEEALIFTTTHLESVIP  231

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+ +PRVGA++Y+ IYE   THN +LL+FAKLDFN+LQK+H+
Sbjct  232   NLSNSLKVQVTEALSHPIRKAIPRVGARKYIHIYENIGTHNDLLLKFAKLDFNMLQKLHR  291

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY  SR + T+++ + S++D
Sbjct  292   KELNELTSWWKDLDRANKFPYAKDRLVEAYFWTVGIYFEPQYSRSRSLVTKVVKMNSIID  351

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEV+AKE K  H
Sbjct  352   DTYDAYATFDELVLFTDAIQRWDEGAMDLLPTYLRPIYQGLLDVFNEMEEVLAKEGKADH  411

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK    Y++E  W    ++P  EEY+K  LVSS   M     LV M +IITK
Sbjct  412   IYYAKKEMKKVAEVYFKEAEWLNANYIPKCEEYMKHGLVSSTGPMYGIISLVVMEEIITK  471

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+T+EPL ++   +ICRLMDDM  HE EQ+RGHVAS VECYMK Y VSKQEAYVE+
Sbjct  472   EAFEWLTNEPLILRPASTICRLMDDMADHEVEQQRGHVASFVECYMKEYGVSKQEAYVEM  531

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ AWKDIN+E L P  VPM +L R LN +R      KD+D YT  + K K LI + 
Sbjct  532   RKKITNAWKDINKELLRPTAVPMFILERSLNFSRLADTFLKDDDGYTNPKSKVKDLIASL  591

Query  366   LVQPVTI  346
              V+ V I
Sbjct  592   FVESVDI  598



>gb|AAX16121.1| germacrene-D synthase [Actinidia deliciosa]
Length=565

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/543 (50%), Positives = 391/543 (72%), Gaps = 8/543 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTE---IDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
             RRS  YHP++WGD+FLAY S   E   I+  +++ +  LK++VRK+L AA   S + L L
Sbjct  27    RRSANYHPSIWGDHFLAYSSDAMEEEVINMEQQQRLHHLKQKVRKMLEAAAEQSSQMLNL  86

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             VDKIQRLGV YHFE EI+ +++HI+   D        ++L+  +L FRLLRQ+G+ +SC 
Sbjct  87    VDKIQRLGVSYHFETEIETALRHIYKTCDYHF-----DDLHTAALSFRLLRQQGYPVSCD  141

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             +F+KF +  G+F++S+  DV+GMLSLYEA+ L +HGE  LDEAL FT + L S LP L+ 
Sbjct  142   MFDKFKNSKGEFQESIISDVQGMLSLYEATCLRIHGEDILDEALAFTITQLRSALPNLST  201

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 ++ HAL  PI + L R+ A+ ++  +EQ+  H+K LL FAKLDFNLLQK+HQREL 
Sbjct  202   PFKEQIIHALNQPIHKGLTRLNARSHILFFEQNDCHSKDLLNFAKLDFNLLQKLHQRELC  261

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              ITRWWKDL   K LPFAR R+ ECYFWILGVYFEPQY  +RR+ T++I + S++DD+YD
Sbjct  262   EITRWWKDLNFAKTLPFARDRMVECYFWILGVYFEPQYLLARRMLTKVIAMISIIDDIYD  321

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VYGT +EL LFT+AI+R++ SA +++P+Y+K  Y A+LD+ + ++E MAK+ + + V Y 
Sbjct  322   VYGTLEELVLFTDAIERWEISALDQLPEYMKLCYQALLDVYSMIDEEMAKQGRSYCVDYA  381

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MK  +R Y++E  WF+  +VP  EEY++V+LV++ Y M+AT+  VGMGD+ TKE  D
Sbjct  382   KSSMKILVRAYFEEAKWFHQGYVPTMEEYMQVALVTAGYKMLATSSFVGMGDLATKEAFD  441

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             WV+++PL V+A   I RL DD++GH+FEQ+RGHVASAVECY K +  +++EA +E++K +
Sbjct  442   WVSNDPLIVQAASVIGRLKDDIVGHKFEQKRGHVASAVECYSKQHGTTEEEAIIELDKQV  501

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             + +WKDIN ECL P+ VPM +L RVLNLAR +++IY+D D YT    K ++ +T+ L+  
Sbjct  502   THSWKDINAECLCPIKVPMPLLARVLNLARVLYVIYQDEDGYTHPGTKVENFVTSVLIDS  561

Query  354   VTI  346
             + I
Sbjct  562   MPI  564



>gb|ADK94034.1| alpha-copaene synthase [Eleutherococcus trifoliatus]
Length=556

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/543 (53%), Positives = 377/543 (69%), Gaps = 10/543 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDS-KLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             RRS  YHP +WGD FL Y+S  L++ D + +   +QLKEEV+K+L+ A P   ++L L+D
Sbjct  21    RRSANYHPNIWGDQFLKYNSFDLSKTDANTKEHFRQLKEEVKKMLVDAGPN--QQLNLID  78

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV Y FE EI A++Q +     N I   ++++L+ +SLRFRLLRQ G+++S  VF
Sbjct  79    DIQRLGVAYQFEAEIDAALQRM-----NVIFQGNDDDLHTISLRFRLLRQHGYNVSSDVF  133

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF+D +GKFK+ L  D+ G+LSLYEA++  VHGE  L++AL FT SHLE +   L    
Sbjct  134   RKFMDNNGKFKECLISDLRGVLSLYEATHFRVHGEDILEDALEFTTSHLERLKSHLKNPL  193

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
             AA+V  ALK PI + L R+ AK Y+ IY+Q D +HNKVLL FAKLDFNLLQK+HQ ELS 
Sbjct  194   AAQVIRALKCPIHKGLNRLEAKHYISIYQQEDDSHNKVLLNFAKLDFNLLQKMHQGELSH  253

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             ITRWWK+L   K LPFAR R+ ECYFWILGVYFEPQY  +RR  T+II + SV DD+YDV
Sbjct  254   ITRWWKELNFAKKLPFARDRVVECYFWILGVYFEPQYLIARRFLTKIIAMASVADDIYDV  313

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK-LFHVSYT  895
             YGT +EL + T+AI+R+D  A +++P+ ++  + A+LD+ TEMEE MAK  +  + V Y 
Sbjct  314   YGTLEELVILTDAIERWDMGALDQIPECMRVYHRALLDVYTEMEEEMAKTGRPSYRVHYA  373

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                 K+ +R Y  E  WF   + P  EEYL V+L+S  Y M+AT   VGMGD+ TKE  D
Sbjct  374   KEAYKELVRQYLAEAKWFQEDYDPTLEEYLPVALISGGYKMLATHSFVGMGDLATKEAFD  433

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             WV++ PL VKA+  ICRL DDM+GHE E ERG VASAVECYMK Y V+KQE Y+E +K I
Sbjct  434   WVSNNPLIVKASSVICRLSDDMVGHEVEHERGDVASAVECYMKQYGVTKQEVYIEFQKQI  493

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             S AWKD+NQECLHP  V M +L  + N+ R I L+Y + D YT S  + K  IT+ L+ P
Sbjct  494   SNAWKDMNQECLHPTTVTMPLLTVIFNMTRVINLLYDEEDGYTNSNTRTKDFITSVLIDP  553

Query  354   VTI  346
             V I
Sbjct  554   VQI  556



>ref|XP_009594549.1| PREDICTED: germacrene C synthase-like [Nicotiana tomentosiformis]
Length=597

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/547 (52%), Positives = 388/547 (71%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             +N +SS R    +H T+WGD+FL+Y+S++TEI   E+ E ++LKE  RK+L+  P  S +
Sbjct  52    MNPSSSSRHLADFHSTIWGDHFLSYNSEITEITTQEKNEHEELKEIGRKMLVETPDNSTQ  111

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF    N  + DDE+NLYVV+LRFRL RQ+G++
Sbjct  112   KLVLIDTIQRLGLAYHFNDEIENSIQNIFYLSQNS-EEDDEHNLYVVALRFRLARQQGNY  170

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  171   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMSVHEEEILEEALIFTTTHLESMIP  230

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+T+PRVGA++Y+ IYE  + HN +LL+FAKLDFN+LQK+H+
Sbjct  231   NLSNSLKVQVTEALSQPIRKTIPRVGARKYIYIYENIEAHNDLLLKFAKLDFNMLQKLHR  290

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW+ G+YFEPQY  SRR+ T+++   S++D
Sbjct  291   KELNELTSWWKDLDFANKFPYAKDRLVEAYFWMAGIYFEPQYSRSRRMITKVVKTNSIID  350

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEV+AKE K   
Sbjct  351   DTYDAYATFDELVLFTDAIQRWDVGAMDSLPTYLRPIYQGLLDVFNEMEEVLAKEGKADR  410

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK +  Y++E  W    ++P  EEY+K  LVS   MM  T  LV M + ITK
Sbjct  411   IYYAKKEMKKLVAAYFKEAQWLNANYIPKCEEYMKNGLVSCTGMMYGTISLVVMEEFITK  470

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+++EPL ++A+ +ICRLMDD+  HE EQ+RGHVAS VECYMK Y VSKQEAYVE+
Sbjct  471   ETFEWLSNEPLILRASSTICRLMDDIADHEVEQQRGHVASFVECYMKEYGVSKQEAYVEM  530

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ AWKDIN+E L P  VPM VL R LN  R +   +KD+D YT  + K K LIT  
Sbjct  531   WKNITNAWKDINKELLRPTAVPMFVLERTLNYTRLVDTFFKDDDGYTNPKSKVKDLITLL  590

Query  366   LVQPVTI  346
              V+ + I
Sbjct  591   FVESIDI  597



>gb|AGB05614.1| sesquiterpene synthase 5 [Valeriana officinalis]
Length=568

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/552 (52%), Positives = 390/552 (71%), Gaps = 18/552 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDS----KLTEIDPSEEREVQQLKEEVRKVLIAAPPASL--EK  1804
             RR+  YHP++WG+YFL Y S    ++ + D +EE E      EVR+ L+A        E+
Sbjct  23    RRTANYHPSIWGNYFLKYASTDCVQIGDHDGAEELE------EVRRKLVADGNDDRVDEQ  76

Query  1803  LELVDKIQRLGVDYHFENEIQASIQH----IFDNYDNCIKGDDENNLYVVSLRFRLLRQE  1636
             L+L+D IQRLGV YHFE+EI   +      + D++ N     ++++LY+VSLRFRLLRQ+
Sbjct  77    LKLIDAIQRLGVAYHFESEIDVVLNRQLLKLSDSFGNTNPNVEDDDLYMVSLRFRLLRQQ  136

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             GH +SCGVF KF D +G+FK+S+  DV GMLSLYEA+++ V  E  L+EAL F+ +HL+ 
Sbjct  137   GHPVSCGVFSKFTDNEGRFKESIVSDVRGMLSLYEAAHMRVREEDILEEALNFSTTHLKQ  196

Query  1455  IL-PGLNELA-AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             ++   L + A  ++V HAL  PIR+TL R+ A+ YMQIYEQ+++H++ LL+FAKLDFN+L
Sbjct  197   VVNKSLRDHALISQVVHALNWPIRKTLARLEARNYMQIYEQEKSHDETLLKFAKLDFNML  256

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QKVHQREL  ITRWW +  V + LPFAR RL ECY WILGVYFEP Y  +R I T++I +
Sbjct  257   QKVHQRELGVITRWWSEFNVAEKLPFARDRLVECYIWILGVYFEPHYRLARSILTKVIVL  316

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE  922
              SV+DD+YDVYGT +EL LFT+AIQR+D    NE+P+Y+  IY  +L + +EMEE ++K+
Sbjct  317   ASVIDDIYDVYGTIEELLLFTDAIQRWDIDDKNEMPEYMSHIYGTLLAVYSEMEEELSKQ  376

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
                F V Y    MK+  + Y+ E   +   +VP  EEY+KV+LVSS YMM+ATT LVGMG
Sbjct  377   EASFRVDYAKQAMKELTKAYFDEANLYDKSNVPKVEEYMKVALVSSGYMMLATTSLVGMG  436

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
              + +++  +WV+  PL V+A+C+I RLMDDM+GHE EQERG VAS VECYMK +  +K+E
Sbjct  437   VLASEDAFEWVSGTPLIVRASCTIARLMDDMVGHESEQERGDVASIVECYMKEHGATKEE  496

Query  561   AYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
              YVE+   I+ AWKDINQECL P  VPM +L R+LN AR I+L+YKD D YT S+ + K 
Sbjct  497   TYVELNTRIADAWKDINQECLCPTAVPMVLLDRILNQARVIYLLYKDEDCYTNSKTRAKD  556

Query  381   LITTTLVQPVTI  346
             ++T+ L++ V I
Sbjct  557   IVTSLLIERVPI  568



>ref|XP_009793508.1| PREDICTED: germacrene C synthase-like isoform X1 [Nicotiana sylvestris]
Length=601

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/550 (52%), Positives = 385/550 (70%), Gaps = 4/550 (1%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++++SS R    +  T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+  P  S +
Sbjct  53    MDLSSSSRHLADFPSTIWGDHFLSYNSEITEITTQEKNEHEMLKEIVRKMLVETPDNSTQ  112

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + DDE+NLYV +LRFRL RQ+G++
Sbjct  113   KLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-EDDDEHNLYVAALRFRLARQQGYY  171

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  172   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEEILEEALIFTTTHLESVIP  231

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+ +PRVGA++Y+ IYE   THN +LL+FAKLDFN+LQK+H+
Sbjct  232   NLSNSLKVQVTEALSHPIRKAIPRVGARKYIHIYENIGTHNDLLLKFAKLDFNMLQKLHR  291

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY  SR + T+++ + S++D
Sbjct  292   KELNELTSWWKDLDRANKFPYAKDRLVEAYFWTVGIYFEPQYSRSRSLVTKVVKMNSIID  351

Query  1086  DLYDVYGTQDELQLFTNAIQ---RFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             D YD Y T DEL LFT+AIQ   R+D  A + +P YL+ IY  +LD+  EMEEV+AKE K
Sbjct  352   DTYDAYATFDELVLFTDAIQRLCRWDEDAMDLLPTYLRPIYQGLLDVFNEMEEVLAKEGK  411

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
               H+ Y   EMKK    Y++E  W    ++P  EEY+K  LVSS   M     LV M +I
Sbjct  412   ADHIYYAKKEMKKVAEVYFKEAEWLNANYIPKCEEYMKNGLVSSTGPMYGIISLVVMEEI  471

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             ITKE  +W+T+EPL ++A  +ICRLMDDM  HE EQ+RGHVAS VECYMK Y VSKQEAY
Sbjct  472   ITKEAFEWLTNEPLILRAASTICRLMDDMADHEVEQQRGHVASFVECYMKEYGVSKQEAY  531

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
             VE+ K I+ AWKDIN+E L P  VPM +L R LN +R      KD+D YT  + K K LI
Sbjct  532   VEMRKKITNAWKDINKELLRPTAVPMFILERSLNFSRLADTFLKDDDGYTNPKSKVKDLI  591

Query  375   TTTLVQPVTI  346
              +  V+ V I
Sbjct  592   ASLFVESVDI  601



>gb|AEM23825.1| sesquiterpene synthase [Solanum habrochaites]
Length=544

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/553 (51%), Positives = 386/553 (70%), Gaps = 13/553 (2%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +  +  R    +HPTVWG +FL+Y  ++T     E+ EV + KE +RK+L+ AP  S
Sbjct  1     MAASSANKSRPLANFHPTVWGYHFLSYTHEITN---QEKVEVDEYKETIRKMLVEAPEGS  57

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
              +KL L+D +QRLGV YHF NEI+ SIQ+IFD           NNL++VSL FRL+RQ+G
Sbjct  58    EQKLVLIDAMQRLGVAYHFHNEIETSIQNIFD------APKQNNNLHIVSLHFRLVRQQG  111

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H++S  VF++F ++DGKFK+ LT DV+G+LSLYEASYL V  E  L+EAL FT +HL+SI
Sbjct  112   HYMSSDVFKQFTNQDGKFKERLTNDVQGLLSLYEASYLRVRDEEILEEALAFTTTHLKSI  171

Query  1452  LPGLNELAA---AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             +  ++        +VS AL  PIR TLPR+ A+ Y+ IYE +  HN +LL+FAKLDFN+L
Sbjct  172   VSNMSNNNNSLKVEVSEALTQPIRMTLPRMEARRYISIYENNDAHNHLLLKFAKLDFNML  231

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QK+HQRELS +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ +
Sbjct  232   QKLHQRELSDLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLKM  291

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE  922
              S++DD +D Y T DEL+ F +AIQR+D +A + +  Y++  Y A LDI +EME+V++KE
Sbjct  292   TSIIDDTFDAYATFDELEPFNDAIQRWDANAIDSIQPYMRPAYQAFLDIYSEMEQVLSKE  351

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFYT-KHVPPFEEYLKVSLVSSCYMMIATTCLVGM  745
              KL  V Y   EMKK +R Y++E  W     H+P +EE+++ SLVS  YMMI TTCLVGM
Sbjct  352   GKLDRVYYAKNEMKKLVRAYFKETQWLNDCDHIPKYEEHMENSLVSGGYMMIPTTCLVGM  411

Query  744   GDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQ  565
              + I+ E  +W+ ++PL V+A+  I R M+D++GHE EQERGHVAS +ECYMK Y  SKQ
Sbjct  412   EEFISIETFEWLMNDPLIVRASSLIARAMNDIVGHEVEQERGHVASLIECYMKDYGASKQ  471

Query  564   EAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
             EAY + +K ++ AWKDIN+E   P  VPM VL RVLNL RA   +YK+ D YT ++ K K
Sbjct  472   EAYAKFKKDVTNAWKDINKEFFRPTEVPMFVLERVLNLTRAADTLYKEKDAYTNAKGKLK  531

Query  384   SLITTTLVQPVTI  346
             ++I + L++ V I
Sbjct  532   NMINSILIESVKI  544



>ref|XP_011095305.1| PREDICTED: LOW QUALITY PROTEIN: beta-caryophyllene synthase-like 
[Sesamum indicum]
Length=547

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/540 (52%), Positives = 380/540 (70%), Gaps = 10/540 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRSV YHP++WGD+FL Y S  TEI   EE+E+Q+ KE V++VL+  P  S  KLEL+D 
Sbjct  18    RRSVKYHPSIWGDHFLTYAS--TEICVDEEKELQRQKELVKRVLVRVPHHSSHKLELIDS  75

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI  S+Q++ D Y  C   D  N+L  V+LRFRLLRQ+G+ +SC VF 
Sbjct  76    IQRLGVSYHFEEEIGKSLQYMHDTYLECCNKD--NDLRTVALRFRLLRQQGYRVSCDVFN  133

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF+D  G FK+S+ +DVEGML LYEA++LGVH E  LD+AL F++SHLES+ P +    +
Sbjct  134   KFIDDQGNFKESIMEDVEGMLELYEAAHLGVHEEDILDKALHFSSSHLESLAPHMTSSHS  193

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             A V  ALK P+R+ L R+GA++++  Y++D++HN++LL FAK+DFN++QK+HQ+ELS +T
Sbjct  194   ALVDEALKFPVRKNLTRLGARKFISAYQEDESHNEILLNFAKMDFNIVQKIHQKELSDLT  253

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL     LPF R R+ ECYFW LGVYFEPQY  +R+I  ++I + S +DD+YDVYG
Sbjct  254   RWWKDLDFKNELPFVRDRMVECYFWALGVYFEPQYQVARKILAKVIVLASTVDDIYDVYG  313

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T  EL++FT+AIQR++  A  E  QY++  Y A+LD   EMEE+   E       Y   E
Sbjct  314   TLHELKIFTHAIQRWNIDALAEX-QYMRICYKALLDAYIEMEELEGIEMP-DKTKYAKQE  371

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             ++K I  Y++E  W Y  H+P  EEY+KV++VSS Y+M+A+T L+GMG+ +TKE  +WV+
Sbjct  372   IQKMIGAYFEEAKWLYNTHIPTLEEYMKVAIVSSGYIMVASTSLIGMGNSVTKEDFNWVS  431

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
              +P  V+A+  I RLMDDM GH  E +     SAV CYM     S++EA+ E +K +SKA
Sbjct  432   GKPRIVEASSIIARLMDDMAGHGLETK----ISAVGCYMNENGASREEAFEEFQKQVSKA  487

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P  V   +L+R+LNLAR I L+Y+D D YT +    K+LI + L+QPV I
Sbjct  488   WKDINEECLRPTAVSEPILVRILNLARVIHLLYRDGDGYTNTNTMIKNLIKSVLIQPVAI  547



>ref|XP_010092286.1| (-)-germacrene D synthase [Morus notabilis]
 gb|EXB50920.1| (-)-germacrene D synthase [Morus notabilis]
Length=562

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/546 (52%), Positives = 386/546 (71%), Gaps = 11/546 (2%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RRS  YHP++WGD FL+  S   EI      ++ +LKEEV+K++ A      +KL LVD
Sbjct  19    NRRSGNYHPSIWGDRFLSEKSAEGEI----TNKILKLKEEVKKMVAAPVEDPSKKLNLVD  74

Query  1788  KIQRLGVDYHFENEIQASIQHIFDN-YDNCIKGDD--ENNLYVVSLRFRLLRQEGHHISC  1618
              IQRLGV YHFE EI+  +  I+DN   NC +  +  +++L+ V+L FRLLRQ+G+ +SC
Sbjct  75    AIQRLGVSYHFEKEIETVLHQIYDNTLYNCPQNAETYDDDLHTVALCFRLLRQQGYPVSC  134

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              +F+ F   +GKFK++L  D+ GMLSLYEA+YL VHGE  LDEAL FT + L+S     +
Sbjct  135   DIFKNFKKTEGKFKETLASDIRGMLSLYEATYLRVHGEDILDEALVFTTTCLKSAASSRH  194

Query  1437  ---ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
                     +V+HALK PIR+ L R+ A+ YM +Y+QD +HNKVLL FAKLDFNLLQKVHQ
Sbjct  195   LSPSFLVEQVTHALKQPIRKGLTRLEARHYMSVYQQDPSHNKVLLNFAKLDFNLLQKVHQ  254

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
              ELS I RWWK+L   + LPFAR R+ ECYFWILGVYFEP+Y F+RR  T++I + SV+D
Sbjct  255   EELSHIARWWKELDFARKLPFARDRVIECYFWILGVYFEPEYGFARRALTKVIAMTSVID  314

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN-KLF  910
             D+YDVYGT +EL+LF+ A +R+D SA +++P+Y+K  Y A+L++  E+EE +A E+ KL+
Sbjct  315   DIYDVYGTLEELELFSEAAERWDVSAMDKLPEYMKVCYKALLNVYDEIEENLATEDGKLY  374

Query  909   HVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIIT  730
              + Y    MK+QIR Y QE  WF   + P  EEY+ ++ V+S Y M+ATT  VGMGDI+T
Sbjct  375   RLDYAKEAMKRQIRAYVQEAKWFNLNYTPTMEEYMPLARVTSAYAMLATTSFVGMGDIVT  434

Query  729   KEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVE  550
             K+  +W+ S P  V A+  +CRLMDD++ H FEQ+RGHVASAVECYMK ++ +++EA  +
Sbjct  435   KDSFEWLFSNPKLVSASEVVCRLMDDIVSHMFEQKRGHVASAVECYMKQHDATEEEAVKD  494

Query  549   IEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITT  370
             + K +  AWKDIN+ECL+P+ VPM +L+RV+NLAR I +I KD D YT S+V  K  I +
Sbjct  495   LRKQVINAWKDINEECLYPISVPMPLLMRVVNLARVIDVINKDEDGYTHSKVVLKDFIAS  554

Query  369   TLVQPV  352
              L+ PV
Sbjct  555   MLIDPV  560



>gb|AEM23826.1| sesquiterpene synthase [Solanum habrochaites]
Length=545

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 389/552 (70%), Gaps = 10/552 (2%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +     R    + PTVWG +FL+Y     EI   E+ EV +LKE  RK+L+     S
Sbjct  1     MAASSADKSRPLANFSPTVWGYHFLSY---TPEISSQEKHEVDELKEIFRKMLVETCDNS  57

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
              +KL L+D IQRLGV YHF+NEI+ SIQ+IFD      + D+++NL++VSLRFRL+RQ+G
Sbjct  58    TQKLVLIDTIQRLGVAYHFDNEIETSIQNIFDA---SKQNDNDDNLHIVSLRFRLVRQQG  114

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H++S  VF++F ++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI
Sbjct  115   HYMSSDVFKQFTNQDGKFKETLTNDVQGLLSLYEASHLRVRDEEILEEALTFTTTHLESI  174

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +  L+     +VS AL  PIR TLPR+GA++Y+ IYE +  HN +LL+FAKLDFN+LQK+
Sbjct  175   VSNLSNNNKVEVSEALTQPIRMTLPRMGARKYISIYENNDAHNHLLLKFAKLDFNMLQKL  234

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQRELS +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T++I + S 
Sbjct  235   HQRELSDLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVIQMASF  294

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
              DD +D Y T DEL+ F +AIQR+D +A + VP YL+  Y A+LDI +EME+ +AKE K 
Sbjct  295   FDDTFDAYATFDELEPFNDAIQRWDINAIDSVPPYLRHAYQALLDIYSEMEQELAKEFKS  354

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
               V Y   EMKK +R Y++E  W     H+P +EE+++ ++VS+ YMM ATTCLVG+ + 
Sbjct  355   DRVYYAKYEMKKLVRAYFKEAQWLNDDNHIPKYEEHMENAMVSAGYMMGATTCLVGVDEF  414

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             I++E  +W+ +EPL V+A+  I R MDD+ GHE EQ+R H AS +ECYMK Y VSKQEAY
Sbjct  415   ISQETFEWIINEPLIVRASSLIARAMDDIAGHEVEQQREHGASLIECYMKDYGVSKQEAY  474

Query  555   VEIEKLISKAWKDINQE--CLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
             V+ +K ++  W DIN+E  CL  + VP  VL RVLN  R I  +YK+ D YT S+ KFK+
Sbjct  475   VKFQKEVTNGWMDINKEFFCL-DVQVPKFVLERVLNFTRVINTLYKEKDEYTNSKGKFKN  533

Query  381   LITTTLVQPVTI  346
             +I T LV+ V I
Sbjct  534   MIITLLVESVEI  545



>ref|XP_010092292.1| (-)-germacrene D synthase [Morus notabilis]
 gb|EXB50926.1| (-)-germacrene D synthase [Morus notabilis]
Length=568

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/548 (51%), Positives = 384/548 (70%), Gaps = 9/548 (2%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEE--REVQQLKEEVRKVLIAAPPASLEKLEL  1795
              RRS  +HP++WGD FL+Y     E     E   ++ +LKEEV+K+++       +KL L
Sbjct  19    NRRSANFHPSIWGDRFLSYAPNSMEKSAEAEITNKILELKEEVKKMVVGPVEDPSKKLNL  78

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDN-YDNCIKGDD--ENNLYVVSLRFRLLRQEGHHI  1624
             +D IQRLGV YHFE EI+  +  I DN   NC +  +  +++L+ V+LRFRLLRQ+G+ +
Sbjct  79    IDTIQRLGVSYHFEKEIETVLHQIHDNTLYNCPQNAETYDDDLHTVALRFRLLRQQGYPV  138

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
             SC +F+ F + +GKFK++L  D+ G+LSLYEA++L VHGE  LDEAL FT   L+S    
Sbjct  139   SCDIFKNFKNTEGKFKEALASDIRGILSLYEATHLRVHGEDILDEALVFTTPCLKSAASS  198

Query  1443  LN---ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
              +        +V+HALK PIR+ L R+ A+ YM +Y+QD +HNKVLL FAKLDFNLLQKV
Sbjct  199   RHLSPSFLIEQVTHALKQPIRKGLTRLEARHYMSVYQQDPSHNKVLLNFAKLDFNLLQKV  258

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQ ELS I RWWK+L   + LPFAR R+ ECYFWILGVYFEP+Y F+RR  T++I + SV
Sbjct  259   HQEELSHIARWWKELDFARKLPFARDRVIECYFWILGVYFEPEYGFARRTLTKVIAMTSV  318

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN-K  916
             +DD+YDVYGT +EL+LFT A +R+D SA +++P+Y+K  Y A+LD+  E+EE +A E+ K
Sbjct  319   IDDIYDVYGTLEELELFTEAAERWDVSAMDKLPEYMKVCYKALLDVYDEIEENLATEDGK  378

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
             L+ +      MK+QIR Y+ E  WF   + P  EEY+ ++LV+S Y M+ATT  VGMGD 
Sbjct  379   LYRLGNAKEAMKRQIRAYFHEAKWFNLNYTPTMEEYMPLALVTSAYAMLATTSFVGMGDN  438

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             + K+  +W+ S P  V A+  +CRLMDD++ H+FEQ+RGHVASAVECYMK +  +++EA 
Sbjct  439   VAKDSFEWLFSNPKLVSASEIVCRLMDDIVSHKFEQKRGHVASAVECYMKQHEATEEEAV  498

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
              ++ K +  AWKDIN+ECL+P+ VPM +L+RV+NLAR I +IYKD D YT S V  K  I
Sbjct  499   KDLWKQVINAWKDINEECLYPISVPMPLLMRVVNLARVIDVIYKDEDGYTHSDVVLKDFI  558

Query  375   TTTLVQPV  352
              + L+ PV
Sbjct  559   ASMLIDPV  566



>ref|XP_010644711.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
Length=562

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/543 (50%), Positives = 384/543 (71%), Gaps = 5/543 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFL---AYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
             R S  YHP++WG++FL   ++D K+  ID   E++VQQLKEEVRK++I++     +K  L
Sbjct  22    RDSANYHPSIWGNHFLENASHDVKVHIIDGHTEQQVQQLKEEVRKMIISSTDNYSQKYNL  81

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D IQRLGV YHFE+EI+ +++H+ D Y    + DD ++L  V+LRFRLLRQ G++IS  
Sbjct  82    IDTIQRLGVSYHFESEIEEALKHLSDYYHVSCEEDD-DDLCTVALRFRLLRQHGYNISYD  140

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
              F+KF D  G FK+SL  DV+GMLSLYEA++L  HGE  LDEALTFT +HL+S +P  + 
Sbjct  141   AFKKFKDNKGNFKESLISDVKGMLSLYEATHLRKHGEDILDEALTFTTTHLQS-MPYFSS  199

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               A +V HAL+ P+ + + R+ A+ ++ IY++D  H++ LL+ AKLDFN LQKVHQ+ELS
Sbjct  200   PLAEQVVHALRQPLHKGIQRLEARHHISIYQEDDAHSEALLKLAKLDFNQLQKVHQQELS  259

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I  WWKDL   K LPFAR R+ ECYFW L VYFEPQY  +RRI T++I + S+LDD+YD
Sbjct  260   VIVSWWKDLDFAKKLPFARDRVVECYFWALTVYFEPQYFHARRILTKVIALTSILDDIYD  319

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             ++GT +EL++FT AI+R+D S   ++P Y+K  Y A+LD+  E+EEV  K  + +   Y 
Sbjct  320   LFGTLEELEIFTEAIERWDISFIGQLPDYMKVFYQALLDVYNEIEEVTVKAGRSYRAHYA  379

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MK Q+R Y+ E  W + + +P  EEY+ V+L +S Y ++ATT  +GM +++TK+  +
Sbjct  380   KEAMKNQVRAYFAEAKWLFLRQMPTIEEYMSVALPTSGYQLLATTSFIGMENMVTKDTFE  439

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             WV S+P  V+A+ +ICRLM+DM+ H+FEQ+RGHV SAVECYMK + VS+Q+   E+   +
Sbjct  440   WVFSDPKIVRASSTICRLMNDMVPHKFEQKRGHVPSAVECYMKQHGVSEQQTLDELHNQV  499

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
               AWKD+NQECL P  VPM +++RVLNLAR I ++YKD D YT S+   K LI + L+ P
Sbjct  500   RDAWKDMNQECLSPTAVPMPIIMRVLNLARFIDVVYKDEDGYTHSETVLKDLIASLLIHP  559

Query  354   VTI  346
             V I
Sbjct  560   VPI  562



>ref|XP_011095786.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=550

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/538 (51%), Positives = 387/538 (72%), Gaps = 8/538 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR++ YHP+VWG YFL Y S  TEI  +EE E+Q+ K  VR +L   P  SL+KLEL+D 
Sbjct  21    RRAIKYHPSVWGKYFLTYAS--TEISSAEEEELQRQKNMVRTMLAQTPDDSLQKLELIDV  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLG  YHFE EI  S+++I D Y      D  N+L   +LRFRLLRQ+G+ +SC VF+
Sbjct  79    VQRLGSGYHFEEEIDKSLRYIHDTYLEYTSKD--NDLRTTALRFRLLRQQGYPLSCDVFD  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KFLD +G F++SL ++VEG+L LYEA++ GVHGE  LD+A+ F++S L+ +LP +N   +
Sbjct  137   KFLDGEGNFEESLVENVEGLLELYEAAHFGVHGEEILDKAMEFSSSKLKYLLPNMNCSLS  196

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V  AL+  IR++L R+G K+++ +Y+ D++ N++LL FAKLD+N++QK+HQ+ELS IT
Sbjct  197   TRVKAALETSIRKSLSRLGPKKFIPMYQHDKSCNEILLNFAKLDYNIVQKLHQKELSEIT  256

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWW+ L     L FAR R+AECYFWI+ VYFEP+YH +R + T+I+ + S+LDD+YDVYG
Sbjct  257   RWWRALDFANKLSFARDRVAECYFWIVEVYFEPRYHKARIMLTKILNMTSILDDIYDVYG  316

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T D+LQ+FT+ +QR+D +A  +VP YLK  Y A+ D+  EME  + +  +L+ V Y   E
Sbjct  317   TLDDLQVFTDLVQRWDANALEQVPAYLKICYEALSDVYIEMENEVKEIGELYRVQYAKEE  376

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK +R Y +E  W Y+K  P  EEY+KV++V++ YMM++TT LVGMG+++TK+  DWVT
Sbjct  377   MKKLVRAYLEETKWSYSKDTPTMEEYMKVAIVTATYMMLSTTSLVGMGNLVTKKDFDWVT  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             SEPL V A+ ++CRL +D++G+ FEQ+R    +AV CYM  Y VSK+EA VEI KL  KA
Sbjct  437   SEPLLVIASSAVCRLTNDVVGYGFEQKR----AAVHCYMNQYGVSKEEAVVEIRKLTKKA  492

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             WKD+NQECL P PV + VL RV+NLAR + L Y   D Y+ S++  K +I   LV+P+
Sbjct  493   WKDMNQECLQPTPVSVPVLTRVVNLARIVHLFYDYADEYSNSKINIKDVIYDVLVEPL  550



>ref|NP_001234481.1| sesquiterpene synthase 1 [Solanum lycopersicum]
 ref|NP_001234055.1| epidermal germacrene C synthase [Solanum lycopersicum]
 sp|O64961.1|TPSGC_SOLLC RecName: Full=Germacrene C synthase; AltName: Full=Sesquiterpene 
synthase 1 [Solanum lycopersicum]
 gb|AAG41889.1|AF279453_1 sesquiterpene synthase 1 [Solanum lycopersicum]
 gb|AAC39431.1| epidermal germacrene C synthase [Solanum lycopersicum]
 gb|AEM05858.1| germacrene synthase [Solanum lycopersicum]
Length=548

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/544 (51%), Positives = 388/544 (71%), Gaps = 9/544 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP+VWG +FL+Y  ++T     E+ EV + KE +RK+L+     S +KL L+D 
Sbjct  10    RPLANFHPSVWGYHFLSYTHEITN---QEKVEVDEYKETIRKMLVETCDNSTQKLVLIDA  66

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF+NEI+ SIQ+IFD   +  + D++NNLYVVSLRFRL+RQ+GH++S  VF+
Sbjct  67    MQRLGVAYHFDNEIETSIQNIFDA--SSKQNDNDNNLYVVSLRFRLVRQQGHYMSSDVFK  124

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             +F ++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI+  L+    
Sbjct  125   QFTNQDGKFKETLTNDVQGLLSLYEASHLRVRNEEILEEALTFTTTHLESIVSNLSNNNN  184

Query  1425  ---AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 +V  AL  PIR TLPR+GA++Y+ IYE +  H+ +LL+FAKLDFN+LQK HQRELS
Sbjct  185   SLKVEVGEALTQPIRMTLPRMGARKYISIYENNDAHHHLLLKFAKLDFNMLQKFHQRELS  244

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ + S++DD +D
Sbjct  245   DLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLNLTSIIDDTFD  304

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
              Y T DEL  F +AIQR+D +A + +  Y++  Y A+LDI +EME+V++KE KL  V Y 
Sbjct  305   AYATFDELVTFNDAIQRWDANAIDSIQPYMRPAYQALLDIYSEMEQVLSKEGKLDRVYYA  364

Query  894   IGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
               EMKK +R Y++E  W     H+P +EE ++ ++VS+ YMMI+TTCLVG+ + I+ E  
Sbjct  365   KNEMKKLVRAYFKETQWLNDCDHIPKYEEQVENAIVSAGYMMISTTCLVGIEEFISHETF  424

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ +E + V+A+  I R M+D++GHE EQERGHVAS +ECYMK Y  SKQE Y++  K 
Sbjct  425   EWLMNESVIVRASALIARAMNDIVGHEDEQERGHVASLIECYMKDYGASKQETYIKFLKE  484

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             ++ AWKDIN++   P  VPM VL RVLNL R    +YK+ D YT ++ K K++I + L++
Sbjct  485   VTNAWKDINKQFFRPTEVPMFVLERVLNLTRVADTLYKEKDTYTNAKGKLKNMINSILIE  544

Query  357   PVTI  346
              V I
Sbjct  545   SVKI  548



>gb|AAG41890.1|AF279454_1 sesquiterpene synthase 2, partial [Solanum lycopersicum]
Length=552

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/544 (51%), Positives = 388/544 (71%), Gaps = 9/544 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP+VWG +FL+Y  ++T     E+ EV + KE +RK+L+     S +KL L+D 
Sbjct  14    RPLANFHPSVWGYHFLSYTHEITN---QEKVEVDEYKETIRKMLVETCDNSTQKLVLIDA  70

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF+NEI+ SIQ+IFD   +  + D++NNLYVVSLRFRL+RQ+GH++S  VF+
Sbjct  71    MQRLGVAYHFDNEIETSIQNIFDA--SSKQNDNDNNLYVVSLRFRLVRQQGHYMSSDVFK  128

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             +F ++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI+  L+    
Sbjct  129   QFTNQDGKFKETLTNDVQGLLSLYEASHLRVRNEEILEEALTFTTTHLESIVSNLSNNNN  188

Query  1425  ---AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 +V  AL  PIR TLPR+GA++Y+ IYE +  H+ +LL+FAKLDFN+LQK HQRELS
Sbjct  189   SLKVEVGEALTQPIRMTLPRMGARKYISIYENNDAHHHLLLKFAKLDFNMLQKFHQRELS  248

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ + S++DD +D
Sbjct  249   DLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLNLTSIIDDTFD  308

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
              Y T DEL  F +AIQR+D +A + +  Y++  Y A+LDI +EME+V++KE KL  V Y 
Sbjct  309   AYATFDELVTFNDAIQRWDANAIDSIQPYMRPAYQALLDIYSEMEQVLSKEGKLDRVYYA  368

Query  894   IGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
               EMKK +R Y++E  W     H+P +EE ++ ++VS+ YMMI+TTCLVG+ + I+ E  
Sbjct  369   KNEMKKLVRAYFKETQWLNDCDHIPKYEEQVENAIVSAGYMMISTTCLVGIEEFISHETF  428

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ +E + V+A+  I R M+D++GHE EQERGHVAS +ECYMK Y  SKQE Y++  K 
Sbjct  429   EWLMNESVIVRASALIARAMNDIVGHEDEQERGHVASLIECYMKDYGASKQETYIKFLKE  488

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             ++ AWKDIN++   P  VPM VL RVLNL R    +YK+ D YT ++ K K++I + L++
Sbjct  489   VTNAWKDINKQFFRPTEVPMFVLERVLNLTRVADTLYKEKDTYTNAKGKLKNMINSILIE  548

Query  357   PVTI  346
              V I
Sbjct  549   SVKI  552



>ref|NP_001234060.1| germacrene C synthase [Solanum lycopersicum]
 gb|AAC39432.1| germacrene C synthase [Solanum lycopersicum]
Length=548

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/544 (51%), Positives = 387/544 (71%), Gaps = 9/544 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP+VWG +FL+Y  ++T     E+ EV + KE +RK+L+     S +KL L+D 
Sbjct  10    RPLANFHPSVWGYHFLSYTHEITN---QEKVEVDEYKETIRKMLVETCDNSTQKLVLIDA  66

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF+NEI+ SIQ+IFD   +  + D++NNLYVVSLRFRL+RQ+GH++S  VF+
Sbjct  67    MQRLGVAYHFDNEIETSIQNIFDA--SSKQNDNDNNLYVVSLRFRLVRQQGHYMSSDVFK  124

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             +F ++DGKFK++LT DV+G+LSLYEAS+L V  E  L+EALTFT +HLESI+  L+    
Sbjct  125   QFTNQDGKFKETLTNDVQGLLSLYEASHLRVRNEEILEEALTFTTTHLESIVSNLSNNNN  184

Query  1425  ---AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 +V  AL  PIR TLPR+GA++Y+ IYE +  H+ +LL+FAKLDFN+LQK HQRELS
Sbjct  185   SLKVEVGEALTQPIRMTLPRMGARKYISIYENNDAHHHLLLKFAKLDFNMLQKFHQRELS  244

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              +TRWWKDL      P+AR RL ECYFWILGVYFEP+Y  +R++ T+++ + S++DD +D
Sbjct  245   DLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLNLTSIIDDTFD  304

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
              Y T DEL  F +AIQR+D +A + +  Y++  Y A+LDI +EME+V++KE KL  V Y 
Sbjct  305   AYATFDELVTFNDAIQRWDANAIDSIQPYMRPAYQALLDIYSEMEQVLSKEGKLDRVYYA  364

Query  894   IGEMKKQIRTYYQEFMWFY-TKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
               EMKK +R Y++E  W     H+P +EE ++ ++VS+ YMMI+TTCLVG+ + I+ E  
Sbjct  365   KNEMKKLVRAYFKETQWLNDCDHIPKYEEQVENAIVSAGYMMISTTCLVGIEEFISHETF  424

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ +E + V+A+  I R M+D++GHE EQERGHVAS +ECYMK Y  SKQE Y++  K 
Sbjct  425   EWLMNESVIVRASALIARAMNDIVGHEDEQERGHVASLIECYMKDYGASKQETYIKFLKE  484

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             ++ AWKDIN++   P  VPM VL RVLNL R    +YK+ D Y+ ++ K K++I   L++
Sbjct  485   VTNAWKDINKQFSRPTEVPMFVLERVLNLTRVADTLYKEKDTYSTAKGKLKNMINPILIE  544

Query  357   PVTI  346
              V I
Sbjct  545   SVKI  548



>emb|CDP18846.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/578 (50%), Positives = 397/578 (69%), Gaps = 31/578 (5%)
 Frame = -2

Query  1995  EMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLK-EEVRKVLIAAPP  1819
             E+ +     GRR+   HP+VWG+YFLAY S +   + SEE    Q   +EVRK+L   P 
Sbjct  2     EVSLQAQPVGRRTANCHPSVWGEYFLAYASDIKADNFSEEEGELQQLEDEVRKMLTETPD  61

Query  1818  ASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQ  1639
              S  KL+L+D I+RLGV YHFE+EI+ S+Q+I++  D  +   D N+L+ ++LRFRLLRQ
Sbjct  62    ESPRKLDLIDTIRRLGVSYHFESEIEESLQNIYNAGDE-MNNKDANDLHTIALRFRLLRQ  120

Query  1638  EGHHISCG----------------------------VFEKFLDKDGKFKDSLTKDVEGML  1543
             +G + S G                            VF+ F + +G FK+SL  +V+GML
Sbjct  121   QGFYASSGKREFSVICPNIFNAFLFICLCLSLYFSDVFDNFKNPEGDFKESLASNVQGML  180

Query  1542  SLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAK  1363
             SLYEA+  GVHGE  L+EAL F+ S+LES++P L+   AA+V  ALK+PI+++L R+ A+
Sbjct  181   SLYEAANFGVHGENVLEEALKFSMSNLESMIPNLSNFLAAQVVQALKVPIQKSLTRIAAR  240

Query  1362  EYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAE  1183
             +Y+  Y+QD++H+K+LL+FAKLDFN+LQK+HQ+EL  +T WWK+L      PFAR RL E
Sbjct  241   QYISFYQQDESHDKLLLKFAKLDFNILQKLHQKELGCLTAWWKNLDFATNTPFARDRLVE  300

Query  1182  CYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASN  1003
             CY+WILGVYFEP+Y  +R I T++I I S++DD+YDVYGT DEL +FT+AI+R++    +
Sbjct  301   CYYWILGVYFEPKYCLARTILTKVISITSIIDDIYDVYGTIDELTIFTDAIERWNIHELD  360

Query  1002  EVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT-IGEMKKQIRTYYQEFMWFYTKHV  826
             ++P Y++  Y A+LD  T+ EE + +E K   ++Y  +  MKK ++ Y++E  WF+  +V
Sbjct  361   QLPSYMRHCYRALLDTYTDYEEELGREAKSERLTYAKLEAMKKLVKAYFEEAKWFHNGYV  420

Query  825   PPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMI  646
             P  EEY+KV+LV+  YMM+ATT +VGMGD +T +  DW+T+EPL V+A   ICRLMDDM 
Sbjct  421   PRVEEYMKVALVTGAYMMLATTSMVGMGDSVTTQAFDWITNEPLIVRAASVICRLMDDMA  480

Query  645   GHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLL  466
             GHEFEQERGHVASAVECY+  + V+KQEA+ E+ +  +KAWKDIN ECL+   VPM+ L 
Sbjct  481   GHEFEQERGHVASAVECYVNEHGVTKQEAFDELNRQTAKAWKDINGECLNSNAVPMEALQ  540

Query  465   RVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             RVLNLA+ I LIYKD D YT S    K  I+  LV PV
Sbjct  541   RVLNLAKVICLIYKDEDGYTHSATVLKDYISLMLVDPV  578



>ref|XP_002282488.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CBI20289.3| unnamed protein product [Vitis vinifera]
 gb|ADR74225.1| selina-411-diene/intermedeol synthase [synthetic construct]
Length=561

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/543 (50%), Positives = 373/543 (69%), Gaps = 5/543 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
              R   TYHP  WGD FL Y  D         +E+++Q+LKEEVRK L A    + + L+L
Sbjct  22    ARHEATYHPNFWGDRFLHYNPDDDFCGTHACKEQQIQELKEEVRKSLEATAGNTSQLLKL  81

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D IQRLG+ YHFE EI+ +++ ++  Y      DD ++L  VSL FRLLRQEG+HI   
Sbjct  82    IDSIQRLGLAYHFEREIEEALKAMYQTYTLV---DDNDHLTTVSLLFRLLRQEGYHIPSD  138

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF+KF+D+ G FK+SL  D+ GML+LYEA++L VHGE  LDEAL FT +HL+S+    + 
Sbjct  139   VFKKFMDEGGNFKESLVGDLPGMLALYEAAHLMVHGEDILDEALGFTTAHLQSMAIDSDN  198

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 +V  ALK PIR+ LPRV A+ Y+ IY++D +HN+ LL+ AKLD+N+LQ +H++ELS
Sbjct  199   PLTKQVIRALKRPIRKGLPRVEARHYITIYQEDDSHNESLLKLAKLDYNMLQSLHRKELS  258

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              IT+WWK L     LPFAR R+ E YFWILGVYFEPQY+ +RRI  ++  + S++DD+YD
Sbjct  259   EITKWWKGLDFATKLPFARDRIVEGYFWILGVYFEPQYYLARRILMKVFGVLSIVDDIYD  318

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
              YGT +EL+LFT AI+R+D S+ +++P Y+K  Y A+LD+  EMEE M K+ KL+ V Y 
Sbjct  319   AYGTFEELKLFTEAIERWDASSIDQLPDYMKVCYQALLDVYEEMEEEMTKQGKLYRVHYA  378

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                +K+Q++ Y  E  W   +++P  +EY+  +LVSS   M+ TT  VGMGDI+TKE  D
Sbjct  379   QAALKRQVQAYLLEAKWLKQEYIPRMDEYMSNALVSSACSMLTTTSFVGMGDIVTKEAFD  438

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             WV S+P  ++A+  ICRLMDD++ HEFEQ+RGHVASAVECYMK Y VSK+EAY E +K +
Sbjct  439   WVFSDPKMIRASNVICRLMDDIVSHEFEQKRGHVASAVECYMKQYGVSKEEAYDEFKKQV  498

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
               AWKD N+E L P  VP+ +L RVLN +R + ++YKD D YT      K L+   L+ P
Sbjct  499   ESAWKDNNEEFLQPTAVPVPLLTRVLNFSRMMDVLYKDEDEYTLVGPLMKDLVAGMLIDP  558

Query  354   VTI  346
             V +
Sbjct  559   VPM  561



>ref|XP_009609204.1| PREDICTED: LOW QUALITY PROTEIN: germacrene C synthase-like [Nicotiana 
tomentosiformis]
Length=632

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 388/555 (70%), Gaps = 3/555 (1%)
 Frame = -2

Query  2004  EITEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAA  1825
             +I  MD +  S  R    +  TVWG +FL+Y  +LTEI   E+ E+ +LKE+VRK+L+  
Sbjct  79    KILAMDASF-SDHRHVANFESTVWGYHFLSYTYQLTEIRTQEKLELDELKEKVRKMLVET  137

Query  1824  PPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLL  1645
                S +KL L+D IQRLGV YHF NEI+ SIQ+IFD      + + ++NLYVV+LRFRL+
Sbjct  138   RDNSTQKLVLIDTIQRLGVAYHFHNEIETSIQNIFDASQLQTENNIDDNLYVVALRFRLV  197

Query  1644  RQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASH  1465
             RQ+GH++S  VF++F + DG FK++L+ DV+G+LSLYE S++ VH E  L+EALTFT  H
Sbjct  198   RQQGHYMSSDVFKQFTNHDGGFKEALSNDVQGLLSLYETSHMRVHAEEILEEALTFTTIH  257

Query  1464  LESILPGLNELAA--AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDF  1291
             LES+   LN + +  A+V+ AL  PIR+T+PR GA++ + IYE    HN++LL+FAKLDF
Sbjct  258   LESMDTNLNNVNSLKAQVTEALSQPIRKTVPRFGARKNISIYEDIDAHNELLLKFAKLDF  317

Query  1290  NLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             N+LQK+HQREL+ +TRWWKDL      P+AR RL ECY WILG+Y+EPQY  +R++ T+I
Sbjct  318   NVLQKLHQRELNELTRWWKDLDFVNKYPYARDRLVECYXWILGLYYEPQYSRARKMITKI  377

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
             I I S+LDD +D Y T DEL  FT+AIQR+D SA + +  YL+  Y A+LD+ +EMEEV+
Sbjct  378   IKIDSILDDTFDAYATLDELVPFTDAIQRWDISAIDSLQPYLRPAYQALLDVYSEMEEVL  437

Query  930   AKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLV  751
             AKE K   V Y   EMKK +R + +E  W    + P  EEY K +LVS  YMM+ATT LV
Sbjct  438   AKECKSDRVYYAKYEMKKLVRAFLKEAQWLDAGYTPTCEEYTKNALVSCGYMMLATTSLV  497

Query  750   GMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVS  571
             GM + I++E  +W+ ++P  V A  +I R MDD++GH+ EQ+RGHVAS +ECYMK Y  S
Sbjct  498   GMEEFISRETFEWIINKPSIVLAASTISRAMDDIVGHDVEQQRGHVASIIECYMKEYGAS  557

Query  570   KQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVK  391
             K+EAYV+++K I  AWK IN+E   P  VPM VL RV+N AR +  +YK+ D YT S+  
Sbjct  558   KEEAYVKLQKEIKNAWKVINKELFLPTEVPMFVLERVINCARVMXTLYKEGDGYTNSKGN  617

Query  390   FKSLITTTLVQPVTI  346
              K++I   LV+P+ I
Sbjct  618   VKNMINLLLVEPIKI  632



>emb|CDP18843.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/577 (50%), Positives = 391/577 (68%), Gaps = 28/577 (5%)
 Frame = -2

Query  1995  EMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLK-EEVRKVLIAAPP  1819
             E+ +     GRR+   HP+VWG+YFLAY S +   + SEE    Q   +EVRK+L   P 
Sbjct  2     EVSLQAQPVGRRTANCHPSVWGEYFLAYASDIKADNFSEEEGELQQLEDEVRKMLTETPD  61

Query  1818  ASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQ  1639
              S  KL+L+D I+RLGV YHFE+EI+ S+Q+I++  D  +   D N+L+ ++LRFRLLRQ
Sbjct  62    ESPRKLDLIDTIRRLGVSYHFESEIEESLQNIYNAGDE-MNNKDANDLHTIALRFRLLRQ  120

Query  1638  EGHHISCG-------------------VFEKFLDKDGKFKDS-----LTK-DVEGMLSLY  1534
             +G + S G                   ++ K   +   F +      LTK   E MLSLY
Sbjct  121   QGFYASSGKNFYGLRSCLPRKFNSNSIMYYKKKKRACNFYEKQNWERLTKTQKERMLSLY  180

Query  1533  EASYLGVHGETTLDEALTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYM  1354
             EA+  GVHGE  L+EAL F+ S+LES++P L+   AA+V  ALK+PI+++L R+ A++Y+
Sbjct  181   EAANFGVHGENVLEEALKFSMSNLESMIPNLSNFLAAQVVQALKVPIQKSLTRIAARQYI  240

Query  1353  QIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYF  1174
               Y+QD++H+K+LL+FAKLDFN+LQK+HQ+EL  +T WWK+L      PFAR RL ECY+
Sbjct  241   SFYQQDESHDKLLLKFAKLDFNILQKLHQKELGCLTAWWKNLDFATNTPFARDRLVECYY  300

Query  1173  WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVP  994
             WILGVYFEP+Y  +R I T++I I  ++DD+YDVYGT DEL +FT+AI+R++    +++P
Sbjct  301   WILGVYFEPKYCLARTILTKVISITPIIDDIYDVYGTIDELTIFTDAIERWNIHELDQLP  360

Query  993   QYLKKIYLAILDITTEMEEVMAKENKLFHVSYT-IGEMKKQIRTYYQEFMWFYTKHVPPF  817
              Y++  Y A+LD  T+ EE + KE K   ++Y  +  MKK ++ Y++E  WF+  +VP  
Sbjct  361   SYMRHCYRALLDTYTDYEEELGKEAKSERLTYAKLEAMKKLVKAYFEEAKWFHNGYVPRV  420

Query  816   EEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHE  637
             EEY+KV+LV+  YMM+ATT +VGMGD +T +  DWVT+EPL V+A   ICRLMDDM GHE
Sbjct  421   EEYMKVALVTGAYMMLATTSMVGMGDSVTTQAFDWVTNEPLIVRAASVICRLMDDMTGHE  480

Query  636   FEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVL  457
             FEQERGHVASAVECY+  Y V+KQEA+ E+ +  +KAWKDIN ECL+   VPMK L RVL
Sbjct  481   FEQERGHVASAVECYVNEYGVTKQEAFDELNRQTAKAWKDINGECLNSNAVPMKALQRVL  540

Query  456   NLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             NLA+ I LIYKD D YT S    K  I+  LV PV +
Sbjct  541   NLAKVICLIYKDEDGYTHSATVLKDYISLMLVDPVNL  577



>ref|XP_006365934.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=550

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/553 (52%), Positives = 382/553 (69%), Gaps = 7/553 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             M  +  +  R    +H TVWG +FL+Y     EI   E+ E+ +L+E  RK+L+     S
Sbjct  1     MTTSSPNKSRPLANFHSTVWGYHFLSYTP---EISIQEKVEIDELEEIFRKMLVETCDNS  57

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQE  1636
              +KL L+D IQ+LGV YHF NEI+ SIQ+IFD   + +  ++ + NLYVVSLRFRLLRQ+
Sbjct  58    TQKLVLIDTIQQLGVAYHFHNEIKTSIQNIFDTTISQLHSENIDGNLYVVSLRFRLLRQQ  117

Query  1635  GHHISCG-VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLE  1459
             GHHIS   VF++F+D+DGKFK++LT DV+G+LSLYEAS+L +  E  L+EALTF  +HLE
Sbjct  118   GHHISSADVFKQFMDQDGKFKETLTNDVQGLLSLYEASHLRMRDEEILEEALTFATNHLE  177

Query  1458  SILPGL-NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             SI+  L N     +V+ ALK PIR+TLPRVGA++Y+  YE +  HN +LL+FAKLDFN L
Sbjct  178   SIVSNLSNNSLKVEVTEALKQPIRKTLPRVGARKYISTYEHNDAHNHLLLKFAKLDFNAL  237

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QK+HQ ELS +TRWWKDL      P AR RL ECYFWILGVYFEP+Y  +R++  ++I +
Sbjct  238   QKLHQSELSELTRWWKDLDFANKYPHARDRLVECYFWILGVYFEPKYSRARKMMAKVIKM  297

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE  922
              S++DD YD Y T DEL  FT+AIQR+D S  + +P Y++  Y A++D+  EME+++AKE
Sbjct  298   TSIIDDTYDAYATFDELVPFTDAIQRWDISVIDSLPPYMRPAYQALIDVYNEMEQLLAKE  357

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
              K   V Y   EMKK +R Y++E  W   +++P  EE++K +LVS  YMM ATT L+GM 
Sbjct  358   GKSDRVYYAKYEMKKLVRAYFKEAQWLDARYIPKCEEHMKNALVSCGYMMAATTSLIGMD  417

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
             + I+ E  +W+ +EPL V+A   I R MDD+IGHE EQ RGHVAS++ECYM  Y  SKQE
Sbjct  418   EFISIETFEWIINEPLIVRAASIINRGMDDIIGHEDEQLRGHVASSIECYMAEYGASKQE  477

Query  561   AYVEIEKLISKAWKDINQECL-HPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
             AY +  K +   WKDIN+E L  P  VP+ VL RVLN AR +  +YK+ D YT S+ K K
Sbjct  478   AYTKYHKEVVNGWKDINKELLFRPTEVPIFVLERVLNFARVMDTLYKEEDGYTNSKGKLK  537

Query  384   SLITTTLVQPVTI  346
             ++I   LV+PV I
Sbjct  538   NIINLLLVEPVKI  550



>ref|XP_006472987.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=620

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/539 (52%), Positives = 375/539 (70%), Gaps = 6/539 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIA-APPASLEKLELVD  1789
             RRS  +HP++WGD FL+Y S   E D    +  Q+LKEE+R++L A     +   L+L+D
Sbjct  83    RRSANFHPSIWGDRFLSYTSDSMEKDDGSAKH-QELKEEIRRMLKAYINKPTQNNLDLID  141

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCGV  1612
              IQRLGV YHFE+EI   +  + + + +C  GD+EN+ LY +SL+FRLLRQ G  IS  V
Sbjct  142   AIQRLGVSYHFESEIDEILGKLHEAHQDCGLGDNENDELYYISLQFRLLRQHGCKISADV  201

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLNE  1435
             F++F D DG FK SL KDV GMLSLYEA++LGVH E  LDEAL FT SHLESI    +  
Sbjct  202   FKRFKDSDGNFKTSLAKDVGGMLSLYEATHLGVHEENILDEALAFTTSHLESIAAHQIGS  261

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               A +V HAL  PI R L R+ A+ Y+ IY++  +HN+ LL FAKLDFN LQK+HQ+EL 
Sbjct  262   PLAERVKHALIQPIHRGLQRLEARHYIPIYQEQSSHNEALLTFAKLDFNKLQKLHQKELG  321

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I+RWWK+L     LPF R R+AECYFWILGVYFEPQY F+RRI T++I + S++DD+YD
Sbjct  322   DISRWWKELDFAHKLPFIRDRIAECYFWILGVYFEPQYSFARRILTKVISMTSIIDDIYD  381

Query  1074  VYGTQDELQLFTNAI--QRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             VYG  +EL+LFT+ I  +R+D SA +++P+Y+K  Y A+LD+ +E E+ +A + KL+ + 
Sbjct  382   VYGKIEELELFTSTIFFRRWDISAIDQLPEYMKLCYRALLDVYSEAEKDLAPQGKLYRLH  441

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK  ++  + E  W +  ++P  +EY+ V+LV+S Y M++TT  VGMGDI+TKE 
Sbjct  442   YAKKAMKNIVKNCFFEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKES  501

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +W+ S P  ++A+  +CRLMDDM  HEFEQ RGHVAS+VECYMK +  +++EA  E  K
Sbjct  502   FEWLFSNPRFIRASSVVCRLMDDMASHEFEQSRGHVASSVECYMKQHGATEEEACNEFRK  561

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
              +S AWKDIN++CL P  VPM +L+R+LNL R I +IYK  D YT S V  KSLI +  
Sbjct  562   QVSNAWKDINEDCLRPTVVPMPLLMRILNLTRVIDVIYKYEDGYTHSAVVLKSLIISNF  620



>ref|XP_006365530.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=587

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/550 (50%), Positives = 380/550 (69%), Gaps = 6/550 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             MD N   S R    +H  VWG  FL+Y S+LTEI   E+ EV + KE+V  +L+     S
Sbjct  43    MDAN---SSRHLANFHSNVWGYNFLSYTSQLTEITTQEKLEVDEYKEKVMNMLMEIHDNS  99

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
              +KL L+D IQRLGV YHF NEI+ SIQ+IFD      + +D  NL+VVSLR RL+RQ+G
Sbjct  100   TQKLVLIDTIQRLGVSYHFHNEIETSIQNIFDASSQHSENND--NLHVVSLRIRLVRQQG  157

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             H+IS  VF++F+++DGKFK +L  DV+ +LSLYEA+ + VHGE  L+EALTFT +HLES+
Sbjct  158   HYISSDVFKQFVERDGKFKKTLNNDVQALLSLYEAAQMRVHGEDILEEALTFTTTHLESM  217

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +P LN    A++  AL  PI + +PR+GA++Y+ IYE  ++HN +LL+F+KLDFN+LQK 
Sbjct  218   IPMLNNPLKAQIIEALSHPIHKVIPRLGARKYIDIYENMESHNHLLLKFSKLDFNMLQKQ  277

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQRELS +T WWKDL +   +P+AR +L E Y W LG+YFEP+Y  +RR+  ++  + S+
Sbjct  278   HQRELSELTSWWKDLDLASKVPYARDKLVEGYTWTLGLYFEPKYSRARRMLVKVFKMLSI  337

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
              DD YD Y T DEL LFTNAIQR+D +A + +P Y++  Y AILDI  EMEE + KE K 
Sbjct  338   CDDTYDAYATFDELVLFTNAIQRWDINAMDSLPPYMRPFYQAILDIFDEMEEELTKEGKS  397

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
               V Y   EMKK  R Y++E  W    ++P  ++Y+K ++VS+ +M++ TT L+GM + I
Sbjct  398   DRVYYGKFEMKKLARAYFKEAEWLNAGYIPNCDQYIKNAIVSTTFMVLGTTSLIGMEEFI  457

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             TK+  +W+T+EP  ++A+ +ICRLMDD+  HE +Q+RGHVAS +ECYM  Y  SKQEAYV
Sbjct  458   TKDTFEWITNEPSILRASSTICRLMDDISDHETDQQRGHVASVIECYMNEYGASKQEAYV  517

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKSLI  376
             +  K +  AWKDIN+  L P+ VP+ VL R+LNLAR +   ++D  D YT S  K K +I
Sbjct  518   KFRKEVKNAWKDINKALLRPIEVPIFVLERILNLARTMDTFFQDEEDGYTNSNSKCKDII  577

Query  375   TTTLVQPVTI  346
             T  LV  VTI
Sbjct  578   TLLLVDSVTI  587



>ref|XP_006475286.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Citrus 
sinensis]
Length=562

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/544 (51%), Positives = 372/544 (68%), Gaps = 3/544 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S RRS  YHP++WGD+FL Y     E D     +  +LK+E+R++L A    S   L+L+
Sbjct  20    STRRSANYHPSIWGDHFLQYTCDTQETDDGSNVKHLELKKEIRRMLKADNKPS-RTLQLI  78

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  +     +    D+EN+ LY +SL FRLLRQ G+ IS  
Sbjct  79    DAIQRLGVSYHFESEIDEILGKMHKASQDSDLCDNENDELYYISLHFRLLRQNGYKISAD  138

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLN  1438
             VF+KF D DG FK SL KDV GMLSLYEA++LGVH E  LDEAL FT SHLESI    + 
Sbjct  139   VFKKFKDTDGNFKTSLAKDVRGMLSLYEATHLGVHEEDILDEALAFTTSHLESIATHQIR  198

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                  +V HAL  PI R L R+ A++Y+ IY+++  HN+ LL FAKLDFN LQK+HQ+EL
Sbjct  199   SPLVEQVKHALVQPIHRGLQRLEARQYIPIYQEESPHNEALLTFAKLDFNKLQKLHQKEL  258

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
               I+RWWK+L     LPF R R+AECYFWILGVYFEPQY F+RRI T++I + SV+DD+Y
Sbjct  259   GDISRWWKELDFAHKLPFIRDRVAECYFWILGVYFEPQYSFARRILTKVISMTSVIDDIY  318

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DVYG  +EL+LFT+AI+R+D SA +++P+Y+K  Y A+LD+ +E E+ +A + K + + Y
Sbjct  319   DVYGKIEELELFTSAIERWDISAIDQLPEYMKLCYRALLDVFSEAEKDLAPQGKSYRLYY  378

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MK  ++ Y+ E  W    +VP  +EY+ V+LV+S   M++TT  VGMGDI+TKE  
Sbjct  379   AKEAMKNMVKNYFYEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESF  438

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ S P  ++A+  +CRLMDD++ H+FEQ RGHVAS+VECYMK +  +++EA  E  K 
Sbjct  439   EWLFSNPRFIRASSIVCRLMDDIVSHKFEQSRGHVASSVECYMKQHGATEEEACNEFRKQ  498

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             +S AWKDIN++CL P  VPM +L+R+LNL R I +IYK  D YT S V  K  + +  + 
Sbjct  499   VSNAWKDINEDCLRPTVVPMPLLMRILNLTRVIDVIYKYEDGYTHSAVVLKDFVASLFIN  558

Query  357   PVTI  346
             PV I
Sbjct  559   PVPI  562



>gb|AEM23828.1| sesquiterpene synthase [Solanum habrochaites]
Length=554

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/541 (49%), Positives = 385/541 (71%), Gaps = 8/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS ++HPT+WGD+FLAY + L   +  EE++ + LKEEVRK+L+ AP  SLEKLEL++ 
Sbjct  18    RRSGSHHPTLWGDHFLAY-ADLRGANEGEEKQNEDLKEEVRKMLVMAPSNSLEKLELINT  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LG+ YHF++EI  S+ +++ +Y+    GD    L+ ++L FRLLRQ+G+++SC  F+
Sbjct  77    IQCLGLAYHFQSEIDESLSYMYTHYEEYSIGD----LHAIALCFRLLRQQGYYVSCDAFK  132

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NELA  1429
             KF +  G FK+ L KDVEGMLSLYEA+   VHGE  LDEAL FT + L+ ILP L N   
Sbjct  133   KFTNDQGNFKEELVKDVEGMLSLYEAAQFRVHGEQILDEALNFTITKLKQILPKLSNSQL  192

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A ++++ALK PI+  + RV  ++Y+  Y+Q+Q HN+VLL FAKLDFN+LQ +H++ELS +
Sbjct  193   AQQITNALKFPIKDGIVRVETRKYISFYQQNQNHNQVLLNFAKLDFNILQTLHKKELSDM  252

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK + +   LP+AR RL ECYFW LG YFEPQY  +R++ T+I    S++DD YD+Y
Sbjct  253   TRWWKKMELVNTLPYARDRLVECYFWCLGTYFEPQYSVARKMLTKISFFISIIDDTYDIY  312

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G  DEL LFT AI+R++  AS ++P Y+K IY  +LD+  E+E+ +A ENK F V+Y+I 
Sbjct  313   GKLDELTLFTQAIERWNIDASEQLPLYMKIIYRDLLDVYDEIEKELANENKSFLVNYSIN  372

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK +R Y+QE  W+Y K VP  E+Y+K ++ +S Y+++ TT  + MG++ TK+V DWV
Sbjct  373   EMKKVVRGYFQEAKWYYGKKVPKMEQYMKNAISTSAYILLTTTSWLAMGNVATKDVFDWV  432

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              +EP  V A+C I RL++D++ HE EQ+RG+ ASAVECYM  Y+V+++EA+V+I  +I  
Sbjct  433   ATEPKLVVASCHIIRLLNDLVSHEEEQKRGNAASAVECYMNEYSVTQEEAHVKIRDIIEN  492

Query  528   AWKDINQEC--LHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
              WKD+N+E   +  + +P  +L+ ++NL R    IYKD D YTFS+   K +I+  LV P
Sbjct  493   YWKDLNEEYFKVDMIIIPRVLLMCIINLTRVAEFIYKDEDAYTFSKNNLKDVISDILVDP  552

Query  354   V  352
             +
Sbjct  553   I  553



>ref|XP_004242295.1| PREDICTED: germacrene C synthase-like [Solanum lycopersicum]
 gb|AEP82770.1| terpene synthase [Solanum lycopersicum]
Length=591

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/552 (51%), Positives = 385/552 (70%), Gaps = 9/552 (2%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIA-APPA  1816
             MDVN   S R    +H  +WG +FL+Y S+LTEI   E+ EV +LKE+V  +L+      
Sbjct  43    MDVN---SSRHLANFHSNIWGYHFLSYTSQLTEITTQEKLEVDELKEKVMNMLMEIRDDN  99

Query  1815  SLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQE  1636
             S +KL L+D IQRLGV YHF NEI+ SIQ+IFD      + D++NNLYVVSLRFRL+RQ+
Sbjct  100   STQKLVLIDAIQRLGVAYHFHNEIETSIQNIFDA---SKQNDNDNNLYVVSLRFRLVRQQ  156

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             GH+IS  VF++F+++DGKFK +L  DV+ +LSLYEA+ + V GE  L+EALTFT +HLES
Sbjct  157   GHYISSDVFKQFMERDGKFKKTLNNDVQALLSLYEAAQIRVRGEDILEEALTFTTTHLES  216

Query  1455  ILPGLNELA-AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQ  1279
             ++P L++    A++  AL  PI + +PR+GA++Y+ IYE  ++HN +LL+F+KLDFN+LQ
Sbjct  217   MIPLLSDNPLKAQIIEALTHPIHKVIPRLGARKYIDIYENMESHNHLLLKFSKLDFNMLQ  276

Query  1278  KVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIW  1099
             K HQRELS +T WWKDL +   +P+AR +L E Y W LGVYFEPQY  +RR+  ++  + 
Sbjct  277   KQHQRELSELTSWWKDLDLASKVPYARDKLVEGYTWTLGVYFEPQYSRARRMLVKVFKML  336

Query  1098  SVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN  919
             S+ DD YD Y T DEL LFTNAIQR+D +A + +P Y++  Y AILDI  E+EE + KE 
Sbjct  337   SICDDTYDAYATFDELVLFTNAIQRWDINAMDSLPPYMRPFYQAILDIFDELEEELTKEG  396

Query  918   KLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGD  739
             K   V Y   EMKK  R Y++E  W    ++P  +EY+K ++VS+ +M + TT L+GM +
Sbjct  397   KSDRVYYGKFEMKKLARAYFKEAQWLNAGYIPNCDEYIKNAIVSTTFMALGTTSLIGMEE  456

Query  738   IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEA  559
              ITK++ +W+T+EP  ++A+ +ICRLMDD+  HE +Q+RGHVAS +ECY K Y  SKQEA
Sbjct  457   FITKDIFEWITNEPSILRASSTICRLMDDISDHESDQQRGHVASVIECYTKEYGASKQEA  516

Query  558   YVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKS  382
             YV+  K +  AWK IN+  L P+ VP+ VL R+LNLAR +   ++D  D YT S  K K 
Sbjct  517   YVKFRKEVKDAWKGINKALLRPIEVPIFVLQRILNLARTMDTFFQDEEDGYTNSNSKCKD  576

Query  381   LITTTLVQPVTI  346
             ++T  LV  VTI
Sbjct  577   IVTLLLVDSVTI  588



>emb|CAN82172.1| hypothetical protein VITISV_040547 [Vitis vinifera]
 gb|ADR74221.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/539 (49%), Positives = 379/539 (70%), Gaps = 2/539 (0%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    +HP++WGD F+AY  +       +E++V+ LKEEVR+ L+AA     + L  +D
Sbjct  18    NRPRAEFHPSIWGDQFIAYTPEDEVSRACKEKQVEDLKEEVRRELMAAAGNPSQLLNFID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              +QRLGV YHFE EI+ S+QHI+D + +    D  ++LY ++LRFRLLRQ+G++ISCG+F
Sbjct  78    AVQRLGVAYHFEREIEESLQHIYDRFHDA--DDTNDDLYNIALRFRLLRQQGYNISCGIF  135

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF D+ G FK+ L  +++GML LYEA++L VHGE  L+EAL+FT +HL++ +  L    
Sbjct  136   NKFKDEKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALSFTTTHLKATVESLGYPL  195

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +VSHALK PIR+ L R+ A+ Y+ +Y+ + +H+K LL+ AKLDFNL+Q +H+ ELS +
Sbjct  196   AEQVSHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNL  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              RWWK+LG    LPFAR RL E YFWI+GVYFEPQY ++ RI T+II + +V+DD+YD Y
Sbjct  256   ARWWKELGFATKLPFARDRLVEGYFWIVGVYFEPQYLWAIRILTKIIVMTTVIDDIYDAY  315

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +E++ FT AI+R+D ++ + +P+Y+K  Y+A+LD+  E+EE M KE   + V Y I 
Sbjct  316   GTLEEIKHFTEAIERWDINSIDHLPKYMKLFYVALLDVYKEIEEEMEKERHQYRVHYAID  375

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R Y+ E  WF+ +H+P  EEY++V+L+SS Y ++AT+  +GMG+I++KE  DWV
Sbjct  376   AMKNQVRAYFAEAKWFHEQHIPTMEEYMRVALLSSGYSLLATSSFIGMGEIVSKEAFDWV  435

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  ++A+  I R MDDM  H+FEQERGHVAS +ECYMK   VS+++AY E    I  
Sbjct  436   ISDPKIIRASTVIARFMDDMTSHKFEQERGHVASGIECYMKQCGVSEEQAYKEFHNQIVN  495

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             AW DINQECL P  VPM +L RVLNL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  496   AWMDINQECLKPTAVPMPLLTRVLNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  554



>ref|XP_011100634.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=553

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 375/538 (70%), Gaps = 10/538 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R S  YHP+VWGDYFLAY S  TEI  +EE E+ + KE VRKVL   P  S  KLE +D 
Sbjct  21    RESFKYHPSVWGDYFLAYVS--TEISVAEEEELGRQKEMVRKVLAQTPDHSYHKLEFIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI   +  I D Y      D  N+L  V+LRFRLLRQ G+ +SC +F 
Sbjct  79    IQRLGVGYHFEEEIDKFVHFIHDTYLEYSSKD--NDLRTVALRFRLLRQHGYLVSCDIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D +G FK SL K+++GML L+EA+   + GE  L++AL F+ S+LES++  +N   +
Sbjct  137   KFTDGEGNFKISLIKNLKGMLELFEAAQFRIAGEEILEKALQFS-SNLESLVSNMNCSIS  195

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              KV  ALK+PI ++  RVGAK+++ IY+QD++H+++LL FAKLDFN++QK HQ+ELS  T
Sbjct  196   TKVKEALKIPILKSSNRVGAKKFISIYQQDESHSEMLLNFAKLDFNIVQKTHQKELSDFT  255

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL     LPFAR R+ ECYFW L VYFEP YH +RR+ T+II + S+LDD+YDVYG
Sbjct  256   RWWKDLDFVNRLPFARDRMVECYFWALEVYFEPHYHIARRMLTKIINMTSILDDIYDVYG  315

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T D+LQLFT+ IQR+D +A  ++P Y++  Y A+ D+  E+E  + K  + + V Y   E
Sbjct  316   TLDDLQLFTDLIQRWDVNALEQLPSYMRICYEALSDVYIEIENELEKTGESYRVQYAKEE  375

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK +R Y +E  W Y K +P  EEY+KV++VSS YMM+ TT LVGMG+++TK+  DW+T
Sbjct  376   MKKLVRAYIEEAKWSYNKDMPRMEEYMKVAIVSSTYMMLLTTSLVGMGNLVTKKDFDWIT  435

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             SEPL + A+ +ICRL +D++G+ FE++    ++AVECYM   + SK+EA+ E+   I+KA
Sbjct  436   SEPLLLLASATICRLTNDLVGYGFEKK----STAVECYMNENDASKEEAFAELGNQITKA  491

Query  525   WKDINQECLHPL-PVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             WKDINQECL P+ P+ M VL R LNLA A  L Y + D Y+ SQ   K++I   L++P
Sbjct  492   WKDINQECLQPMVPISMSVLTRALNLACATHLFYLEYDEYSNSQANIKNIIHDVLLEP  549



>gb|KDP36230.1| hypothetical protein JCGZ_09950 [Jatropha curcas]
Length=555

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/545 (49%), Positives = 372/545 (68%), Gaps = 7/545 (1%)
 Frame = -2

Query  1977  NSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             +++ R +  + P +WGD FL+YDS+ T I+   E +VQ+LKEEV++++IA+   S E L 
Sbjct  17    SNTTRHTANFSPDIWGDRFLSYDSEFTNINNDMEEQVQRLKEEVKRMIIASTHESSEDLN  76

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
             L+D IQRLGV YHFENEI+ ++  I  + DN       N+L+  +LRFRLLRQ+G ++SC
Sbjct  77    LIDSIQRLGVAYHFENEIEEALLRIHCSTDNY------NDLHSAALRFRLLRQQGFNVSC  130

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              VF KF D +G F ++L  D++G+LSLYEA+YL VHGE  L+EAL F+  HL+SI     
Sbjct  131   DVFNKFRDSNGHFNETLKNDIQGILSLYEAAYLRVHGEDILEEALAFSTVHLKSIANSNT  190

Query  1437  ELA-AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
                 AA+VS ALK PIR+ L R+ +K Y+ +Y++D +HN+VLL FAKLDFN+LQK+H+ E
Sbjct  191   RFPFAAQVSRALKQPIRKGLQRLESKHYISMYQEDASHNEVLLTFAKLDFNVLQKMHREE  250

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             L  I++WWKDL     LPF R R+ E YFWI+GVYFE QY  +RR  T++I I SV+DD+
Sbjct  251   LRYISKWWKDLDFTTKLPFIRDRVVEGYFWIIGVYFESQYSLARRFLTKVIAISSVIDDI  310

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD YGT +EL +FT+AIQR+D +  +++P+Y+K  Y+A+LDI  EME  ++++    ++ 
Sbjct  311   YDAYGTLEELIIFTSAIQRWDIACMDQLPEYMKLCYMALLDIYDEMERELSEQGSSSYIH  370

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y   EMKK ++ Y  E  W    ++P  +EY+ ++LV+  Y ++ TT  +GMGDI TK+V
Sbjct  371   YAKDEMKKLVQAYLVEANWMNKDYIPTMDEYMSIALVTCGYSLLTTTSFIGMGDISTKDV  430

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW ++ P  V+A   ICRLMDD++ HEFEQ RGHVASAVECYMK   VS++    E  K
Sbjct  431   FDWSSNGPKIVRAASVICRLMDDIVSHEFEQARGHVASAVECYMKQNGVSEEATRDEFNK  490

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              I  AWKDIN  CL P  VPM +L RV+NLAR I  +YKD D YT +    KS IT+  +
Sbjct  491   QIVSAWKDINAACLKPTEVPMPILTRVVNLARVIDYLYKDGDEYTHTGELMKSSITSVFI  550

Query  360   QPVTI  346
               V I
Sbjct  551   DRVQI  555



>gb|AGW18162.1| terpene synthase 4-2 [Copaifera langsdorffii]
Length=556

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/541 (50%), Positives = 367/541 (68%), Gaps = 4/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  YHP+VWGD+FL Y S+  E+D   E  +  LKE VRK+L+ A    L K+ L+D 
Sbjct  18    RRSANYHPSVWGDHFLKYASQPLEVDEKMEDRIGTLKETVRKMLVPATDKPLTKVRLIDS  77

Query  1785  IQRLGVDYHFENEIQASIQHIFDNY--DNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             +QRLGVDYHFE+EI   +  I +NY  D  I  ++  +L+ ++L FRLLRQ+G+H+S  V
Sbjct  78    MQRLGVDYHFESEIDEVLYQIQNNYVKDGIITLNE--DLHSMALLFRLLRQQGYHVSPDV  135

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF D+ GK  +++  DVEGMLSLYEA++L +HGE  LDEAL FT++HL+ +   L++ 
Sbjct  136   FNKFKDEQGKISETIANDVEGMLSLYEAAHLRIHGEDILDEALDFTSTHLKFLTTQLSDS  195

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A KV  +LK P+RR LPR+ A  Y   Y++D +H + LL FAK DFN +QK+HQRE+  
Sbjct  196   HAGKVIRSLKCPLRRRLPRLEAWHYFSTYQEDPSHIETLLAFAKSDFNGVQKLHQREIGN  255

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             +++WWKDL     LPFAR RL E YFWILGVYFEP Y  +RRI T++I + S++DD+YDV
Sbjct  256   LSKWWKDLDFATKLPFARDRLVEAYFWILGVYFEPCYSLARRIMTKVISLTSIIDDIYDV  315

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +ELQLFT AI ++D S  + +P+Y+K IY  +LD+  E+E   AKE + F V+Y  
Sbjct  316   YGTLEELQLFTEAINKWDISCMDFLPEYMKLIYQPLLDVYDEIERETAKEGRAFCVNYGK  375

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              +M+K +R Y  E  WF+  + P FEEY++V+LVSS Y M+ T   +G+G I T+E   W
Sbjct  376   EQMRKVVRAYLAEAKWFHNNYTPTFEEYMEVALVSSAYRMLTTVSFIGVGSIATEEAFKW  435

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VT +P  VKA+  ICRLMDD++  +FEQERGHV  A+ECYMK Y  +++E  VE  + + 
Sbjct  436   VTKDPKIVKASLVICRLMDDIVSRKFEQERGHVVPALECYMKQYGATEEETIVEFRRRVE  495

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDIN++CL P  V   +L+R LNL+R I L+Y D+D YT S    K  I   L+ PV
Sbjct  496   NAWKDINEDCLQPFKVAKPLLMRSLNLSRVINLLYTDDDCYTHSAGNTKKNIEALLINPV  555

Query  351   T  349
              
Sbjct  556   A  556



>ref|XP_006353135.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=557

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/541 (49%), Positives = 387/541 (72%), Gaps = 4/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR   +HP+VWGD+FLAY ++LT  +  EE++   LKEEVRK+L+ +P  S++KLE+++ 
Sbjct  16    RRIGNHHPSVWGDHFLAY-AELTGANEQEEKQHANLKEEVRKMLVMSPSKSIQKLEVINT  74

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCI-KGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
             IQRLGVDYHFE+EIQ S+ ++ + Y+  I + D+ NNL+V++L FRLLR +G+++SC  F
Sbjct  75    IQRLGVDYHFEHEIQESLSYLSEGYEEWIGEVDNANNLHVIALSFRLLRVQGYYVSCDAF  134

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF D+ G +K++L +DV+GMLSLYEA+   VH E  LDEA  FT + L+ ILP LN   
Sbjct  135   RKFTDEQGNYKEALVRDVQGMLSLYEAAQFRVHDEQILDEAKNFTTTQLKLILPNLNNSL  194

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +VS A K  IR  + R+ A +Y+ IY++D++ N+VLL FAKLDFN+LQ +H++EL  I
Sbjct  195   AQQVSSAFKFSIRDGIVRLEAWKYISIYKEDKSCNQVLLNFAKLDFNILQMLHKKELCDI  254

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK+L + K++P+AR R+ E YFW LG+YFEPQY  SR+I T+++   S++DD YD Y
Sbjct  255   TRWWKELELVKVVPYARDRVVELYFWCLGIYFEPQYSVSRKILTKVLSFCSIMDDTYDTY  314

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK-LFHVSYTI  892
             GT +EL L TNAI+R++  AS ++P Y+K  Y A+LD+  EME+ +  ENK L  V+Y+I
Sbjct  315   GTLNELTLLTNAIERWNIDASEQLPPYMKITYHALLDVYNEMEKELTNENKSLIFVNYSI  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              EMKK ++ Y+QE  W++ K VP  E+Y+K   +SS Y ++ATT L+GMGD+ TK+  DW
Sbjct  375   NEMKKLLKAYFQETKWYHGKIVPKMEQYVKNGALSSTYHLLATTFLLGMGDVATKDAFDW  434

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             + +EP  + A+  I RL++D++ HE EQERG  AS +ECYM  Y V+K++A++EI K+I+
Sbjct  435   IATEPPILVASGIIARLLNDLVSHEIEQERGDAASGIECYMNEYGVTKEKAHMEIRKIIA  494

Query  531   KAWKDINQECL-HPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
               WKD+N++ L H + +P  +L+ +LNL R    +YKD D Y+FS    K +I+  L+ P
Sbjct  495   NYWKDLNEDYLKHIVVIPRVLLMVMLNLTRTAEFVYKDEDAYSFSNNNLKDVISMLLIHP  554

Query  354   V  352
             +
Sbjct  555   I  555



>ref|NP_001289493.1| germacrene C synthase-like [Nicotiana sylvestris]
 gb|ADI87448.1| cembratrienol synthase 3 [Nicotiana sylvestris]
Length=598

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/547 (50%), Positives = 378/547 (69%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++++SS R    +  T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+     S +
Sbjct  53    MDLSSSSRHLADFPSTIWGDHFLSYNSEITEITTQEKNEHELLKEIVRKMLVETLDNSTQ  112

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF    N  + +DE+NLYV +LRFRL RQ+G++
Sbjct  113   KLVLIDTIQRLGLAYHFNDEIENSIQNIFYLSQNS-EDNDEHNLYVAALRFRLARQQGNY  171

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  172   MSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEEILEEALIFTTTHLESVIP  231

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ AL  PIR+T+PRVGA++Y+ IYE   THN +LL+FAKLDFN+LQK+H 
Sbjct  232   NLSNSLKVQVTEALSHPIRKTIPRVGARKYIYIYENIGTHNDLLLKFAKLDFNMLQKLHL  291

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY  SR + T+++ + S++D
Sbjct  292   KELNELTSWWKDLDCANKFPYAKDRLVEAYFWTVGIYFEPQYSRSRSMITKVVKMNSIID  351

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEV+AKE K   
Sbjct  352   DTYDAYATFDELVLFTDAIQRWDEGAMDSLPTYLRSIYQGLLDVFNEMEEVLAKEGKADR  411

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK +  Y++E  W    ++P  EEY+K  +V+S   M     LV M +IITK
Sbjct  412   IYYAKKEMKKLVAAYFKEAQWLNANYIPKCEEYMKNGVVTSTGTMYGIISLVVMEEIITK  471

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+ +EPL ++A  +ICRLMDDM  HE EQ+R HVAS VECYM+ Y VSKQEAYVE+
Sbjct  472   EAFEWLANEPLILRAASTICRLMDDMADHEVEQQREHVASFVECYMEEYGVSKQEAYVEM  531

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ A KDIN+E L P  VPM +L R LN  R +    KD+D YT  + + K  I   
Sbjct  532   RKKITNACKDINKELLRPTAVPMFILERTLNFIRLVGTFLKDDDGYTNPKSQVKDSIALL  591

Query  366   LVQPVTI  346
              V+ + I
Sbjct  592   FVESIDI  598



>gb|KDP39015.1| hypothetical protein JCGZ_00772 [Jatropha curcas]
Length=558

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/543 (50%), Positives = 371/543 (68%), Gaps = 8/543 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RRS  YHP +WGD FL+YDS    ID +   ++++LKEEVR+ L+     SL+KL+L+D
Sbjct  21    NRRSANYHPNIWGDRFLSYDSNFMTIDNATHHQLEELKEEVRRTLVVTTNNSLQKLQLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGVDYHFE EI+  ++ ++   D     D+EN+LY ++LRFRLLRQ+G + SC VF
Sbjct  81    AIQRLGVDYHFEKEIEDELEKLYHEND-----DNENDLYTIALRFRLLRQQGFNASCEVF  135

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              +F D +G FK SL  D +GML LYEA+++ VHGE TLDEAL FT  +LE     L+   
Sbjct  136   NQFKDDEGNFKKSLVCDAKGMLELYEATHVRVHGENTLDEALEFTTINLEWAATNLDYPL  195

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             + ++S ALK  IR+ LPR+ A+ Y+  Y++D +HNK LL+ AKLDFNLLQ +H++ELS I
Sbjct  196   SYQISEALKQSIRKRLPRLEARRYVSFYQEDCSHNKALLKMAKLDFNLLQSLHKKELSEI  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              RWWKDL     LPFAR R+ ECYFWIL V+ EPQY F+RRI T+II + SVLDD+YDVY
Sbjct  256   FRWWKDLNFATKLPFARDRIVECYFWILSVFHEPQYSFARRILTKIIALASVLDDIYDVY  315

Query  1068  GTQDELQLFTNAIQRFDTSA--SNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             G+ +EL L T  IQR++     +  +P+Y+K +Y A+ ++  E+EE +AKE K   + Y 
Sbjct  316   GSLEELTLLTEIIQRWEVIDLYTEPLPEYMKHVYKALREVYREIEEELAKEGKFDRIQYA  375

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
             IG MK+ +R+YY E  W +  +VP  EEY+ V+LVSS   M+  T  VGMGDI TKE LD
Sbjct  376   IGAMKEFVRSYYAEAKWLHEGYVPSMEEYMGVALVSSGNPMLTVTSFVGMGDIATKEALD  435

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+++EP  V+A  +I RLMDD++ ++ E+E G +ASA+ECY + Y V+++EA  E  K I
Sbjct  436   WISNEPKIVRAGSTISRLMDDIVSYKLEKETGKIASAIECYKREYGVTEEEACNEFNKQI  495

Query  534   SKAWKDINQECLHPLPV-PMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
               AWKDINQE L P    PM +L+R LNLAR + ++YKD D YT         IT+ L+ 
Sbjct  496   MNAWKDINQELLKPTAAWPMPLLMRPLNLARVMDILYKDGDNYTHVGKVAIDGITSLLID  555

Query  357   PVT  349
             P++
Sbjct  556   PMS  558



>ref|NP_001239041.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEM23832.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82780.1| TPS17 [Solanum lycopersicum]
Length=554

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/541 (49%), Positives = 383/541 (71%), Gaps = 8/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS ++HPT+WGD+FLAY + L   +  EE++ + LKEEVRK+L+ AP  SLEKLEL++ 
Sbjct  18    RRSGSHHPTLWGDHFLAY-ADLRGANEGEEKQNEDLKEEVRKMLVMAPSKSLEKLELINT  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LG+ YHF++EI  S+ +++ +Y+    GD    L+ ++L FRLLRQ+G+++SC  F+
Sbjct  77    IQCLGLGYHFQSEIDESLSYMYTHYEEYSIGD----LHAIALCFRLLRQQGYYVSCDAFK  132

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NELA  1429
             KF +  G FK+ L KDVEGMLSLYEA+   VHGE  LDEAL FT + L+ ILP L N   
Sbjct  133   KFTNDQGNFKEELVKDVEGMLSLYEAAQFRVHGEQILDEALNFTIAQLKQILPKLSNSQL  192

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A ++++ALK PI+  + RV  ++Y+  Y+Q+Q HN+VLL FAKLDFN+LQ +H++ELS +
Sbjct  193   AQQITNALKYPIKDGIVRVETRKYISFYQQNQNHNEVLLNFAKLDFNILQTLHKKELSDM  252

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK + +   LP+AR RL ECYFW LG YFEPQY  +R++ T+I    S++DD YD+Y
Sbjct  253   TRWWKKMELVNTLPYARDRLVECYFWCLGTYFEPQYSVARKMLTKISFYISIIDDTYDIY  312

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G  DEL LFT AI+R++  AS ++P Y+K IY  +LD+  E+E+ +A ENK F V+Y+I 
Sbjct  313   GKLDELTLFTQAIERWNIDASEQLPLYMKIIYRDLLDVYDEIEKELANENKSFLVNYSIN  372

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK +R Y+QE  W+Y K VP  E+Y+K  + +S Y+++ TT  + MG++ TK+  DWV
Sbjct  373   EMKKVVRGYFQEAKWYYGKKVPTMEQYMKNGISTSAYILLTTTSWLAMGNVATKDAFDWV  432

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              +EP  V A+C I RL++D++ HE EQ+RG+ ASAVECYM  Y+V+K+EA+++I  +I  
Sbjct  433   ATEPPIVVASCYIIRLLNDLVSHEEEQKRGNAASAVECYMNEYSVTKEEAHIKIRDIIEN  492

Query  528   AWKDINQEC--LHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
              WKD+N+E   +  + +P  +L+ ++NL R    IYKD D YTFS+   K +I+  LV P
Sbjct  493   YWKDLNEEYFKVDMIIIPRVLLMCIINLTRVAEFIYKDEDAYTFSKNNLKDVISDILVDP  552

Query  354   V  352
             +
Sbjct  553   I  553



>gb|AAR99061.1| (-)-germacrene D synthase [Populus trichocarpa x Populus deltoides]
Length=561

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/545 (49%), Positives = 378/545 (69%), Gaps = 6/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RRS  Y P++WGD+FL+Y +    ++ S++ E ++LKEEV++ L+A      + L+ +D
Sbjct  19    SRRSAGYSPSIWGDHFLSYATD--SMETSDKAEHKKLKEEVKRELMANINKPSQTLDFID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNY----DNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
              IQRLG+ YHFE EI   ++ ++ ++    +        N+LY +SL+FRLLRQ+G+ IS
Sbjct  77    AIQRLGISYHFEIEIDEILREMYKSHCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKIS  136

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C VF KF +  G F DSL  D  G+LSLYEA++L VHG+  L+EAL FT SHLE +    
Sbjct  137   CDVFGKFKNSQGTFNDSLANDTRGILSLYEATHLRVHGDEVLEEALVFTTSHLEFLATHS  196

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    AK++HALK P+R+ +PR+ A+ Y  IY++D + ++VLL FAKLDFN+LQK HQ+E
Sbjct  197   SSPLRAKINHALKQPVRKNIPRLEARHYFSIYQEDPSCSEVLLNFAKLDFNILQKQHQKE  256

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I  WWK+L   K LPFAR R+ ECYFWILGVY EP+Y  +RRI T++I + SV+DD+
Sbjct  257   LSEIANWWKELDFAKKLPFARDRVIECYFWILGVYLEPEYFLARRILTKVIAMTSVIDDI  316

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYGT +EL+LFT+AI+R++ +A +++P+Y+K  Y A+LD+ TE+EE M  E + + V 
Sbjct  317   YDVYGTPEELELFTDAIERWEITAVDQLPEYMKVTYKALLDVYTEIEENMVTEERSYRVY  376

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK  +R YY E  WF+ KH P  EEY+ V+LV+S Y M+A T  VGMG ++TK+ 
Sbjct  377   YAKEAMKNLVRAYYLESKWFHQKHTPTMEEYMAVALVTSGYAMLAATSFVGMGHVVTKDS  436

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+   P  +KA+  ICRLMDD++ H+FEQ+RGHVAS++ECYMK +  ++QE   E  K
Sbjct  437   FDWLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRK  496

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++ AWKD+N+E LHP  VPM +L R+LNLAR I ++YKD D YT +    K L++  L+
Sbjct  497   QVTDAWKDLNEEFLHPTAVPMPLLTRMLNLARVIDVVYKDEDGYTNAGTVLKDLVSALLI  556

Query  360   QPVTI  346
              PV +
Sbjct  557   DPVPM  561



>ref|XP_006475285.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=563

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/545 (51%), Positives = 372/545 (68%), Gaps = 4/545 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S RRS  YHP++WGD+FL Y     E D     +  +LK+E+R++L A    S   L+L+
Sbjct  20    STRRSANYHPSIWGDHFLQYTCDTQETDDGSNVKHLELKKEIRRMLKADNKPS-RTLQLI  78

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  +     +    D+EN+ LY +SL FRLLRQ G+ IS  
Sbjct  79    DAIQRLGVSYHFESEIDEILGKMHKASQDSDLCDNENDELYYISLHFRLLRQNGYKISAA  138

Query  1614  -VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GL  1441
              VF+KF D DG FK SL KDV GMLSLYEA++LGVH E  LDEAL FT SHLESI    +
Sbjct  139   DVFKKFKDTDGNFKTSLAKDVRGMLSLYEATHLGVHEEDILDEALAFTTSHLESIATHQI  198

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
                   +V HAL  PI R L R+ A++Y+ IY+++  HN+ LL FAKLDFN LQK+HQ+E
Sbjct  199   RSPLVEQVKHALVQPIHRGLQRLEARQYIPIYQEESPHNEALLTFAKLDFNKLQKLHQKE  258

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             L  I+RWWK+L     LPF R R+AECYFWILGVYFEPQY F+RRI T++I + SV+DD+
Sbjct  259   LGDISRWWKELDFAHKLPFIRDRVAECYFWILGVYFEPQYSFARRILTKVISMTSVIDDI  318

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYG  +EL+LFT+AI+R+D SA +++P+Y+K  Y A+LD+ +E E+ +A + K + + 
Sbjct  319   YDVYGKIEELELFTSAIERWDISAIDQLPEYMKLCYRALLDVFSEAEKDLAPQGKSYRLY  378

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK  ++ Y+ E  W    +VP  +EY+ V+LV+S   M++TT  VGMGDI+TKE 
Sbjct  379   YAKEAMKNMVKNYFYEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKES  438

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +W+ S P  ++A+  +CRLMDD++ H+FEQ RGHVAS+VECYMK +  +++EA  E  K
Sbjct  439   FEWLFSNPRFIRASSIVCRLMDDIVSHKFEQSRGHVASSVECYMKQHGATEEEACNEFRK  498

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              +S AWKDIN++CL P  VPM +L+R+LNL R I +IYK  D YT S V  K  + +  +
Sbjct  499   QVSNAWKDINEDCLRPTVVPMPLLMRILNLTRVIDVIYKYEDGYTHSAVVLKDFVASLFI  558

Query  360   QPVTI  346
              PV I
Sbjct  559   NPVPI  563



>gb|AAL25826.1| cyclase [Nicotiana tabacum]
Length=597

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/547 (49%), Positives = 380/547 (69%), Gaps = 1/547 (0%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             +N +SS R    +H T+WGD+FL+Y+S++TEI   E+ E + LKE VRK+L+  P  S +
Sbjct  52    MNPSSSSRHLADFHSTIWGDHFLSYNSEITEITTQEKNEHEMLKEIVRKMLVETPDNSTQ  111

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + D+E+NLYV +LRFRL RQ+G++
Sbjct  112   KLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-ENDNEHNLYVAALRFRLARQQGYY  170

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +S  VF++F + DGKFK++   D++G+LSLYEA+++ VH E  L+EAL FT +HLES++P
Sbjct  171   MSSDVFKQFTNHDGKFKENHINDIQGLLSLYEATHMRVHDEEILEEALIFTTTHLESMIP  230

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+     +V+ A   PIR+T+PRVG+++Y+ IYE   THN +L++FAKLDFN+LQ++H+
Sbjct  231   NLSNSLKVQVTEASNQPIRKTIPRVGSRKYIYIYENIGTHNDLLVKFAKLDFNMLQELHR  290

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ +T WWK++       +A+ RL E YFW++G+YFEPQY  SRR+ TQ++ + S++D
Sbjct  291   KELNELTSWWKEMDFATNFQYAKGRLVEAYFWMVGIYFEPQYSRSRRMITQVVNMNSIID  350

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD + T DEL LFT+AIQR+D  A + +P YL+ IY  +LD+  EMEEVMAKE K   
Sbjct  351   DTYDAFATFDELMLFTDAIQRWDVGAMDSLPAYLRPIYQGLLDVFNEMEEVMAKEGKADR  410

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y   EMKK +  Y++E  W    ++P  EEY+K  +VS     +    LV + +IITK
Sbjct  411   IYYAKKEMKKLVAAYFKEVEWLNANYIPKCEEYMKNGVVSCTGRCMEQFALVVIEEIITK  470

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+ +EPL  +A  +ICRLMDD++ HE EQ+RGHVAS VE YMK Y  SKQEAYVE+
Sbjct  471   EAFEWLANEPLIPRAASTICRLMDDIVDHEVEQQRGHVASFVEYYMKEYGTSKQEAYVEM  530

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I+ AWKDIN+E L    VPM VL R L+  R +   +KD+D YT  + K K +I   
Sbjct  531   WKKITNAWKDINKELLRATAVPMFVLERTLDYTRLVDTCFKDDDGYTNPKSKVKDMIALL  590

Query  366   LVQPVTI  346
              V+ + I
Sbjct  591   FVESIDI  597



>ref|XP_006370591.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67160.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=561

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/545 (48%), Positives = 376/545 (69%), Gaps = 6/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RRS ++ P++WGD+FL+Y +    ++ S++ E ++LKEEV++ L+       + L+ +D
Sbjct  19    SRRSASFPPSIWGDHFLSYATD--SMETSDKAEHKKLKEEVKRELMTTINKPSQTLDFID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDN----YDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
              IQRLG+ YHFE EI   ++ ++ +     +        N+LY +SL+FRLLRQ+G+ IS
Sbjct  77    AIQRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKIS  136

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C VF KF +  G F DSL  D   +LS YEA++L VHG+  L+EAL FT SHLE +    
Sbjct  137   CDVFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTTSHLEFLATHS  196

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    AK++HALK PIR+ +PR+ A+ Y  +Y++D + ++VLL FAKLDFN+LQK HQ+E
Sbjct  197   SSPLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDFNILQKQHQKE  256

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I +WWK+L   K LPFAR R+ ECYFWILGVYFEP++  +RR+ T++I + SV+DD+
Sbjct  257   LSDIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEHFLARRMLTKVIAMTSVIDDI  316

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYG  +EL+LFT+AI+R++ +A + +P+Y+K  Y A+LD+ TE+EE M  E + + V 
Sbjct  317   YDVYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENMVNEERSYRVY  376

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK Q+R YY E  WF+ KH P  EEY+ V+LV+S Y M+A T  VGMG ++TK+ 
Sbjct  377   YAKEAMKNQVRAYYHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDS  436

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+   P  +KA+  ICRLMDD++ H+FEQ+RGHVAS++ECYMK +  ++QE   E  K
Sbjct  437   FDWLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRK  496

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++ AWKD+N+E LHP  VPM +L R+LNLAR I ++YKD D YT +    K L++  L+
Sbjct  497   QVTDAWKDVNEEFLHPTAVPMPLLTRMLNLARVIDVVYKDEDGYTNAGTALKDLVSALLI  556

Query  360   QPVTI  346
              PV +
Sbjct  557   DPVPM  561



>ref|XP_002275408.3| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CBI31300.3| unnamed protein product [Vitis vinifera]
 gb|ADR74222.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/540 (49%), Positives = 370/540 (69%), Gaps = 4/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R  V YHP++WGD F++Y  +       +E++++ LKEE+R+ L+     + +KL+ +D 
Sbjct  19    RPVVKYHPSIWGDQFMSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTSQKLKFIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQEGHHISCGVF  1609
             +QRLGV YHFE EI+  +QHI+D+Y N   GDD E  +Y V+L+FRLLRQ G +ISCG+F
Sbjct  79    VQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGGIYNVALQFRLLRQAGFNISCGLF  135

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              +F D+ G FK +L  DV GML LYEA++L VHGE  LDEAL  T +HL S++  L    
Sbjct  136   NEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILDEALALTTTHLRSMVEHLEYPF  195

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V+HALK PIR+ L R+ A+ Y+ IY+ + +H++ LL+ AKLDFNL+Q +H+ ELS I
Sbjct  196   AEQVAHALKQPIRKGLERLEARWYISIYQDETSHDRTLLKLAKLDFNLVQSLHKEELSNI  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK L     LPFAR RL E YFWILGV+FEPQY ++RRI T+ I + S +DD+YD Y
Sbjct  256   TRWWKQLNFATKLPFARDRLVEGYFWILGVFFEPQYAWARRIVTKTIAMTSTMDDIYDAY  315

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT AI+R+D ++ + +P+Y+K  Y+A+LD+  E+EE M KE   + V Y I 
Sbjct  316   GTFEELELFTEAIERWDINSIDHLPEYMKHFYVALLDVYKEIEEEMEKEGNQYRVQYAIE  375

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MKKQ+R Y+ E  W +   +P  EEY+ ++ VSS Y M+  T  +GMG I+TKE  DWV
Sbjct  376   AMKKQVRAYFHEAKWLHEGRIPTMEEYMSIARVSSGYPMLTATSFIGMGKIVTKEAFDWV  435

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  V A+  I RLMDD+  H+FEQ+RGHVAS VECYMK Y  S++E Y + +K +  
Sbjct  436   ISDPKIVTASAVIARLMDDITSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQKQVVD  495

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKD N+E L P  VPM +L+RVLNL+R +++IY   D YT      K+ + + L+ P+ 
Sbjct  496   AWKDTNEEFLRPTAVPMPLLMRVLNLSRVMYVIYTGGDGYTHVGKVMKNNVASLLIHPIA  555



>ref|XP_002522812.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9S9Z3.1|TPS1_RICCO RecName: Full=Alpha-copaene synthase; AltName: Full=(+)-delta-cadinene 
synthase; AltName: Full=Terpene synthase 1; Short=RcSeTPS1 
[Ricinus communis]
 gb|EEF39510.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 gb|AEQ27766.1| alpha-copaene synthase [Ricinus communis]
Length=558

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/542 (49%), Positives = 373/542 (69%), Gaps = 8/542 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R S TYHPT+WGD+FLA  S    ID S E++ + LK++VRK++I       +KL L+D 
Sbjct  23    RHSSTYHPTIWGDHFLANLSHSKIIDGSIEQQFEGLKQKVRKMIIDLNNEPCKKLGLIDA  82

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF++EI+  +Q ++ +Y      DDE++L  V+LRFRLLRQ G  +SC +FE
Sbjct  83    VQRLGVGYHFKSEIEDVLQKVYHDY-----SDDEDDLNTVALRFRLLRQHGIKVSCAIFE  137

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D +G FK SL  D  GMLSLYEA++L + GE  LDEAL FT ++L+S+LP LN   A
Sbjct  138   KFKDSEGNFKTSLINDALGMLSLYEATHLSIRGEDVLDEALAFTTTNLQSVLPQLNTHLA  197

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             A++S AL  PIR+ LPR+ A+ Y+ IY  ++++N  LL FAKLDFN+LQ++HQ+EL+ +T
Sbjct  198   AQISRALNRPIRKYLPRLEARNYIDIYATEESYNTTLLNFAKLDFNMLQELHQKELNVVT  257

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             +WWK L V   LP+AR R+ ECYFW++GVYFEPQY F+R + T+II I S+LDD YD Y 
Sbjct  258   KWWKSLDVATKLPYARDRVVECYFWMVGVYFEPQYSFARIMMTKIIAITSLLDDTYDNYA  317

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK--LFHVSYTI  892
             T +EL++ T AI+R+D  A + +P+Y+K IY  +LDI  E EE +AKE K  L+ V Y  
Sbjct  318   TGEELEILTEAIERWDIKAKDALPEYMKIIYTTLLDIYNEYEENIAKEEKSLLYSVYYAK  377

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK+ +R Y  E  W    + P  EEY++ +L+++C  M+A    +G+ +I TKE  +W
Sbjct  378   EVMKRVVRAYLAEVRWRDNCYTPTMEEYMQSALLTTCSPMLAIASFLGLKEIATKEAYEW  437

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
              + +P  ++A+  +CRLMDD++ HEFEQ R HVAS VECY+K Y  S++E      K ++
Sbjct  438   ASEDPKIIRASSIVCRLMDDIVSHEFEQTRKHVASGVECYIKQYGASEEEVIKLFRKEVT  497

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKD+N+ECL+P PVPM +L RV+NL RAI +IYKD+D YT S +  K  + + L  PV
Sbjct  498   NAWKDLNEECLNPTPVPMPMLERVVNLTRAIDVIYKDDDGYTNSHI-MKDYVASVLKDPV  556

Query  351   TI  346
              +
Sbjct  557   PV  558



>gb|AEI52901.1| terpene synthase 1 [Populus trichocarpa]
Length=561

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/545 (48%), Positives = 376/545 (69%), Gaps = 6/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RRS ++ P++WGD+FL+Y +    ++ S++ E ++LKEEV++ L+       + L+ +D
Sbjct  19    SRRSASFPPSIWGDHFLSYATD--SMETSDKAEHKKLKEEVKRELMTTINKPSQTLDFID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDN----YDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
              IQRLG+ YHFE EI   ++ ++ +     +        N+LY +SL+FRLLRQ+G+ IS
Sbjct  77    AIQRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKIS  136

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C VF KF +  G F DSL  D   +LS YEA++L VHG+  L+EAL FT SHLE +    
Sbjct  137   CDVFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTTSHLEFLATHS  196

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    AK++HALK PIR+ +PR+ A+ Y  +Y++D + ++VLL FAKLDFN+LQK HQ+E
Sbjct  197   SSPLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDFNILQKQHQKE  256

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I +WWK+L   K LPFAR R+ ECYFWILGVYFEP++  +RR+ T++I + SV+DD+
Sbjct  257   LSDIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEHFLARRMLTKVIAMTSVIDDI  316

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYG  +EL+LFT+AI+R++ +A + +P+Y+K  Y A+LD+ TE+EE M  E + + V 
Sbjct  317   YDVYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENMVNEERSYRVY  376

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK Q+R YY E  WF+ KH P  EEY+ V+LV+S Y M+A T  VGMG ++TK+ 
Sbjct  377   YAKEAMKNQVRAYYLESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDS  436

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+   P  +KA+  ICRLMDD++ H+FEQ+RGHVAS++ECYMK +  ++QE   E  K
Sbjct  437   FDWLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRK  496

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++ AWKD+N+E LHP  VPM +L R+LNLAR I ++YKD D YT +    K L++  L+
Sbjct  497   QVTDAWKDVNEEFLHPTAVPMPLLTRMLNLARVIDVVYKDEDGYTNAGTALKDLVSALLI  556

Query  360   QPVTI  346
              PV +
Sbjct  557   DPVPM  561



>gb|KDO45658.1| hypothetical protein CISIN_1g039366mg [Citrus sinensis]
Length=547

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/544 (50%), Positives = 372/544 (68%), Gaps = 19/544 (3%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S RRS  +HP++WGD FL+Y S   E D    +  Q+LKEE+R++L    P S   L+L+
Sbjct  21    STRRSANFHPSIWGDRFLSYTSDSMEKDDGSAKH-QELKEEIRRMLKINKP-SQNNLDLI  78

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  + D + +C  GD+EN+ LY +SL+FRLLRQ G+ IS  
Sbjct  79    DAIQRLGVSYHFESEIDEILGKLHDAHQDCGLGDNENDELYYISLQFRLLRQHGYKISAD  138

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLN  1438
             VF++F D DG FK SL KDV GMLSL+EA++LGVH E  LDEAL FT S LESI    ++
Sbjct  139   VFKRFKDSDGNFKTSLAKDVRGMLSLFEATHLGVHEENILDEALAFTTSQLESIAAHQIS  198

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V HAL  PI R L R+ A+ Y+ IY++  +HN+ LL FAKLDFN LQK+HQ+EL
Sbjct  199   SPLAEQVKHALIQPIHRGLQRLEARHYIPIYQEQSSHNEALLTFAKLDFNKLQKLHQKEL  258

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
               I+R                R+AECYFWILGVYFEPQY F+RRI T++I + S +DD+Y
Sbjct  259   GDISR---------------DRIAECYFWILGVYFEPQYSFARRILTKVISMTSTIDDIY  303

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DVYG  +EL+LFT+AI+R+D SA +++P+Y+K  Y A+LD+ +E E+ +A + KL+ + Y
Sbjct  304   DVYGKIEELELFTSAIKRWDISAIDQLPEYMKLCYRALLDVYSEAEKDLAPQGKLYRLHY  363

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MK  ++ Y+ E  W +  ++P  +EY+ V+LV+S Y M++TT  VGMGDI+TKE  
Sbjct  364   AKKAMKNIVKNYFFEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESF  423

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ S P  ++A+  +CRLMDDM  HEFEQ RGHVAS+VECYMK +  +++EA  E  K 
Sbjct  424   EWLFSNPRFIRASSVVCRLMDDMASHEFEQSRGHVASSVECYMKQHGATEEEACNEFRKQ  483

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             +S AWKDIN++CL P  +PM +L+R+LNL R I +IYK  D YT S V  K  + + L+ 
Sbjct  484   VSNAWKDINEDCLRPTVLPMPLLMRILNLTRVIDVIYKYEDGYTHSAVVLKDFVASLLIN  543

Query  357   PVTI  346
             PV I
Sbjct  544   PVPI  547



>ref|XP_009803139.1| PREDICTED: germacrene C synthase-like isoform X1 [Nicotiana sylvestris]
Length=505

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/505 (53%), Positives = 356/505 (70%), Gaps = 1/505 (0%)
 Frame = -2

Query  1860  LKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDEN  1681
             LKE VRK+L+  P  S +KL L+D IQRLG+ YHF +EI+ SIQ+IF+   N  + DDE+
Sbjct  2     LKEIVRKMLVETPDNSTQKLVLIDTIQRLGLAYHFNDEIENSIQNIFNLSQNS-EDDDEH  60

Query  1680  NLYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGET  1501
             NLYV +LRFRL RQ+G+++S  VF++F + DGKFK++ T DV+G+LSLYEA+++ VH E 
Sbjct  61    NLYVAALRFRLARQQGYYMSSDVFKQFTNHDGKFKENHTNDVQGLLSLYEAAHMRVHDEE  120

Query  1500  TLDEALTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNK  1321
              L+EAL FT +HLES++P L+     +V+ AL  PIR+ +PRVGA++Y+ IYE   THN 
Sbjct  121   ILEEALIFTTTHLESVIPNLSNSLKVQVTEALSHPIRKAIPRVGARKYIHIYENIGTHND  180

Query  1320  VLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQY  1141
             +LL+FAKLDFN+LQK+H++EL+ +T WWKDL      P+A+ RL E YFW +G+YFEPQY
Sbjct  181   LLLKFAKLDFNMLQKLHRKELNELTSWWKDLDRANKFPYAKDRLVEAYFWTVGIYFEPQY  240

Query  1140  HFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAIL  961
               SR + T+++ + S++DD YD Y T DEL LFT+AIQR+D  A + +P YL+ IY  +L
Sbjct  241   SRSRSLVTKVVKMNSIIDDTYDAYATFDELVLFTDAIQRWDEGAMDLLPTYLRPIYQGLL  300

Query  960   DITTEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSC  781
             D+  EMEEV+AKE K  H+ Y   EMKK    Y++E  W    ++P  EEY+K  LVSS 
Sbjct  301   DVFNEMEEVLAKEGKADHIYYAKKEMKKVAEVYFKEAEWLNANYIPKCEEYMKNGLVSST  360

Query  780   YMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAV  601
               M     LV M +IITKE  +W+T+EPL ++A  +ICRLMDDM  HE EQ+RGHVAS V
Sbjct  361   GPMYGIISLVVMEEIITKEAFEWLTNEPLILRAASTICRLMDDMADHEVEQQRGHVASFV  420

Query  600   ECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD  421
             ECYMK Y VSKQEAYVE+ K I+ AWKDIN+E L P  VPM +L R LN +R      KD
Sbjct  421   ECYMKEYGVSKQEAYVEMRKKITNAWKDINKELLRPTAVPMFILERSLNFSRLADTFLKD  480

Query  420   NDIYTFSQVKFKSLITTTLVQPVTI  346
             +D YT  + K K LI +  V+ V I
Sbjct  481   DDGYTNPKSKVKDLIASLFVESVDI  505



>gb|AGW18157.1| terpene synthase 4 [Copaifera officinalis]
Length=557

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/541 (50%), Positives = 366/541 (68%), Gaps = 4/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  YHP+VWGD+FL Y S+  E+D   E  +  LKE VRK+L+ A    L K+ L+D 
Sbjct  19    RRSANYHPSVWGDHFLKYASQPLEVDEKMEDRIGTLKETVRKMLVPATDKPLTKVRLIDS  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNY--DNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             IQRLGVDYHFE+EI   +  I +NY  D  I  ++  +L+ ++L FRLLRQ+G+H+S  V
Sbjct  79    IQRLGVDYHFESEIDEVLCQIQNNYVKDGIITLNE--DLHSLALLFRLLRQQGYHVSPDV  136

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF D+ GK  +++  DVEGMLSLYEA++L +HGE  LDEAL FT++HL+ +   L++ 
Sbjct  137   FNKFKDEQGKISETIANDVEGMLSLYEAAHLRIHGEDILDEALDFTSTHLKFLTTQLSDS  196

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A  V  +LK P+R  LPR+ A+ Y   Y++D +H + LL FAKLDFN LQK+HQRE+  
Sbjct  197   HAGNVIRSLKRPLRMRLPRLEARHYFFTYQEDPSHIETLLAFAKLDFNGLQKLHQREIGN  256

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             +++WWKDL     LPFAR+RL E YFWILGVYFEP Y  +RRI T++I + S++DD+YDV
Sbjct  257   LSKWWKDLDFATKLPFARNRLVEAYFWILGVYFEPCYSLARRIMTKVISLTSIIDDIYDV  316

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +ELQLFT AI ++D S  + +P+Y+K IY  +LD+  E+E   AKE + F V+Y  
Sbjct  317   YGTLEELQLFTEAIDKWDISCMDFLPEYMKLIYQPLLDVYDEIERETAKEGRAFCVNYGK  376

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              +M+K +R Y  E  WF+  + P  EEY++V+ VSS Y M+ T   +G+G I T+E   W
Sbjct  377   EQMRKVVRAYLAEAKWFHNNYTPTLEEYMEVAQVSSAYSMLTTVSFIGVGSIATEEAFKW  436

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VT +P  VKA+  ICRLMDD++  +FEQERGHV SA+ECYMK +  +++E  VE  + + 
Sbjct  437   VTKDPKIVKASLIICRLMDDIVSSKFEQERGHVVSALECYMKQHGATEEETIVEFRRRVE  496

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDIN+ CL P  V   +L+R LNL+R I L+Y D+D YT S    K  I   L+ PV
Sbjct  497   NAWKDINEACLQPFEVAKPLLMRSLNLSRVISLLYTDDDCYTRSAGNTKKNIEALLINPV  556

Query  351   T  349
              
Sbjct  557   A  557



>gb|KHG04103.1| (-)-germacrene D synthase [Gossypium arboreum]
Length=545

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/548 (51%), Positives = 379/548 (69%), Gaps = 10/548 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             NVN   RRSV YHP++WGD FL+  SK+ +ID +  +E ++LK+E+ ++L+ AP  S +K
Sbjct  6     NVN---RRSVNYHPSIWGDIFLSCPSKM-KIDTATRQEYEELKQEITRMLMVAPDGSSQK  61

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHI  1624
               L+  I+RLGV Y FE EI+ ++Q  F ++    K D    L   SL+FRLLR+ G + 
Sbjct  62    YRLIATIKRLGVSYLFEKEIEDALQTNFHHHG--YKAD--QTLEYTSLQFRLLRENGFNA  117

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLE-SILP  1447
                +F  F D  G FK SLT DV+G+L LYEAS+L VHGE  L+EAL FT +HLE +   
Sbjct  118   QSEIFNNFKDDKGNFKISLTSDVKGLLELYEASHLLVHGEHILEEALAFTTTHLELAQRI  177

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
             G+    +A VSHA K PIR+ LPR+ A++++ +Y++D +H+K LL+FAKLDFNLLQ +H+
Sbjct  178   GIERPLSALVSHARKRPIRKALPRLEARQFISLYQEDDSHDKTLLKFAKLDFNLLQNLHK  237

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
              ELS I+RWWKDL     LPFAR RL ECYFWILGVYFEPQY F+R I T+ I + S +D
Sbjct  238   EELSKISRWWKDLDFATNLPFARDRLVECYFWILGVYFEPQYSFAREIMTKAIVMASTMD  297

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D+YDV+GT +EL+LFTNAI+R+D++  + +P Y+K  Y A+LD+  EME+VM K+ K + 
Sbjct  298   DIYDVHGTYEELELFTNAIERWDSNFIDRLPAYMKVFYKALLDLYEEMEKVMTKQGKSYR  357

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             V Y    MK+  + Y+ E  W++  +VP  EEYLK +LVSS Y M+A T  VGMGD++T+
Sbjct  358   VQYAKEAMKQLSQAYFIEAKWYHENYVPMVEEYLKTALVSSGYPMVAITSFVGMGDVVTE  417

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W ++ P  V+A+  I R+MDD++ H+FEQERGH ASAVECYMK + VS+++AY E+
Sbjct  418   ETFNWASNNPKIVRASSMISRIMDDIVSHKFEQERGHCASAVECYMKQHGVSEEKAYEEL  477

Query  546   EKLISKAWKDINQECL-HPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITT  370
             +KLI  AWKDINQE L  P   P  VL  VLNLAR +  +YK+ D YT      K+ IT+
Sbjct  478   KKLIDSAWKDINQELLFKPARAPFPVLTCVLNLARVMDFLYKEGDGYTHVGNVTKAGITS  537

Query  369   TLVQPVTI  346
              L+ PV I
Sbjct  538   LLIDPVPI  545



>gb|KDO69460.1| hypothetical protein CISIN_1g044370mg [Citrus sinensis]
Length=554

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/541 (49%), Positives = 370/541 (68%), Gaps = 6/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEV-RKVLIAAPPASLEKLELVD  1789
             RR+  +HP+VWGD F  Y ++       + +E++ LKEEV RK+L  A P    +L L+D
Sbjct  19    RRTANFHPSVWGDRFANYTAEDKMNHARDLKELKALKEEVGRKLLATAGPI---QLNLID  75

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE E++ ++QH+++  +     D E++LY +SLRFRLLRQ G+++SC  F
Sbjct  76    AIQRLGVGYHFERELEQALQHLYN--EKYSDDDTEDDLYRISLRFRLLRQHGYNVSCDKF  133

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D  G FK+SL  D  GMLSLYEA++LGVHGE  LDEA+ FT +HL+S+   L+   
Sbjct  134   NMFKDDKGNFKESLASDALGMLSLYEAAHLGVHGEDILDEAIAFTTTHLKSVATHLSNPL  193

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
              A+V HAL+ P+ R LPR+  + Y+ IY+ D +H K LL  AKLDFNL+Q +H++EL  I
Sbjct  194   KAQVRHALRQPLHRGLPRLEHRRYISIYQDDASHYKALLTLAKLDFNLVQSLHKKELCEI  253

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             +RWWKDL   + LPFAR R+ ECYFWILGVYFEP Y  +RRI T++I + S++DD+YDVY
Sbjct  254   SRWWKDLDFARKLPFARDRMVECYFWILGVYFEPNYSLARRILTKVIAMTSIIDDIYDVY  313

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT  I+R+D S+ +++P+Y++  + A+LD+  E+E+ +A E   + V Y   
Sbjct  314   GTPEELKLFTEVIERWDESSMDQLPEYMQTFFGALLDLYNEIEKEIANEGWSYRVQYAKE  373

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK  +  YY E  WF+  ++P  EEY++V+LV+S Y M+ T   +GM +I+TKE  DWV
Sbjct  374   AMKILVEGYYDESKWFHENYIPKMEEYMRVALVTSGYTMLTTVSFLGMDNIVTKETFDWV  433

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S P  ++A+  I R MDD+  H+FEQERGH ASAVECYMK + +S+QE   E+ + +S 
Sbjct  434   FSRPKIIRASEIIGRFMDDIKSHKFEQERGHAASAVECYMKQHGLSEQEVCEELYRQVSN  493

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL+P  VPM +L+R LNLAR I ++YK+ D YT    + K  +   L+  V 
Sbjct  494   AWKDINEECLNPTAVPMPLLMRALNLARVIDVVYKEGDGYTHVGNEMKQNVAALLIDQVP  553

Query  348   I  346
             I
Sbjct  554   I  554



>ref|NP_001268063.1| uncharacterized protein LOC100267145 [Vitis vinifera]
 gb|ADR74196.1| terpene synthase [Vitis vinifera]
Length=555

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/540 (50%), Positives = 374/540 (69%), Gaps = 4/540 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R  V YHP++WGD FL+Y  +       +E++++ LKEE+R+ L+     + ++L+ +D
Sbjct  18    NRPVVQYHPSIWGDQFLSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTSQQLKFID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQEGHHISCGV  1612
              +QRLGV YHFE EI+  +QHI+D+Y N   GDD E ++Y V+L+FRLLRQ G +ISCG+
Sbjct  78    AVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNISCGL  134

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F +F D+ G FK +L  DV GML LYEA++L VHGE  L +AL FT +HL++++  L   
Sbjct  135   FNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYH  194

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS 
Sbjct  195   LAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSN  254

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL ECYFW+LGVYFEPQY  +RRI T++I + S+LDD++D 
Sbjct  255   LARWWKELDFATKLPFARDRLVECYFWMLGVYFEPQYLRARRILTKVIAMISILDDIHDA  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ +++P+Y+K  Y A+LD+  E+EE M KE   + V Y  
Sbjct  315   YGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAK  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP FEEY++V+LVSS Y ++ATT  VGMG+I TKE  DW
Sbjct  375   EVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCILATTSFVGMGEIATKEAFDW  434

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VTS P  + ++  I RLMDD+  H+FEQ+RGHVASAVECYMK Y VS+++ Y E +K I 
Sbjct  435   VTSNPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYKEFQKQIE  494

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AW DINQECL P  V M +L R+LNL RA  ++YK+ D YT      +  I + L+  V
Sbjct  495   NAWLDINQECLKPTAVSMPLLARILNLTRAADVVYKEQDSYTHVGKVMRDNIASVLINAV  554



>gb|AAX40666.1| sesquiterpene synthase [Fabiana imbricata]
Length=546

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/540 (49%), Positives = 372/540 (69%), Gaps = 1/540 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HPTVWGD+FLAY   L   +  EE+E   LKEEVRK+L+     SL+ L+L++K
Sbjct  7     RRSDNHHPTVWGDHFLAY-IHLLGANEWEEKEHGDLKEEVRKMLLMTSSKSLQMLDLINK  65

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+ S+ +I+  Y+  I   D ++L+ VSL FRLLR++G+ +SC  F 
Sbjct  66    IQLLGVAYHFEHEIEESLSYIYTRYEEWINEVDNSDLHAVSLSFRLLRRQGYCVSCDAFR  125

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             K+++  G +  +L  +V G+LSLYEA+ L V GE  LDEA+ FT +HL+ +LP L+   A
Sbjct  126   KYIEGQGDYNKALVSNVHGLLSLYEAAQLRVEGEEILDEAVNFTITHLKLLLPKLSNSLA  185

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V +ALK PI +T+ RV +++Y+  Y++D +HN+VLL FAKLDFN+LQK+H+REL  IT
Sbjct  186   IQVHNALKYPINKTIVRVASRKYISFYQEDDSHNEVLLNFAKLDFNILQKLHKRELCDIT  245

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L   + L FAR R+ E YFW LGVYFEPQY  +R I T+++C  S+ DD+YD YG
Sbjct  246   RWWKELDFAQTLHFARDRVVELYFWSLGVYFEPQYRVARNILTKMLCFISITDDIYDTYG  305

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T DEL L TNAI+R++ +AS ++P Y+K  YLA+L+   E E+ + KENK F V+Y+I E
Sbjct  306   TLDELTLLTNAIERWNINASEQLPSYMKLFYLALLNFYNEAEKELLKENKSFRVNYSIVE  365

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK +R Y+QE  W+   ++P  E+Y+K  +VSS Y+++ TT  +G+G   TKE  DW+ 
Sbjct  366   MKKLVRAYFQEAQWYNGDNIPTMEQYVKNGIVSSTYLLLVTTSSLGLGKEATKEAFDWIA  425

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             +EP    A   I RL +D++ HE E +RG VASA+ECYM  Y V+K+EAY ++ K+I   
Sbjct  426   TEPPIAVAASIIGRLSNDIVSHERELKRGDVASAIECYMNDYGVTKEEAYTKMRKIIENK  485

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WK++N+ CL PL V   + + +LNL+R     YKD D YT S+   + +I+  LV P+TI
Sbjct  486   WKNVNRGCLKPLAVARVLPMAMLNLSRVAEFFYKDEDAYTVSKNNLRDIISMVLVDPITI  545



>emb|CAN75099.1| hypothetical protein VITISV_019788 [Vitis vinifera]
Length=530

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/542 (49%), Positives = 366/542 (68%), Gaps = 33/542 (6%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             GRR   +HP++WGD+FL+Y S+ T  D   ++ VQQLKEEVRK+L+AA   S +KL L+D
Sbjct  21    GRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSXQKLLLID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG-V  1612
              IQRLGV YHFE+EI   ++H+FD+  + +    E ++Y  SLRFRLLRQ+G+H+SC  +
Sbjct  81    AIQRLGVAYHFESEIDEXLKHMFDS--SVVSA--EEDVYTASLRFRLLRQQGYHVSCADL  136

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F  F D +G FK+SL+ DV GMLSLYEA++  VHGE  LDEAL FT +HL+S        
Sbjct  137   FNNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEALAFTTTHLQSA----TNS  192

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
             +  K +H      +   PR+ A+ Y  +Y+ D +HNK LL+ AK+ F  + ++       
Sbjct  193   SCPKAAHP-----KGVSPRLEARHYFSVYQADDSHNKALLKLAKVGFQPITEITPEG---  244

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
               +WWKDL     LPFAR R+ ECYFWILGVYFEPQ+ F+RRI T++I + S++DD+YDV
Sbjct  245   -AKWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRILTKVIAMTSIIDDIYDV  303

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LFT A++R+D SA +++P+Y++  Y A+L + +E+EE MAKE +        
Sbjct  304   YGTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEIEEEMAKEGR--------  355

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
                      YY+E  W   + +P  EEY+ V+LV+S Y M+ATT  VGMGD +TKE  DW
Sbjct  356   -------SAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDW  408

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             + S+P  V+A+  +CRLMDDM+ H+FEQ+RGHVASAVECYMK +  S+QE + E  K + 
Sbjct  409   IFSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQETHNEFHKQVR  468

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDIN+ECL P  VPM +L+RVLNLAR I +IYK+ D YT S    K  +T+ L+ PV
Sbjct  469   DAWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHSGTVLKDFVTSMLIDPV  528

Query  351   TI  346
              I
Sbjct  529   PI  530



>ref|XP_002283076.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
Length=559

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/546 (51%), Positives = 372/546 (68%), Gaps = 10/546 (2%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDP-SEEREVQQ---LKEEVRKVLIAAPPASLEK  1804
             + RRS  + P  WGD FL Y    T  DP +  R+VQQ   LK+E+R  L A    S + 
Sbjct  20    AARRSANFRPCFWGDRFLTY----TPADPVTHARKVQQIEELKDELRNELKATARKSSQL  75

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHI  1624
             L  +D IQRLG+ Y FE EI+ +++ ++  Y+     +D+      SLRFRLLRQEG+HI
Sbjct  76    LNFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLT--NASLRFRLLRQEGYHI  133

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
                VF KF D +G FK+SLT D+ G+L+LYEA++L VHGE  L+EAL F+ +HL+S+   
Sbjct  134   PPDVFNKFKDDEGNFKESLTGDLPGLLALYEATHLMVHGEDILEEALAFSTAHLQSMATD  193

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
                  AA+V+ ALK PIR+ L RV A+ Y+ +Y++D  HNK LL+ +KLDFNLLQ +H++
Sbjct  194   STHPLAAQVTRALKRPIRKCLTRVEARHYISVYQEDGPHNKTLLKLSKLDFNLLQSLHRK  253

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ELS +TRWWK L   K +PFAR RL E YFWILGVYFEPQY  +RRI  +++ + S++DD
Sbjct  254   ELSEVTRWWKGLNFAKKMPFARDRLVEGYFWILGVYFEPQYSLARRILIKVLAMISIIDD  313

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT +EL+LFT AI+R+D ++ N++P Y+K  Y A+LD+  EMEE MAKE  L+ V
Sbjct  314   IYDAYGTFEELKLFTEAIERWDANSVNQLPDYMKPCYQALLDVYEEMEEEMAKEGNLYRV  373

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    +++QI+ Y+ E  W   ++ P  +EY+  +L+SS Y M+ TT  VGMGDI TKE
Sbjct  374   QYAKAAIERQIQAYFVEAKWLNQEYTPTLDEYMSNALISSGYSMLMTTSFVGMGDIATKE  433

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
               DWV ++P  V+A+  ICRLMDD++ HEFEQ+RGHVASAVECYMK + V KQEAY E+ 
Sbjct  434   AFDWVFNDPKMVRASSVICRLMDDIVSHEFEQKRGHVASAVECYMKQHGVCKQEAYDELN  493

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD+N+ECL P  VPM +L RVLN +R I ++YKD D YT      K LI + L
Sbjct  494   KQVVNAWKDMNKECLKPTQVPMPLLTRVLNFSRVIDILYKDEDQYTHVGKLMKDLIASIL  553

Query  363   VQPVTI  346
             + PV I
Sbjct  554   IDPVPI  559



>gb|AFQ23183.1| sesquiterpene synthase [Gossypium hirsutum]
 gb|AGX84975.1| terpene synthase [Gossypium hirsutum]
Length=545

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/548 (51%), Positives = 378/548 (69%), Gaps = 10/548 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             NVN   RRSV YHP++WGD FL+  SK+ +ID    +E ++LK+E+ ++L+ AP  S +K
Sbjct  6     NVN---RRSVNYHPSIWGDIFLSCPSKM-KIDTVTRQEYEELKQEITRMLMVAPDGSSQK  61

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHI  1624
               L+  I+RLGV Y FE EI+ ++Q  F ++    K D    L   SL+FRLLR+ G + 
Sbjct  62    YRLIATIKRLGVSYLFEKEIEDALQTDFHHHG--YKAD--QTLEYTSLQFRLLRENGFNA  117

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLE-SILP  1447
                +F  F D  G FK SLT DV+G+L LYEAS+L VHGE  L+EAL FT +HLE +   
Sbjct  118   QAEIFNNFKDDKGNFKISLTSDVKGLLELYEASHLLVHGEHILEEALAFTTTHLELAQRI  177

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
             G+    +A VSHA K PIR+ LPR+ A++++ +Y++D +H+K LL+FAKLDFNLLQ +H+
Sbjct  178   GIERPLSALVSHARKRPIRKALPRLEARQFISLYQEDDSHDKTLLKFAKLDFNLLQNLHK  237

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
              ELS I+RWWKDL     LPFAR RL ECYFWILGVYFEPQY F+R I T+ I + S +D
Sbjct  238   EELSKISRWWKDLDFATNLPFARDRLVECYFWILGVYFEPQYSFAREIMTKAIVMASTMD  297

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D+YDV+GT +EL+LFTNAI+R+D++  + +P Y+K  Y A+LD+  EME+VM K+ K + 
Sbjct  298   DIYDVHGTYEELELFTNAIERWDSNFIDRLPAYMKVFYKALLDLYEEMEKVMTKQGKSYR  357

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             V Y    MK+  + Y+ E  W++  +VP  EEYLK +LVSS Y M+A T  VGMGD++T+
Sbjct  358   VQYAKEAMKQLSQAYFIEAKWYHENYVPMVEEYLKTALVSSGYPMVAITSFVGMGDVVTE  417

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W ++ P  V+A+  I R+MDD++ H+FEQERGH ASAVECYMK + VS+++AY E+
Sbjct  418   ETFNWASNNPKIVRASSMISRIMDDIVSHKFEQERGHCASAVECYMKQHGVSEEKAYEEL  477

Query  546   EKLISKAWKDINQECL-HPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITT  370
             +KLI  AWKDINQE L  P   P  VL  VLNLAR +  +YK+ D YT      K+ IT+
Sbjct  478   KKLIDSAWKDINQELLFKPARAPFPVLTCVLNLARVMDFLYKEGDGYTHVGNVTKAGITS  537

Query  369   TLVQPVTI  346
              L+ PV I
Sbjct  538   LLIDPVPI  545



>sp|B5A435.1|STPS1_SANAL RecName: Full=Sesquiterpene synthase; Short=SaSesquiTPS1 [Santalum 
album]
 gb|ACF24768.1| sesquiterpene synthase [Santalum album]
Length=559

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/549 (48%), Positives = 371/549 (68%), Gaps = 5/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             N+    R    + P++WGD F+ Y  +       +ER+V++LKE+VR+ L A     L++
Sbjct  13    NLKELSRPIANFPPSIWGDRFINYACEDENEQAQKERQVEELKEQVRRELAATVDKPLQQ  72

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L ++D  QRLG+ YHFENEI+ S++HI+ +    +NC +G   ++LY V+L FRLLRQ+G
Sbjct  73    LNIIDATQRLGIAYHFENEIEESLEHIYLHTYVENNCFQGS--HDLYSVALWFRLLRQDG  130

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             + +SC VF+KF D +  FK+SL +D +G+L LYEA++L VHGE  LD+AL F  + LESI
Sbjct  131   YKVSCDVFDKFRDYEDNFKNSLMEDAKGLLELYEATHLSVHGEEMLDDALEFAKTRLESI  190

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +  LN   A +V HAL  P+R+ LPR+ A  + +IYE   +HNK LL+ AKLDFNLLQ +
Sbjct  191   VNHLNYPLAEQVRHALYRPLRKGLPRLEAVYFFRIYEAYDSHNKALLKLAKLDFNLLQSL  250

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H++ELS + RWWK L      PFAR RL E YFW+LGVYFEPQY  +R+I  ++  + S 
Sbjct  251   HKKELSDMARWWKSLDFAAKFPFARDRLVEGYFWVLGVYFEPQYSLARKIIIKVFTMIST  310

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YD YGT DEL+LFT A+QR+D  + +++P+Y+K  Y +ILD+  E+EE M  +  L
Sbjct  311   IDDIYDAYGTLDELELFTKAMQRWDVGSLDQLPEYMKPCYKSILDVYNEIEEEMDNQGSL  370

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             F + Y    MKK +  Y  E  W + K+VP FEEY+ V+LV+S Y  + T   +GMG+I 
Sbjct  371   FRMHYAKEVMKKLVEGYMDEAKWCHEKYVPTFEEYMPVALVTSGYTFLTTISYLGMGEIA  430

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             +KE  DW+ S P  ++A+ S+CRLMDDM  H+FEQERGHVAS +ECYMK Y V+++EA+ 
Sbjct  431   SKEAFDWLFSHPPVIEASESVCRLMDDMRSHKFEQERGHVASGIECYMKQYGVTEEEAHD  490

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E  K + KAWKDIN+ECL P  VP  +L+R+LNL R I +IYK+ D YT  +   K  I 
Sbjct  491   EFRKQLVKAWKDINEECLRPYRVPKPLLMRILNLTRVIDVIYKNEDGYTHVKKAMKDNIA  550

Query  372   TTLVQPVTI  346
             + L+ P+ +
Sbjct  551   SLLIDPMIV  559



>gb|ADR74194.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/539 (49%), Positives = 373/539 (69%), Gaps = 2/539 (0%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    +HP +WGD F+ Y  +       +E++V+ LK+EVR+ L+AA     + L  +D
Sbjct  18    NRPRAKFHPNIWGDLFITYTPEDEVSRACKEKQVEDLKDEVRRELMAAAGNPSQLLNFID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              +QRLGV YHFE EI+ S+QHI+D + +    D  ++LY ++LRFRLLRQ+G++ISCG+F
Sbjct  78    AVQRLGVAYHFEREIEESLQHIYDRFHDA--DDTNDDLYNIALRFRLLRQQGYNISCGIF  135

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF D++G FK+ L  +++GML LYEA++L VHGE  L+EAL FT +HL++ +  L    
Sbjct  136   NKFKDEEGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALAFTTTHLKAKVESLGCPL  195

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V+HALK PIR+ L R+ A+ Y+ IY+ +  H+K LL+ AKLDFNL+Q +H+ ELS +
Sbjct  196   AEQVAHALKRPIRKGLERLEARWYISIYQDEAFHDKTLLKLAKLDFNLVQSLHKEELSNL  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              RWWK L     LPFAR RL E YFWI+GVYFEPQY ++ RI T+II + +V+DD+YD Y
Sbjct  256   ARWWKKLDFATKLPFARDRLVEGYFWIVGVYFEPQYLWAIRILTKIIVMTTVIDDIYDAY  315

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +E++ FT AI+R+D ++ + +P+Y+K  Y+A+LD+  E+EE M KE   + V Y I 
Sbjct  316   GTFEEIKHFTEAIERWDINSIDHLPEYMKLFYVALLDVYKEIEEEMEKERHQYRVHYAID  375

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R Y+ E  WF+ +H+P  EEY+ V+L+SS Y ++AT+  +GMG+I++KE  DWV
Sbjct  376   AMKNQVRAYFAEAKWFHEQHIPTMEEYMSVALLSSGYSLLATSSFIGMGEIVSKEAFDWV  435

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  ++A+  I R MDDM  H+FEQERGHVAS +ECYMK   VS+++AY E    I  
Sbjct  436   ISDPKIIRASTVIARFMDDMTSHKFEQERGHVASGIECYMKQCGVSEEQAYKEFHNQIVN  495

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             AW DINQECL P  VPM +L RVLNL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  496   AWLDINQECLKPTAVPMPLLTRVLNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  554



>emb|CBI20475.3| unnamed protein product [Vitis vinifera]
Length=609

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/546 (51%), Positives = 372/546 (68%), Gaps = 10/546 (2%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDP-SEEREVQQ---LKEEVRKVLIAAPPASLEK  1804
             + RRS  + P  WGD FL Y    T  DP +  R+VQQ   LK+E+R  L A    S + 
Sbjct  70    AARRSANFRPCFWGDRFLTY----TPADPVTHARKVQQIEELKDELRNELKATARKSSQL  125

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHI  1624
             L  +D IQRLG+ Y FE EI+ +++ ++  Y+     +D+      SLRFRLLRQEG+HI
Sbjct  126   LNFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLT--NASLRFRLLRQEGYHI  183

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
                VF KF D +G FK+SLT D+ G+L+LYEA++L VHGE  L+EAL F+ +HL+S+   
Sbjct  184   PPDVFNKFKDDEGNFKESLTGDLPGLLALYEATHLMVHGEDILEEALAFSTAHLQSMATD  243

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
                  AA+V+ ALK PIR+ L RV A+ Y+ +Y++D  HNK LL+ +KLDFNLLQ +H++
Sbjct  244   STHPLAAQVTRALKRPIRKCLTRVEARHYISVYQEDGPHNKTLLKLSKLDFNLLQSLHRK  303

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ELS +TRWWK L   K +PFAR RL E YFWILGVYFEPQY  +RRI  +++ + S++DD
Sbjct  304   ELSEVTRWWKGLNFAKKMPFARDRLVEGYFWILGVYFEPQYSLARRILIKVLAMISIIDD  363

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT +EL+LFT AI+R+D ++ N++P Y+K  Y A+LD+  EMEE MAKE  L+ V
Sbjct  364   IYDAYGTFEELKLFTEAIERWDANSVNQLPDYMKPCYQALLDVYEEMEEEMAKEGNLYRV  423

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    +++QI+ Y+ E  W   ++ P  +EY+  +L+SS Y M+ TT  VGMGDI TKE
Sbjct  424   QYAKAAIERQIQAYFVEAKWLNQEYTPTLDEYMSNALISSGYSMLMTTSFVGMGDIATKE  483

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
               DWV ++P  V+A+  ICRLMDD++ HEFEQ+RGHVASAVECYMK + V KQEAY E+ 
Sbjct  484   AFDWVFNDPKMVRASSVICRLMDDIVSHEFEQKRGHVASAVECYMKQHGVCKQEAYDELN  543

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD+N+ECL P  VPM +L RVLN +R I ++YKD D YT      K LI + L
Sbjct  544   KQVVNAWKDMNKECLKPTQVPMPLLTRVLNFSRVIDILYKDEDQYTHVGKLMKDLIASIL  603

Query  363   VQPVTI  346
             + PV I
Sbjct  604   IDPVPI  609



>ref|XP_002321642.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
 gb|EEF05769.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
Length=553

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/540 (49%), Positives = 376/540 (70%), Gaps = 6/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP++WGD F+++  K    + +E +E+++L+E+ ++ L+AA   S ++L+L+D 
Sbjct  20    RRTANYHPSIWGDQFISHLPKDKVHEATELQEIEKLREQFKRELLAAASNSSQQLDLIDA  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI+ ++Q I   Y+N I  +DE+ LY  +L FRLLRQ G+++SC +F 
Sbjct  80    IQRLGVAYHFETEIEEALQKI---YNNRIDMEDED-LYNTALGFRLLRQHGYNVSCDIFN  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK S   DV G+L LYEA++L VHGE  LDEAL FT  HL+S+    N    
Sbjct  136   KFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALAFTTIHLKSMETSPNCPLT  193

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             AKVSHALK PI+R +PR+ ++ Y+ IY+ + + NK LLR AKL+FNL+Q++H+ EL+ IT
Sbjct  194   AKVSHALKQPIQRGVPRLESRRYISIYQDEPSCNKTLLRLAKLNFNLVQELHKEELAEIT  253

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK L   + LPFAR R+ EC+FWI+GVYFEPQY  +R+I T++I + S++DD+YDVYG
Sbjct  254   RWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTKVIAMTSIIDDIYDVYG  313

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI R+DT + +++P Y+K  Y A+L++ +E+EE +AKE   + V Y    
Sbjct  314   TLEELELFTEAIDRWDTKSMDQLPDYMKICYEALLNVFSEIEEKVAKEGWSYRVHYGKDA  373

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK  +  Y+ E  WF+  H+P  EEY++V+LV+S Y M+ T   +GMGD++TK+  DWV 
Sbjct  374   MKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSFIGMGDMVTKQAFDWVF  433

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P  ++A+ +I RLMDD+  H+FEQERGH AS VECY++ Y +S+QE Y E    +  A
Sbjct  434   NHPKIIRASETIGRLMDDVKSHKFEQERGHAASGVECYIRQYGLSEQEVYKEFHMQVVNA  493

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P   PM +L R+LNL+R I +IYK+ D YT      K+ + + L+  V I
Sbjct  494   WKDINEECLKPTAAPMPLLERILNLSRVIDVIYKEEDGYTHVGKVMKNNVASLLINSVPI  553



>dbj|BAJ46125.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/542 (48%), Positives = 375/542 (69%), Gaps = 6/542 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP +WGD F+ Y            + +++LK+ VR+ L+ A    L +L L+D 
Sbjct  19    RRNANYHPNIWGDRFINYVPVDKMNHTCHLQAIEELKDAVRRELLTA--TGLSQLNLIDA  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE E++ ++QH++  + N    D E+NLY++SLRFRLLRQ G+++SC +  
Sbjct  77    IQRLGVGYHFERELEEALQHVY--HKNHYHDDTEDNLYIISLRFRLLRQHGYYVSCDILN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG--LNEL  1432
             KF D+   FK+SLT DV GMLSLYEA++LG HGE  LDEA+ FT +HL+S+      N  
Sbjct  135   KFKDEKDNFKESLTTDVPGMLSLYEAAHLGAHGEDILDEAIAFTTTHLKSLAIDHLRNPS  194

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A++V HAL+ P+ R +PR+  + Y+ IY+ + +HNK L++  KLDFNL+Q +H++ELS 
Sbjct  195   LASQVIHALRQPLHRGVPRLENRRYISIYQDEVSHNKALVKLFKLDFNLVQSLHKKELSE  254

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I++WWK+L +   LPFAR RL ECYFWI+GVY+EPQY  +R+I T+II + S++DD+YDV
Sbjct  255   ISKWWKELDLANKLPFARDRLVECYFWIIGVYYEPQYSLARKILTKIIAMASIIDDIYDV  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT++EL LFT+AI+R+D S  + +P+Y++  Y A+LD+  E+E+ +AKE   + V Y  
Sbjct  315   YGTREELNLFTDAIERWDASCMDLLPEYMQIFYEALLDLYNEIEKEIAKEGWSYRVHYAK  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK  +R Y+ E  WF+  ++P  EEY++V+LV+S Y M+ T+  +GM +I+TKE  DW
Sbjct  375   EAMKILVRGYHDESKWFHNNYIPTMEEYMRVALVTSAYTMLTTSSFLGMDNIVTKETFDW  434

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V S P  ++A+ +I RLMDD+  H+FEQERGH ASAVECYM+ + VS+QE   E  + + 
Sbjct  435   VFSGPKIIRASETISRLMDDVKSHKFEQERGHAASAVECYMEQHGVSEQEVCKEFYQQVG  494

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDINQ+ L P  VPM +L+RVLNLAR I ++YK+ D YT      K  + + L+ P+
Sbjct  495   NAWKDINQDFLKPTDVPMTILMRVLNLARVIDVVYKEGDGYTHVGKVMKENVASLLIDPI  554

Query  351   TI  346
              +
Sbjct  555   PV  556



>ref|XP_011095783.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=627

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 385/549 (70%), Gaps = 10/549 (2%)
 Frame = -2

Query  1992  MDVNVNSSG-RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPA  1816
             +D+ V+    RRSV YHP+VWGDYFLAY S  TEI  +EE E+++ KE VRKVL   P  
Sbjct  84    LDLKVDQDDVRRSVKYHPSVWGDYFLAYVS--TEISATEEEELRRPKEMVRKVLARTPDN  141

Query  1815  SLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQE  1636
             S  KLEL+D IQRLGV YHFE EI   +Q   D Y      D  N+L +V+LRFRLLRQ 
Sbjct  142   SYHKLELIDAIQRLGVGYHFEEEIDKFLQFTHDTYLEYSSKD--NDLRIVALRFRLLRQH  199

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             G+ +SC +F KF+D +G FK SL K++E ML L+EA+   + GE  L++AL F++S+LES
Sbjct  200   GYPVSCDIFNKFIDGEGNFKASLIKNLEVMLELFEAAQFRIVGEEILEKALEFSSSNLES  259

Query  1455  ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
              L  +N   + +V  ALK+PI ++  RVGAK+++ IY+Q+ +H+++LL FAKLDFN++QK
Sbjct  260   SLSNMNSSLSTQVKEALKIPILKSSNRVGAKKFISIYQQNVSHSEILLNFAKLDFNIIQK  319

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
              HQ+EL+ ITRWWKDL     LPFAR R+ ECYFW +GVYFEP YH +RR+ T+II I S
Sbjct  320   THQKELNDITRWWKDLDFANRLPFARDRVVECYFWAVGVYFEPHYHIARRMLTKIINITS  379

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             +LDD+YDVYGT D+LQLFTN IQR+D +A  ++P Y+K  Y A+ D+  EME  + K   
Sbjct  380   ILDDIYDVYGTLDDLQLFTNLIQRWDVNALEQLPSYMKICYEALCDVYIEMENELEKTGG  439

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
              + + Y   EMKK +R Y +E  W Y K +P  EEY+KV++V+S YMM+ TT LVGMG++
Sbjct  440   SYRIKYAKEEMKKLVRAYLEEAKWSYNKDMPRMEEYMKVAIVTSTYMMLLTTSLVGMGNL  499

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             +TK+  DW+TSEPL + A+  ICRL +D++G+ FE++     +AVECYM    VS++EA+
Sbjct  500   VTKKDFDWITSEPLLLLASSIICRLTNDLVGYGFEKK----PTAVECYMNENGVSREEAF  555

Query  555   VEIEKLISKAWKDINQECLHP-LPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSL  379
              ++++ ++KAWKD+NQE L P +PV M VL RVLN  R + L Y + D YT S+   K +
Sbjct  556   AKLQEQVTKAWKDMNQESLWPTIPVSMPVLTRVLNFTRIVHLFYVEGDEYTNSKANIKDI  615

Query  378   ITTTLVQPV  352
             I + LV+PV
Sbjct  616   IHSVLVEPV  624



>ref|XP_009794478.1| PREDICTED: germacrene C synthase-like [Nicotiana sylvestris]
Length=558

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/558 (50%), Positives = 380/558 (68%), Gaps = 13/558 (2%)
 Frame = -2

Query  1992  MDVNVNSSG-------RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVL  1834
             MD N  SS        R    +H +VWGDYFL+Y  +LTEI   E+ E ++LKE+VR++L
Sbjct  5     MDDNTFSSSISTTNIERPLANFHSSVWGDYFLSYTPQLTEISSQEKVEFEELKEKVRQML  64

Query  1833  IAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRF  1654
             +  P    +KLEL+D IQRLGV YHFENEIQ SI++IFD        DD  NLYVV+LRF
Sbjct  65    VETPDNKTQKLELIDTIQRLGVAYHFENEIQTSIKNIFDASQQSENKDD--NLYVVALRF  122

Query  1653  RLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFT  1474
             RL+RQ+ H++S  VF+KF +KDG+FK++LTKDV+G+LSLYEA++L VHGE  L++A++FT
Sbjct  123   RLMRQQRHYMSSDVFKKFTNKDGRFKETLTKDVQGLLSLYEAAHLRVHGEEILEQAMSFT  182

Query  1473  ASHLESILPGL-NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKL  1297
              ++LES+ P L N L  A+VS AL  PI   LPRVGAK+YM +YE++++HN +LL+FAKL
Sbjct  183   LTNLESMGPKLSNSLLKAQVSEALSQPIHTNLPRVGAKKYMSMYEENESHNDLLLKFAKL  242

Query  1296  DFNLLQKVHQRELSGITR-WWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRIT  1120
             DFN+ QKV+Q EL   TR WWKDL      P+AR RL ECY+  +GV FEPQY  +R+I 
Sbjct  243   DFNIAQKVYQSELYEFTRYWWKDLDYANKFPYARDRLVECYYGAVGVLFEPQYSRTRKIQ  302

Query  1119  TQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEME  940
              ++I I +++DD +D Y T DE+  FTNAI+R D SA + VP  L+  Y  ++D   EME
Sbjct  303   AKLINIITMVDDTFDAYATFDEIVAFTNAIERCDISAMDLVPPNLRHAYQVLIDFFNEME  362

Query  939   EVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATT  760
             + + KE K + V Y    MKK IR Y++E  W    ++P  +EYLK    S   +++A T
Sbjct  363   QELTKEGKAYRVYYAKFVMKKCIRAYFKEAQWLSAGYIPKCDEYLKNGSASIGIILMAVT  422

Query  759   CLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGY  580
              LVG+ + ITKE L+WV ++PL ++A+  I RL DD+IGH FEQ+RGHVAS +ECYMK Y
Sbjct  423   SLVGLEEFITKETLEWVINDPLILRASGVISRLKDDIIGHNFEQQRGHVASFIECYMKEY  482

Query  579   NVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFS  400
               SKQEAY  +EK ++ AWKDIN E   P  VP  VL R++N  R +   +++ND +  +
Sbjct  483   GASKQEAYAAVEKEMANAWKDINTEFFRPSQVPTFVLERIINPTRLVNG-FQEND-FINT  540

Query  399   QVKFKSLITTTLVQPVTI  346
             Q ++K  IT+ LV  + I
Sbjct  541   QGEYKDKITSLLVDSMKI  558



>ref|XP_006476905.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=554

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/541 (48%), Positives = 370/541 (68%), Gaps = 6/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEV-RKVLIAAPPASLEKLELVD  1789
             RR+  +HP+VWGD F  Y ++       + +E++ LKEEV RK+L  A P    +L L+D
Sbjct  19    RRTANFHPSVWGDRFANYTAEDKMNHARDLKELKALKEEVGRKLLATAGPI---QLNLID  75

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQRLGV YHFE E++ ++QH+++  +     D E++LY +SLRFRLLRQ G+++SC  F
Sbjct  76    AIQRLGVGYHFERELEQALQHLYN--EKYSDDDTEDDLYRISLRFRLLRQHGYNVSCDKF  133

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F D  G FK+SL  D  GMLSLYEA++LGVHGE  LDEA+ FT +HL+S+   L+   
Sbjct  134   NMFKDDKGNFKESLASDALGMLSLYEAAHLGVHGEDILDEAIAFTTTHLKSVATHLSNPL  193

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
              A+V HAL+ P+ R LPR+  + Y+ IY+ D +H K LL  AKLDFNL+Q +H++EL  I
Sbjct  194   KAQVRHALRQPLHRGLPRLEHRRYISIYQDDASHYKALLTLAKLDFNLVQSLHKKELCEI  253

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             +RWWKDL   + LPFAR R+ EC+FWILGVYFEP Y  +RRI T++I + S++DD+YDVY
Sbjct  254   SRWWKDLDFARKLPFARDRMVECFFWILGVYFEPNYSLARRILTKVIAMTSIIDDIYDVY  313

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL+LFT  I+R+D S+ +++P+Y++  + A+LD+  E+E+ +A E   + V +   
Sbjct  314   GTPEELKLFTEVIERWDESSMDQLPEYMQTFFGALLDLYNEIEKEIANEGWSYRVQHAKE  373

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK  +  YY E  WF+  ++P  EEY++V+LV+S Y M+ T   +GM +I+TKE  DWV
Sbjct  374   AMKILVEGYYDESKWFHENYIPKMEEYMRVALVTSGYTMLTTVSFLGMDNIVTKETFDWV  433

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S P  ++A+  I R MDD+  H+FEQERGH ASAVECYMK + +S+QE   E+ + +S 
Sbjct  434   FSRPKIIRASEIIGRFMDDIKSHKFEQERGHAASAVECYMKQHGLSEQEVCEELYRQVSN  493

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL+P  VPM +L+R LNLAR I ++YK+ D YT    + K  +   L+  V 
Sbjct  494   AWKDINEECLNPTAVPMPLLMRALNLARVIDVVYKEGDGYTHVGNEMKQNVAALLIDQVP  553

Query  348   I  346
             I
Sbjct  554   I  554



>sp|J7LJN5.1|TPS6_PHYDL RecName: Full=Beta-caryophyllene synthase; AltName: Full=Terpene 
synthase 6; Short=LdTPS6 [Phyla dulcis]
 gb|AFR23370.1| beta-caryophyllene synthase [Phyla dulcis]
Length=555

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/550 (50%), Positives = 380/550 (69%), Gaps = 20/550 (4%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R+SVTYHP+VWGDYFL   S   E   SE  E+Q+ ++EV K+L A    SL+KLEL+D 
Sbjct  16    RQSVTYHPSVWGDYFLTPASNHEESSTSEGEELQESRQEVEKLLGATHDDSLQKLELIDA  75

Query  1785  IQRLGVDYHFENEIQASIQHIF-------DNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             IQRLGVD+HF+ EI+ S+Q I+       D+YD+     ++ +L+ V+LRFRLLRQ+G++
Sbjct  76    IQRLGVDHHFQKEIEKSLQDIYLRCCNDKDDYDH-----NQTDLHTVALRFRLLRQQGYN  130

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             IS   F KF D++GKF++SL  DV GMLSLYEA++ GV GE  LDEAL F++S+L+SIL 
Sbjct  131   ISSETFNKFTDRNGKFEESLADDVRGMLSLYEAAHCGVQGEKILDEALVFSSSNLKSILA  190

Query  1446  G---LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
                  N    A++  A   PIR+ L   GA+++M +YE+D++H++ LL+FA+LDFN  QK
Sbjct  191   KNHMSNSGLTARIEEAFDTPIRKCLTNFGARKFMSMYEEDESHSEALLKFARLDFNFSQK  250

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQ+E+S +TRWWK+L     LPFAR R+ ECY W LG++ EPQY+ +R   +++I + S
Sbjct  251   LHQKEISDLTRWWKELDFKTKLPFARDRMVECYCWTLGIHPEPQYNLARNFLSKVIMLAS  310

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             V+DD+YDV GT DELQLFT+AIQR+D SA  ++P Y++  Y A+L++  E+EE + + + 
Sbjct  311   VIDDIYDVRGTLDELQLFTDAIQRWDISAMEQLPPYMRVCYEALLNVYAEVEE-LERIDG  369

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
              + V Y   EMKK  R Y +E  W Y K++P F+EY+ V++ SS Y+M+A  CLVG+G+ 
Sbjct  370   PYRVHYAKEEMKKLARAYLEESQWLYKKYIPTFKEYMSVAIPSSGYIMVAGNCLVGLGNS  429

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             +  +  DWV+ EPL VKA+  I RLMDDM GH FE++     SAVECY      S++EA+
Sbjct  430   LVMKDFDWVSCEPLMVKASAIIARLMDDMAGHGFEKK----ISAVECYTNENGASEKEAF  485

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
              E+EK +S AWKD+NQE LHP  V M VL RVLN AR I L+YKD D YT S+   K LI
Sbjct  486   EELEKQVSNAWKDMNQEFLHPTAVSMTVLTRVLNAARVIHLLYKDGDSYTNSKTYIKELI  545

Query  375   TTTLVQPVTI  346
                L+QPV I
Sbjct  546   EAVLIQPVKI  555



>emb|CAN81129.1| hypothetical protein VITISV_002911 [Vitis vinifera]
Length=561

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/543 (50%), Positives = 369/543 (68%), Gaps = 5/543 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
              R   TY+P  WGD FL Y  D         +E+++Q+LKEEVRK L A    + + L+L
Sbjct  22    ARHEATYYPNFWGDRFLHYNPDDDFCGTHACKEQQIQELKEEVRKSLEATAGNTSQLLKL  81

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D IQRLG+ YHFE EI+ +++ ++  Y      DD ++L  VSL FRLLRQEG+HI   
Sbjct  82    IDSIQRLGLAYHFEREIEEALKAMYQTYTLV---DDNDHLTTVSLLFRLLRQEGYHIPSD  138

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF+KF+D+ G FK+SL  D+ GML+LYEA++L VHGE  LDEAL FT +HL+S+    + 
Sbjct  139   VFKKFMDEGGNFKESLVGDLPGMLALYEAAHLMVHGEDILDEALGFTTAHLQSMAIDSDN  198

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 +V  ALK PIR+ LPRV A+ Y+ IY++D +HN+ LL+ AKLD+N+LQ +H++ELS
Sbjct  199   PLTKQVIRALKRPIRKGLPRVEARHYITIYQEDDSHNESLLKLAKLDYNMLQSLHRKELS  258

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              IT+WWK L     LPFAR R+ E YFWILGVYFEPQY+ +RRI  ++  + S++DD+YD
Sbjct  259   EITKWWKGLDFATKLPFARDRIVEGYFWILGVYFEPQYYLARRILMKVFGVLSIVDDIYD  318

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
              YGT +EL+LFT AI+R+D S+ +++P Y+K  Y A+LD+  EMEE M K+ KL+ V Y 
Sbjct  319   AYGTFEELKLFTEAIERWDASSIDQLPDYMKVCYQALLDVYEEMEEEMXKQGKLYRVHYA  378

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                +K Q++ Y  E  W   +++P  EEY+  +LV S   M+ TT  VGMGD +TKE  D
Sbjct  379   QAALKXQVQAYLLEAKWLKQEYIPTMEEYMSNALVXSACSMLTTTSFVGMGDXVTKEAFD  438

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             WV S+P  ++A+  ICRLMDD++ HEFEQ+RGHVASAVECYMK Y VSK+EAY E +K +
Sbjct  439   WVFSDPKMIRASNVICRLMDDIVSHEFEQKRGHVASAVECYMKQYGVSKEEAYDEFKKQV  498

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
               AWKD N+E L P  VP+ +L RVLN +R   ++YKD D YT      K L+   L+ P
Sbjct  499   ESAWKDNNEEXLQPTAVPVPLLTRVLNFSRMXDVLYKDEDEYTLVGPLMKDLVAGMLIDP  558

Query  354   VTI  346
             V +
Sbjct  559   VPM  561



>gb|AII32471.1| terpene synthase [Populus trichocarpa]
Length=553

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/540 (48%), Positives = 376/540 (70%), Gaps = 6/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP++WGD F+++  K    +  E +E+++L+E+ ++ L+AA   S ++L+L+D 
Sbjct  20    RRTANYHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFKRELLAAASNSSQQLDLIDA  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI+ ++QHI   Y+N I  +D ++LY  +L FRLLRQ G+++SC +F 
Sbjct  80    IQRLGVAYHFETEIEEALQHI---YNNRIDMED-DDLYNTALGFRLLRQHGYNVSCDIFN  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK S   DV G+L LYEA++L VHGE  LDEAL FT  HL+S+    N    
Sbjct  136   KFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALAFTTIHLKSMASSPNCPLT  193

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             AKVSHALK PI+R +PR+ ++ Y+ IY+ + + NK LLR AKL+FNL+Q++H+ EL+ IT
Sbjct  194   AKVSHALKQPIQRGVPRLESRRYISIYQDEPSCNKTLLRLAKLNFNLVQELHKEELAEIT  253

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK L   + LPFAR R+ EC+FWI+GVYFEPQY  +R+I T++I + S++DD+YDVYG
Sbjct  254   RWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTKVIAMTSIIDDIYDVYG  313

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI R+DT + +++P Y+K  Y A+L++ +E+EE +AKE   + V Y    
Sbjct  314   TLEELELFTEAIDRWDTKSMDQLPDYMKICYEALLNVFSEIEEKVAKEGWSYRVHYGKDA  373

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK  +  Y+ E  WF+  H+P  EEY++V+LV+S Y M+ T   +GMGD++TK+  DWV 
Sbjct  374   MKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSFIGMGDMVTKQAFDWVF  433

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P  ++A+ +I RL+DD+  H+FEQERGH AS VECY++ Y +S+QE Y E    +  A
Sbjct  434   NHPKIIRASETIGRLLDDVKSHKFEQERGHAASGVECYIRQYGLSEQEVYKEFHMQVVNA  493

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P  VP  +L R+LNL+R I +IYK+ D YT      K+ + + L+  V I
Sbjct  494   WKDINEECLKPTAVPTPLLERILNLSRVIDVIYKEEDGYTHVGKVMKNNVASLLINSVPI  553



>ref|XP_006473872.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=547

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/546 (47%), Positives = 376/546 (69%), Gaps = 13/546 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP +WGD F+ Y+++      ++ +E+++LKEEVR+ L+ +   SL +L+L+D 
Sbjct  9     RRTANYHPNIWGDRFINYNAEDEIYHGAQSQEIEELKEEVRRELLGSGVDSLSRLKLIDA  68

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             I RLGV Y FE E++ ++Q+++D + N     ++N+LY V+LRFR+LRQ G+ +SC +F 
Sbjct  69    ILRLGVGYQFERELEEALQNLYDAFSNHFYNIEDNDLYHVALRFRILRQRGYKVSCDIFN  128

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK+SL  DV GMLSLYEA++LGVHGE  LDEA+ FT +HL+S +       A
Sbjct  129   KFKDGKGNFKESLKIDVSGMLSLYEAAHLGVHGEDILDEAIAFTTAHLQSSM-------A  181

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIY-EQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
              +V HAL+ P+ + LPR+ A+ ++ +Y E +  HNK LL+ AKLDFN +Q +++ ELS I
Sbjct  182   PQVIHALRQPLYKGLPRIEARFFISLYQEHEPLHNKALLKLAKLDFNQVQSLYKIELSEI  241

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             +RWWKDL   + LPFAR R+ ECYFWI+GVYFEPQY  +R++ T++I + S++DD+YDVY
Sbjct  242   SRWWKDLDFARKLPFARDRVVECYFWIVGVYFEPQYSLARKLLTKVISMTSIIDDIYDVY  301

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G  +EL LFT AI R+D S  +++P+Y++  Y+A+LD+  E+EE +A +   + V Y   
Sbjct  302   GIPEELDLFTAAIDRWDVSCIDQLPEYMQTFYVALLDLYKEIEEELATKGWSYRVHYAKE  361

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMK  +  Y+ E  WF+  +VP  EEY++VSLV+S Y M+     +GM  ++TKE  DWV
Sbjct  362   EMKILVHGYHDESKWFHNNYVPTMEEYMRVSLVTSGYSMLTAASFLGMDGVVTKEAFDWV  421

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMK-----GYNVSKQEAYVEIE  544
             + +P  ++A+  I RLMDD+  H+FEQERGH ASA+ECYMK     G +V++QE + E+ 
Sbjct  422   SGKPKIIRASTIIGRLMDDIKSHKFEQERGHAASAIECYMKEKEREGVSVTEQEVHEELY  481

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKDIN+ECL P  VP  +L+RVLNL+R I +IYK+ D YT      K  I + L
Sbjct  482   KKVGDAWKDINEECLMPTEVPRPLLMRVLNLSRVIDVIYKEGDGYTHVGQVMKDNIASVL  541

Query  363   VQPVTI  346
             + PV I
Sbjct  542   IHPVAI  547



>ref|XP_011095787.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=552

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/539 (49%), Positives = 376/539 (70%), Gaps = 8/539 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRSV +HPT+WG+YFLAY S  TEI   E+ E+Q+ K+ +RKVL   P  S  KLEL+D 
Sbjct  21    RRSVKFHPTIWGEYFLAYAS--TEISSVEKDELQKQKKMMRKVLNQTPDDSSHKLELIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI  S++ I+D Y  C   D  NN+  V+LRFRLLRQ+G+ IS  VF 
Sbjct  79    IQRLGVSYHFEEEIGKSLKCIYDIYSECSNKD--NNVRSVALRFRLLRQQGYAISPDVFS  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF DK+G F + + ++VE +L LYEA++ GV G+  LD+AL F++S L+ +LP +    +
Sbjct  137   KFTDKEGNFNEMMFENVEDLLDLYEAAHFGVDGDEILDKALEFSSSKLQFLLPIMTTSLS  196

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V  ALK+PI ++L R+GA +++  Y+Q ++HN++LL FAKLDFN++QK+HQ+ELS IT
Sbjct  197   KQVKEALKIPILKSLTRLGAWKFIAAYQQHKSHNEILLNFAKLDFNIVQKMHQKELSLIT  256

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL     L FAR R+AECYFWILGVYFEPQY F RRI T+++ + S++DD+YD+YG
Sbjct  257   RWWKDLNFTNKLSFARDRVAECYFWILGVYFEPQYQFERRILTKVLALISIMDDIYDIYG  316

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T ++LQLFT  +QR+D +  +++P Y+   Y A LD+  EME  +    + + V YT  E
Sbjct  317   TLEDLQLFTRIVQRWDVNDLDQLPPYMGICYKAFLDVYLEMEAEVENGGESYLVQYTKEE  376

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK  R + QE  W Y+K++P  EEY +V+LV++ + M+AT  L+G+ + +TK+ L+W+T
Sbjct  377   MKKLTRAFLQEAEWVYSKYMPTMEEYTEVALVTTGHAMMATLSLIGVRNTVTKKDLEWIT  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             S+PL V+A+  +CR MDD++G   E++     +AV CYM     SK + + ++ + + KA
Sbjct  437   SKPLIVQASAIVCRFMDDIVGFGIEKK----YTAVHCYMNQNGASKMDTFAQLREQVKKA  492

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             WKD+NQECL P PV M +L  V++LAR I L+Y DND YT SQ   +  I+  LV+P+T
Sbjct  493   WKDMNQECLEPTPVSMSILKPVVDLARVIHLLYADNDDYTNSQTNTRDYISCVLVEPLT  551



>ref|XP_011048258.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=561

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/545 (48%), Positives = 375/545 (69%), Gaps = 6/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RR  ++ P++WGD+FL+  S    ++ +++ E ++LKEE+++ L+A      + L+ +D
Sbjct  19    SRRCASFPPSIWGDHFLS--SATASMETNDKAEHKKLKEELKRELMANINKPSQALDFID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNY----DNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
              IQRLG+ YHFE EI   ++ ++ ++    +     D  N+LY +SL+FRLLRQ+G+ IS
Sbjct  77    AIQRLGISYHFEIEIDEILREVYRSHCDFDNGDDDDDHHNDLYAISLKFRLLRQQGYKIS  136

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C VF KF +  G F DSL  D  G+LS YEA++L VHG+  L+EA  FT SHLE +    
Sbjct  137   CDVFGKFKNSQGNFSDSLVNDTRGILSFYEATHLRVHGDEVLEEAFVFTTSHLEFLATHS  196

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    A+++HALK PIR+ +PR+ A+ Y  IY++D + ++VLL FAK DFN+LQK H +E
Sbjct  197   SSPLKAQINHALKQPIRKNIPRLEARHYFSIYQEDPSCSEVLLNFAKFDFNILQKQHLKE  256

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I +WWK+L   K LPFAR R+ ECYFWILGVYFEP+Y  +RR+ T++I + SV+DD+
Sbjct  257   LSDIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEYFLARRLLTKVIAMTSVIDDI  316

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD YG  +EL+LFT+AI+R++ +A +++P+Y+K  Y A+LD+ TE+EE M  E +   VS
Sbjct  317   YDAYGKPEELELFTDAIERWEITAVDQLPEYMKVTYKALLDVYTEIEENMVTEERSCRVS  376

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    +K Q+R YY E  WF+ KH P  EEY+ V+LV+S Y M+A T  VGMG  +TK+ 
Sbjct  377   YAKEALKNQVRAYYLESKWFHQKHTPTMEEYMAVALVTSGYAMLAATSFVGMGHAVTKDS  436

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+ S P  +KA+  ICRLMDD++ HEFEQ+RGHVAS++ECYMK +  ++QE   E  K
Sbjct  437   FDWLFSGPKILKASEIICRLMDDIVSHEFEQKRGHVASSIECYMKQHGTTEQETVREFRK  496

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++ AWKDIN+E L+P  VPM +L R+LNLAR I ++YKD D YT +    K L++  L+
Sbjct  497   QVTDAWKDINEEFLYPTAVPMPLLTRILNLARVIDVVYKDEDGYTNAGTALKDLVSALLI  556

Query  360   QPVTI  346
              PV +
Sbjct  557   DPVPM  561



>ref|XP_008347229.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=554

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/545 (49%), Positives = 376/545 (69%), Gaps = 11/545 (2%)
 Frame = -2

Query  1974  SSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
             S  R S T++ ++WGD+FL+Y     E+D   E+ VQ+LKEEVR++L  +     +KL L
Sbjct  19    SVHRPSATFYTSIWGDHFLSY--GFMEVDAELEQHVQELKEEVRRMLTTSVENVSQKLNL  76

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D +QRLGV Y+F NEI+  +Q I +N        D ++LY  +L FRLLRQ+G++I+C 
Sbjct  77    IDDVQRLGVSYYFGNEIEEILQKIHEN------SYDLDDLYTAALCFRLLRQQGYNITCD  130

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             +F KF D DGKFK+SL  DV G+LSLYEA++L +HGE  LDEALTFT +HLES    L+ 
Sbjct  131   LFNKFKDGDGKFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTHLESATNRLSP  190

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQREL  1258
               A  V+HAL   +R+ LPRV A+ Y+ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+EL
Sbjct  191   PLAKTVTHALNQQLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKEL  250

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             S +TRWWKDL +P  LPF R RL E YF W L VYF+PQY F+RR   ++  I S++DD+
Sbjct  251   SELTRWWKDLDIPNKLPFVRDRLVEVYFCWSLSVYFQPQYSFARRTLCKVTAITSIIDDV  310

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD YGT +EL+LFT AI+R+D SA +++P+Y+K  Y A+LDI +E+ E +  E KL+H+ 
Sbjct  311   YDEYGTNEELELFTEAIERWDVSAMDQLPEYMKVCYRALLDIYSEIHEKLVHEGKLYHIH  370

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             + I  MKKQ+R Y+ E   F  KH+P  ++Y+ +SLV+S Y ++ TT  VGM +  T + 
Sbjct  371   HAIEAMKKQVRGYFVEGKLFRQKHIPSLDDYMSISLVTSGYPLLITTSFVGMEE-ATIDS  429

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+ + P AVKA  ++ RLMDD+  H+ EQE  H+ SAV CYM  Y  +K+EA +E+ +
Sbjct  430   FDWLLNSPQAVKAASTVARLMDDIADHKLEQENEHLVSAVTCYMMKYGATKEEAVIELRR  489

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++KAWKDIN+ CLHP  VPM +L+R+LN AR + ++YK  D YT +Q   K  I +TLV
Sbjct  490   QVNKAWKDINEACLHPTAVPMPLLIRILNFARVMDVVYKCEDGYTIAQGGLKDFIVSTLV  549

Query  360   QPVTI  346
             +PV +
Sbjct  550   EPVAL  554



>ref|XP_009358866.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=556

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/540 (49%), Positives = 379/540 (70%), Gaps = 11/540 (2%)
 Frame = -2

Query  1959  SVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQ  1780
             S T+ P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR++L  +     +KL L+D IQ
Sbjct  26    SSTFSPSIWGDHFLSYAS--LEVDAELEQHVQELKEEVRRMLTTSLENVSQKLNLIDDIQ  83

Query  1779  RLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFEKF  1600
              LGV YHF NEI+  +Q I  +        D ++LY  +LRFRLLRQ+G++ISC +F KF
Sbjct  84    HLGVSYHFGNEIEEILQKIHKS------SYDLDDLYTAALRFRLLRQQGYNISCDLFNKF  137

Query  1599  LDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAK  1420
              D DGKFK+SL  DV G+LSLYEA++L +HGE  LDEALTFT ++LES    L+   A  
Sbjct  138   KDSDGKFKESLVDDVAGLLSLYEATHLRIHGEEILDEALTFTRTNLESATFRLSPPLAKA  197

Query  1419  VSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGITR  1243
             V+HAL  P+R+ LPRV A+ Y+ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+ELS ITR
Sbjct  198   VTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLMFAKLDFNRLQRVHQKELSEITR  257

Query  1242  WWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             WWKDLGVP  LPFAR RL E YF W L VYF+PQY F RRI  ++  I S++DD+YD +G
Sbjct  258   WWKDLGVPNKLPFARDRLVEVYFCWSLSVYFQPQYSFGRRILCKVTAIASIMDDIYDAHG  317

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI+R+D SA +++P+Y+K  Y A+L+I +E+ E +A E KL+ + +    
Sbjct  318   TFEELELFTEAIERWDVSAIDQLPEYMKLCYRALLNIYSEIHEKLAHEGKLYRIHHAREA  377

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK Q+R ++ E   F  KH+P  +EY+ V++V++ Y ++ T   VGM +  T +  DW+ 
Sbjct  378   MKNQVRGFFDEAKLFRQKHLPSLDEYMSVAIVTNGYALLITLSFVGMEE-ATIDSFDWLL  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P AVKA  ++ RLMDD++ H+FEQE+ H+ SAV CYM+ Y  +++EA +E+++ ++ A
Sbjct  437   TSPQAVKAASTVARLMDDIVDHKFEQEKEHLVSAVNCYMRKYGATQEEAIIELQRQVNNA  496

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ CLHP  VPM +L+R+LN AR + ++YK  + YT ++   K LI +TLV+PV +
Sbjct  497   WKDINEACLHPTAVPMPLLIRILNFARVMDVVYKCENGYTNAKGVLKDLIASTLVEPVAL  556



>emb|CAN78342.1| hypothetical protein VITISV_000109 [Vitis vinifera]
Length=555

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/540 (50%), Positives = 371/540 (69%), Gaps = 4/540 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R  V YH  +WGD FL+Y  +       +E++++ LKEE+R+ L+     + ++L+ +D
Sbjct  18    NRPVVXYHXXIWGDQFLSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTSQQLKFID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQEGHHISCGV  1612
              +QRLGV YHFE EI+  +QHI+D+Y N   GDD E ++Y V+L+FRLLRQ G +ISCG+
Sbjct  78    AVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNISCGL  134

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F +F D+ G FK +L  DV GML LYEA++L VHGE  L +AL FT +HL++++  L   
Sbjct  135   FNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYH  194

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS 
Sbjct  195   LAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSN  254

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL ECYFW+LGVYFEPQY   RRI T++I + S+LDD++D 
Sbjct  255   LARWWKELDFATKLPFARDRLVECYFWMLGVYFEPQYLRGRRILTKVIAMISILDDIHDA  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ +++P+Y+K  Y A+LD+  E+EE M KE   + V Y  
Sbjct  315   YGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAK  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP FEEY++V+LVSS Y ++ATT  VGMG+I TKE  DW
Sbjct  375   EVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCILATTSFVGMGEIATKEAFDW  434

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VTS P  + ++  I RLMDD+  H+FEQ+RGHVASAVECYMK Y VS+++ Y E +K I 
Sbjct  435   VTSNPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYKEFQKQIE  494

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AW DINQECL P  V M +L R+LNL RA  ++YK+ D YT      +  I + L+  V
Sbjct  495   NAWLDINQECLKPTAVSMPLLARILNLTRAADVVYKEQDSYTHVGKVMRDNIASVLINAV  554



>ref|XP_007021123.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12648.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=557

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/549 (49%), Positives = 375/549 (68%), Gaps = 10/549 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL-E  1807
             ++++  RRS  +HP++WGD FL++ SK+  +D + +   ++LK+EVR++L       L +
Sbjct  16    SMSNENRRSTKFHPSIWGDLFLSFPSKVN-VDTTTQLHYEELKQEVRRMLRVPTDNQLSQ  74

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L++ I+RLGV YHFE EI+  +Q+I   YD   K D   NL V SLRFRLLR+ G +
Sbjct  75    KLRLIETIKRLGVSYHFEREIEDVLQNI---YDQDYKDD---NLEVTSLRFRLLREHGFN  128

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             + C  F KF D  G FK SL  DV+G+L LYEA+++  HGE  L+EAL FT +HLES   
Sbjct  129   VQCETFNKFKDDKGNFKVSLKSDVKGLLELYEAAHIRTHGEHILEEALAFTTTHLESAKT  188

Query  1446  GLNELA-AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVH  1270
              L E   +  VSHA K PIR+ L R+ A+ ++ IY++D +H+K LL+FAKLDF+L+Q +H
Sbjct  189   SLCEYPISVLVSHARKRPIRKGLQRLEARRFISIYQEDGSHDKTLLKFAKLDFSLVQNLH  248

Query  1269  QRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVL  1090
             + ELS I+RWWKDL   + LPFAR RL E YFWILGVYFEPQY F+R+I T+ I + S +
Sbjct  249   KEELSKISRWWKDLDFKRQLPFARDRLVEGYFWILGVYFEPQYSFARQILTKAIVMASTM  308

Query  1089  DDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLF  910
             DD+YD YGT +ELQLFT AI+R+DT+  + +P Y+K  Y A+LD+  EMEEVM K+ K +
Sbjct  309   DDIYDAYGTFEELQLFTKAIERWDTNCMDRLPAYMKLFYKALLDVYEEMEEVMTKQVKSY  368

Query  909   HVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIIT  730
              V Y    MK+  + Y+ E  W++  +VP  EEY+  +LVSS Y+M+  T  VGMG+++T
Sbjct  369   RVKYAKEAMKQLSQAYFVEAKWYHENYVPTVEEYMTNALVSSGYIMVTVTSFVGMGNVVT  428

Query  729   KEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVE  550
             KE   W ++ P  V+A+  I RLMDD++ H+FEQERGHVASA+ECYMK + VS+++A  E
Sbjct  429   KETFQWASNNPRIVRASSIIARLMDDIVSHKFEQERGHVASAIECYMKQHGVSEEKACNE  488

Query  549   IEKLISKAWKDINQECLH-PLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             + K I  AWKDINQE +  P  VPM VL R+LNLAR +  +YK+ D YT      K  IT
Sbjct  489   LNKQIENAWKDINQELVRPPAGVPMPVLTRILNLARVMDFLYKEGDGYTHVGEAVKDGIT  548

Query  372   TTLVQPVTI  346
             + ++ P+ I
Sbjct  549   SLMIDPIPI  557



>ref|XP_006478792.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=559

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/543 (48%), Positives = 375/543 (69%), Gaps = 4/543 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S R S  + P++WGD+F  Y     E D    + ++ LK+E+R++L AA   S   LEL+
Sbjct  20    STRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLE-LKKEIRRMLKAANKTS-HTLELI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFENEI   +  +   Y +C   D+EN+ LY +SL+FRL RQ G+ IS  
Sbjct  78    DAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISAD  137

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF  F+  DGKF  SL KDV GMLS YEA++L VH E  LDEAL FT+SHLES+   ++ 
Sbjct  138   VFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVAKQVSS  197

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               A +V HAL  PI + L R+ A+ Y+ IY+ + +HN+ LL FAKLDFN LQK+HQ+EL 
Sbjct  198   PLAEQVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLDFNRLQKLHQKELG  257

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I+RWWK+L     LPF R R+AE YFW +GVYFEPQY F+R++ T+++ + S++DD+YD
Sbjct  258   DISRWWKELDFAHKLPFVRDRIAEGYFWAVGVYFEPQYSFARKLFTKVVYMTSIIDDIYD  317

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VYG  +EL+LFT+AI+R+D +A +++P+Y+K  Y A++++ +E+E+ +  + KL  + Y 
Sbjct  318   VYGKIEELELFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLVSQGKLSRLHYA  377

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MK Q++ Y+ E  W++  +VP  +EY+ V+L+SS +  ++T   VGMGDI+TKE  +
Sbjct  378   KEAMKNQVKHYFFEAKWYHQNYVPTVDEYMTVALISSAHPNLSTISFVGMGDIVTKESFE  437

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+ S P +++A+C++ RLM+DM+ H+FEQ RGHVAS+VECYM  Y  +++EAY E  K +
Sbjct  438   WLFSNPRSIRASCAVGRLMNDMVSHKFEQSRGHVASSVECYMNQYGATEEEAYSEFRKQV  497

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             S AWKDIN+ECL P  VP+ +L+R+LNL RA  ++YK  D YT ++ + K  I + L+ P
Sbjct  498   SNAWKDINEECLRPTLVPVPLLMRILNLTRAADVVYKYKDGYTDTE-ELKDFIASLLINP  556

Query  354   VTI  346
             V I
Sbjct  557   VPI  559



>ref|XP_009334624.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=557

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/548 (49%), Positives = 379/548 (69%), Gaps = 7/548 (1%)
 Frame = -2

Query  1980  VNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL  1801
              N   RRS  + PT+WGDYFL+Y S   EI+  EE+ VQ+LK + R ++   P   L+KL
Sbjct  14    TNDVNRRSANFSPTIWGDYFLSYAS--IEINIEEEQHVQELKVK-RMIMAPIPSKPLKKL  70

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKG-DDENNLYVVSLRFRLLRQEGHHI  1624
             EL+D IQR GV  HFENEI   +  I ++Y    +G DD+ +L+  +L FRLLRQ+G++I
Sbjct  71    ELIDAIQRFGVSRHFENEIDQVLLQIHNSYHRYHQGSDDDEDLHAAALYFRLLRQQGYNI  130

Query  1623  SCGVFEKFLD-KDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             SC +F KF D  D KFK SLT D+ G+LSLYEA++L VHGE  L+EAL+FT +HLES   
Sbjct  131   SCDMFNKFKDVNDAKFKGSLTNDIVGLLSLYEATHLRVHGEDILEEALSFTTTHLESAAH  190

Query  1446  GLNELAA-AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVH  1270
              L+      +V HAL  P  +  PR+ A+ Y+ IY ++ +HN+ LL FAKLDFNLLQKVH
Sbjct  191   SLSPGPLLQQVKHALYQPFWKGNPRLEARHYLSIYRENNSHNETLLTFAKLDFNLLQKVH  250

Query  1269  QRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVL  1090
             Q+ELS I+RWWK+L     LPFAR R+ ECY W LG Y+EP+Y F+R I  ++I +  ++
Sbjct  251   QKELSEISRWWKELDFVNKLPFARDRVVECYLWALGCYYEPKYSFARMIFGKVIAMLVII  310

Query  1089  DDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLF  910
             DD+YDVYGT +EL+LFT A++R+D SA   +P+Y+K  Y A+LD+  E+EE +  E   +
Sbjct  311   DDIYDVYGTFEELELFTEAVERWDISAMVHLPEYMKVCYQALLDLYAEIEEKLGNEGNSY  370

Query  909   HVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIIT  730
              + Y    MK Q+++Y++E  WFY  ++P  +EYL  +L +S Y M+ATT LVGMG ++T
Sbjct  371   RIHYAREAMKIQVKSYFKEAKWFYDNYIPTMDEYLSEALNTS-YFMLATTALVGMGSVVT  429

Query  729   KEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVE  550
             K+ LDWV S+P  VKAT  I RL+DDM  H+FEQ+RGHVAS VECYMK ++ ++++A +E
Sbjct  430   KDSLDWVFSDPKIVKATSLIGRLVDDMKSHKFEQKRGHVASCVECYMKEHDATEEQAIIE  489

Query  549   IEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITT  370
             + K ++ AWKD+N+ C  P   PM+++LR++NLAR I +IYK +D +T + +  K ++ +
Sbjct  490   LSKQVNNAWKDVNETCHRPTIFPMQLILRIVNLARMIEVIYKHDDGFTHAGIFLKDIVVS  549

Query  369   TLVQPVTI  346
               V+PV +
Sbjct  550   LFVEPVPL  557



>gb|AGB14624.1| beta-caryophyllene synthase [Malus domestica]
Length=554

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/545 (49%), Positives = 376/545 (69%), Gaps = 11/545 (2%)
 Frame = -2

Query  1974  SSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
             S  R S T++ ++WGD+FL+Y     E+D   E+ VQ+LKEEVR++L  +     +KL L
Sbjct  19    SVHRPSATFYTSIWGDHFLSY--GFMEVDAELEQHVQELKEEVRRMLTTSVENVSQKLNL  76

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D IQRLGV Y+F NEI+  +Q I +N        D ++LY  +L FRLLRQ+G++++C 
Sbjct  77    IDDIQRLGVSYYFGNEIEEILQKIHEN------SYDLDDLYTATLCFRLLRQQGYNVTCD  130

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             +F KF D DGKFK+SL  DV G+LSLYEA++L +HGE  LDEALTFT +HLES    L+ 
Sbjct  131   LFNKFKDGDGKFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTHLESATNRLSP  190

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQREL  1258
               A  V+HAL   +R+ LPRV A+ Y+ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+EL
Sbjct  191   PLAKTVTHALNQQLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKEL  250

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             S +TRWWKDL +P  LPF R RL E YF W L VYF+PQY F+RR   ++  I S++DD+
Sbjct  251   SELTRWWKDLDIPNKLPFVRDRLVEVYFCWSLSVYFQPQYSFARRTLCKVTAITSIIDDV  310

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD YGT +EL+LFT AI+R+D SA +++P+Y+K  Y A+LDI +E+ E +  E KL+H+ 
Sbjct  311   YDEYGTNEELELFTEAIERWDVSAMDQLPEYMKVCYRALLDIYSEIHEKLVHEGKLYHIH  370

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             + I  MKKQ+R Y+ E   F  KH+P  ++Y+ +SLV+S Y ++ TT  VGM +  T + 
Sbjct  371   HAIEAMKKQVRGYFVEGKLFRQKHIPSLDDYMSISLVTSGYPLLITTSFVGMEE-ATIDS  429

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+ + P AVKA  ++ RLMDD+  H+ EQE  H+ SAV CYM  Y  +K+EA +E+ +
Sbjct  430   FDWLLNSPQAVKAASTVARLMDDIADHKLEQENEHLVSAVTCYMMKYGATKEEAVIELRR  489

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++KAWKDIN+ CLHP  VPM +L+R+LN AR + ++YK  D YT ++   K  I +TLV
Sbjct  490   QVNKAWKDINEACLHPTAVPMPLLIRILNFARVMDVVYKCEDGYTIAEGGLKDFIVSTLV  549

Query  360   QPVTI  346
             +PV +
Sbjct  550   EPVAL  554



>emb|CBI20174.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/541 (50%), Positives = 362/541 (67%), Gaps = 3/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R +  Y P +WGD FL Y    T     + +++++LKEEVRK L A+   S E L+L+D
Sbjct  22    ARSTANYPPNIWGDRFLTYAPDDTVTQECKAQKIKELKEEVRKELKASAHKSPELLKLID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQ LG+ YHFE EI+ +++ ++  Y      DD  +L   SLRFRLLRQEG+ +   VF
Sbjct  82    SIQLLGLTYHFEREIEEALKDMYGTYSLV---DDNEDLTNASLRFRLLRQEGYGVPSDVF  138

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF DK+G FK+SL  D+ GML+LYEA++L VHGE  L+EAL FT +HL+S+    N   
Sbjct  139   SKFKDKEGNFKESLIGDLPGMLALYEATHLMVHGEDILEEALAFTTAHLQSVATDPNNPL  198

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             + +V  ALKL I   +  VGA+ Y+ IY++D +HN+ LL+ AKLDFNLLQ +H++ELS I
Sbjct  199   SKQVIRALKLSIHNGVTSVGARHYISIYQEDGSHNESLLKLAKLDFNLLQSLHRKELSEI  258

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK L     LPFAR RL E YF  LGV FEPQY  S R  T++  + +++DD+YD Y
Sbjct  259   TRWWKGLDFATKLPFARDRLVEIYFSALGVCFEPQYSLSLRFLTKVAIMITMVDDIYDAY  318

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL L T AI+R+D S+ +++P Y+K  Y A+LD+  EME+ MAKE KL+ V Y   
Sbjct  319   GTIEELTLLTEAIERWDASSIDQLPDYMKCFYRALLDLYEEMEQEMAKEGKLYRVHYAKE  378

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MKKQI++Y+ E  W    ++P F+EY+   +VS C  ++  T  VGMGDI+TKE   WV
Sbjct  379   LMKKQIQSYFVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTKESFQWV  438

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S P  + A+  ICRLMDDM  HEFEQ+R HVAS+VECYMK Y VSKQEAY E+ K + K
Sbjct  439   LSRPTMIGASQIICRLMDDMASHEFEQKRVHVASSVECYMKQYGVSKQEAYDELNKQVVK  498

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDINQECL P PV M ++ RVLN+AR + ++YKD D +T    + K LI + L+ PV 
Sbjct  499   AWKDINQECLKPTPVLMPIITRVLNIARMMNILYKDGDEFTHVGKQRKDLIASILIDPVP  558

Query  348   I  346
             +
Sbjct  559   M  559



>emb|CAN62603.1| hypothetical protein VITISV_009665 [Vitis vinifera]
Length=587

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/541 (50%), Positives = 361/541 (67%), Gaps = 3/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R +  Y P +WGD FL Y    T     + +++++LKEEVRK L A+   S E L+L+D
Sbjct  22    ARSTANYPPNIWGDRFLTYAPDDTVTQECKAQKIKELKEEVRKELKASAHKSPELLKLID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQ LG+ YHFE EI+ +++ ++  Y      DD  +L   SLRFRLLRQEG+ +   VF
Sbjct  82    SIQLLGLTYHFEREIEEALKDMYGTYSLV---DDNEDLTNASLRFRLLRQEGYXVPSDVF  138

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF DK+G FK SL  D+ GML+LYEA++L VHGE  L+EAL FT +HL+S+    N   
Sbjct  139   SKFKDKEGNFKXSLIGDLPGMLALYEATHLMVHGEDILEEALAFTTAHLQSVATDPNNPL  198

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             + +V  ALKL I   +  VGA+ Y+ IY++D +HN+ LL+ AKLDFNLLQ +H++ELS I
Sbjct  199   SKQVIRALKLSIHNGVTSVGARHYISIYQEDGSHNESLLKLAKLDFNLLQSLHRKELSEI  258

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK L     LPFAR RL E YF  LGV FEPQY  S R  T++  + +++DD+YD Y
Sbjct  259   TRWWKGLDFATKLPFARDRLVEIYFSALGVCFEPQYSLSLRFLTKVAIMITMVDDIYDAY  318

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL L T AI+R+D S+ +++P Y+K  Y A+LD+  EME+ MAKE KL+ V Y   
Sbjct  319   GTIEELTLLTEAIERWDASSIDQLPDYMKCFYRALLDLYEEMEQEMAKEGKLYRVHYAKE  378

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MKKQI++Y+ E  W    ++P F+EY+   +VS C  ++  T  VGMGDI+TKE   WV
Sbjct  379   LMKKQIQSYFVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTKESFQWV  438

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S P  + A+  ICRLMDDM  HEFEQ+R HVAS+VECYMK Y VSKQEAY E+ K + K
Sbjct  439   LSRPTMIGASQIICRLMDDMASHEFEQKRVHVASSVECYMKQYGVSKQEAYDELNKQVVK  498

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDINQECL P PV M ++ RVLN+AR + ++YKD D +T    + K LI + L+ PV 
Sbjct  499   AWKDINQECLKPTPVLMPIITRVLNIARMMNILYKDGDEFTHVGKQRKDLIASILIDPVP  558

Query  348   I  346
             I
Sbjct  559   I  559



>ref|XP_009338863.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=556

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/540 (49%), Positives = 378/540 (70%), Gaps = 11/540 (2%)
 Frame = -2

Query  1959  SVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQ  1780
             S T+ P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR++L  +     +KL L+D IQ
Sbjct  26    STTFSPSIWGDHFLSYAS--LEVDAELEQHVQELKEEVRRMLTTSLENVSQKLNLIDDIQ  83

Query  1779  RLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFEKF  1600
              LGV YHF NEI+  +Q I  +        D ++LY  +LRFRLLRQ+G++ISC +F KF
Sbjct  84    HLGVSYHFGNEIEEILQKIHKS------SYDLDDLYTAALRFRLLRQQGYNISCDLFNKF  137

Query  1599  LDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAK  1420
              D DGKFK+SL  DV G+LSLYEA++L +HGE  LDEALTFT ++LES    L+   A  
Sbjct  138   KDSDGKFKESLVDDVAGLLSLYEATHLRIHGEEILDEALTFTRTNLESATFRLSPPLAKA  197

Query  1419  VSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGITR  1243
             V+HAL  P+R+ LPRV A+ Y+ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+ELS ITR
Sbjct  198   VTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLMFAKLDFNRLQRVHQKELSEITR  257

Query  1242  WWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             WWKDL VP  LPFAR RL E YF W L VYF+PQY F RRI  ++  I S++DD+YD +G
Sbjct  258   WWKDLDVPNKLPFARDRLVEVYFCWSLSVYFQPQYSFGRRILCKVTAIASIMDDIYDAHG  317

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI+R+D SA +++P+Y+K  Y A+L+I +E+ E +A E KL+ + +    
Sbjct  318   TFEELELFTEAIERWDVSAIDQLPEYMKLCYRALLNIYSEIHEKLAHEGKLYRIHHAREA  377

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK Q+R ++ E   F  KH+P  +EY+ V++V++ Y ++ T   VGM +  T +  DW+ 
Sbjct  378   MKNQVRGFFDEAKLFRQKHLPSLDEYMSVAIVTNGYALLITLSFVGMEE-ATIDSFDWLL  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P AVKA  ++ RLMDD++ H+FEQE+ H+ SAV CYM+ Y  +++EA +E+++ ++ A
Sbjct  437   TSPQAVKAASTVARLMDDIVDHKFEQEKEHLVSAVNCYMRKYGATQEEAIIELQRQVNNA  496

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ CLHP  VPM +L+R+LN AR + ++YK  + YT ++   K LI +TLV+PV +
Sbjct  497   WKDINEACLHPTAVPMPLLIRILNFARVMDVVYKCENGYTNAKGVLKDLIASTLVEPVAL  556



>ref|XP_004168174.1| PREDICTED: (+)-gamma-cadinene synthase-like, partial [Cucumis 
sativus]
Length=571

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/552 (47%), Positives = 384/552 (70%), Gaps = 8/552 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             +++   R    +HPT+W + FL++D  L   D  E   +++LKEE+R ++ A+    L  
Sbjct  18    DISDVNRSLANFHPTIWKEQFLSFDDALKVDDGMELERIEKLKEEIRMMVTASMENPLAN  77

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCI----KGDDENNLYVVSLRFRLLRQE  1636
             L LVD IQRLGV YHFE+EI+  ++HI+ +Y+N +    K  ++++L+  +L FRLLRQ+
Sbjct  78    LNLVDSIQRLGVSYHFEDEIEQFLEHIYVSYNNSLLLSNKDSEDDDLHFTALLFRLLRQQ  137

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             G+ ISC +F KF+DK+GKFK+SL +D  G+LSLYEAS++  HGE  L+EAL FT +HL++
Sbjct  138   GYRISCDIFLKFMDKNGKFKESLVEDERGILSLYEASHMRGHGEALLEEALEFTTTHLKA  197

Query  1455  ---ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNL  1285
                +   +N   A++VS+ALKLPIR+ +PR+ A+EY QIY+Q  +H++ LL F+KLDFN+
Sbjct  198   YIHLYSNINPNFASEVSNALKLPIRKCVPRIKAREYFQIYQQHPSHSETLLEFSKLDFNI  257

Query  1284  LQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIIC  1105
             LQK+HQ+ELS I RWWKDL VP   PFAR R+ ECYFW LG YFEPQY+  R++ T++I 
Sbjct  258   LQKLHQKELSEICRWWKDLDVPTKFPFARDRIVECYFWTLGAYFEPQYNVGRKMLTKVIA  317

Query  1104  IWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAK  925
             I S+LDD+YD YGT +ELQ+   AIQR+D S  + +P+Y+K  Y+A+ ++  E+ + + K
Sbjct  318   ISSILDDIYDAYGTFEELQVLAPAIQRWDRSMVHTLPEYMKPFYVAMFEVYEEISKEIGK  377

Query  924   ENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGM  745
             +    H+   IG +KK   +Y++E  W   K+ P F+EY++++L ++ Y ++ +   +G+
Sbjct  378   DQNSLHLQVAIGGIKKLSESYFEEAKWLNKKYKPSFKEYMELALNTTGYTLLISISFLGL  437

Query  744   GD-IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSK  568
             GD I+T EVL W+++ P  +KA+  ICRLMDD+  H+FEQER HVASAVE YM+ Y+ S+
Sbjct  438   GDHIVTNEVLQWLSNGPQIIKASTIICRLMDDIASHKFEQEREHVASAVESYMEQYDCSE  497

Query  567   QEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKF  388
             +EA VE+ K +  AWKD N+    P  VP+ VL+RVLN +R + L+Y D D YT ++ + 
Sbjct  498   EEACVELHKEVVDAWKDTNEAFYRPFNVPLPVLMRVLNFSRVMNLLYLDEDGYTNAKSRT  557

Query  387   KSLITTTLVQPV  352
             K LI + LV P+
Sbjct  558   KFLIKSLLVDPL  569



>dbj|BAM24405.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/542 (48%), Positives = 371/542 (68%), Gaps = 6/542 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP +WGD F+ Y            + +++LK+ VR+ L+ A    L +L L+D 
Sbjct  19    RRNANYHPNIWGDRFINYVPVDKMNHTCHLQAIEELKDAVRRELLTA--TGLSQLNLIDA  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE E++ ++QH++  + N    D E+NLY +SLRFRLLRQ G+++SC +  
Sbjct  77    IQRLGVGYHFERELEEALQHVY--HKNHYHDDTEDNLYSISLRFRLLRQHGYYVSCDILN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG--LNEL  1432
             KF D+   FK+SLT DV GMLSLYEA++ GVHGE  LDEA+ FT +HL+S+      N  
Sbjct  135   KFKDEKDNFKESLTTDVPGMLSLYEAAHPGVHGEDILDEAIAFTTTHLKSLAIDHLRNPS  194

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A++V HAL+ P+ R +PR+  + Y+ IY+ + +HNK L++  KLDFNL+Q +H++ELS 
Sbjct  195   LASQVIHALRQPLHRGVPRLENRRYISIYQDEVSHNKALVKLFKLDFNLVQSLHKKELSE  254

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I+RWWK+L +   LPFAR RL ECYFWI+GVY+EPQY  +R+I T+ I + S++DD+YDV
Sbjct  255   ISRWWKELDLANKLPFARDRLVECYFWIIGVYYEPQYSLARKILTKTIAMGSIIDDIYDV  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL LFT+AI+R+D S  +++P+Y++  Y A+LD+  E+E+ +AKE   + V Y  
Sbjct  315   YGTPEELNLFTDAIERWDASCMDQLPEYMQIFYEALLDLYNEIEKEIAKEGWSYRVHYAK  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK   R Y+ E  WF+  ++P  EEY+ V+LV+S Y M+ T+  +GM +I+TKE  DW
Sbjct  375   EAMKILARGYHDESKWFHNNYIPTMEEYMHVALVTSGYTMLTTSSFLGMDNIVTKETFDW  434

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V S P  ++A+ +I RLMDD+  H+FEQERGH ASAVECYM+ + VS+QE   E  + + 
Sbjct  435   VFSGPKIIRASGTIARLMDDVKSHKFEQERGHAASAVECYMEQHGVSEQEVCKEFYQQVG  494

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDINQ+ L P  VPM +L+RVLNLAR I ++YK+ D YT      K  + + L+ P+
Sbjct  495   NAWKDINQDFLKPTDVPMTILMRVLNLARVIDVVYKEGDGYTHVGKVMKENVASLLIDPI  554

Query  351   TI  346
              +
Sbjct  555   PV  556



>gb|AIC76495.1| terpene synthase [Prunus cerasoides var. campanulata]
Length=514

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/514 (50%), Positives = 362/514 (70%), Gaps = 5/514 (1%)
 Frame = -2

Query  1875  REVQQLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDN-YDNCI  1699
             R  Q LKE+V+ +++A      +KL+L+D IQRLGV +HFENEI+  +Q I ++ +DN  
Sbjct  2     RRAQDLKEKVKMIIMAPVKKPSQKLDLIDDIQRLGVSHHFENEIEELLQQIHNSSHDNTE  61

Query  1698  KGDDE--NNLYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEAS  1525
              GD E  N LY  +LRFRLLRQ+G++ISC +F  F D DGKFK+SL  DV G+LSLYEA+
Sbjct  62    SGDQETDNELYTAALRFRLLRQQGYNISCDIFNNFKDGDGKFKESLVNDVVGLLSLYEAT  121

Query  1524  YLGVHGETTLDEALTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIY  1345
             +L +HGE  LDEALTFT +HLES    L+ +   +V+HA+  P  + LPR+  + Y+ +Y
Sbjct  122   HLRIHGEDILDEALTFTTTHLESATHRLSPILLKQVTHAMYQPFWKGLPRLETRHYLSLY  181

Query  1344  EQDQTHNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWIL  1165
             ++  + N+ LL FAKLDFNLLQ+VHQRELS I+RWWKDL     LPFAR R+ E YFW  
Sbjct  182   QERDSRNETLLNFAKLDFNLLQQVHQRELSEISRWWKDLDFVNKLPFARDRVVESYFWAS  241

Query  1164  GVYFEPQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYL  985
             GV+FEPQY+F+RR   ++  +  ++DD+YDVYGT +EL+LFT A++R+D SA + +P+Y+
Sbjct  242   GVHFEPQYYFARRTLCKVTALLVIIDDIYDVYGTHEELELFTEAVERWDISAMDHLPEYM  301

Query  984   KKIYLAILDITTEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYL  805
             K  Y A+LD+  E+EE +A E  L+ + Y    MK Q+R Y++E  W + KH P  +EY+
Sbjct  302   KVCYQALLDVYVEIEENLANEGNLYSIHYAREAMKVQVRAYFREAKWLHQKHTPTMDEYM  361

Query  804   KVSLVSSCYMMIATTCLVGMGDIITKEVLDWVTSEPLA-VKATCSICRLMDDMIGHEFEQ  628
               +L +S Y M+ATT  VGMGDI TK+ +DWV ++P   VKA   I RL+DD+  H+FEQ
Sbjct  362   SAALDTS-YFMMATTSFVGMGDIATKDSMDWVFNDPTKMVKAASLIGRLIDDIKSHQFEQ  420

Query  627   ERGHVASAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLA  448
             +RGHVASAVECYMK Y  +++EA +E+ K ++ AWKDIN+ C+    +PM +LLR+LNLA
Sbjct  421   KRGHVASAVECYMKEYGATEEEANIELSKQVNNAWKDINEACIQNTTIPMPLLLRILNLA  480

Query  447   RAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             RAI +IYK +D +T + +  K  + +  V+PV +
Sbjct  481   RAIEVIYKHDDGFTHAGIFLKDSVVSLFVEPVPL  514



>ref|XP_011095304.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=554

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/538 (51%), Positives = 377/538 (70%), Gaps = 9/538 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRSV YHP+VWGDYFLAY S   EI  +EE E+++ KE VRKVL   P     KLEL+D 
Sbjct  21    RRSVKYHPSVWGDYFLAYVS--MEISATEEEELRRQKEMVRKVLAWTPDHLYHKLELIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI   +Q   D Y      D  N+L +V+LRFRLLRQ G+ +SC +F 
Sbjct  79    IQRLGVGYHFEEEIDKFLQFTHDTYLEYSSKD--NDLRIVALRFRLLRQHGYPVSCDIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF+D +G FK SL K+VEGML L+EA+   + GE  L++AL F++S+LES L  +N   +
Sbjct  137   KFIDGEGNFKVSLIKNVEGMLELFEAAQFRIAGEKILEKALEFSSSNLESSLSNMNSSLS  196

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V  +LK+PI ++  RVGAK+++ IY+Q+ +H+++LL FAKLDFN++QK HQ+ELS IT
Sbjct  197   TQVKESLKIPILKSSNRVGAKKFISIYQQNVSHSEILLNFAKLDFNIIQKTHQKELSDIT  256

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL     LPFAR R+ ECYFW + VYFEP YH +RR+ T+I+ + S+LDD+YDVYG
Sbjct  257   RWWKDLDFANKLPFARDRVVECYFWAMEVYFEPHYHIARRMLTKILNMTSILDDIYDVYG  316

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T D+LQLFT+ IQR+D  A  ++P Y++  Y A+ D+  EME  + K ++ + + Y   E
Sbjct  317   TLDDLQLFTDLIQRWDVHALEQLPSYMRICYEALSDVYIEMENELKKTDESYRIQYAKEE  376

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK ++TY +E  W Y +++P  EEY+KV++VSS YMM+ TT LVGMG+++TK+  DW+T
Sbjct  377   MKKLVKTYIEEAKWSYNRYMPRMEEYMKVAIVSSTYMMLLTTSLVGMGNLVTKKDFDWIT  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             SEP+ V+A+  I RL +D+ GH FE++     +AVECYM     SK+EA+ E+   ++KA
Sbjct  437   SEPVLVRASSIIGRLANDLAGHGFEKK----PTAVECYMNENGASKEEAFAELGNQVTKA  492

Query  525   WKDINQECLHPL-PVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             W +INQECL P+ P+PM VL+R LNLA    L Y  +D Y+ S+   +S+I   LV+P
Sbjct  493   WMNINQECLRPMVPIPMPVLMRALNLACGTHLFYLKDDEYSNSEANIRSIIHGVLVEP  550



>sp|F6M8H7.1|SMST_SANMU RecName: Full=Probable sesquiterpene synthase; Short=SmSTPS [Santalum 
murrayanum]
 gb|AEF32537.1| putative sesquiterpene synthase [Santalum murrayanum]
Length=562

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/549 (48%), Positives = 367/549 (67%), Gaps = 5/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             ++N   R    + P++WGD F+ Y  +       +ER+V++LKE+VR+ L A     L++
Sbjct  16    DLNMISRPIANFPPSIWGDRFINYTCEDENDQTQKERQVEELKEQVRRELAATVDKPLQQ  75

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L ++D  QRLG+ Y FENEI+ S++HI+ +    +NC +G D  +LY V+L FRLLRQ G
Sbjct  76    LNIIDATQRLGIAYLFENEIEESLKHIYLHTYVENNCFEGSD--DLYSVALWFRLLRQNG  133

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             + +SC VF KF D +G FK++L +D +G+L LYEA+++ +HGE  LD+AL FT + LES+
Sbjct  134   YKVSCDVFNKFRDNEGNFKNNLMEDAKGLLELYEATHVSIHGEEMLDDALEFTKTRLESV  193

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +  LN   A +V HAL  P+ R LPR+ A  + +IYE   +HNK LL+ AKLDFNLLQ  
Sbjct  194   VSHLNYPLAEQVRHALYQPLHRGLPRLEAVYFFRIYEAHASHNKALLKLAKLDFNLLQSF  253

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H++ELS I RWWK L      PFAR RL E YFW+LGVYFEPQY  +R+I  ++  + S 
Sbjct  254   HKKELSDIARWWKSLDFAAKFPFARDRLVEGYFWVLGVYFEPQYSLARKIIIKVFTMIST  313

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YD YGT DEL+LFT A+QR+D  + +++P+Y+K  Y +ILD+  E+EE MA +  L
Sbjct  314   IDDIYDAYGTLDELKLFTKAMQRWDVGSLDQLPEYMKPCYKSILDVYNEIEEEMANQGSL  373

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             F + Y    MK  +  Y  E  W + K+VP F+EY+ V+LV+S Y  + T   +GMG+I 
Sbjct  374   FRMHYAKEVMKTIVEGYMDEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTISYLGMGEIA  433

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             +KE  DW+ S P  ++A+ S+ RLMDDM  H+FEQERGHVAS +ECYMK Y V+++EA+ 
Sbjct  434   SKEAFDWLFSHPPVIEASESVGRLMDDMRSHKFEQERGHVASGIECYMKQYGVTEEEAHD  493

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E  K + KAWKDIN+ECL P  VP  +L R+LNL R I +IYK+ D YT  +   K  I 
Sbjct  494   EFRKRLVKAWKDINEECLRPYRVPKPLLTRILNLTRVIDVIYKNEDGYTHVKKAMKDNIA  553

Query  372   TTLVQPVTI  346
             + L+ PV +
Sbjct  554   SLLIDPVIV  562



>emb|CBI31274.3| unnamed protein product [Vitis vinifera]
Length=750

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/540 (50%), Positives = 374/540 (69%), Gaps = 4/540 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R  V YHP++WGD FL+Y  +       +E++++ LKEE+R+ L+     + ++L+ +D
Sbjct  213   NRPVVQYHPSIWGDQFLSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTSQQLKFID  272

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQEGHHISCGV  1612
              +QRLGV YHFE EI+  +QHI+D+Y N   GDD E ++Y V+L+FRLLRQ G +ISCG+
Sbjct  273   AVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNISCGL  329

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F +F D+ G FK +L  DV GML LYEA++L VHGE  L +AL FT +HL++++  L   
Sbjct  330   FNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYH  389

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS 
Sbjct  390   LAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSN  449

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL ECYFW+LGVYFEPQY  +RRI T++I + S+LDD++D 
Sbjct  450   LARWWKELDFATKLPFARDRLVECYFWMLGVYFEPQYLRARRILTKVIAMISILDDIHDA  509

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ +++P+Y+K  Y A+LD+  E+EE M KE   + V Y  
Sbjct  510   YGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAK  569

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP FEEY++V+LVSS Y ++ATT  VGMG+I TKE  DW
Sbjct  570   EVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCILATTSFVGMGEIATKEAFDW  629

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VTS P  + ++  I RLMDD+  H+FEQ+RGHVASAVECYMK Y VS+++ Y E +K I 
Sbjct  630   VTSNPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYKEFQKQIE  689

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AW DINQECL P  V M +L R+LNL RA  ++YK+ D YT      +  I + L+  V
Sbjct  690   NAWLDINQECLKPTAVSMPLLARILNLTRAADVVYKEQDSYTHVGKVMRDNIASVLINAV  749


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -2

Query  660  MDDMIGHEFEQERGHVASAVECYMKGYNVSKQE-AYVEIEKLISKAWKDINQECLHPLPV  484
            MDD+  H+FEQ+RGHVAS +ECYMK Y  S++E    E +K +  AW+DIN+E L P  V
Sbjct  1    MDDISSHKFEQKRGHVASGIECYMKQYGASEEEETNREFQKQVVDAWRDINEEFLRPTVV  60

Query  483  PMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
            PM +L+ VLNL+R + +IY   D YT      K+ + + L+  +
Sbjct  61   PMPLLMCVLNLSRVMDVIYTGGDGYTHVGKVMKNNVASLLIHSI  104



>gb|ADR66821.1| germacrene A synthase [Vitis vinifera]
Length=555

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/538 (47%), Positives = 368/538 (68%), Gaps = 2/538 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP++WGD F+AY  +  +    +E++V+ LK EVR+ L+AA     + L  +D 
Sbjct  19    RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKAEVRRELMAAAGNPAQLLNFIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHFE EI+ S+QHI+D + +    D E++LY ++L+FRLLRQ+G++ISCG+F 
Sbjct  79    VQRLGVAYHFEREIEESLQHIYDRFHDA--DDTEDDLYNIALQFRLLRQQGYNISCGIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK+ L  +V+GML LYEA++L VHGE TL+EAL FT +HL++ +  L    A
Sbjct  137   KFKDEKGSFKEDLISNVQGMLGLYEAAHLRVHGEDTLEEALAFTTTHLKATVESLGYPLA  196

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V+HALK PIR+ L R+ A+ Y+ +Y+ + +H+K LL+ AKLDFNL+Q +H+ ELS + 
Sbjct  197   EQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  256

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L     LPFAR R  E YFW LGVYFEPQY  +RRI T++  + S++DD+YD YG
Sbjct  257   RWWKELDFATKLPFARDRFVEGYFWTLGVYFEPQYSRARRILTKLFAMASIIDDIYDAYG  316

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +ELQ FT AI+R+D  + + +P+Y+K  Y+ +LD+  E+++ + K    + V Y    
Sbjct  317   TLEELQPFTEAIERWDIKSIDHLPEYMKLFYVTLLDLYKEIDQELEKYGNQYRVYYAKEV  376

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             +K Q+R Y+ E  W +  ++P  EEY+ V+LV+S   ++AT   +GMG+I+TKE  DWV 
Sbjct  377   LKSQVRAYFAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDWVI  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             S+P  + A+  I RLMDD+  H+FEQ+RGHVAS +ECYMK Y VS+++ Y E  K +  A
Sbjct  437   SDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVENA  496

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             W DINQECL P  VPM +L RV+NL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  497   WLDINQECLKPTAVPMPLLTRVVNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  554



>sp|J9R5V4.1|TPS2_VALOF RecName: Full=Valerena-4,7(11)-diene synthase; AltName: Full=Terpene 
synthase 2; Short=VoTPS2 [Valeriana officinalis]
 gb|AFR42418.1| valerena-4,7(11)-diene synthase [Valeriana officinalis]
Length=562

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/549 (47%), Positives = 379/549 (69%), Gaps = 9/549 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL--  1810
             N+    R +  +H +VWG++FL Y S   +ID   + + +QLKEE+RK L+         
Sbjct  16    NIQEPVRPNAKFHKSVWGNHFLKYASNPEQIDYDADEQHEQLKEELRKKLVVNVTNERVE  75

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGH  1630
             E+L+L+D IQRLGV YHF+ EI A + ++     N     D +++Y+VSLRFRLLRQ+GH
Sbjct  76    EQLKLIDAIQRLGVAYHFQREIDAVLNNLLLFRSN----KDSDDIYMVSLRFRLLRQQGH  131

Query  1629  HISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI-  1453
             ++SC VFEKF + DG+FKDSL  DV G+LSLYEA+++ VH E  L+EAL FT   LE + 
Sbjct  132   NVSCSVFEKFKNIDGRFKDSLRDDVRGLLSLYEATHMRVHKEDILEEALEFTIYELEQVV  191

Query  1452  -LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
              L   + L A++V HAL +PIR+ L R+ A+ ++ +Y+ D++H++ LL+F+K+DFN+LQK
Sbjct  192   KLSSNDTLLASEVIHALNMPIRKGLTRIEARHFISVYQHDKSHDETLLKFSKIDFNMLQK  251

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQREL+ +T WW+ L V + +P+AR R  ECYFW LGVYFEPQY  +R++  ++I + S
Sbjct  252   LHQRELADLTIWWEKLNVAEKMPYARDRFVECYFWGLGVYFEPQYSRARKMFVKVINLTS  311

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             ++DD YD YGT DEL LFT+A++R++ + ++++P+Y++ +++ +L++   MEE + +E  
Sbjct  312   LIDDTYDSYGTFDELDLFTDAVKRWNVNETDKLPEYMRPLFMELLNVYNAMEEELKEEGV  371

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG-D  739
              + V Y    M + +  Y  E +W++  +VP F+EYLKV+L+S  YM+++T   VGMG  
Sbjct  372   SYRVEYAKQSMIQIVTAYNDEAIWYHNGYVPTFDEYLKVALISCGYMLLSTISFVGMGVT  431

Query  738   IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEA  559
              +TK   DWVT+ PL + A+C+I RL DD +GHE EQERGHVAS VECYMK  N +KQE 
Sbjct  432   TVTKPAFDWVTNNPLILIASCTINRLADDKVGHELEQERGHVASGVECYMKHNNATKQEV  491

Query  558   YVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSL  379
              +E  K IS AWKDINQECLHPLPVP+ +++R L LA  + + YKD D YT S  + K  
Sbjct  492   VIEFNKRISNAWKDINQECLHPLPVPLHLVVRPLYLACFMNVFYKDEDWYTHSNTQMKEC  551

Query  378   ITTTLVQPV  352
             I + LV+ V
Sbjct  552   INSLLVESV  560



>ref|XP_006478794.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=559

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/543 (48%), Positives = 373/543 (69%), Gaps = 4/543 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S R S  + P++WGD+F  Y     E D    + ++ LK+E+R++L A    S   LEL+
Sbjct  20    STRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLE-LKKEIRRMLKAVNKTS-HTLELI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  +   Y +C   D+EN+ LY +SL+FRL RQ G+ IS  
Sbjct  78    DAIQRLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNGYRISAD  137

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF  F   DGKFK SL KDV GMLSLYEA++L VHGE  LDEAL FT SHLES+   +  
Sbjct  138   VFNTFEGSDGKFKASLAKDVRGMLSLYEATHLRVHGENILDEALAFTTSHLESVAKQVCS  197

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               A +V HAL  PI + L R+ A+ Y+ IY+ + +HN+ LL FAKLDFN LQK+HQ+EL 
Sbjct  198   PLAEQVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLDFNGLQKLHQKELG  257

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I+RWWK+L     LPF R R+AE YFW +GV+FEPQY F+R++ T++I + S++DD+YD
Sbjct  258   DISRWWKELDFAHKLPFVRDRIAEVYFWAVGVHFEPQYSFARKLFTKVIYMTSIIDDIYD  317

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VYG  +EL LFT+AI+R+D +A +++P+Y+K  Y A++++ +E+E+ +A + KL+ + Y 
Sbjct  318   VYGKIEELDLFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLASQAKLYRLHYA  377

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MK Q++ Y+ E  W++  ++P  +EY+ V+L+SS +  ++    VGMGDI+TKE  +
Sbjct  378   KEAMKNQVKHYFFEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFE  437

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+ S P +++A+C++ RLM+DM  H+FEQ RGHVAS+VECYM  Y  +++EAY E  K +
Sbjct  438   WLFSNPRSIRASCAVGRLMNDMASHKFEQSRGHVASSVECYMNQYGATEEEAYSEFRKQV  497

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             S AWKDIN+ECL P  VP+ +L+R+LNL RA  +IYK  D YT S+ + K  I + L+ P
Sbjct  498   SNAWKDINEECLRPTVVPVPLLIRILNLTRAADVIYKYKDGYTDSE-ELKDFIVSLLINP  556

Query  354   VTI  346
             V I
Sbjct  557   VPI  559



>ref|XP_011035527.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/540 (49%), Positives = 372/540 (69%), Gaps = 8/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP++WGD F+++  K    +  E +E+++L E  ++ ++A+   S +KL+L+D 
Sbjct  23    RRTANYHPSIWGDQFISHLPKDKVHEAIELQEIEKLMERFKREILAS--NSSQKLDLIDA  80

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI+ ++ HI   Y+N I  +D ++LY  +L FRLLRQ G+++SC +F 
Sbjct  81    IQRLGVAYHFETEIEEALLHI---YNNRIDMED-DDLYNTALGFRLLRQHGYNVSCDIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK   T DV G+L LYEA++L VHGE  LDEAL FT   L+SI    N    
Sbjct  137   KFKDDKGYFKQ--TNDVRGILGLYEAAHLAVHGEDILDEALAFTTIQLKSIATSPNCPLT  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             AKVSHALK PIRR +PR+ ++ Y  IY+ + + NK LLR AKL+FNL+Q++H+ ELS IT
Sbjct  195   AKVSHALKQPIRRGVPRLESRRYFSIYQDEPSCNKTLLRLAKLNFNLVQELHKEELSEIT  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK L     LPFAR R+AEC+FWI+GVYFEPQY  +R+I T++I + +++DD+YDVYG
Sbjct  255   RWWKGLDFAGRLPFARDRVAECFFWIVGVYFEPQYSLARKILTKVIAMTTIIDDIYDVYG  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI R+DT + + +P Y+K  Y A+L++ +E+EE +AKE   + V Y    
Sbjct  315   TLEELELFTEAIDRWDTKSMHRLPDYMKICYEALLNVYSEIEEKVAKEGWSYRVHYGKEA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK Q+  Y+ E  WF+ KH+P  EEY++V+LV+  Y M+AT   +GMGD+ T++  DWV 
Sbjct  375   MKVQVHAYFNEAKWFHEKHIPTMEEYMQVALVTIGYSMLATMSFIGMGDVATEQAFDWVF  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P  V+A+ +ICRLMDD+  H+FEQERGH AS VECY+K Y +S+QE Y E    +  A
Sbjct  435   NRPKIVRASETICRLMDDVRSHKFEQERGHNASGVECYIKQYGLSEQEVYKEFHMQVVNA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P  VPM +L R+LNL+RA  +IY++ D Y       K+ + +  + PV I
Sbjct  495   WKDINEECLKPTVVPMPLLERILNLSRAAGVIYEEEDGYNHVGEVMKNNVASLFIDPVPI  554



>gb|AGB05610.1| sesquiterpene synthase 1 [Valeriana officinalis]
Length=562

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/549 (47%), Positives = 378/549 (69%), Gaps = 9/549 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL--  1810
             N+    R +  +H +VWG++FL Y S   +ID   + + +QLKEE+RK L+         
Sbjct  16    NIQEPVRPNAKFHKSVWGNHFLKYASNPEQIDYDADEQHEQLKEELRKKLVVNVTNERVE  75

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGH  1630
             E+L+L+D IQRLGV YHF+ EI A + ++     N     D +++Y+VSLRFRLLRQ+GH
Sbjct  76    EQLKLIDAIQRLGVAYHFQREIDAVLNNLLLFRSN----KDNDDIYMVSLRFRLLRQQGH  131

Query  1629  HISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI-  1453
              +SC VFEKF + DG+FKDSL  DV G+LSLYEA+++ VH E  L+EAL FT   LE + 
Sbjct  132   DVSCSVFEKFKNIDGRFKDSLRDDVRGLLSLYEATHMRVHKEDILEEALEFTIYELEQVV  191

Query  1452  -LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
              L   + L A++V HAL +PIR+ L R+ A+ ++ +Y+ D++H++ LL+F+K+DFN+LQK
Sbjct  192   KLSSNDTLLASEVIHALNMPIRKGLTRIEARHFISVYQHDKSHDETLLKFSKIDFNMLQK  251

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQREL+ +T WW+ L V + +P+AR R  ECYFW LGVYFEPQY  +R++  ++I + S
Sbjct  252   LHQRELADLTIWWEKLNVAEKMPYARDRFVECYFWGLGVYFEPQYSRARKMFVKVINLTS  311

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             ++DD YD YGT DEL LFT+A++R++ + ++++P+Y++ +++ +L++   MEE + +E  
Sbjct  312   LIDDTYDSYGTFDELDLFTDAVKRWNVNETDKLPEYMRPLFMELLNVYNAMEEELKEEGV  371

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG-D  739
              + V Y    M + +  Y  E +W++  +VP F+EYLKV+L+S  YM+++T   VGMG  
Sbjct  372   SYRVEYAKQSMIQIVTAYNDEAIWYHNGYVPTFDEYLKVALISCGYMLLSTISFVGMGVT  431

Query  738   IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEA  559
              +TK   DWVT+ PL + A+C+I RL DD +GHE EQERGHVAS VECYMK  N +KQE 
Sbjct  432   TVTKPAFDWVTNNPLILIASCTINRLADDKVGHELEQERGHVASGVECYMKHNNATKQEV  491

Query  558   YVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSL  379
              +E  K IS AWKDINQECLHPLPVP+ +++R L LA  + + YKD D YT S  + K  
Sbjct  492   VIEFNKRISNAWKDINQECLHPLPVPLHLVVRPLYLACFMNVFYKDEDWYTHSNTQMKEC  551

Query  378   ITTTLVQPV  352
             I + LV+ V
Sbjct  552   INSLLVESV  560



>gb|KDO52415.1| hypothetical protein CISIN_1g008620mg [Citrus sinensis]
Length=559

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/543 (48%), Positives = 373/543 (69%), Gaps = 4/543 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S R S  + P++WGD+F  Y     E D    + ++ LK+E+R++L A    S   LEL+
Sbjct  20    STRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLE-LKKEIRRMLKAVNKTS-HTLELI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  +   Y +C   D+EN+ LY +SL+FRL RQ G+ IS  
Sbjct  78    DAIQRLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNGYRISAD  137

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF  F   DGKFK SL KDV GMLSLYEA++L VHGE  LDEAL FT SHLES+   +  
Sbjct  138   VFNTFEGSDGKFKASLAKDVRGMLSLYEATHLRVHGENILDEALAFTTSHLESVAKQVCS  197

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               A +V HAL  PI + L R+ A+ Y+ IY+ + +HN+ LL FAKLDFN LQK+HQ+EL 
Sbjct  198   PLAEQVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLDFNGLQKLHQKELG  257

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I+RWWK+L     LPF R R+AE YFW +GV+FEPQY F+R++ T++I + S++DD+YD
Sbjct  258   DISRWWKELDFAHKLPFVRDRIAEVYFWAVGVHFEPQYSFARKLFTKVIYMTSIIDDIYD  317

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VYG  +EL LFT+AI+R+D +A +++P+Y+K  Y A++++ +E+E+ +A + KL+ + Y 
Sbjct  318   VYGKIEELDLFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLASQAKLYRLHYA  377

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MK Q++ Y+ E  W++  ++P  +EY+ V+L+SS +  ++    VGMGDI+TKE  +
Sbjct  378   KEAMKNQVKHYFFEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFE  437

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+ S P +++A+C++ RLM+DM  H+FEQ RGHVAS+VECY+  Y  +++EAY E  K +
Sbjct  438   WLFSNPRSIRASCAVGRLMNDMASHKFEQSRGHVASSVECYINQYGATEEEAYSEFRKQV  497

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             S AWKDIN+ECL P  VP+ +L+R+LNL RA  +IYK  D YT S+ + K  I + L+ P
Sbjct  498   SNAWKDINEECLRPTVVPVPLLIRILNLTRAADVIYKYKDGYTDSE-ELKDFIVSLLINP  556

Query  354   VTI  346
             V I
Sbjct  557   VPI  559



>ref|XP_006475284.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=565

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/543 (50%), Positives = 370/543 (68%), Gaps = 5/543 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIA-APPASLEKLEL  1795
             S RRS  + PT+WGDYFL+Y     E   +  +  Q+LK+E+R +L A     S  KL+L
Sbjct  21    STRRSANFDPTIWGDYFLSYTGDFKESGDASVKH-QELKKEIRTMLRADINKPSQTKLDL  79

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDEN--NLYVVSLRFRLLRQEGHHIS  1621
             +D IQRLGV YHFE+EI   +Q + +   +C  GDDEN   LY +SL+FRLLRQ G+ IS
Sbjct  80    IDDIQRLGVSYHFESEIDEILQKMHEANQDCDLGDDENVQELYYISLQFRLLRQNGYKIS  139

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
               VF  F D +G FK  L +D+ GMLSLYEA++L VHGE  L+EALTFT +HLES     
Sbjct  140   ADVFNSFKDSNGNFKSFLKRDIRGMLSLYEAAHLRVHGENILNEALTFTVTHLESFTSQS  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             N   AA+V+ AL  PIR++LPR+ AK YM IY++D +HNK LL FA LDFN+LQK HQ E
Sbjct  200   NTQLAAQVNRALNRPIRKSLPRLEAKHYMPIYQKDPSHNKDLLTFAMLDFNILQKQHQEE  259

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             L  I RWWK+  VP  LPF R R+ E YFWILGVYFEP++  +R+I T++I + S++DD+
Sbjct  260   LRDIVRWWKNFDVPNKLPFIRDRVVEGYFWILGVYFEPKFLLARKILTKVISMASIIDDI  319

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD YGT +EL+LF  AI+R+D SA + +P+Y+K  Y A+LD  +E E+ +A +  L+ + 
Sbjct  320   YDAYGTIEELELFATAIERWDLSAIDLLPEYIKLCYCALLDAYSEFEKDLASKGILYGLP  379

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             +    MK  +R+Y  E  W   ++VP  EEY++V+L+S  Y++++T+  +GM DI+TKE 
Sbjct  380   FAKESMKILVRSYIIEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTKEA  439

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +WV+  P  V+A+  ICRLMDD++ H+FEQ+RGHVASAVECYMK + VS++EA     +
Sbjct  440   FEWVSGNPKIVQASSIICRLMDDIVSHKFEQQRGHVASAVECYMKQHGVSEEEAVKVFRE  499

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              +  AWKDIN+E + P  VPM +L RVLNLAR + ++Y++ND YT   +  K  +   L 
Sbjct  500   KVGNAWKDINEELMRPPVVPMPLLERVLNLARLMDVLYQNNDSYTNPHL-MKDHVAALLK  558

Query  360   QPV  352
              PV
Sbjct  559   DPV  561



>ref|XP_006364906.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=554

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/541 (49%), Positives = 380/541 (70%), Gaps = 8/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS ++HPT+WGD+FLAY + L+  +  EE+E + LKEEVRK+L+ AP  SLEKLEL++ 
Sbjct  18    RRSGSHHPTIWGDHFLAY-ADLSGENEGEEKEHEDLKEEVRKMLVMAPSNSLEKLELINT  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LG+ YHFE+EI  S+ +++ +Y+    GD    L+ ++L FRLLRQ+GH++SC  F+
Sbjct  77    IQCLGLAYHFESEIDESLNYMYTHYEEHWIGD----LHAIALCFRLLRQQGHYVSCDAFK  132

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NELA  1429
             KF    G FK+ L K+V+GMLSLYEA+   VH E  LDEAL FT + L+ ILP L N   
Sbjct  133   KFTTHQGNFKEELVKNVQGMLSLYEAAQFRVHEEQILDEALNFTITQLKLILPKLINSQL  192

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A ++++ALK PI+  + RV  ++Y+  Y+Q+Q HN+VLL FAKLDFN+LQ +H++EL  I
Sbjct  193   AQQITNALKFPIKDGIVRVETRKYISFYQQNQNHNQVLLNFAKLDFNILQTLHEKELFDI  252

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK+L +    P+ R RL E YFW LGV+FEPQ   +R+I T++  + S++DD YD+Y
Sbjct  253   TRWWKELEIANTSPYVRDRLVETYFWSLGVHFEPQTSVTRKILTKVSFLLSIIDDTYDIY  312

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT DEL LFT AI+R++ +AS E+P Y+K IY  +LD+  E+E+ +A ENK F V+Y+I 
Sbjct  313   GTLDELTLFTKAIERWNINASEELPSYMKIIYQYLLDVYNEIEKELANENKSFLVNYSIN  372

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK ++ Y+QE  W+Y K VP  E+Y+K  + +S Y+++AT   +GMG+I TK+  DW+
Sbjct  373   EMKKVVKAYFQEAKWYYGKRVPRMEQYMKNGIPTSGYLLLATNSWLGMGEIATKDAFDWL  432

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             T+EP  + A+C I RL++D++ HE EQ+RG  AS VECYMK Y V+K+EA+ +I K+I  
Sbjct  433   TTEPPMLVASCIIARLLNDLLSHEEEQKRGDAASGVECYMKEYGVTKEEAHTKIRKIIEN  492

Query  528   AWKDINQEC--LHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
              WKD+N+E   +    +P  +L+ ++NL R    IYKD D YTFS+   K  I+  LV P
Sbjct  493   YWKDLNEEYFKVDVAIIPRVLLMPIINLTRVSEFIYKDEDAYTFSKNNLKDTISEILVDP  552

Query  354   V  352
             +
Sbjct  553   I  553



>ref|XP_002283070.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CAN76781.1| hypothetical protein VITISV_000919 [Vitis vinifera]
 emb|CBI20476.3| unnamed protein product [Vitis vinifera]
 gb|ADR74226.1| cubebol/delta-cadinene synthase [synthetic construct]
Length=559

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/545 (50%), Positives = 366/545 (67%), Gaps = 10/545 (2%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDP-SEEREVQQ---LKEEVRKVLIAAPPASLEKL  1801
              RRS  + P  WGD FL Y    T  DP +  R+VQQ   LK+E+R  L A    S + L
Sbjct  21    ARRSANFRPCFWGDRFLTY----TPDDPVTHARKVQQIEELKDELRNELKATARKSSQLL  76

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
               +D IQRLG+ Y FE EI+ +++ ++  Y+     +D+      SLRFRLLRQEG+HI 
Sbjct  77    NFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLT--NASLRFRLLRQEGYHIP  134

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
               VF KF D +G FK+SLT D+ G+L+LYEA++L  HGE  L+EAL F+ +HL+S+    
Sbjct  135   PDVFNKFKDDEGNFKESLTGDLPGLLALYEATHLMAHGEAILEEALAFSTAHLQSMATDS  194

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
                  A+V+ ALK PIR+ L RV A+ Y+ +Y++D  HNK LL+ +KLDFNLLQ +H++E
Sbjct  195   THPLPAQVTRALKRPIRKCLTRVEARHYISVYQEDGPHNKTLLKLSKLDFNLLQSLHRKE  254

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS +TRWWK L   K +PFAR RL E YFWILGVYFEPQY  +RRI  +++ + S++DD+
Sbjct  255   LSEVTRWWKGLNFAKKMPFARDRLVEGYFWILGVYFEPQYSLARRILIKVLAMISIIDDI  314

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD YGT +EL+LFT AI+R+D S+ +++P Y+K  Y A+LD+  EMEE +AKE  L+ V 
Sbjct  315   YDAYGTFEELKLFTEAIERWDASSVDQLPDYMKPCYQALLDVYEEMEEEIAKEGNLYRVQ  374

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    +++QI+ Y+ E  W   ++ P  +EY+  +LVSS Y M+ TT  VGMGDI TKE 
Sbjct  375   YAKAAIQRQIQAYFVEAKWLNQEYTPTLDEYMSNALVSSGYSMLITTSFVGMGDIATKEA  434

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DWV S+P  V+A+  ICRLMDD++ HEFEQ+RGHVASAVECYMK   V KQEAY E+ K
Sbjct  435   FDWVFSDPKMVRASSVICRLMDDIVSHEFEQKRGHVASAVECYMKQRGVCKQEAYDELNK  494

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              +   WKD+N+ECL P  VPM +L RVLN +R I ++YKD D YT      K LI + L+
Sbjct  495   QVVNGWKDMNEECLKPTQVPMPLLTRVLNFSRVIDILYKDEDQYTHVGKLMKDLIASILI  554

Query  360   QPVTI  346
               V I
Sbjct  555   DLVPI  559



>gb|KGN56190.1| hypothetical protein Csa_3G097540 [Cucumis sativus]
Length=558

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/552 (46%), Positives = 383/552 (69%), Gaps = 8/552 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             +++   R    +HPT+W + FL++D  L   D  E   +++LKEE+R ++ A+    L  
Sbjct  5     DISDVNRSLANFHPTIWKEQFLSFDDALKVDDGMELERIEKLKEEIRMMVTASMENPLAN  64

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCI----KGDDENNLYVVSLRFRLLRQE  1636
             L LVD IQRLGV Y+FE+EI+  ++HI+ +Y+N +    K  ++++L+  +L FRLLRQ+
Sbjct  65    LNLVDSIQRLGVSYNFEDEIEQFLEHIYVSYNNSLLLSNKDSEDDDLHFTALLFRLLRQQ  124

Query  1635  GHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES  1456
             G+ ISC +F KF+D +GKFK+SL +D  G+LSLYEAS++  HGE  L+EAL FT +HL++
Sbjct  125   GYRISCDIFLKFMDNNGKFKESLVEDERGILSLYEASHMRGHGEALLEEALEFTTTHLKA  184

Query  1455  ---ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNL  1285
                +   +N   A++VS+ALKLPIR+ +PR+ A+EY QIY+Q  +H++ LL F+KLDFN+
Sbjct  185   YIHLYSNINPNFASEVSNALKLPIRKCVPRIKAREYFQIYQQHPSHSETLLEFSKLDFNI  244

Query  1284  LQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIIC  1105
             LQK+HQ+ELS I RWWKDL VP   PFAR R+ ECYFW LG YFEPQY+  R++ T++I 
Sbjct  245   LQKLHQKELSEICRWWKDLDVPTKFPFARDRIVECYFWTLGAYFEPQYNVGRKMLTKVIA  304

Query  1104  IWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAK  925
             I S+LDD+YD YGT +ELQ+   AIQR+D S  + +P+Y+K  Y+A+ ++  E+ + + K
Sbjct  305   ISSILDDIYDAYGTFEELQVLAPAIQRWDRSMVHTLPEYMKPFYVAMFEVYEEISKEIGK  364

Query  924   ENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGM  745
             +    H+   IG +KK   +Y++E  W   K+ P F+EY++++L ++ Y ++ +   +G+
Sbjct  365   DQNSLHLQVAIGGIKKLSESYFEEAKWLNKKYKPSFKEYMELALNTTGYTLLISISFLGL  424

Query  744   GD-IITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSK  568
             GD I+T EVL W+++ P  +KA+  ICRLMDD+  H+FEQER HVASAVE YM+ Y+ S+
Sbjct  425   GDHIVTNEVLQWLSNGPQIIKASTIICRLMDDIASHKFEQEREHVASAVESYMEQYDCSE  484

Query  567   QEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKF  388
             +EA VE+ K +  AWKD N+    P  VP+ VL+RVLN +R + L+Y D D YT ++ + 
Sbjct  485   EEACVELHKEVVDAWKDTNEAFYRPFNVPLPVLMRVLNFSRVMNLLYLDEDGYTNAKSRT  544

Query  387   KSLITTTLVQPV  352
             K LI + LV P+
Sbjct  545   KFLIKSLLVDPL  556



>gb|ADK73619.1| terpene synthase 3 [Origanum vulgare]
Length=563

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/539 (50%), Positives = 374/539 (69%), Gaps = 5/539 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRSVTYHP+VW D+FL+Y + +TEI  +E+ E+++ KE+V+ +L   P  S  K+EL+D 
Sbjct  22    RRSVTYHPSVWRDHFLSYTNDVTEITAAEKEELEKQKEKVKNLLDQTPNDSTLKIELIDA  81

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLG  YHFE  I  S+  ++D Y+     DDE+ + V SLRFRLLRQ+G+ + C VFE
Sbjct  82    IQRLGFGYHFEEVIDESLGEVYDRYEMPSGKDDEDEIRVRSLRFRLLRQQGYRVPCDVFE  141

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             K LD  G FKDSL  DVEG+LSLYEAS  G++GE  +D+AL F++SHLE  +  +    +
Sbjct  142   KLLDDKGNFKDSLITDVEGLLSLYEASNYGINGEEIMDKALKFSSSHLEGSIHKMPTSLS  201

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V  AL +PI +TL R+GA++++ +Y++D++HN++LL+FAKLDFN++QK+HQREL  IT
Sbjct  202   RRVKEALDMPISKTLTRLGARKFISLYQEDESHNELLLKFAKLDFNIVQKMHQRELHHIT  261

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWW+ L   K LPFAR R+ EC+FWILGVYFEP+Y  +RR  T++I + S+LDD+YDVYG
Sbjct  262   RWWEGLEFGKKLPFARDRVVECFFWILGVYFEPKYEIARRFLTKVISMTSILDDIYDVYG  321

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             + DEL+  T+AIQR+D S  +E+P Y++  Y A+L + +EME+ MAK+ + + + Y   E
Sbjct  322   SLDELRRLTHAIQRWDISVGDELPPYMRICYEALLGVYSEMEDEMAKKGQSYRLLYARQE  381

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI-ITKEVLDWV  709
             M K +  Y  E  W ++K+ P  EEY+K +LVS  YMM++TT LVGM D+ ITK   DW+
Sbjct  382   MIKLVMAYMVEAEWCFSKYFPTMEEYMKQALVSGAYMMLSTTSLVGMEDLNITKHDFDWI  441

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             TSEP  ++A   ICRLMDDM+GH  EQ+      +V+CYM+    SK+EA  E    + K
Sbjct  442   TSEPPMLRAASVICRLMDDMVGHGIEQK----IISVDCYMRENGCSKEEACREFWNRVKK  497

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             AWK +N+ECL P    M +L RVLNLAR I L+Y   D Y  S  K K+ I + LV P+
Sbjct  498   AWKCMNEECLEPRAASMAILARVLNLARVINLLYVGEDAYGSSSTKTKNFIKSVLVDPI  556



>ref|XP_011005622.1| PREDICTED: valencene synthase-like isoform X1 [Populus euphratica]
 ref|XP_011005623.1| PREDICTED: valencene synthase-like isoform X2 [Populus euphratica]
Length=554

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/540 (48%), Positives = 375/540 (69%), Gaps = 8/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  +HP++WGD F+++  K    +  E +E+++L+E+  + L+A+   S ++L+L+D 
Sbjct  23    RRTANFHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFTRELLAS--NSSQQLDLIDA  80

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI+ ++QHI++N      G ++++LY  +L FRLLRQ G+++SC +F 
Sbjct  81    IQRLGVAYHFETEIEEALQHIYNNR----IGMEDDDLYNTALGFRLLRQHGYNVSCDIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK S   DV G+L LYEA++L VHGE  LDEAL  T  HL+S+    +   A
Sbjct  137   KFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALALTTIHLKSMATSPDCPLA  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             AKVSHALK PIRR +PR+ ++ Y+ IY+ + + NK LLR  KL+FNL+Q++H+ EL+ IT
Sbjct  195   AKVSHALKQPIRRGVPRLESRRYISIYQDEPSCNKTLLRLGKLNFNLVQELHKEELAEIT  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK L   + LPFAR R+ EC+FWI+GVYFEPQY  +R+I T++I + S++DD+YDVYG
Sbjct  255   RWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTKVIAMTSIIDDIYDVYG  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI R+DT + + +P Y+K  Y A+L++ +EMEE +AKE   + V Y    
Sbjct  315   TLEELELFTAAIDRWDTKSMDHLPDYMKICYEALLNVYSEMEEKVAKEGWSYRVHYGKEA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK  +  Y+ E  WF+  H+P  EEY++V+LV++ Y M+AT   VGMGD++T++  DWV 
Sbjct  375   MKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTTGYCMLATVSFVGMGDMVTEQAFDWVF  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P  ++A+ +I RLMDD+  H+FEQERGH AS VECY++ Y +S+QE Y E    +  A
Sbjct  435   NHPKIIRASETIARLMDDVKSHKFEQERGHAASGVECYIRQYGLSEQEVYEEFHMQVVNA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P  VPM +L R+LNL+R + +IYK+ D YT      K+ + + L+  V I
Sbjct  495   WKDINEECLKPTAVPMPLLERILNLSRVMDVIYKEEDGYTHVGKVMKNNVASLLIDSVPI  554



>ref|XP_009344725.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=555

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/542 (49%), Positives = 379/542 (70%), Gaps = 12/542 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             + S T+ P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR++L  +P    +KL L+D 
Sbjct  24    KPSATFSPSIWGDHFLSYAS--LEVDAELEQHVQELKEEVRRMLTTSPENVSQKLNLIDD  81

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHF NEI+  +Q I  +        D ++LY  +L FRLLRQ+G+++SC +F 
Sbjct  82    IQHLGVSYHFGNEIEEILQKIHKS------SYDLDDLYTAALLFRLLRQQGYNVSCDLFN  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D DG FK+SL  DV G+LSLYEA++L +HGE  LDEALTFT ++LES    L+   A
Sbjct  136   KFKDGDGNFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTMTNLESATFRLSPPLA  195

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
               V+HAL  P+R+ LPRV A+ ++ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+ELS I
Sbjct  196   KAVTHALNQPLRKGLPRVEARYHLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELSEI  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             TRWWKDL VP  LPFAR RL E YF W + VYF+PQY F+RR + ++  + S++DDLY+ 
Sbjct  256   TRWWKDLDVPNKLPFARDRLVEVYFCWSMSVYFQPQYSFARRTSCKVTAVASIIDDLYE-  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             Y T ++L+LFT AI+R+D SA +++P+Y+K  Y A+LD+  E+ E +  + KL+ + +  
Sbjct  315   YDTDEQLKLFTEAIERWDVSAMDQLPEYMKVCYRALLDVYNEIHEKLLHDGKLYRIHHAR  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MKKQ+R Y+ E   F+ KH+P  +EY+ +SLV+S Y ++ TT  VGM +  T +  DW
Sbjct  375   EAMKKQVRGYFVEAKLFHQKHIPSLDEYMSLSLVTSGYPLLITTSFVGMEEA-TIDSFDW  433

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             +++ P AVKA   ICRLMDD++ H+FEQE+ H  SAV CYMK Y V+++EA +E+++ + 
Sbjct  434   LSTFPQAVKAASKICRLMDDIVDHKFEQEKEHFISAVNCYMKKYGVTEEEAIIELKRQVH  493

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDIN+ CLHP  VPM +L+R+LN AR + ++YK  D YT ++   K LI +TLV+PV
Sbjct  494   NAWKDINEACLHPTAVPMPLLIRILNFARIMDVVYKCEDGYTNAKGVLKDLIVSTLVEPV  553

Query  351   TI  346
              +
Sbjct  554   AL  555



>sp|E3W207.1|SAUSS_SANAS RecName: Full=Sesquiterpene synthase; Short=SauSesquiTPS [Santalum 
austrocaledonicum]
 gb|ADO87005.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=559

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/549 (47%), Positives = 367/549 (67%), Gaps = 5/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             N+    R    + P++WGD F+ Y  +       +ER+V++LKE+VR+ L A     L++
Sbjct  13    NLKELSRPIANFPPSIWGDRFINYTCEDENEQAQKERQVEELKEQVRRELAATVDKPLQQ  72

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L ++D  QRLG+ YHFENEI+ S++HI+ +    +NC +G   ++LY V+L FRLLRQ+G
Sbjct  73    LNIIDATQRLGIAYHFENEIEESLEHIYLHTYVKNNCFQGS--HDLYSVALWFRLLRQDG  130

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             + +SC VF+ F D +G FK+SL +D +G+L LYEA++L VHGE  LD+AL F  + LESI
Sbjct  131   YKVSCDVFDNFRDYEGNFKNSLMEDAKGLLELYEATHLSVHGEEMLDDALEFAKTRLESI  190

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +  LN   A +V HAL  P+R+ LPR+ A  + +IYE   +HNK LL+ AKLDFNLLQ +
Sbjct  191   VNHLNYPLAEQVRHALYRPLRKGLPRLEAVYFFRIYEAYHSHNKALLKLAKLDFNLLQSL  250

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H++EL  + RWW+ L      PFAR RL E YFWILGVYFEPQY  +R ITT++  + S 
Sbjct  251   HRKELGDMARWWRSLDFATKFPFARDRLVEGYFWILGVYFEPQYSLAREITTKVFAMIST  310

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YD YGT DEL+LFT AIQR+D  + +++P+Y+K  Y +ILD+  E+EE MA +  L
Sbjct  311   IDDIYDAYGTLDELKLFTEAIQRWDVGSLDQLPEYMKPCYKSILDVYNEIEEEMANQGSL  370

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             F + Y    MK  +  Y  E  W + K+VP F+EY+ ++LV+S Y  + T   +GMG I 
Sbjct  371   FRMHYAKEVMKTIVEGYMDEAKWCHEKYVPTFQEYMSLALVTSGYTFLTTISYLGMGGIA  430

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             +KE  +W+ S P  ++A+ SICRLMDDM  H+FEQERGHVAS +ECYMK Y V ++EA+ 
Sbjct  431   SKEAFEWLFSHPPIIEASESICRLMDDMSSHKFEQERGHVASGIECYMKQYGVIEEEAHD  490

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E  K + KAWKDIN+  L P  VP  +L+R+LNL R + +IYK+ D YT  +   K  I 
Sbjct  491   EFHKRLVKAWKDINEGFLRPYAVPEPLLMRILNLTRVMDVIYKNEDSYTHVKKAMKDNIA  550

Query  372   TTLVQPVTI  346
             + L+ P+ +
Sbjct  551   SLLIDPMIV  559



>ref|NP_001284382.1| (+)-gamma-cadinene synthase [Cucumis melo]
 sp|B2KSJ5.1|GCSY1_CUCME RecName: Full=(+)-gamma-cadinene synthase; Short=CmTpsNY; AltName: 
Full=(+)-delta-cadinene synthase [Cucumis melo]
 gb|ABX83200.1| terpene synthase [Cucumis melo]
Length=571

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/548 (47%), Positives = 382/548 (70%), Gaps = 11/548 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             R    +HP +W ++FL++  D  L +ID   +   ++LKEE+R ++IA     L KL LV
Sbjct  23    RSLANFHPNIWKEHFLSFTFDDAL-KIDEGMKERTEKLKEEIRMMMIAYVENQLIKLNLV  81

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCI----KGDDENNLYVVSLRFRLLRQEGHHI  1624
             D IQRLGV YHFE+E+   ++HI+ +Y+N +    K  +  +L++ +L FRLLRQ+G+ I
Sbjct  82    DSIQRLGVSYHFEDEVDEFLEHIYVSYNNSLLLSNKNSNGEDLHITALLFRLLRQQGYRI  141

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESIL--  1450
             SC +F KF+D +GKFK+SL +D  G+LSLYEAS++  HGE  L+EAL FT +HL++ +  
Sbjct  142   SCDIFLKFMDDNGKFKESLVEDERGLLSLYEASHMMGHGEALLEEALEFTTTHLQTYIHR  201

Query  1449  -PGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
                +N   A++VS+ALKLPIR+++PR+ A+EY++IY+Q  +HN+ LL F+KLDFN+LQK+
Sbjct  202   YSNINPSFASEVSNALKLPIRKSVPRIKAREYLEIYQQHPSHNETLLEFSKLDFNILQKL  261

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQ+ELS I RWWKDL VP   PFAR R+ ECYFW LG YFEPQY   R++ T++I I S+
Sbjct  262   HQKELSEICRWWKDLDVPTKFPFARDRIVECYFWTLGAYFEPQYSVGRKMLTKVIAIASI  321

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             LDD+YD YGT +ELQ+ T AIQR+D S  + +P Y+K  Y+A+L++  E+ + + K+   
Sbjct  322   LDDIYDAYGTFEELQVLTPAIQRWDRSMVHTLPLYMKPFYVAMLELYEEIGKEIDKDQNS  381

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGD-I  736
              H+   IG +K+   +Y++E  W   ++ P F+EY++++L ++ Y M+ +   +G+GD I
Sbjct  382   LHLQVAIGGIKRLSESYFEEAKWLNKEYKPSFKEYMELALKTTGYTMLISISFLGLGDHI  441

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             +T EVL W+++ P  +KA+  ICRLMDD+  H+FEQER HVASAVECYMK Y+ S++EA 
Sbjct  442   VTNEVLQWLSNGPQIIKASTIICRLMDDIASHKFEQEREHVASAVECYMKQYDCSEEEAC  501

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
             +E+ K +  AWKD N+    P  VP+ VL+RVLN +R I L+Y D D YT ++   K LI
Sbjct  502   IELHKEVVDAWKDTNEAFYRPFNVPVPVLMRVLNFSRVINLLYLDEDGYTNAKSGTKFLI  561

Query  375   TTTLVQPV  352
              + LV P+
Sbjct  562   KSLLVDPL  569



>ref|XP_006363765.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=551

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/539 (48%), Positives = 375/539 (70%), Gaps = 2/539 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR   +HP+VWGD+FLAY + L+  +  EE+E +  K  VRK+L+ AP  SL+KLEL++ 
Sbjct  12    RRCANHHPSVWGDHFLAY-ANLSGANEWEEKEHEDQKGGVRKMLVMAPSKSLQKLELINT  70

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+  +   +  YD+ I    E++L+VV+L FRLLRQ+G+++S   F 
Sbjct  71    IQLLGVAYHFEHEIEELLSCFYTCYDDWIGEFGESDLHVVALSFRLLRQQGYYVSSDAFG  130

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF+++ G +K+ L +DV+G+LSLYEA+   VH E  LDEA+ FT +HL+ ILP L++  A
Sbjct  131   KFINEQGSYKEELARDVQGLLSLYEAAQFRVHDEEILDEAINFTTTHLKLILPNLSDPLA  190

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VS+ALK PI   + RVG ++Y+  Y++D++H+++LL FAKLDFN+LQ++H++EL  IT
Sbjct  191   TQVSNALKFPINNIIVRVGTRKYISFYKEDESHSEMLLNFAKLDFNILQRLHKKELCDIT  250

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+  + + LPFAR R+ E YFW LGVYF PQY  +R+I T+++C  S++DD YD YG
Sbjct  251   RWWKESEIAQALPFARDRVVELYFWSLGVYFVPQYSVARKILTKVLCFCSIMDDTYDTYG  310

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEME-EVMAKENKLFHVSYTIG  889
             T DEL L T AI+R+D  AS ++P Y+K  Y A+L +  E E E+    NK F V Y+I 
Sbjct  311   TLDELTLLTTAIERWDIDASEQLPPYMKLSYRALLQVYNETERELENLGNKTFRVKYSIN  370

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK ++ Y+QE  W++ K VP  E+Y+K  + SS Y+++ATT  +GMGD  TK+  DW+
Sbjct  371   EMKKLLKAYFQEAKWYHAKDVPTMEQYIKNGIPSSTYLLLATTSWLGMGDAATKDAFDWI  430

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             ++EP  + A+C I RL++D++ HE E ERG VAS +ECYM  +  + +EAY+EI K+I  
Sbjct  431   SNEPTILVASCIIARLLNDLVTHEIEVERGDVASGIECYMNEHGATTEEAYMEIRKIIEI  490

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              WKD+N+ CL P  VP  +L+ VLNL R     YKD D YTFS+   K +I+  L+ P+
Sbjct  491   NWKDLNRGCLKPTTVPRVLLMPVLNLTRVAEFFYKDEDAYTFSKNNLKDVISMVLIDPI  549



>sp|F6M8H6.1|SPIST_SANSP RecName: Full=Probable sesquiterpene synthase; Short=SspiSTPS 
[Santalum spicatum]
 gb|AEF32536.1| sesquiterpene synthase [Santalum spicatum]
Length=562

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/549 (47%), Positives = 370/549 (67%), Gaps = 5/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             ++N   R    + P++WGD F+ Y  +       +ER+V++LKE+VR+ L  A    L++
Sbjct  16    DLNMISRPVANFPPSIWGDRFINYACEDENEQAQKERQVEELKEQVRRELATAIDKPLQQ  75

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L ++D  QRLG+ YHFENEI+ S++HI+ +    + C +G D  +LY V+L FRLLRQ+ 
Sbjct  76    LNIIDATQRLGIAYHFENEIEESLKHIYLHTYVENTCFEGSD--DLYSVALWFRLLRQDD  133

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             + +SC VF+KF D +G FK+SL +D +G+L LYEA++L V+GE  LD+AL FT +HLE +
Sbjct  134   YRVSCDVFKKFRDSEGNFKNSLMEDAKGLLELYEATHLSVNGEEMLDDALEFTKTHLELV  193

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +  LN   A +V HAL  P  + LPR+ A  + +IYE   +HN+ LL+ AKLDFNLLQ +
Sbjct  194   VSHLNYPLAEQVRHALYQPQHKGLPRLEAVYFFRIYEAYDSHNEALLKLAKLDFNLLQSL  253

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H +ELS + +WWK L      PFAR RL E YFWILGVYFEPQY  +R+I  ++  + S 
Sbjct  254   HMKELSHMAKWWKSLDFATKFPFARDRLVEGYFWILGVYFEPQYSLARKIIIKVFTMIST  313

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YD YGT DEL+LFT AIQR+D  + +++P+Y+K  Y ++LD+  E+EE M  +  L
Sbjct  314   IDDIYDAYGTLDELKLFTKAIQRWDIGSLDQLPEYMKPCYKSVLDVYNEIEEEMDNQGSL  373

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             F + Y   EMKK +  Y  E  W + K+VP F+EY+ V+LV++ Y  + T   +GMG+I 
Sbjct  374   FRMHYAKEEMKKIVEGYMDEAKWCHEKYVPTFQEYMSVALVTAGYTFLTTISYLGMGEIA  433

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             +KE  DW+ S P  ++A+ S+CRLMDDM  HEFEQERGHVAS +ECYMK Y V+++EA+ 
Sbjct  434   SKEAFDWLFSRPPIIEASESVCRLMDDMRSHEFEQERGHVASGIECYMKQYGVTEEEAHD  493

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             +  K + KAWKDIN+ CL P P+P  +L+R+L+L R I +IYK+ D YT  +   K  I 
Sbjct  494   KFHKRLVKAWKDINEGCLRPYPMPKPLLMRILSLTRVIDVIYKNEDWYTHVKKPMKDKIA  553

Query  372   TTLVQPVTI  346
             + L+ P+ +
Sbjct  554   SLLIDPMIV  562



>ref|XP_006469889.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=562

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/544 (49%), Positives = 372/544 (68%), Gaps = 5/544 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S RRS  + P++WGD+FL Y     E D    + ++ LK+E+R++L A    S   LEL+
Sbjct  20    STRRSANFRPSIWGDHFLQYTCDYQETDDRSLKHLE-LKKEIRRMLKALNKTS-HTLELI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  + + Y  C   D+EN+ LY +SL+FRL RQ G+ IS  
Sbjct  78    DAIQRLGVSYHFESEIDEILGKMHEAYRECDLWDNENDKLYYISLQFRLFRQNGYRISSD  137

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLN  1438
             VF  F   DGKF  SL KDV GMLSLYEA++L VH E  LDEAL FT SHLESI    + 
Sbjct  138   VFNTFKGSDGKFTASLAKDVRGMLSLYEATHLRVHEENILDEALAFTTSHLESIATHQIR  197

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V HAL  PI + L R+ A+EY+ IY ++ +HN+ LL FAKLDFN LQK+HQ+EL
Sbjct  198   SPLAEQVKHALVQPIHKGLQRLEAREYIPIYHEEPSHNEALLTFAKLDFNKLQKLHQKEL  257

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
               I+RWWK+L     LPF R R+AE YFW +G YFEPQ+ F+RR+ T++I + SV+DD+Y
Sbjct  258   GDISRWWKELDFTHKLPFIRDRVAEGYFWAIGAYFEPQHSFARRLFTKVITLISVIDDIY  317

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DVYG  +EL+LFT+AI+R+D +A +++P+Y+K  Y A++D+ +E E+ +A + KL+ + Y
Sbjct  318   DVYGKIEELELFTSAIERWDINAIDQLPEYMKLCYGALIDVYSEAEKDLASQGKLYRLHY  377

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MK  ++ Y  E  W +  +VP  +EY+ V+L++S  +M++T   VGMGDI+TKE  
Sbjct  378   AKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALITSASLMLSTISFVGMGDIVTKESF  437

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +W+ S P +++A+  + RLM+D++ H+FEQ RGHVAS+VECYMK Y  +++EAY E+ K 
Sbjct  438   EWLFSNPRSIRASSVVNRLMNDIMSHKFEQSRGHVASSVECYMKQYEATEEEAYNELRKQ  497

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             +S AWKDIN++CL P  VPM +L+R+LNL R   + YK +D YTF++V  K  I +  + 
Sbjct  498   VSNAWKDINEDCLRPTVVPMPLLMRILNLTRDADVTYKYDDGYTFAEV-LKDFIASLFIN  556

Query  357   PVTI  346
             PV I
Sbjct  557   PVPI  560



>dbj|BAP75561.1| linalool synthase [Citrus unshiu]
Length=565

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/545 (49%), Positives = 370/545 (68%), Gaps = 9/545 (2%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVL---IAAPPASLEKL  1801
             S RRS  + PT+WGDYFL+Y     E   +  +  Q+LK+E+R +L   I  P  +  KL
Sbjct  21    STRRSANFDPTIWGDYFLSYTGDFKESGDASVKH-QELKKEIRTMLRADINKPTQT--KL  77

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDEN--NLYVVSLRFRLLRQEGHH  1627
             +L+D IQRLGV YHFE+EI   ++ + +   +C  GDDEN   LY +SL FRLLRQ G+ 
Sbjct  78    DLIDDIQRLGVSYHFESEIDEILRKMHEANQDCDLGDDENVQELYYISLHFRLLRQNGYK  137

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             IS  VF  F D +G FK  L +D+ GMLSLYEA++L VHGE  L+EALTFT +HLES   
Sbjct  138   ISADVFNSFKDSNGNFKSFLKRDIRGMLSLYEAAHLRVHGENILNEALTFTVTHLESFTS  197

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
               N   AA+V+ AL  PIR++LPR+ AK YM IY++D +HNK LL FA LDFN+LQK HQ
Sbjct  198   QSNTQLAAQVNRALNRPIRKSLPRLEAKHYMPIYQKDPSHNKDLLTFAMLDFNILQKQHQ  257

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
              EL  I RWWK+  VP  LPF R R+ E YFWILGVYFEP++  +R+I T++I + S++D
Sbjct  258   EELRDIVRWWKNFDVPNKLPFIRDRVVEGYFWILGVYFEPKFLLARKILTKVISMASIID  317

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D+YD YGT +EL+LF  AI+R+D SA + +P+Y+K  Y A+LD  +E E+ +A +  L+ 
Sbjct  318   DIYDAYGTIEELELFATAIERWDLSAIDLLPEYMKLCYCALLDAYSEFEKDLASKGILYG  377

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + +    MK  +R+Y  E  W   ++VP  EEY++V+L+S  Y++++T+  +GM DI+TK
Sbjct  378   LPFAKESMKILVRSYIIEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTK  437

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +WV+  P  V+A+  ICRLMDD++ H+FEQ+RGHVASAVECYMK + VS++EA    
Sbjct  438   EAFEWVSGNPKIVQASSIICRLMDDIVSHKFEQQRGHVASAVECYMKQHGVSEEEAVKVF  497

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              + +  AWKDIN+E + P  VPM +L RVLNLAR + ++Y++ND YT   +  K  +   
Sbjct  498   REKVGNAWKDINEELMRPPVVPMPLLERVLNLARLMDVLYQNNDSYTNPHL-MKDHVAAL  556

Query  366   LVQPV  352
             L  PV
Sbjct  557   LKDPV  561



>sp|F6M8H4.1|SAST_SANAL RecName: Full=Probable sesquiterpene synthase; Short=SaSTPS [Santalum 
album]
 gb|AEF32534.1| sesquiterpene synthase [Santalum album]
Length=559

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/544 (48%), Positives = 366/544 (67%), Gaps = 5/544 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    + P++WGD F+ Y  +       +ER+V++LKE+VR+ L A     L++  ++D
Sbjct  18    SRPIANFPPSIWGDRFINYTCQDENERAQKERQVEELKEQVRRELAATVDKPLQQQNIID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
               QRLG+ YHFENEI+ S++HI+ +    + C +G D  +LY V+L FRLLRQ G+ +SC
Sbjct  78    ATQRLGIAYHFENEIEESLEHIYLHTYVENTCFEGSD--DLYSVALWFRLLRQNGYRVSC  135

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              VF KF D +G FK++L +D +G+L LYEA++L VHGE  LD+AL FT + LES++  LN
Sbjct  136   DVFNKFRDNEGNFKNNLMEDAKGLLELYEATHLSVHGEEMLDDALEFTKTRLESVVSHLN  195

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V HAL  P+ + LPR+ A  + +IYE   +HNK LL+ AKLDFNLLQ  H++EL
Sbjct  196   YPLAEQVRHALYQPLHKGLPRLEAVYFFRIYEAHASHNKALLKLAKLDFNLLQSFHKKEL  255

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             S I RWWK L     +PFAR RL E YFW+LGVYFEPQY  +R+I  ++  + S +DD+Y
Sbjct  256   SDIARWWKSLDFATKVPFARDRLVEGYFWVLGVYFEPQYSLARKIIIKVFTMISTIDDIY  315

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             D YGT DEL+LFT AI+R+D  + +++P+Y+K  Y +IL++  E+EE M  +  LF + Y
Sbjct  316   DAYGTVDELKLFTEAIRRWDVGSLDQLPEYMKPCYKSILEVYNEIEEEMDNQGSLFRMHY  375

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MKK +  Y  E  W + K+VP FEEY+ V+LV+S Y  + T   +GMG+I +KE  
Sbjct  376   AKEVMKKLVEGYMDEAKWCHEKYVPTFEEYMSVALVTSGYTFLTTMSYLGMGEIASKEAF  435

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DW+ S P  ++A+ S+ RLMDDM  H+FE+ERGHVAS +ECYMK Y+V+++EAY E  K 
Sbjct  436   DWLFSHPPVIEASESVGRLMDDMRSHKFERERGHVASGIECYMKQYSVTEEEAYDEFCKR  495

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             + KAWKDIN+ECL P  VP  +L+R+LNL R I +IYK+ D YT  +   K  I + L+ 
Sbjct  496   LVKAWKDINEECLRPYHVPKPLLMRILNLTRVIDVIYKNEDGYTHVKKAMKDNIASLLID  555

Query  357   PVTI  346
             P+ +
Sbjct  556   PMIV  559



>ref|NP_001268024.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74197.1| germacrene D synthase [Vitis vinifera]
Length=584

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/539 (49%), Positives = 366/539 (68%), Gaps = 2/539 (0%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    +HP +WGD F+ Y  +       +  +++ LK+EV++ L AA       L  +D
Sbjct  47    NRPVTNFHPNIWGDQFITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANHSLLLNFID  106

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              +QRLGV YHFE EI+ ++QHI++++ +    D + +LY V+L FRLLRQ+G+ ISCG+ 
Sbjct  107   AVQRLGVAYHFEQEIEEALQHIYESFHDL--NDIDGDLYNVALGFRLLRQQGYSISCGIL  164

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
             +KF D+ G+FK+ L  +V G+L LYEA++L VHGE  L EALTFT +HL++++  L    
Sbjct  165   KKFTDERGRFKEVLITNVRGLLGLYEAAHLRVHGEDILAEALTFTTTHLKAMVESLGYPL  224

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS +
Sbjct  225   AEQVVHALNRPIRKGLERIEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHREELSNL  284

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              RWWK+L     LPFAR RL E YFWILGVYFEPQY  +RRI T++I + S+LDD+YD Y
Sbjct  285   ARWWKELDFATKLPFARDRLVEGYFWILGVYFEPQYLRARRILTKVIAMTSILDDIYDAY  344

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G  +EL+LFT AI+R+D ++ +++P+Y+K  Y A+LD+  E+EE M KE   + V Y   
Sbjct  345   GNPEELKLFTEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAKE  404

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R Y+ E  W + +HVP  EEYL+V+LVSS Y M+ATT LVGMG+I TKE  DWV
Sbjct  405   VMKNQVRAYFAEAKWLHEEHVPTIEEYLRVALVSSGYCMLATTSLVGMGEIATKEAFDWV  464

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             TS+P  + ++  I RLMDD+  H+FEQ+R HVASA+ECYMK Y VS+++AY E  K I  
Sbjct  465   TSDPKIMSSSNFIARLMDDISSHKFEQKREHVASAIECYMKQYGVSEEQAYSEFRKQIEN  524

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             AW DINQECL P  VPM +L RVLNL RA  +IYK+ D YT      K+ I    + P+
Sbjct  525   AWMDINQECLKPTAVPMPLLARVLNLTRAADVIYKEQDSYTHVGKVMKNNIAAFFINPI  583



>ref|XP_006374233.1| hypothetical protein POPTR_0015s05270g [Populus trichocarpa]
 gb|ERP52030.1| hypothetical protein POPTR_0015s05270g [Populus trichocarpa]
Length=554

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/540 (48%), Positives = 375/540 (69%), Gaps = 8/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP++WGD F+++  K    +  E +E+++L+E+ ++ L+A+   S +KL+L+D 
Sbjct  23    RRTANYHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFKRELLAS--NSSQKLDLIDA  80

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI+ ++QHI   Y+N I  +D ++LY  +L FRLLRQ G+++SC +F 
Sbjct  81    IQRLGVAYHFETEIEEALQHI---YNNRIDMED-DDLYNTALGFRLLRQHGYNVSCDIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK S   DV G+L LYEA++L VHGE  LDEAL FT  HL+S+    N    
Sbjct  137   KFKDDKGYFKPS--NDVRGILGLYEAAHLAVHGEDILDEALAFTTIHLKSMATSPNCPLT  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             AKVSHALK PIRR +PR+ ++ Y+  Y+ + + NK LLR AKL+FN++Q++H+ ELS IT
Sbjct  195   AKVSHALKQPIRRGVPRLESRRYISFYQDEPSCNKTLLRLAKLNFNVVQELHKEELSEIT  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK L   + LPFAR R+ EC+FWI+G YFEPQY  +R+I T++I + S++DD+YDVYG
Sbjct  255   RWWKGLDFARRLPFARDRVVECFFWIVGAYFEPQYSLARKILTKVIAMTSIIDDIYDVYG  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI R+DT + +++P Y+K  Y A+L++ +E+EE +AKE   + V +    
Sbjct  315   TLEELELFTEAIDRWDTKSMDQLPDYMKICYEALLNVYSEIEEKVAKEGWSYRVHFGKQA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK  +  Y+ E  WF+  H+P  EEY++V+LV+S Y ++AT   +GMGD++T++  DWV 
Sbjct  375   MKVLVHAYFDEAKWFHENHIPTMEEYMQVALVTSGYSLLATVSFIGMGDMVTEQAFDWVF  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P  V+A+ +I RL+DD+  H+FEQERGH AS VECY++ Y +S+QE Y E    +  A
Sbjct  435   NRPKIVRASETISRLVDDVRSHKFEQERGHAASGVECYIRQYGLSEQEVYKEFHMQVVNA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P  VPM +L R+LNL R I +IYK+ D YT      K+ + + ++  V I
Sbjct  495   WKDINEECLKPTAVPMPLLERILNLTRVIDVIYKEKDEYTHVGEVMKNNVASLVIDSVPI  554



>dbj|BAP74389.1| delta-elemene synthase [Citrus jambhiri]
Length=563

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/545 (48%), Positives = 365/545 (67%), Gaps = 8/545 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HP++WGD+FL Y     E D     +  +LK+E+R++L A    S   LEL+D 
Sbjct  22    RRSANFHPSIWGDHFLQYTCDSQEPDDGSNVKHLELKKEIRRMLKADNKPS-RTLELIDA  80

Query  1785  IQRLGVDYHFENEIQ---ASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             IQRLGV YHFE+EI      +   +   D C+  +D   LY +SL+FRLLR+ G+ IS  
Sbjct  81    IQRLGVSYHFESEIDEILGRVHQAYQESDLCVNEND--GLYYISLQFRLLRENGYRISAD  138

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLN  1438
             VF KF D DG FK SL KDV GMLSLYEA++L VH E  LDEA  F  SHLESI    ++
Sbjct  139   VFNKFRDIDGNFKPSLAKDVRGMLSLYEATHLRVHEENILDEAHAFATSHLESIATHQIS  198

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V HAL  PI + + R+ A+ Y+ IY ++ +HN+ LL FAKLDFN LQK+HQ+EL
Sbjct  199   SPLAEQVKHALFQPIHKGVQRLEARHYISIYREESSHNEALLTFAKLDFNKLQKLHQKEL  258

Query  1257  SGITRWWKDLGVPKMLPFA-RHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             S I+RWWK+L     LPF  R R+AECYFW + VYFEPQY   RR+  ++  + S++DD+
Sbjct  259   SDISRWWKELDFAHNLPFTIRDRIAECYFWAVAVYFEPQYSLGRRMLAKVFPMTSIIDDI  318

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYG  +EL+LFT+AI+R+D SA +E+P+Y+K  Y A+LD+ +E E+ +A + KL+H+ 
Sbjct  319   YDVYGKFEELELFTSAIERWDISAIDELPEYMKLCYRALLDVYSEAEKDLASQGKLYHLH  378

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK Q++ Y+ E  W +  ++P  +EY+ V+ V+S Y M++TT  VGMGDI+TKE 
Sbjct  379   YAKEAMKNQVKNYFFEAKWCHQNYIPSVDEYMTVASVTSGYPMLSTTSFVGMGDIVTKES  438

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +W  + P  ++A+    RLM+DM+ H+FEQ RGHVAS VECY+K Y  +++EA  E  K
Sbjct  439   FEWSLTNPRVIRASSVAARLMNDMVSHKFEQSRGHVASCVECYIKQYGATEEEACNEFRK  498

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              +S AWKD+N+ECL P  VPM +L+R+LNL R + ++Y+  D YT S V  K  + + L+
Sbjct  499   QVSNAWKDVNEECLRPTVVPMPLLMRILNLTRFLDVVYRFEDGYTHSGVVLKDFVASLLI  558

Query  360   QPVTI  346
              PV+I
Sbjct  559   NPVSI  563



>ref|XP_011015484.1| PREDICTED: valencene synthase-like [Populus euphratica]
Length=554

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/540 (48%), Positives = 375/540 (69%), Gaps = 8/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  +HP++WGD F+++  K    +  E +E+++L+E+  + L+A+   S ++L+L+D 
Sbjct  23    RRTANFHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFTRELLAS--NSSQQLDLIDA  80

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI+ ++Q+I++N      G ++++LY  +L FRLLRQ G+++SC +F 
Sbjct  81    IQRLGVAYHFETEIEEALQYIYNNR----IGMEDDDLYNTALGFRLLRQHGYNVSCDIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G FK S   DV G+L LYEA++L VHGE  LDEAL  T  HL+S+    +   A
Sbjct  137   KFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALALTTIHLKSMATSPDCPLA  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
             AKVSHALK PI+R +PR+ ++ Y+ IY+ + + NK LLR AKL+FNL+Q++H+ EL+ IT
Sbjct  195   AKVSHALKQPIQRGVPRLESRRYISIYQDEPSCNKTLLRLAKLNFNLVQELHKEELAEIT  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK L   + LPFAR R+ EC+FWI+GVYFEPQY  +R+I T++I + S++DD+YDVYG
Sbjct  255   RWWKGLDFARRLPFARDRVVECFFWIIGVYFEPQYSLARKILTKVIAMASIIDDIYDVYG  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL+LFT AI R+DT + + +P Y+K  Y A+L++ +EMEE +AKE   + V Y    
Sbjct  315   TLEELELFTEAIDRWDTKSMDHLPDYMKICYEALLNVYSEMEEKVAKEGWSYRVHYGKEA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK  +  Y+ E  WF+  H+P  EEY++V+LV+S Y M+ T   VGMGD++T++  DWV 
Sbjct  375   MKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSFVGMGDMVTEQAFDWVF  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P  ++A+ +I RLMDD+  H+FEQERGH AS VECY++ Y +S+QE Y E    +  A
Sbjct  435   NHPKIIRASETIARLMDDVKSHKFEQERGHAASGVECYIRQYGLSEQEVYKEFHMQVVNA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ECL P  VPM +L R+LNL+R + +IYK+ D YT      K+ + + L+  V I
Sbjct  495   WKDINEECLKPTAVPMPLLERILNLSRVMDVIYKEEDGYTHVGKVMKNNVASLLIDSVPI  554



>gb|AGB14625.1| germacrene-D synthase [Malus domestica]
Length=553

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/540 (48%), Positives = 372/540 (69%), Gaps = 11/540 (2%)
 Frame = -2

Query  1959  SVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQ  1780
             S T+ P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR +L+ +P    +KL L+D IQ
Sbjct  23    SATFSPSIWGDHFLSYAS--LEVDAELEQHVQELKEEVRSMLMTSPENVSQKLNLIDDIQ  80

Query  1779  RLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFEKF  1600
             RLGV YHF NEI+  +Q I  +        D ++LY V+LRFRLLRQ+G+++SC +F K 
Sbjct  81    RLGVSYHFGNEIEEILQKIHQS------SYDLDDLYTVALRFRLLRQQGYNVSCDLFNKL  134

Query  1599  LDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAK  1420
              D DGKFK+SL  DV G+LSLYEA++L +HGE  LDEALTFT ++LES    L+   A  
Sbjct  135   KDGDGKFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTNLESATFRLSPPLAKA  194

Query  1419  VSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGITR  1243
             V+HAL  P+R+ LPRV A+ Y+ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+ELS ITR
Sbjct  195   VTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELSEITR  254

Query  1242  WWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             WWKDL VP  LPFAR RL E YF W + VYF+PQY F+RR + ++  I S++DD+YD +G
Sbjct  255   WWKDLDVPNKLPFARDRLVEVYFCWSMSVYFQPQYSFARRTSCKVTAITSIMDDIYDTHG  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
               +EL+LFT AI+R+D SA +++P+Y+K  Y  +L+I +E+ E +A E KL+ + +    
Sbjct  315   KFEELELFTEAIERWDVSAIDQLPEYMKLCYRELLNIYSEIHEKLAHEGKLYRIDHAREA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK Q+R ++ E   F   H+P  +EY+ VSL++  Y ++ TT  VGM +  T +  DW+ 
Sbjct  375   MKNQVRGFFDEAKLFRQNHMPSLDEYMSVSLMTCGYALLITTSFVGMEE-ATIDSFDWLL  433

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P AVKA  ++ RLMDD+  H+ EQER H ASAV CYM+ Y  +++EA +E+++ ++ A
Sbjct  434   TSPQAVKAASTVTRLMDDIADHKLEQEREHFASAVNCYMRKYGATEEEAIIELQRQVNNA  493

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ CLHP  V M +L+R+LN AR + ++YK  D Y  +    K  I +TLV+PV +
Sbjct  494   WKDINEACLHPTAVAMPLLIRILNFARVMDVVYKCEDGYNNADGGLKDFIVSTLVEPVAL  553



>emb|CBI31262.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/538 (47%), Positives = 368/538 (68%), Gaps = 3/538 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP++WGD F+AY  +  +    +E++V+ LK EVR+ L+AA     + L  +D 
Sbjct  69    RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKAEVRRELMAAAGNPAQLLNFIDA  128

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHFE EI+ S+QHI+D + +    D E++LY ++L+FRLLRQ+G++ISCG+F 
Sbjct  129   VQRLGVAYHFEREIEESLQHIYDRFHDA--DDTEDDLYNIALQFRLLRQQGYNISCGIFN  186

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK+ L  +V+GML LYEA++L VHGE TL+EAL FT +HL++ +  L    A
Sbjct  187   KFKDEKGSFKEDLISNVQGMLGLYEAAHLRVHGEDTLEEALAFTTTHLKATVESLGYPLA  246

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V+HALK PIR+ L R+ A+ Y+ +Y+ + +H+K LL+ AKLDFNL+Q +H+ ELS + 
Sbjct  247   EQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  306

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L     LPFAR R  E YFW LGVYFEPQY  +RRI T++  + S++DD+YD YG
Sbjct  307   RWWKELDFATKLPFARDRFVEGYFWTLGVYFEPQYSCARRILTKLFAMASIIDDIYDAYG  366

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +ELQ FT AI+R+D  + + +P+Y+K  Y+ +LD+  E+++ + K    + V Y   E
Sbjct  367   TLEELQPFTEAIERWDIKSIDHLPEYMKLFYVTLLDLYKEIDQELEKYGNQYRVYYA-KE  425

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             +K Q+R Y+ E  W +  ++P  EEY+ V+LV+S   ++AT   +GMG+I+TKE  DWV 
Sbjct  426   LKSQVRAYFAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDWVI  485

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             S+P  + A+  I RLMDD+  H+FEQ+RGHVAS +ECYMK Y VS+++ Y E  K +  A
Sbjct  486   SDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVENA  545

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             W  INQECL P  VPM +L RV+NL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  546   WLGINQECLKPTAVPMPLLTRVVNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  603



>gb|ADX01384.1| germacrene D synthase [Citrus hystrix]
Length=541

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/541 (48%), Positives = 373/541 (69%), Gaps = 8/541 (1%)
 Frame = -2

Query  1959  SVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQ--QLKEEVRKVLIAAPPASLEKLELVDK  1786
             S  +HP++WGD+FL Y     E   + +R V+  +LK+E+R++L A    S   LEL+D 
Sbjct  6     SANFHPSIWGDHFLQYTRDFQE---TGDRSVKHLELKKEIRRMLKAVNKTS-HTLELIDA  61

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCGVF  1609
             IQRLGV YHFE+EI   +  +   Y +C   D+EN+ LY +SL+FRL RQ G+ IS  VF
Sbjct  62    IQRLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNGYRISADVF  121

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
               F   DGKFK SL KDV GMLSLYEA++L VHGE  LDEAL FT SHLES+   +    
Sbjct  122   NTFKGSDGKFKASLAKDVRGMLSLYEATHLRVHGENILDEALAFTTSHLESVAKQVCSPL  181

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
               +V HAL  PI + L R+ A+ Y+ IY+ + +HN+ LL FAKL FN LQK+HQ+EL  I
Sbjct  182   VEQVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLGFNGLQKLHQKELGDI  241

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             +RWWK+L     LPF R R+AE YFW +GV+FEPQY F+R++ T++I + S++DD+YDVY
Sbjct  242   SRWWKELDFAHKLPFVRDRIAEVYFWAVGVHFEPQYSFTRKLFTKVIYMTSIIDDIYDVY  301

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G  +EL LFT+AI+R+D +A +++P+Y+K    A++++ +E+E+ +  + KL+ + Y   
Sbjct  302   GKIEELDLFTSAIERWDINAIDQLPEYMKLCIRALINVYSEVEKDLVSQGKLYRLHYAKE  361

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q++ Y+ E  W +  +VP  +EY+ V+L+SS +  ++T   VG+GDI+TKE  +W+
Sbjct  362   AMKNQVKHYFFEAKWCHQNYVPTVDEYMTVALISSGHPNLSTISFVGLGDIVTKESFEWL  421

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S P +++A+C++ RLM+DM+ H+FEQ RGHVAS+VECY+  Y  +++EAY E  K +S 
Sbjct  422   FSNPRSIRASCAVGRLMNDMVSHKFEQSRGHVASSVECYINQYGATEEEAYSEFRKQVSN  481

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL P  VP+ +L+R+LNL RA  +IYK  D YT+S+ + K  I + L+ PV 
Sbjct  482   AWKDINEECLRPTVVPVPLLMRILNLTRAADVIYKYKDGYTYSE-ELKDFIVSLLINPVP  540

Query  348   I  346
             I
Sbjct  541   I  541



>emb|CBI31305.3| unnamed protein product [Vitis vinifera]
Length=645

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/539 (49%), Positives = 366/539 (68%), Gaps = 2/539 (0%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    +HP +WGD F+ Y  +       +  +++ LK+EV++ L AA       L  +D
Sbjct  108   NRPVTNFHPNIWGDQFITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANHSLLLNFID  167

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              +QRLGV YHFE EI+ ++QHI++++ +    D + +LY V+L FRLLRQ+G+ ISCG+ 
Sbjct  168   AVQRLGVAYHFEQEIEEALQHIYESFHDL--NDIDGDLYNVALGFRLLRQQGYSISCGIL  225

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
             +KF D+ G+FK+ L  +V G+L LYEA++L VHGE  L EALTFT +HL++++  L    
Sbjct  226   KKFTDERGRFKEVLITNVRGLLGLYEAAHLRVHGEDILAEALTFTTTHLKAMVESLGYPL  285

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS +
Sbjct  286   AEQVVHALNRPIRKGLERIEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHREELSNL  345

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              RWWK+L     LPFAR RL E YFWILGVYFEPQY  +RRI T++I + S+LDD+YD Y
Sbjct  346   ARWWKELDFATKLPFARDRLVEGYFWILGVYFEPQYLRARRILTKVIAMTSILDDIYDAY  405

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G  +EL+LFT AI+R+D ++ +++P+Y+K  Y A+LD+  E+EE M KE   + V Y   
Sbjct  406   GNPEELKLFTEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAKE  465

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R Y+ E  W + +HVP  EEYL+V+LVSS Y M+ATT LVGMG+I TKE  DWV
Sbjct  466   VMKNQVRAYFAEAKWLHEEHVPTIEEYLRVALVSSGYCMLATTSLVGMGEIATKEAFDWV  525

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             TS+P  + ++  I RLMDD+  H+FEQ+R HVASA+ECYMK Y VS+++AY E  K I  
Sbjct  526   TSDPKIMSSSNFIARLMDDISSHKFEQKREHVASAIECYMKQYGVSEEQAYSEFRKQIEN  585

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             AW DINQECL P  VPM +L RVLNL RA  +IYK+ D YT      K+ I    + P+
Sbjct  586   AWMDINQECLKPTAVPMPLLARVLNLTRAADVIYKEQDSYTHVGKVMKNNIAAFFINPI  644


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 11/97 (11%)
 Frame = -2

Query  729  KEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVE  550
            KE  DWV  +P +V+A+ ++ R+ DDM  H+    RGH AS+VECYMK + V +Q AY+E
Sbjct  4    KEAFDWVIKDPKSVRASSTVIRINDDMASHK----RGHSASSVECYMKQHGVLEQPAYLE  59

Query  549  IEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAI  439
            + K ++K +       L  LP+       VL+L++ I
Sbjct  60   LSKHLAKLF-------LSYLPIHHSRYSAVLSLSQGI  89



>ref|XP_006364159.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=548

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/540 (48%), Positives = 371/540 (69%), Gaps = 3/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HPTVWGD+FLAY + L+  +  EE+E + LKEEVRK+L+ +P  SL+KL L++ 
Sbjct  12    RRSDNHHPTVWGDHFLAY-ANLSGANEWEEKEHKDLKEEVRKMLVISPSKSLQKLGLINT  70

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+ S   I++ Y+  I   + +NL+ V+L F+LLRQ+G ++S  VF 
Sbjct  71    IQLLGVAYHFEHEIEESFSEIYNGYEEWI--GECSNLHAVALSFQLLRQQGFYVSSDVFR  128

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF +  G +  +L  D++G+LSLYEA+   VH E  LDEA+ FT +HL+ +LP L+   +
Sbjct  129   KFTEDQGNYNKALVNDMQGLLSLYEAAQFKVHDEEILDEAINFTTTHLKLLLPKLSNSLS  188

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VS+ALK PI +T+ RV  ++Y+  Y++D++ ++VLL FAKLDFN LQK+H+REL  IT
Sbjct  189   MQVSYALKYPINKTIARVATRKYIAFYQEDKSCDQVLLNFAKLDFNTLQKMHKRELCDIT  248

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L +   LPFAR R+ E YFW LGVYFEPQ + +R+I T+++   S+ DD+YD YG
Sbjct  249   RWWKELDLANELPFARDRVVELYFWCLGVYFEPQCNVARKILTKVLWFVSITDDIYDTYG  308

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T  EL L TNAI+R++  A+ ++  ++K  Y A+LD  +E+E+ +AKENK F V++ I E
Sbjct  309   TLHELTLLTNAIERWNIDAAEKLAPFMKLFYTALLDFYSEVEKELAKENKSFRVNFAISE  368

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MKK +R Y+QE  W++   VP  EEY+   + +S    ++T C +GMGD  TKE  +W+T
Sbjct  369   MKKLVRAYFQEAKWYHGNTVPRMEEYMMNGIHTSTVPDLSTACWLGMGDEATKEAFEWIT  428

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             +EP  + A+  I RL++D++ HE E ERG VAS ++CYM  Y+ +K EAY+EI K+I   
Sbjct  429   TEPPIIVASSIISRLLNDIVSHEREIERGDVASGIDCYMNEYDATKGEAYMEIRKIIENN  488

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQ CL P  V   +L+ +LNL R     YKD D YTFS+   K +I+  LV P+ +
Sbjct  489   WKDLNQRCLKPTTVTRVLLMPLLNLGRVSEFFYKDEDAYTFSKNNLKDVISMVLVDPIKV  548



>gb|ACF94469.1| germacrene B synthase [Cistus creticus subsp. creticus]
Length=572

 Score =   538 bits (1386),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 272/548 (50%), Positives = 378/548 (69%), Gaps = 11/548 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKV-LIAAPPASL----EKL  1801
             RRS  +HP++WGD FL+Y S     +  E+RE   LK ++++  + AA   SL    E L
Sbjct  25    RRSAGFHPSIWGDQFLSYASNPVVENEEEKREHDLLKGKLKEKLMTAAENKSLIEDKETL  84

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFD--NYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             +L+D IQRL V YHFE EI   ++ I     +++     D+ +LY  SLRFRLLRQ G+ 
Sbjct  85    DLIDLIQRLCVSYHFEKEISRILEQIMQLVTHNDHDHNHDDGDLYTTSLRFRLLRQNGYR  144

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL---ES  1456
             I CGVF KF D +G FK+SL  DV+GMLSLYEA++L + GE  LDEAL+FT++ L   ++
Sbjct  145   IPCGVFNKFKDSEGNFKESLICDVKGMLSLYEAAHLRIQGEDILDEALSFTSTQLGAAKT  204

Query  1455  ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
              +   N   AA+V+HALK PIR+ LPR+ A+ +M +YE D  H+K LL FAKLDFN+LQ+
Sbjct  205   TITTTNPSLAAQVAHALKQPIRKGLPRLQARRFMPVYEADPCHDKTLLTFAKLDFNMLQR  264

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQ+E+  IT+WWKD+     +PFAR R+ ECYFW LGVYFEP+Y   R+I  ++I + S
Sbjct  265   LHQKEVGEITKWWKDIDFSNKMPFARDRVVECYFWTLGVYFEPKYTLGRKIFNKVIAMTS  324

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             VLDD+YDVYGT DEL++FT AI R+D +  +++P Y++  Y A +D+ +EME  M  E+K
Sbjct  325   VLDDIYDVYGTLDELEIFTEAILRWDINTISQLPSYMQIYYQAFIDVYSEMEAQMEVEDK  384

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
             L+ V Y    MKK +R Y+QE  WF+  +VPP EEY+ V+LVSS Y ++A T  VGMGD+
Sbjct  385   LYCVPYAKEVMKKLVRAYHQESKWFHANYVPPMEEYMSVALVSSGYEVLAATSFVGMGDV  444

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             +TK+  +W+ + P  + A+  + RLM+D++GH+FEQ+RGHVASAVECY+K Y  +++EA 
Sbjct  445   VTKDSFEWLFNYPKIITASLIMGRLMNDIVGHKFEQKRGHVASAVECYVKQYGGTEEEAV  504

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
              E  K I+ AWKDIN+ECL P  VPM +L RVLNLAR + +IY  +D YT S++  K  I
Sbjct  505   EEFRKQITNAWKDINEECLCPTAVPMPLLTRVLNLARVLEVIYNIDDCYTNSKLIVKD-I  563

Query  375   TTTLVQPV  352
              + L+ PV
Sbjct  564   ASLLINPV  571



>ref|NP_001268028.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74192.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score =   537 bits (1384),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 251/538 (47%), Positives = 366/538 (68%), Gaps = 2/538 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP++WGD F+AY  +  +    +E++V+ LK EVR+ L+AA     + L  +D 
Sbjct  19    RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKAEVRRELMAAAGNPSQLLNFIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHFE EI+ S+QHI+D + +    D E++LY ++L+FRLLRQ+G++ISCG+F 
Sbjct  79    VQRLGVAYHFEREIEESLQHIYDRFHDA--DDTEDDLYNIALQFRLLRQQGYNISCGIFN  136

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK+ L  +++GML LYEA++L VHGE  L+EAL FT +HL++ +  L    A
Sbjct  137   KFKDEKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALAFTTTHLKATVESLGYPLA  196

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V+HALK PIR+ L R+ A+ Y+ +Y+ + +H+K LL+ AKLDFNL+Q +H+ ELS + 
Sbjct  197   EQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  256

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L     LPFAR R  E YFW LGVYFEPQY  +RRI T++  + S++DD+YD YG
Sbjct  257   RWWKELDFATKLPFARDRFVEGYFWTLGVYFEPQYSRARRILTKLFSMASIIDDIYDAYG  316

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +ELQ FT AI+R+D  + + +P+Y+K  Y+ +LD+  E+++ + K    + V Y    
Sbjct  317   TLEELQPFTEAIERWDIKSIDHLPEYMKLFYVTLLDLYKEIDQELEKYGNQYRVYYAKEV  376

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             +K Q+R Y+ E  W +  ++P  EEY+ V+LV+S   ++AT   +GMG+I+TKE  DWV 
Sbjct  377   LKSQVRAYFAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDWVI  436

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             S+P  + A+  I RLMDD+  H+FEQ+RGHVAS +ECYMK Y VS+++ Y E  K +  A
Sbjct  437   SDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVENA  496

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             W  INQECL P  VPM +L RV+NL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  497   WLGINQECLKPTAVPMPLLTRVVNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  554



>ref|XP_004243482.2| PREDICTED: (-)-germacrene D synthase [Solanum lycopersicum]
Length=551

 Score =   536 bits (1382),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 260/540 (48%), Positives = 375/540 (69%), Gaps = 5/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR   +HP+VWGD+FL Y + L   +  EE+E +  K  VRK+L+ +P  SL+KLEL++ 
Sbjct  13    RRCANHHPSVWGDHFLTY-ANLLGANEWEEKEHEDQKGGVRKMLVLSPSKSLQKLELINT  71

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+ S+  I++ Y+  I   + ++L+ V+L FRLLRQ+G+++S  VF 
Sbjct  72    IQLLGVSYHFEHEIEESLSEIYNGYEEWI--GESHDLHDVALSFRLLRQQGYYVSSDVFR  129

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G +K++L  DV+G+LSLYEA+ L V  E  LDEA+ FT +HL+ +LP L++  A
Sbjct  130   KFTDERGNYKETLASDVQGLLSLYEAAQLRVDDEEILDEAINFTTTHLKLLLPNLSDPLA  189

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VS+ALK PI   + RV  ++Y+  Y++D++HN++LL FAKLDFN+LQ++H+REL  IT
Sbjct  190   TQVSNALKFPINNIIVRVATRKYISFYQEDKSHNEMLLHFAKLDFNILQRLHKRELCDIT  249

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKD  + + LPFAR R+ E YFW LGVYFEP Y  +R+I T+++C  S++DD YD YG
Sbjct  250   RWWKDSEIAQALPFARDRVVELYFWSLGVYFEPHYSVARKILTKVLCFCSIMDDTYDTYG  309

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEME-EVMAKENKL-FHVSYTI  892
             T DEL L T AI+R+D  AS ++P Y+K  Y A++ +  E E E+    NK+ + V Y+I
Sbjct  310   TLDELTLLTTAIERWDIDASEQLPSYMKLSYRALVQVYNETEKELENLGNKMTYRVKYSI  369

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              EMKK +R Y+QE  W++ K VP  E+Y+K  + SS Y+++ATT  +GMGD+ TK+  DW
Sbjct  370   NEMKKLLRAYFQEAKWYHGKDVPTMEQYIKNGIPSSTYLLLATTSWLGMGDVATKDAFDW  429

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             +++EP  + A+  I RL++D++ HE E ERG VAS +ECYM  Y  +K+EAY+EI K+I 
Sbjct  430   ISNEPTILVASSIIARLLNDLVTHEIEVERGDVASGIECYMNEYGATKEEAYMEIRKIIE  489

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
               WKD+N+ CL P  VP  +L+ VLNL R     YKD D YTFS+   K +I+  L+ P+
Sbjct  490   NNWKDLNRGCLKPTTVPRVLLMPVLNLTRVAEFFYKDEDAYTFSKNNLKDVISMVLIDPI  549



>ref|XP_002274781.1| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CAN64791.1| hypothetical protein VITISV_001915 [Vitis vinifera]
 gb|ADR74227.1| alpha-humulene synthase [synthetic construct]
Length=555

 Score =   537 bits (1383),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 263/541 (49%), Positives = 365/541 (67%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R  V YHP +WGD FL++  +       +E++++ LKEE+R+ L+     + ++L+ +D
Sbjct  18    NRPVVKYHPNIWGDQFLSHTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTSQQLKFID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQEGHHISCGV  1612
              +QRLG+ YHFE EI+  +QHI+D+Y N   GDD E ++Y V+L+FRLLRQ G +ISCG+
Sbjct  78    AVQRLGLAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNISCGL  134

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F +F D+ G FK +L  DV GML LYEA++L V GE  LDEAL FT +HL S++  L   
Sbjct  135   FNEFKDEKGNFKKALISDVRGMLGLYEAAHLRVRGEDILDEALAFTTTHLRSMVEHLEYP  194

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V HALK PIRR L R+ A+ Y+ IY+ + +H++ LL+ AKLDFNL+Q +H+ ELS 
Sbjct  195   FAEQVVHALKQPIRRGLERLEARWYISIYQDETSHDRTLLKLAKLDFNLVQSLHKEELSN  254

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I+RWWK L     LPFAR RL ECYFWILG YFEPQY ++RRI T+ I + S +DD+YD 
Sbjct  255   ISRWWKKLDFATKLPFARDRLVECYFWILGFYFEPQYVWARRILTKTIALTSTMDDIYDA  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LFT AI+R+D ++ + +P+Y+K  Y+A+LD+  E+EE M KE   + V Y I
Sbjct  315   YGTFEELKLFTAAIERWDINSIDHLPEYMKHFYVALLDVYKEIEEEMEKEGNQYRVQYAI  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q R Y+ E  W +   +P  EEY+ V+ VSS   M+  T  +GMG I+TKE  DW
Sbjct  375   EAMKNQARAYFHEAKWLHEGRIPTVEEYMSVAQVSSGDSMLTITSFIGMGKIVTKEAFDW  434

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V + P  V A+  I RLMDD+  H+FEQ+RGHVAS VECYMK Y  S++E Y + +K + 
Sbjct  435   VITNPKIVTASSVISRLMDDITSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQKQVE  494

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              A KDIN+E L P  VPM +L+RVLNL+R +++IY   D YT      K+ + + L+ P+
Sbjct  495   DACKDINEEFLRPTAVPMPLLMRVLNLSRVMYVIYTGGDGYTHVGKVMKNNVASLLIHPI  554

Query  351   T  349
              
Sbjct  555   A  555



>sp|J9RLZ7.1|TPS1_VALOF RecName: Full=Germacrene C/D synthase; AltName: Full=Terpene 
synthase 1; Short=VoTPS1 [Valeriana officinalis]
 gb|AFR42417.1| germacrene B/C/D synthase [Valeriana officinalis]
Length=563

 Score =   536 bits (1382),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 257/549 (47%), Positives = 378/549 (69%), Gaps = 8/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAP--PASL  1810
             N+    R +  +H +VWGD+FL Y S   +I+   +++ +QLKEE+RK L+       + 
Sbjct  16    NIQEPVRPNANFHKSVWGDHFLKYASNPEQINDGVDKQHKQLKEELRKKLVVNVNIERAE  75

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGH  1630
             E+L+L+D IQRLGV YHF  EI + + +  + ++N +  DD   LY+ SLRFRLLRQ+G+
Sbjct  76    EQLKLIDAIQRLGVAYHFRTEIASVLNNQLELWNNKVDDDD---LYLTSLRFRLLRQQGY  132

Query  1629  HISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESIL  1450
             ++SC VFEKF + DG+F + LT DV G+LSLYE++++ VH E  L+EAL FT + LE ++
Sbjct  133   NVSCAVFEKFKNIDGRFNECLTDDVRGLLSLYESTHMRVHKEDILEEALEFTVAQLEQVI  192

Query  1449  PGL--NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
                  +++  ++V HAL +PIR++L R+ A+ ++ +YEQD++ N+ LL+F+KLDFN+LQK
Sbjct  193   KSSLSDKVLLSQVVHALNIPIRKSLTRLEARYFISVYEQDKSCNETLLKFSKLDFNILQK  252

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQ+E++ +T WWK+L V + +P+AR RL ECYFW L  YFEPQY  +R+++ +I  + S
Sbjct  253   LHQQEVADLTLWWKNLNVSEKVPYARDRLVECYFWALAEYFEPQYSRARKMSGKITALIS  312

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             ++DD YD YGT +EL LFT+A QR+D +A +++P+Y++ I+  ++ +   MEE +  +  
Sbjct  313   LIDDTYDSYGTFEELALFTDAAQRWDINAIDQLPEYMRPIFRELIYLYNAMEEELLNDGI  372

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
              + V Y    + + I  Y  E +W++  +VP FEEYLKV+LVSS Y M+ T   VGMG  
Sbjct  373   SYRVEYAKQSVIQMITAYNDEAIWYHNNYVPTFEEYLKVALVSSGYRMLPTNSFVGMGKT  432

Query  735   -ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEA  559
              +  +  DWV++ PL VKA+  I RL +D +GHE EQ+RGHVAS VECYMK +  +K+EA
Sbjct  433   EVPHQAFDWVSNNPLMVKASTIIARLDNDKVGHEHEQDRGHVASGVECYMKQHGATKEEA  492

Query  558   YVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSL  379
              VE  K IS AWKDINQECLHPLPVPM +L RVLNL R + L YK+ D+YT S    K  
Sbjct  493   VVEFNKRISSAWKDINQECLHPLPVPMHLLERVLNLVRFVTLFYKNGDMYTNSNTHMKEF  552

Query  378   ITTTLVQPV  352
             I++ LV+ +
Sbjct  553   ISSLLVESI  561



>gb|AAV36464.1| wound-inducible putative cytosolic terpene synthase 1 [Medicago 
truncatula]
 gb|KEH30760.1| sesquiterpene synthase [Medicago truncatula]
Length=562

 Score =   536 bits (1381),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 262/549 (48%), Positives = 372/549 (68%), Gaps = 4/549 (1%)
 Frame = -2

Query  1983  NVNSS-GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             N NS   RRS  YHP +WGD F+ Y  +  E D    +++  LKE+VR++L+     +  
Sbjct  15    NANSDFSRRSANYHPNIWGDLFIQYVLEPMEFDEIM-KQIIMLKEKVRQMLVPNVNVTNP  73

Query  1806  KLE--LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
               E  L+D IQRLG+ +HFE EI   ++HI +N+          +L+ ++L FRLLRQ+G
Sbjct  74    SREANLIDSIQRLGLYHHFEQEIGELLRHIDNNHVENGTITLNEDLHSIALVFRLLRQQG  133

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             +HI   VF+KF ++ G FK++L  DVEGMLSLYEA+++ +HGE  LD+AL+FT+ HLE +
Sbjct  134   YHILPDVFKKFKNEQGNFKETLVGDVEGMLSLYEATHMRIHGEEILDDALSFTSLHLEMM  193

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
                L+   A K++H+LK P+ + LPR+ A+ Y+  YE+D +H+  LL  AKLDFNLLQK 
Sbjct  194   TTQLSPSVATKINHSLKRPLFKNLPRLVARHYISTYEEDPSHDATLLLLAKLDFNLLQKQ  253

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQ+E+  I++WWKDL     LPFAR+R+ E YFWILGVYFEPQY F RRI T++I + SV
Sbjct  254   HQKEVGDISKWWKDLDFATKLPFARNRIVEAYFWILGVYFEPQYSFGRRIMTKVISLASV  313

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YDVYGT +ELQLFT AI+R+D S  + +PQY+K  Y A+LD+  EME+ M KE + 
Sbjct  314   IDDIYDVYGTIEELQLFTQAIERWDISCMDFLPQYMKFCYKAVLDVYEEMEQEMVKEGRA  373

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             F V Y   EMK+ ++ Y+ E  WF   ++P  +EY+ + +V+S Y +I  T  +GMG I 
Sbjct  374   FCVFYAKNEMKRLVQAYFTEAKWFSRNYIPTVDEYMALGIVNSGYYLITATSFIGMGCIA  433

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             T++V  W+T+ P  V A+  I RLMDD++ +EFEQERGH ASA+ECYM  + VS+++A  
Sbjct  434   TEDVFQWLTNNPKIVNASSKIARLMDDIVSNEFEQERGHGASAIECYMNEHGVSREDAVN  493

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E+ + ++ AWKD N+E L P  VP  +L+RVLNL+R I ++YKD D YT SQ   K+ I 
Sbjct  494   ELSRQVTNAWKDTNEELLDPTEVPKPLLIRVLNLSRVIDVLYKDGDCYTNSQGSTKNDII  553

Query  372   TTLVQPVTI  346
             + L+ P  +
Sbjct  554   SILLNPCPV  562



>sp|E3W208.1|SPISS_SANSP RecName: Full=Sesquiterpene synthase; Short=SspiSesquiTPS [Santalum 
spicatum]
 gb|ADO87006.1| sesquiterpene synthase [Santalum spicatum]
Length=562

 Score =   536 bits (1381),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 258/544 (47%), Positives = 367/544 (67%), Gaps = 5/544 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    + P+VWGD F+ Y  +       +ER+V++LKE+VR+ L AA    L++L ++D
Sbjct  21    SRPIANFPPSVWGDRFINYACEDENEQAQKERQVEELKEQVRRELAAAIDKPLQQLNIID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
               QRLG+ YHFENEI+ S++HI+ +    + C +G D  +L  V+L FRLLRQ+G+ +SC
Sbjct  81    ATQRLGIAYHFENEIEESLKHIYLHTYVENTCFEGSD--DLCSVALWFRLLRQDGYRVSC  138

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              VF+KF D +G FK+SL +D +G+L LYEA++L V+GE  LD+AL FT +HLE ++  LN
Sbjct  139   DVFKKFRDSEGNFKNSLMEDAKGLLELYEATHLSVNGEEMLDDALEFTKTHLELVVSHLN  198

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V HAL  P  + LPR+ A  + +IYE   +HN+ LL+ AKLDFNLLQ +H +EL
Sbjct  199   YPLAEQVRHALYQPQHKGLPRLEAVYFFRIYEAYDSHNEALLKLAKLDFNLLQSLHMKEL  258

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             S + +WWK L      PFAR RL E YFWILGVYFEPQY  +R+I  ++  + S +DD+Y
Sbjct  259   SHMAKWWKSLDFATKFPFARDRLVEGYFWILGVYFEPQYSLARKIIIKVFTMISTIDDIY  318

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             D YGT DEL+LFT AIQR+D  + +++P+Y+K  Y ++LD+  E+EE M  +  LF + Y
Sbjct  319   DAYGTLDELKLFTKAIQRWDIGSLDQLPEYMKPCYKSVLDVYNEIEEEMDNQGSLFRMHY  378

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                EMKK +  Y  E  W + K+VP F+EY+ V+LV++ Y  + T   +GMG+I +KE  
Sbjct  379   AKEEMKKIVEGYMDEAKWCHEKYVPTFQEYMSVALVTAGYTFLTTISYLGMGEIASKEAF  438

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DW+ S P  ++A+ S+ RLMDDM  HEFEQERGHVAS +ECYMK Y V+++EA+ +  K 
Sbjct  439   DWLFSHPPIIEASESVGRLMDDMRSHEFEQERGHVASGIECYMKQYGVTEEEAHDKFHKR  498

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             + KAWKDIN+ CL P PVP  +L+R+L+L R I +IYK+ D YT  +   K  I + L+ 
Sbjct  499   LVKAWKDINEGCLRPYPVPKPLLMRILSLTRVIDVIYKNEDWYTHVKKPMKDKIASLLID  558

Query  357   PVTI  346
             P+ +
Sbjct  559   PMIV  562



>ref|XP_002274445.2| PREDICTED: valencene synthase-like [Vitis vinifera]
Length=559

 Score =   535 bits (1379),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 265/542 (49%), Positives = 372/542 (69%), Gaps = 4/542 (1%)
 Frame = -2

Query  1974  SSGRRSVTYHPTVWGDYFLAYDSKLTEID-PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
              + RR+  Y P++WG+ F+  ++   EI    +E++++ LKE V + LIAA    LE+L+
Sbjct  20    GTNRRTANYQPSIWGNSFIVSNTPEDEITLAHKEQQLEDLKEVVIRELIAAASHPLEQLK  79

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
              +D +QRLGV YHFE EI+ ++Q+ +DNY +CI  D  ++LY V+LRFRL RQ+G +ISC
Sbjct  80    FIDAVQRLGVAYHFEKEIEEALQNTYDNY-HCID-DINDDLYDVALRFRL-RQQGFNISC  136

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              +F KF D+ G+FK++L  DV GML LYEA++L VHGE  L +AL FT +HL++++  L 
Sbjct  137   DIFNKFTDERGRFKEALISDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLG  196

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL   KLDFNL+Q +H+ EL
Sbjct  197   YHLAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELGKLDFNLVQSLHKEEL  256

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             S + RWWK+L     LPFAR RL E YFW+ GVYFEPQY   RRI T++I + S+LDD++
Sbjct  257   SNLARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIH  316

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             D YGT +EL+LF  AI+R+D ++ N++P+Y+K  Y+A+LD+  E+EE M KE   + V Y
Sbjct  317   DAYGTPEELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEEEMEKEGNQYRVHY  376

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MK Q+R Y+ E  W + +HVP FEEY++V+L SS Y ++ATT  VGMG+I TKE  
Sbjct  377   AKEVMKNQVRAYFAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMGEIATKEAF  436

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DWVTS+P  + ++  I RLMDD+  H+FEQ+RGHVASAVECYMK Y VS+++ Y E  K 
Sbjct  437   DWVTSDPKIMSSSNFITRLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYSEFRKQ  496

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             I  AW DINQECL P  V M +L R+LNL R + +IYK+ D YT      +  I +  + 
Sbjct  497   IENAWLDINQECLKPTAVSMPLLARLLNLTRTMDVIYKEQDSYTHVGKVMRDNIASVFIN  556

Query  357   PV  352
              V
Sbjct  557   AV  558



>ref|XP_002523635.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9SCB6.1|TPS2_RICCO RecName: Full=Probable terpene synthase 2; Short=RcSeTPS2 [Ricinus 
communis]
 gb|EEF38721.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
Length=550

 Score =   535 bits (1378),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 254/541 (47%), Positives = 370/541 (68%), Gaps = 4/541 (1%)
 Frame = -2

Query  1974  SSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLEL  1795
             ++ R   ++HP +WGD FL+  ++ T+I+   E++V++LKEEV+K++ +A   S + L L
Sbjct  14    NTTRHLASFHPNIWGDRFLSCAAESTDIEDDMEQQVERLKEEVKKMIASADEPS-QILNL  72

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D +QRLGV YHFE EI+ ++Q + +   +  K DD   L+ V+LRFRLLR++G ++SC 
Sbjct  73    IDLLQRLGVSYHFEKEIEEALQQVLNMNSDSDKDDD---LHSVALRFRLLREQGLNVSCD  129

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF KF D++G F  +L  D++GMLSLYEA++  VHGE  LD+AL FT ++LESI+P L+ 
Sbjct  130   VFNKFRDRNGHFIQTLKTDLQGMLSLYEAAHFRVHGEGILDDALAFTTTYLESIVPNLSP  189

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               AA++S  L+ P+R++L RV A+ ++ IY++D +HN+VLL FAKLDFNLLQK+HQ+EL 
Sbjct  190   PLAAQISRTLRQPLRKSLARVEARHFISIYQEDTSHNEVLLTFAKLDFNLLQKLHQKELK  249

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I+ WWKDL     LPF R R+ E YFWILGVYFEPQYH +R+  T++I + SV+DD+YD
Sbjct  250   YISLWWKDLDFVNKLPFTRDRVVEGYFWILGVYFEPQYHRARKFVTKVINVVSVIDDIYD  309

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
              YGT +EL +FT+AI R+D    +++P+Y+K  Y A+L++  E+E  ++++ + + + Y 
Sbjct  310   AYGTLEELVVFTDAINRWDIDCIDQLPEYMKVCYKALLNVYEEIERALSEQGRSYRLHYA  369

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MKK ++ Y  E  W    +VP  +EY+ ++LVS  Y ++  T  VGMGDI TKEV D
Sbjct  370   KEAMKKLVQAYLVEANWMNKNYVPTMDEYMSIALVSCAYPLLTVTSFVGMGDIATKEVFD  429

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W +++P  V+    ICRLMDD++ HEFEQ+RGH+AS+VECYMK   VS++    E  K I
Sbjct  430   WASNDPKIVRVASIICRLMDDIVSHEFEQKRGHIASSVECYMKQNGVSEEATRDEFNKQI  489

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
               AWKDIN+E L P  VPM    RV+N AR +  +YKD+D YT      K  +   L+ P
Sbjct  490   VDAWKDINEEHLQPNYVPMPFRTRVVNSARIMDYLYKDDDEYTHVGELMKGSVAALLIDP  549

Query  354   V  352
              
Sbjct  550   A  550



>emb|CBI31294.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   536 bits (1381),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 263/541 (49%), Positives = 365/541 (67%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R  V YHP +WGD FL++  +       +E++++ LKEE+R+ L+     + ++L+ +D
Sbjct  47    NRPVVKYHPNIWGDQFLSHTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTSQQLKFID  106

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD-ENNLYVVSLRFRLLRQEGHHISCGV  1612
              +QRLG+ YHFE EI+  +QHI+D+Y N   GDD E ++Y V+L+FRLLRQ G +ISCG+
Sbjct  107   AVQRLGLAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNISCGL  163

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F +F D+ G FK +L  DV GML LYEA++L V GE  LDEAL FT +HL S++  L   
Sbjct  164   FNEFKDEKGNFKKALISDVRGMLGLYEAAHLRVRGEDILDEALAFTTTHLRSMVEHLEYP  223

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V HALK PIRR L R+ A+ Y+ IY+ + +H++ LL+ AKLDFNL+Q +H+ ELS 
Sbjct  224   FAEQVVHALKQPIRRGLERLEARWYISIYQDETSHDRTLLKLAKLDFNLVQSLHKEELSN  283

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I+RWWK L     LPFAR RL ECYFWILG YFEPQY ++RRI T+ I + S +DD+YD 
Sbjct  284   ISRWWKKLDFATKLPFARDRLVECYFWILGFYFEPQYVWARRILTKTIALTSTMDDIYDA  343

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LFT AI+R+D ++ + +P+Y+K  Y+A+LD+  E+EE M KE   + V Y I
Sbjct  344   YGTFEELKLFTAAIERWDINSIDHLPEYMKHFYVALLDVYKEIEEEMEKEGNQYRVQYAI  403

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q R Y+ E  W +   +P  EEY+ V+ VSS   M+  T  +GMG I+TKE  DW
Sbjct  404   EAMKNQARAYFHEAKWLHEGRIPTVEEYMSVAQVSSGDSMLTITSFIGMGKIVTKEAFDW  463

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V + P  V A+  I RLMDD+  H+FEQ+RGHVAS VECYMK Y  S++E Y + +K + 
Sbjct  464   VITNPKIVTASSVISRLMDDITSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQKQVE  523

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              A KDIN+E L P  VPM +L+RVLNL+R +++IY   D YT      K+ + + L+ P+
Sbjct  524   DACKDINEEFLRPTAVPMPLLMRVLNLSRVMYVIYTGGDGYTHVGKVMKNNVASLLIHPI  583

Query  351   T  349
              
Sbjct  584   A  584



>ref|XP_011095784.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=560

 Score =   535 bits (1378),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 274/546 (50%), Positives = 377/546 (69%), Gaps = 12/546 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDS----KLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRSV YHP+VWGDYFLAY S     + EI  +EE E+++ KE VRKVL   P     KLE
Sbjct  21    RRSVKYHPSVWGDYFLAYVSMKLCSVQEISATEEEELRRQKEMVRKVLARTPDHLYHKLE  80

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
             L+D IQRLGV YHFE EI   +Q   D Y         N+L +V+LRFRLLRQ G+ +SC
Sbjct  81    LIDAIQRLGVGYHFEEEIDKFLQFTHDTYLEY--SSKANDLRIVALRFRLLRQHGYPVSC  138

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              +F KF+D +G FK SL K+VEGML L+EA+   + GE  L++AL F++S+LES L  +N
Sbjct  139   DIFNKFIDGEGNFKVSLIKNVEGMLELFEAAQFRIAGEKILEKALEFSSSNLESSLSNMN  198

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                + +V  ALK+PI ++  RVGAK+++ IY+Q+ +H+++LL FAKLDFN++QK HQ+EL
Sbjct  199   SSLSTQVKEALKIPILKSSNRVGAKKFISIYQQNVSHSEILLNFAKLDFNIIQKTHQKEL  258

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             S ITRWWKDL     LPFAR R+ ECYFW + VYFEP YH +R++ T+II + S+LDD+Y
Sbjct  259   SDITRWWKDLDFANKLPFARDRVVECYFWAVEVYFEPHYHIARKMLTKIINMTSILDDIY  318

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DVYGT D+LQLFT+ IQR+D  A  ++P Y++  Y A+ D+  EME  + K +  + + Y
Sbjct  319   DVYGTLDDLQLFTDLIQRWDVHALEQLPSYMRICYEALSDVYIEMENELKKTDGSYRIQY  378

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                EMKK +R Y +E  W Y K +P  EEY+KV+ V+S YMM+ TT LVGMG+++TK+  
Sbjct  379   AKEEMKKLVRAYLEEAKWSYNKDMPRMEEYMKVASVTSAYMMLLTTSLVGMGNLVTKKDF  438

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DW+TSEPL + A  +ICRL +D++G+ FE++     +AVECYM     SK+EA+ E+++ 
Sbjct  439   DWITSEPLLLLAFSTICRLTNDLVGYGFEKK----PTAVECYMNENGASKEEAFAELQEQ  494

Query  537   ISKAWKDINQECLHP-LPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
             ++KAWKD+NQE L P + + M VL RVLN  R   L Y ++D YT S+   +S+I + LV
Sbjct  495   VTKAWKDMNQESLRPTVSISMPVLTRVLNFTRIPHLFYVEDDEYTNSEANIRSIIYSILV  554

Query  360   QP-VTI  346
             +  VTI
Sbjct  555   EANVTI  560



>ref|XP_010057304.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW74421.1| hypothetical protein EUGRSUZ_E03115 [Eucalyptus grandis]
Length=567

 Score =   535 bits (1378),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 257/544 (47%), Positives = 372/544 (68%), Gaps = 6/544 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEI----DPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             R S  +HP++WGDYFL Y S    +    D   E+E+Q+L +EV+++L A       KL+
Sbjct  23    RHSANFHPSIWGDYFLKYASCSCSMENGHDQHAEQEIQKLDDEVKRMLCADADKPSLKLD  82

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGD-DENNLYVVSLRFRLLRQEGHHIS  1621
             ++D+IQRLG+ +HF ++I   ++ + +    C  GD D ++LY  +L FRLLRQ+G+ +S
Sbjct  83    MIDQIQRLGIAHHFASDIDHVLKQLSETCFACNNGDRDIDDLYTAALLFRLLRQQGYRVS  142

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
               +F KF D  GKF +    DV G+LSLYEAS+L VHGE  LD+AL+F+ +HLES+   L
Sbjct  143   SDIFNKFKDPSGKFSEKHASDVRGLLSLYEASHLSVHGEDVLDQALSFSLTHLESVKEQL  202

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +   A +V HALK  IR+ +PR+ A++Y+ +YE +  HN+VLL  AKLDFN LQK HQ+E
Sbjct  203   SPPLATQVRHALKQTIRKGVPRLEARQYISMYEAEPLHNEVLLSLAKLDFNRLQKQHQKE  262

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             L  ITRWW  L   + LPFAR RL E YFWI+GV+FEP+   +RR+ T++I + SVLDD+
Sbjct  263   LFDITRWWMGLDFKRKLPFARDRLVEGYFWIVGVHFEPELAVARRMMTKVIAVTSVLDDI  322

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYGT +EL+LFT AIQR+D    +E+P+Y++  Y A+++I  E+EE++A   K + + 
Sbjct  323   YDVYGTYEELELFTQAIQRWDIDCIHELPEYMQVFYKALINIYVEIEEILACTGKSYCLC  382

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y +  MK+Q R+Y+ E  W + +H P  +EY+ ++LVSS Y ++A T  VGM DI+TK+ 
Sbjct  383   YAVEAMKRQARSYFAEAKWLHQQHKPTMDEYMSIALVSSGYPLLAVTSFVGMPDIVTKDD  442

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
             LDW+ ++P  +KA+  ICRLMDD+  H+FEQ RGHV SAV+CYMK Y V++QEA   + K
Sbjct  443   LDWLFNDPKILKASTIICRLMDDLATHKFEQSRGHVDSAVQCYMKQYGVTEQEAENNLRK  502

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKSLITTTL  364
              ++ +WKDIN+ECL P  V M +L+ +LNL+R + ++YKD  D YT   +  K  I + L
Sbjct  503   QVNDSWKDINEECLRPTAVAMPLLVGILNLSRVMDVLYKDGGDHYTNPHIALKDYIHSVL  562

Query  363   VQPV  352
             + PV
Sbjct  563   IDPV  566



>gb|AGW18161.1| terpene synthase 4-1 [Copaifera langsdorffii]
Length=557

 Score =   535 bits (1377),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 273/541 (50%), Positives = 367/541 (68%), Gaps = 4/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  YHP+VWGD+FL Y S+  E+D   E  +  LKE VRK+L+ A    L K+ L+D 
Sbjct  19    RRSANYHPSVWGDHFLKYASQPLEVDEKMEDRIGTLKETVRKMLVPATDKPLTKVRLIDS  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNY--DNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             IQRLGVDYHFE+EI   +  I +NY  D  I  ++  +L+ ++L FRLLRQ+G+H+S  V
Sbjct  79    IQRLGVDYHFESEIDEVLCQIQNNYVKDGIITLNE--DLHSMALLFRLLRQQGYHVSPDV  136

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF D+ GK  +++  DVEGMLSLYEA+ L +HGE  LDEAL FT++HL+ +   L++ 
Sbjct  137   FNKFKDEQGKISETIANDVEGMLSLYEAADLRIHGEDILDEALDFTSTHLKFLTTQLSDS  196

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A  V  +LK P+RR LPR+ A  Y   Y++D +H + LL FAKLDFN LQK+HQREL  
Sbjct  197   HAGNVIRSLKRPLRRRLPRLEAWHYFFTYQEDPSHIETLLAFAKLDFNGLQKLHQRELGN  256

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             +++WWKDL     LPFAR+RL E YFWILGVYFEP Y  +RRI T++I + SV+DD+YDV
Sbjct  257   LSKWWKDLDFATKLPFARNRLVEAYFWILGVYFEPCYSLARRIMTKVISLTSVIDDIYDV  316

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +ELQLFT AI ++D S  + +P+Y+K IY  +LD+  E+E   AKE + F V+Y  
Sbjct  317   YGTLEELQLFTEAIDKWDISCMDFLPEYMKLIYQPLLDVYDEIERETAKEGRAFCVNYGK  376

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              +M+K +R Y  E  WF+  + P  EEY++V+LVSS Y M+ T   +G+G I T+E L W
Sbjct  377   EQMRKVVRAYLAEAKWFHNNYTPTLEEYMEVALVSSAYRMLTTVSFIGVGSIATEEALKW  436

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VT +P  VKA+  ICRLMDD++  +FEQERGHV SA+ECYMK +  +++E  VE  + + 
Sbjct  437   VTKDPKIVKASLVICRLMDDIVSSKFEQERGHVVSALECYMKQHGTTEEETIVEFRRRVE  496

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDIN+ CL P  V   +L+R LNL+R I L+Y D+D YT S    K  I   L+ PV
Sbjct  497   NAWKDINEACLQPFEVAKPLLMRSLNLSRVISLLYTDDDCYTHSAGNTKKNIEALLINPV  556

Query  351   T  349
              
Sbjct  557   A  557



>ref|XP_009785126.1| PREDICTED: germacrene C synthase-like [Nicotiana sylvestris]
Length=553

 Score =   535 bits (1377),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 269/555 (48%), Positives = 379/555 (68%), Gaps = 6/555 (1%)
 Frame = -2

Query  2004  EITEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAA  1825
             ++  +      SGR    +H +VWGDYFL+Y  +LTEI   E+ E ++LKE+VR++L+  
Sbjct  3     QVAFISTTTTDSGRPLANFHSSVWGDYFLSYTPQLTEISSQEKVEFEELKEKVRQMLVET  62

Query  1824  PPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLL  1645
             P  S +KLEL+D  QRLGV YHF NEIQ SI +IFD +      DD+  LYV +LRFRLL
Sbjct  63    PDNSTQKLELIDTNQRLGVAYHFGNEIQTSITNIFDLFQQSENEDDD--LYVAALRFRLL  120

Query  1644  RQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASH  1465
             RQ+ H IS   F+KF +KDG+FK++LTK+V+G+LSLYEA++L VHGE  L++AL+FT ++
Sbjct  121   RQQRHFISSDAFKKFTNKDGRFKETLTKNVQGLLSLYEAAHLRVHGEEILEQALSFTLTN  180

Query  1464  LESILPGL-NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFN  1288
             LES+ P L N    A+VS AL  PI   LPR+GAK+YM +YE++++HN +LL+FAKLDFN
Sbjct  181   LESMGPKLSNTSLKAQVSAALSQPIYTNLPRLGAKKYMCMYEKNESHNDLLLKFAKLDFN  240

Query  1287  LLQKVHQRELSGITR-WWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             ++QKV+QREL  +TR WWKDL      P+AR RL ECY+  +GV FEPQY  +R+I  ++
Sbjct  241   IVQKVYQRELYELTRYWWKDLDYANNFPYARDRLVECYYGAVGVLFEPQYSRTRKILGKL  300

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
             I + +++DD +D Y T DE+  FTNAI+R D S  + +   L+  Y  ++D   EME+ +
Sbjct  301   INVITMVDDTFDAYATFDEIVAFTNAIERCDISVMDSISPNLRPAYQVLIDFFNEMEKEL  360

Query  930   AKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLV  751
             AKE K   V Y   EMKK IR Y++E  W    ++P  +EYL+    S   M++A T LV
Sbjct  361   AKEGKADRVYYAKFEMKKCIRAYFKEAQWLNVGYIPKCDEYLENGSASIGIMLMAVTSLV  420

Query  750   GMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVS  571
             G+ ++ITKE L+WV ++PL ++ +  I RL DD+IGH FEQ+RGHVAS +ECYMK + VS
Sbjct  421   GLEELITKETLEWVINDPLILRVSGVISRLKDDIIGHNFEQQRGHVASFIECYMKEHGVS  480

Query  570   KQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVK  391
             KQEAY  ++K ++ AWKDIN E   P  VP  VL R++N  R + + +++ND +  +Q +
Sbjct  481   KQEAYAAVDKEMANAWKDINTEFFRPSQVPTFVLERIINPTRLV-IGFQEND-FINTQGE  538

Query  390   FKSLITTTLVQPVTI  346
             +K  IT+ LV  + I
Sbjct  539   YKDKITSLLVDSMKI  553



>gb|AGB05616.1| sesquiterpene synthase 7 [Valeriana officinalis]
Length=563

 Score =   535 bits (1377),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 256/549 (47%), Positives = 377/549 (69%), Gaps = 8/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAP--PASL  1810
             N+    R +  +H +VWGD+F+ Y S   +I+   +++ +QLKEE+RK L+       + 
Sbjct  16    NIQEPVRPNGNFHKSVWGDHFVKYASNSEQINDGVDKQHKQLKEELRKKLVVNVNIERAE  75

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGH  1630
             E+L+L+D IQRLGV YHF  EI + + +  + ++N +  DD   LY+ SLRFRLLRQ+G+
Sbjct  76    EQLKLIDAIQRLGVAYHFRTEIASVLNNQLEFWNNKVDDDD---LYMTSLRFRLLRQQGY  132

Query  1629  HISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESIL  1450
             ++SC VFEKF + DG+F + LT DV G+LSLYE++++ VH E  L+EAL FT + LE ++
Sbjct  133   NVSCAVFEKFKNIDGRFNECLTDDVRGLLSLYESTHMRVHKEDILEEALEFTVAQLEQVI  192

Query  1449  PGL--NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
                  +++  ++V HAL +PIR++L R+ A+ ++ +YEQD++ N+ LL+F+KLDFN+LQK
Sbjct  193   KSSLSDKVLLSQVVHALNIPIRKSLTRLEARYFISVYEQDKSCNETLLKFSKLDFNILQK  252

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQ+E++ +T WWK+L V + +P+AR RL ECYFW L  YFEPQY  +R+++ +I  + S
Sbjct  253   LHQQEVADLTLWWKNLNVSEKVPYARDRLVECYFWALAEYFEPQYSRARKMSGKITALIS  312

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             ++DD YD YGT +EL LFT+A QR+D +A +++P+Y++ I+  ++ +   MEE +  +  
Sbjct  313   LIDDTYDSYGTFEELALFTDAAQRWDINAIDQLPEYMRPIFRELIYLYNAMEEELLNDGI  372

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
              + V Y    + + I  Y  E +W++  +VP FEEYLKV+LVSS Y M+ T   VGMG  
Sbjct  373   SYRVEYAKQSVIQMITAYNDEAIWYHNNYVPTFEEYLKVALVSSGYRMLPTNSFVGMGKT  432

Query  735   -ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEA  559
              +  +  DWV++ PL VKA+  I RL +D +GHE EQ+RGHVAS VECYMK Y  +K+E 
Sbjct  433   EVPHQAFDWVSNNPLMVKASTIIARLDNDKVGHEHEQDRGHVASGVECYMKQYGATKEEV  492

Query  558   YVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSL  379
              VE  K IS AWKDINQECLHPLPVPM +L RVLNL R + L YK+ D+YT S    K  
Sbjct  493   VVEFNKRISSAWKDINQECLHPLPVPMHLLERVLNLVRFVTLFYKNGDMYTNSNTHMKEF  552

Query  378   ITTTLVQPV  352
             I++ LV+ +
Sbjct  553   ISSLLVESI  561



>ref|NP_001268015.1| (-)-germacrene D synthase-like [Vitis vinifera]
 gb|ADR74198.1| (E,E)-alpha-farnesene synthase [Vitis vinifera]
Length=558

 Score =   534 bits (1375),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 268/541 (50%), Positives = 361/541 (67%), Gaps = 4/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R +  Y P +WGD FL Y    T     + +++++LKEEVRK L A+   S E L+L+D
Sbjct  22    ARSTANYPPNIWGDRFLTYAPDDTVTQECKAQKIKELKEEVRKELKASAHKSPELLKLID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              IQ LG+ YHFE EI+ +++ ++  Y      DD  +L   SLRFRLLRQEG+ +   VF
Sbjct  82    SIQLLGLTYHFEREIEEALKDMYGTYSLV---DDNEDLTNASLRFRLLRQEGYGVPSDVF  138

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF DK+G FK+SL  D+ GML+LYEA++L VHGE  L+EAL FT +HL+S+    N   
Sbjct  139   SKFKDKEGNFKESLIGDLPGMLALYEATHLMVHGEDILEEALAFTTAHLQSVATDPNNPL  198

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             + +V  ALKL I   +  VGA+ Y+ IY++D +HN+ LL+ AKLDFNLLQ +H++ELS I
Sbjct  199   SKQVIRALKLSIHNGVTSVGARHYISIYQEDGSHNESLLKLAKLDFNLLQSLHRKELSEI  258

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK + +     FAR RL E YF  LGV FEPQY  S R  T++  + +++DD+YD Y
Sbjct  259   TRWWK-VRLCHEATFARDRLVEIYFSALGVCFEPQYSLSLRFLTKVAIMITMVDDIYDAY  317

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL L T AI+R+D S+ +++P Y+K  Y A+LD+  EME+ MAKE KL+ V Y   
Sbjct  318   GTIEELTLLTEAIERWDASSIDQLPDYMKCFYRALLDLYEEMEQEMAKEGKLYRVHYAKE  377

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MKKQI++Y+ E  W    ++P F+EY+   +VS C  ++  T  VGMGDI+TKE   WV
Sbjct  378   LMKKQIQSYFVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTKESFQWV  437

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S P  + A+  ICRLMDDM  HEFEQ+R HVAS+VECYMK Y VSKQEAY E+ K + K
Sbjct  438   LSRPTMIGASQIICRLMDDMASHEFEQKRVHVASSVECYMKQYGVSKQEAYDELNKQVVK  497

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDINQECL P PV M ++ RVLN+AR + ++YKD D +T    + K LI + L+ PV 
Sbjct  498   AWKDINQECLKPTPVLMPIITRVLNIARMMNILYKDGDEFTHVGKQRKDLIASILIDPVP  557

Query  348   I  346
             +
Sbjct  558   M  558



>ref|XP_009757762.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Nicotiana 
sylvestris]
Length=550

 Score =   533 bits (1374),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 261/541 (48%), Positives = 368/541 (68%), Gaps = 3/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR   +HPTVWGD+FLAY S L+  +  E+++ + LKEEVRK+L+ AP  SL+ L+L++ 
Sbjct  12    RRCGNHHPTVWGDHFLAY-SHLSGANEWEKKQHEHLKEEVRKMLVMAPSKSLQNLDLINA  70

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+ S+  I+  YD      DE +L+ V+LRFRLLRQ G+++S  VF 
Sbjct  71    IQCLGVAYHFEHEIEESLAFIYSCYDQLNGEADETDLHTVALRFRLLRQHGYYVSSDVFR  130

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G +K +L  DV+G+LSLYEA+   VH E  L EA+ FT +HL+ +LP L+   A
Sbjct  131   KFTDDQGNYKKALVGDVQGLLSLYEATQFRVHSEEILGEAVNFTTTHLKLLLPTLSNSFA  190

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              K+S+ALK PI  T+     ++Y+  Y++D+ H+ VLL  AKLD+N+LQK+++ EL  IT
Sbjct  191   MKISNALKYPINCTMVTAATRKYISFYQEDKAHDDVLLNLAKLDYNILQKMYKTELCDIT  250

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L   K LPF R R+ E YFW L VYFEPQY   R I T+++C  S+ DD+Y  YG
Sbjct  251   RWWKELDFTKALPFTRDRVVELYFWSLSVYFEPQYKVGRNILTKVLCFISIADDIYGTYG  310

Query  1065  TQDELQLFTNAIQRFDT-SASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             T DEL L TNAI+R++    S ++P Y+K  YLA+LD+ +E+E+ +AKENK F ++Y+I 
Sbjct  311   TIDELTLLTNAIERWNIDDISEKLPSYMKLYYLALLDVYSEIEKELAKENKSFQLNYSIA  370

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK I+ Y+QE  W++  +VP  E+Y+K  + SS    + T   +G+G+  TKE  DW+
Sbjct  371   EMKKLIKAYFQEAKWYHGNNVPTMEQYVKNGIRSSTIPCLVTLSWLGIGNEATKEAHDWL  430

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              SEP  + A+  I RL +D++ HE EQE G + S V CYM  Y V+K+EAY+EI K++  
Sbjct  431   ASEPPILVASSIIARLSNDIVSHEREQEGGDI-SGVVCYMNEYGVTKEEAYMEIRKIMDN  489

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             +WKD+N+ECL P+ +P  +L+ VLNLAR     YKD D YTFS+   K +I+  LV P+T
Sbjct  490   SWKDLNRECLKPIVIPRVLLMPVLNLARMSEFSYKDEDSYTFSKNNLKDIISEVLVDPIT  549

Query  348   I  346
             +
Sbjct  550   M  550



>ref|XP_010645872.1| PREDICTED: LOW QUALITY PROTEIN: valencene synthase [Vitis vinifera]
Length=556

 Score =   533 bits (1374),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 258/541 (48%), Positives = 371/541 (69%), Gaps = 3/541 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL-ELV  1792
              R    YHP +WGD F++Y  +       +E +   LK+EV++ L AA  A+  +L   +
Sbjct  18    NRPVANYHPNIWGDQFISYIPEDKVTRACKEEQFVDLKKEVKRKLTAAAVANPSQLLNFI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             D +QRLGV YHFE EI+ ++QHI +++ +C   D + +LY ++L FRLLRQ+G+ ISCG+
Sbjct  78    DAVQRLGVAYHFEQEIEEALQHICNSFHDC--NDMDGDLYNIALGFRLLRQQGYSISCGI  135

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF+D+ G+FK++L  DV GML LYEA++L VHGE  + +AL FT +HL++++  L   
Sbjct  136   FNKFMDERGRFKEALISDVRGMLCLYEAAHLRVHGEDIIAKALAFTTTHLKAMVESLGYH  195

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS 
Sbjct  196   LAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSN  255

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL ECYFWILGVYFEPQY   RRI T++I + S+LDD++D 
Sbjct  256   LARWWKELDFATKLPFARDRLVECYFWILGVYFEPQYLRGRRILTKVIAMTSILDDIHDA  315

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ +++P+Y+K  Y ++LD+  E+EE M KE   + V Y  
Sbjct  316   YGTPEELKLFKEAIERWDINSIDQLPEYMKLCYASLLDVYKEIEEEMEKEGNQYRVHYAK  375

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP  E+Y++V+LVSS Y M+ TT LVGMG+I TKE  DW
Sbjct  376   EVMKNQVRAYFAEAKWLHEEHVPTIEDYMRVALVSSGYCMLVTTSLVGMGEIATKEAFDW  435

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             +TS+P  + ++  I RLMDD+  H+FEQ+RGHVAS VECYMK Y  S++E Y + +K + 
Sbjct  436   MTSDPKIMSSSNFIARLMDDIKSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQKQVE  495

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              A KDIN+E L P  VPM +L+RVLNL+R +++IY   D YT      K+ + + L+ P+
Sbjct  496   DACKDINEEFLRPTAVPMPLLMRVLNLSRVMYVIYTGGDGYTHVGKVMKNNVASLLIHPI  555

Query  351   T  349
              
Sbjct  556   A  556



>ref|NP_001268215.1| valencene synthase [Vitis vinifera]
 gb|ACO36239.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score =   533 bits (1374),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 260/540 (48%), Positives = 367/540 (68%), Gaps = 3/540 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL-ELV  1792
              R    +HP +WGD F+ Y  +       +E +++ LK+EV++ L AA  A+  +L   +
Sbjct  18    NRPVANFHPNIWGDQFITYTPEDKVTRACKEEQIEDLKKEVKRKLTAAAVANPSQLLNFI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             D +QRLGV YHFE EI+ ++QHI +++ +C   D + +LY ++L FRLLRQ+G+ ISC +
Sbjct  78    DAVQRLGVAYHFEQEIEEALQHICNSFHDC--NDMDGDLYNIALGFRLLRQQGYTISCDI  135

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF D+ G+FK++L  DV GML LYEA++L VHGE  L +AL FT +HL++++  L   
Sbjct  136   FNKFTDERGRFKEALISDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYH  195

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS 
Sbjct  196   LAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSN  255

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL E YFW+ GVYFEPQY   RRI T++I + S+LDD++D 
Sbjct  256   LARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDA  315

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ N++P+Y+K  Y+A+LD+  E+EE M KE   + V Y  
Sbjct  316   YGTPEELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEEEMEKEGNQYRVHYAK  375

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP FEEY++V+L SS Y ++ATT  VGMG+I TKE  DW
Sbjct  376   EVMKNQVRAYFAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMGEIATKEAFDW  435

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VTS+P  + ++  I RLMDD+  H+FEQ+RGHVASAVECYMK Y VS+++ Y E +K I 
Sbjct  436   VTSDPKIMSSSNFITRLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYSEFQKQIE  495

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AW DINQECL P  V M +L R+LNL R + +IYK+ D YT      +  I +  +  V
Sbjct  496   NAWLDINQECLKPTAVSMPLLARLLNLTRTMDVIYKEQDSYTHVGKVMRDNIASVFINAV  555



>ref|XP_011005621.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score =   533 bits (1373),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 254/544 (47%), Positives = 375/544 (69%), Gaps = 8/544 (1%)
 Frame = -2

Query  1977  NSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             N + RR+  + P++WGD F+++  +    +  E +E+++L+E+ ++ L+A+   S ++L 
Sbjct  19    NETIRRTANFRPSIWGDKFISHLPRDKVHETIELQEIEKLREQFKRELLASD--SSQQLN  76

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
             L+D IQRLGV YHFE EI+ ++QHI++N      G ++++LY  +L FRLLRQ G+++SC
Sbjct  77    LIDAIQRLGVAYHFETEIEEALQHIYNNR----IGMEDDDLYNTALGFRLLRQHGYNVSC  132

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              +F KF D  G FK S   DV G+LSLYEA++L V GE  LDEAL FT  HL+S+    +
Sbjct  133   DIFNKFKDDKGYFKQS--NDVRGILSLYEAAHLAVRGEDILDEALAFTTIHLKSMATSPD  190

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                AAKVSHALK PIRR +PR+ ++ Y+ IY+ + + NK LLR AKL+FNL+Q++H+ E+
Sbjct  191   CPLAAKVSHALKQPIRRGVPRLESRRYISIYQDEPSCNKNLLRLAKLNFNLVQELHKEEV  250

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             + I+RWWK L   + LPFAR R+ EC+FWI+GVYFEPQY  +R+I T++I + S++DD+Y
Sbjct  251   AEISRWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTKVIAMTSIIDDIY  310

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DVYGT +EL+LFT AI R+DT + + +P Y+K  Y A+L++ ++MEE +AKE   + V Y
Sbjct  311   DVYGTLEELELFTEAIDRWDTKSMDHLPDYMKICYEALLNVYSKMEEKVAKEGWSYRVHY  370

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MK  +  Y  E  WF+  H+P  EEY++V+L+++ Y M+AT   +GM +++T++  
Sbjct  371   GKEAMKVLVHAYLNEAKWFHENHIPTMEEYMQVALLTTGYCMLATVSFIGMANMVTEQAF  430

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DWV + P  V+A+ +ICRLMDD+  H+FEQERGH AS VECY++ Y  S+QE Y E    
Sbjct  431   DWVFNRPKIVRASETICRLMDDVKSHKFEQERGHAASGVECYIRQYGPSEQEVYKEFHMQ  490

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             +  AWKDIN+ECL P  VPM +L R+LNL+R I +IYK+ D YT      K+ + +  + 
Sbjct  491   VVNAWKDINEECLKPTAVPMPLLERILNLSRVIDVIYKEEDGYTLVGKAMKNDVASLFID  550

Query  357   PVTI  346
              V I
Sbjct  551   SVPI  554



>gb|ADR74199.1| gamma-cadinene synthase [Vitis vinifera]
Length=585

 Score =   534 bits (1376),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 261/540 (48%), Positives = 366/540 (68%), Gaps = 3/540 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL-ELV  1792
              R    YHP +WGD F++Y  +       +E ++  LK+EV++ L AA  A+  +L   +
Sbjct  47    NRPVANYHPNIWGDQFISYIPEDKVTRACKEEQIVDLKKEVKRKLTAAAVANPSQLLNFI  106

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             D +QRLGV YHFE EI+ ++QHI +++ +C   D + +LY ++L FRLLRQ+G+ ISCG+
Sbjct  107   DAVQRLGVAYHFEQEIEEALQHICNSFHDC--NDMDGDLYNIALGFRLLRQQGYSISCGI  164

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF+D+ G+FK++L  DV GML LYEA++L VHGE  L +AL FT +HL++++ GL   
Sbjct  165   FNKFMDERGRFKEALISDVRGMLCLYEAAHLRVHGEDILAKALAFTTTHLKAMVEGLGYH  224

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+  + Y+ +Y+ +  H++ LL  AKLDFNL+Q +H+ ELS 
Sbjct  225   LAEQVAHALNRPIRKGLERLEXRWYISVYQDEAFHDRTLLELAKLDFNLVQSLHKEELSN  284

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL E YFW+ GVYFEPQY   RRI T++I + S+LDD++D 
Sbjct  285   LARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDA  344

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ +++P+Y+K  Y A+LD+  E+EE M KE     V Y  
Sbjct  345   YGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQHRVHYAK  404

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP FEEY++V+LVSS Y M+ATT  VGMG+I T E  DW
Sbjct  405   EVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCMLATTSFVGMGEIATNEAFDW  464

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VTS+P  + ++  I RLMDD+  H+FEQ+RGHVASAVECYMK Y VS+++AY E +K I 
Sbjct  465   VTSDPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQAYSEFQKQIE  524

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AW DINQECL P  V M +L R+LNL R   + YK+ D YT      +  I +  +  V
Sbjct  525   NAWLDINQECLKPTAVSMPLLARILNLTRTADVFYKEQDSYTHVGKVMRDNIASVFINAV  584



>ref|XP_010258444.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=562

 Score =   533 bits (1373),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 258/541 (48%), Positives = 364/541 (67%), Gaps = 3/541 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HP++WGD F  Y      +D    ++ + LKEEVR +L+ +     E L L+D 
Sbjct  24    RRSANFHPSIWGDRFTTYTCDNMTLDACN-KQAEGLKEEVRCMLMNSTNGPSEILSLIDT  82

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLG+ YHFE EI   ++H+   +     G D++ L+ ++L FRLLRQ G++I C +F 
Sbjct  83    IQRLGLAYHFEREIDEILEHMLVTHVGYFNGVDDD-LHTIALWFRLLRQNGYNIPCDIFN  141

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLES-ILPGLNELA  1429
             KF D  GKF+D LT+D++G+L LYEA++LG+ GE  LDEAL FT + LES ++   +   
Sbjct  142   KFKDDHGKFRDGLTRDLKGILGLYEAAHLGIRGEEVLDEALAFTTAQLESSVVTNTSSHL  201

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
               +V HAL+ P  R + ++ A+ Y+  YEQD+THN VLL+FAKLDFN LQ +H +ELS I
Sbjct  202   VKQVMHALEQPFHRGMLKLEARHYISFYEQDETHNPVLLQFAKLDFNRLQPLHLKELSQI  261

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             ++WWKDL     +P+AR+R+ ECYFWI+GVY EPQY   R I T++I + SVLDD YD+Y
Sbjct  262   SKWWKDLDFALKIPYARNRVVECYFWIMGVYPEPQYSLGRMILTKVIAMTSVLDDTYDIY  321

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +ELQLFT+AI+R+D   ++++ +Y+K IYLA+LD+  E+EE + +E + + V Y   
Sbjct  322   GTLEELQLFTDAIERWDVGETDQLLEYMKVIYLALLDVYNEIEEQVNREGRSYCVYYAKE  381

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              M+KQ R Y  E  WF+  H+P  EEY+ V+L+S+ Y ++A    VGMG+I TKE  DWV
Sbjct  382   AMRKQARAYLVEAKWFFQGHIPIVEEYMDVALISTSYPLLAVASFVGMGEIATKEAFDWV  441

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             ++ P  VK +  ICRLMDD++ HE+EQE+G V S+VECYMK Y VSKQE   E  + I+ 
Sbjct  442   SNLPNLVKNSSIICRLMDDIMTHEYEQEKGDVCSSVECYMKQYGVSKQEVVEEFSRSITN  501

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWKDIN+ECL    +P  +L RV NLAR + +IYK  + YT ++   K  IT+ L+  + 
Sbjct  502   AWKDINEECLRTTAIPKPLLTRVANLARMMDVIYKHGNGYTNAETVLKDHITSLLIDSIK  561

Query  348   I  346
             I
Sbjct  562   I  562



>ref|XP_006367836.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=557

 Score =   532 bits (1371),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 262/557 (47%), Positives = 379/557 (68%), Gaps = 5/557 (1%)
 Frame = -2

Query  2007  KEITEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIA  1828
             K   E+  N +S  R    + PT WG +FL+Y  +LTEI   E+ EV+ LKE+V K+L+ 
Sbjct  3     KMTRELATNASSKSRHLANFEPTFWGSHFLSYTPQLTEISSQEKLEVEDLKEKVMKMLVE  62

Query  1827  APPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRL  1648
              P  S +KL L+D +QRLGV YHF+NEI+ SIQ+IFD   + ++ ++++NLY+VSLRFRL
Sbjct  63    TPDNSAQKLVLIDTMQRLGVSYHFDNEIEKSIQNIFDTTMSQLQSENDDNLYIVSLRFRL  122

Query  1647  LRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTAS  1468
             +RQ+GH++S  VF++F D  GKFK+  T+DV G+LSLYEAS++ VH E  L+EALTFT +
Sbjct  123   VRQQGHYMSSDVFKQFTDHGGKFKE--TRDVLGLLSLYEASHMRVHDEEILEEALTFTTT  180

Query  1467  HLESILPGL-NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDF  1291
             HLES+LP + N     +V+ AL  PIR+T+PRVGA++Y+ IY   + HN +LL+FAKLDF
Sbjct  181   HLESMLPNMTNNSLKVQVTEALSKPIRKTVPRVGARKYIHIYGNIEAHNSLLLKFAKLDF  240

Query  1290  NLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             N+LQK+HQ+EL+ ITRWWKDL   K LP+ + RL E YFW+ G+ F+PQY   R+I  ++
Sbjct  241   NMLQKLHQQELNEITRWWKDLDFAKKLPYGKDRLVEGYFWMNGMSFDPQYSRMRKILAKV  300

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
               + S++DD YD YGT DEL LFT+AIQR+D  A + +P Y++  Y  +L++  EME+V+
Sbjct  301   FYMNSIIDDTYDAYGTFDELVLFTSAIQRWDIRAMDSLPPYMRISYQELLNMYDEMEQVL  360

Query  930   AKE-NKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCL  754
              +E  K   V Y   EMK+    Y +E  W    ++P ++EY+  +LV+   M   T  L
Sbjct  361   TREAGKSESVYYAKNEMKRLATAYMKEIDWLNDGYIPKYDEYMTNALVTGTGMFYVTHSL  420

Query  753   VGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNV  574
             +GM ++ITKE ++W+T+EPL V+A   I R MDD+  HE +Q+  H+AS ++CY+K Y  
Sbjct  421   IGMEELITKETIEWITNEPLIVRAASLIARFMDDIADHEVQQQIEHIASIIDCYIKEYGA  480

Query  573   SKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIY-KDNDIYTFSQ  397
             SK+EA +E++K ++ AWKDIN+E L    VP  +L + LN AR+    +   +D YT S 
Sbjct  481   SKEEACIEMQKEVTNAWKDINKEFLLTRKVPFFILEQALNYARSADTTFGGGHDGYTNSN  540

Query  396   VKFKSLITTTLVQPVTI  346
              + K+LIT+  V+ V I
Sbjct  541   CETKNLITSLFVESVNI  557



>ref|XP_008232170.1| PREDICTED: (-)-germacrene D synthase-like [Prunus mume]
Length=559

 Score =   532 bits (1370),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 257/547 (47%), Positives = 372/547 (68%), Gaps = 10/547 (2%)
 Frame = -2

Query  1977  NSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             N   RRS  + P+VWG +FL+Y S  T I    ++  Q+LKE+V+ +L+A      +KL+
Sbjct  20    NDINRRSANFSPSVWGSHFLSYASVETSI--KAKQRAQELKEKVKMILMAPVKKPSQKLD  77

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDN-YDNCIKGDDE--NNLYVVSLRFRLLRQEGHH  1627
             L+  IQRLGV +HFENEI+  +Q I ++ +D+   GD E  N LY  +LRFRLLRQ+G++
Sbjct  78    LIQDIQRLGVSHHFENEIEELLQKIHNSSHDSTEPGDQETDNELYTAALRFRLLRQQGYN  137

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             ISC +F  F D DGKFK+SL  DV G+LSLYEA++L  HGE  LDEAL FT +HLES   
Sbjct  138   ISCDIFNNFKDSDGKFKESLVNDVLGLLSLYEATHLRNHGEDILDEALIFTTTHLESATH  197

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+ + + +V+HA+  P  + LPR+  + YM +Y++  + N+ LL FAKLDFNLLQ+VHQ
Sbjct  198   RLSPILSKQVTHAMYQPFWKGLPRLETRHYMSLYQERDSQNETLLNFAKLDFNLLQQVHQ  257

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             RELS I+RWWKDL     LPFAR R+ E YFW  GV+FEPQY+ +R    ++I + +V+D
Sbjct  258   RELSEISRWWKDLDFVNTLPFARDRVVESYFWASGVHFEPQYYSARITLCKVIALITVID  317

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D+YDV+GT +EL+LFT A++R+D SA + +P+Y+K  Y A+LD+  E+EE +A E  L+ 
Sbjct  318   DIYDVHGTHEELELFTEAVERWDISAMDHLPEYMKVCYQALLDVYVEIEENLANEGNLYS  377

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + Y    MK  +R Y++E  WF+ K+ P  ++Y+  +L +S +M+ ATT  VGMGDI TK
Sbjct  378   IHYAREAMKVLVRAYFREAKWFHQKYTPTMDDYMSAALNTSNFML-ATTSFVGMGDIATK  436

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             + +DWV  +P  VKA   I R+M+D+       +RGHVASAV+CYMK Y  +++EA +E+
Sbjct  437   DSMDWVFDDPKMVKAASLIGRIMNDIKS----DQRGHVASAVKCYMKEYGATEEEANIEL  492

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K ++ AWKDIN+ C+    +PM +LLR+LNLAR + ++YK  D +T + +  K  + + 
Sbjct  493   SKQVNNAWKDINETCIQNTTIPMPLLLRILNLARVVEVLYKHGDGFTDAGIFLKDSVVSL  552

Query  366   LVQPVTI  346
              V+PV +
Sbjct  553   FVEPVPL  559



>sp|Q5SBP6.1|GDS_OCIBA RecName: Full=Germacrene-D synthase; AltName: Full=(-)-germacrene 
D synthase [Ocimum basilicum]
 gb|AAV63786.1| germacrene D synthase [Ocimum basilicum]
Length=546

 Score =   531 bits (1367),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 261/539 (48%), Positives = 372/539 (69%), Gaps = 16/539 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRSVTYHP+VW D+FL Y S +TE+   E  ++Q+ KE ++ +L       + K+EL+D 
Sbjct  22    RRSVTYHPSVWKDHFLDYASGITEV---EMEQLQKQKERIKTLLAQTLDDFVLKIELIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHFE EI  S++ I+D +    K   +N++ VV+LRFRLLRQ G+ +   VF+
Sbjct  79    IQRLGVGYHFEKEINHSLRQIYDTFQISSK---DNDIRVVALRFRLLRQHGYPVPSDVFK  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF+D  G+  +S+  +VEGMLSLYEAS  G+ GE  LD+AL  + SHLE +        +
Sbjct  136   KFIDNQGRLDESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLEPLAS-----RS  190

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +++ AL++PI +TL R+GA++++ IYE+D++ ++ LL+FAKLDFN+LQK+HQ EL+ I 
Sbjct  191   RRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLDFNILQKIHQEELTHIA  250

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L +   LPFAR R+ ECYFWILGVYFEPQY+ +RR  T++I + S++DD+YDV+G
Sbjct  251   RWWKELDLGNKLPFARDRVVECYFWILGVYFEPQYNIARRFMTKVIAMTSIIDDIYDVHG  310

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +ELQ FT+AI+ +D  A +E+P Y++  Y A+L +  EME  M K+N+ + + Y   E
Sbjct  311   TLEELQRFTDAIRSWDIRAIDELPPYMRLCYEALLGMYAEMENEMVKQNQSYRIEYARQE  370

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVG-MGDIITKEVLDWV  709
             M K + TY +E  W Y+K++P  +EY+K++LVS  YMM+ATT LVG +GD ITK+  DW+
Sbjct  371   MIKLVTTYMEEAKWCYSKYIPNMDEYMKLALVSGAYMMLATTSLVGILGDPITKQDFDWI  430

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             T+EP  ++A   ICRLMDD++GH  EQ+     S+V+CYMK    SK EA  E  K + K
Sbjct  431   TNEPPILRAASVICRLMDDVVGHGIEQK----ISSVDCYMKENGCSKMEAVGEFSKRVKK  486

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             AWK++N+E + P    M +L+RV+NLAR I L+Y   D Y  S VK K LI   LV P+
Sbjct  487   AWKNLNEEWVEPRAASMVILVRVVNLARVINLLYVGEDSYGNSSVKTKELIKGVLVHPI  545



>ref|XP_003541022.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Glycine 
max]
Length=567

 Score =   531 bits (1369),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 266/545 (49%), Positives = 369/545 (68%), Gaps = 10/545 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE-KLELVD  1789
             R +  + P+VWGDYFL Y     E D S  ++ Q  KEEVRK+LIA    +   KLE +D
Sbjct  23    RNTANFSPSVWGDYFLYYVPSSVE-DDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
              +QRLGV YHFE+EI  ++  I++     +N I  DD+  L  V+L FRLLRQ+G+HIS 
Sbjct  82    SVQRLGVSYHFEHEIDGALHQIYNISTKDNNIITHDDD--LCHVALLFRLLRQQGYHISS  139

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL-ESILPGL  1441
              VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F    L +S+   L
Sbjct  140   NVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQL  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLDFN+LQ++HQ+E
Sbjct  200   SPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKE  259

Query  1260  LSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ++ +TRWW K+L V   LPF R R+AECYFWILG+YFEPQY  +RRITT++I + SV+DD
Sbjct  260   VNNVTRWWIKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITTKVIALCSVIDD  319

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE M K+ K++ +
Sbjct  320   MYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCI  379

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y   EMK+ I+ +  E  W +  H P  EEY++V  VSS Y M+ T C VGM D  T+E
Sbjct  380   KYAKKEMKRLIKAHMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITICFVGMKD-TTEE  438

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W TS+P+ + A   ICRLMDD++G+EFEQER HVAS++E YMK +N S+Q+A  ++ 
Sbjct  439   VLIWATSDPIIIGAASIICRLMDDIVGNEFEQERRHVASSIESYMKQHNTSRQDAINKLL  498

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT +    K  I T L
Sbjct  499   EMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAGGLMKDYIKTLL  558

Query  363   VQPVT  349
             V  ++
Sbjct  559   VNKMS  563



>ref|NP_001239042.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEM23831.1| sesquiterpene synthase [Solanum lycopersicum]
Length=553

 Score =   531 bits (1367),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 264/543 (49%), Positives = 376/543 (69%), Gaps = 13/543 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR  ++HPTVWGD+FLAY + L+     EE++ + LKEEVRK+L+ AP  +LEKLEL++ 
Sbjct  18    RRVGSHHPTVWGDHFLAY-ANLSGASEEEEKQHEDLKEEVRKMLVMAPSNALEKLELINT  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI++   ++  +Y+    GD    L+ ++L FRLLRQ+G+ +SC  ++
Sbjct  77    IQCLGVAYHFEHEIES---YMCTHYEEYWIGD----LHAIALCFRLLRQQGYRVSCDAYK  129

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NELA  1429
             KF D  G FK  L  DV GMLSLYEA+   VHGE  LDEAL FT + L+ ILP L N   
Sbjct  130   KFTDDQGNFKIELINDVHGMLSLYEAAQFRVHGEEILDEALNFTTTQLKLILPKLSNSPL  189

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V++ALK PI+  + RV A++Y+  Y+Q+Q HN++LL FAKLDFN+LQ +H++EL  I
Sbjct  190   AQQVANALKFPIKDGIVRVEARKYISFYQQNQNHNQLLLNFAKLDFNILQMLHKKELCDI  249

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK+L + K LP+ R RLAE YFW LGVYFEPQY  +R+I T+ I + S++DD YD+Y
Sbjct  250   TRWWKELEIVKTLPYVRDRLAEVYFWSLGVYFEPQYSTARKILTKNISMISLIDDTYDIY  309

Query  1068  GTQDELQLFTNAIQRFDTSASN--EVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             GT DEL LFT AI+R++  AS   ++P Y+K IY  +LD+  E+++ +A ENK F ++Y+
Sbjct  310   GTLDELTLFTEAIERWNIDASEQLQLPSYMKIIYCGLLDVYDEIKKDLANENKSFLINYS  369

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
             I EMKK +  Y+QE  W+Y K +P  EEY+K  + +S Y+ IATT  +GMG++ TK+  D
Sbjct  370   IIEMKKMVMAYFQEAKWYYGKTIPKMEEYMKNGISTSAYVQIATTSWLGMGNVATKDSFD  429

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+ +EP  + A+  I RL++D++ HE EQ+RG   S VECYMK Y V+K+EA+++I   I
Sbjct  430   WIVNEPPILVASSIIARLLNDLLSHEEEQKRGDAPSGVECYMKEYGVTKEEAHIKIRNTI  489

Query  534   SKAWKDINQEC--LHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
               +WKD+ +E   ++   +P  +L+ ++NLAR I  IYKD D YTF +   K +I   L+
Sbjct  490   ENSWKDLYEEYFKVNGTIIPRVLLMCIINLARVIEFIYKDEDAYTFPKNNLKDVIYRILI  549

Query  360   QPV  352
              P+
Sbjct  550   DPI  552



>sp|Q6Q3H2.1|TPSVS_VITVI RecName: Full=Valencene synthase; Short=VvVal; AltName: Full=7-epi-alpha-selinene 
synthase [Vitis vinifera]
 gb|AAS66358.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score =   531 bits (1367),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 258/540 (48%), Positives = 365/540 (68%), Gaps = 3/540 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL-ELV  1792
              R    +HP +WGD F+ Y  +       +E +++ LK+EV++ L AA  A+  +L   +
Sbjct  18    NRPVANFHPNIWGDQFITYTPEDKVTRACKEEQIEDLKKEVKRKLTAAAVANPSQLLNFI  77

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             D +QRLGV YHFE EI+ ++QHI +++ +C   D + +LY ++L FRLLRQ+G+ ISC +
Sbjct  78    DAVQRLGVAYHFEQEIEEALQHICNSFHDC--NDMDGDLYNIALGFRLLRQQGYTISCDI  135

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F KF D+ G+FK++L  DV GML LYEA++L VHGE  L +AL FT +HL++++  L   
Sbjct  136   FNKFTDERGRFKEALISDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYH  195

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +V+HAL  PIR+ L R+ A+ Y+ +Y+ +  H+K LL  AKLDFNL+Q +H+ ELS 
Sbjct  196   LAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSN  255

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             + RWWK+L     LPFAR RL E YFW+ GVYFEPQY   RRI T++I + S+LDD++D 
Sbjct  256   LARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDA  315

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +EL+LF  AI+R+D ++ N++P+Y+K  Y+A+LD+  E+EE M KE   + V Y  
Sbjct  316   YGTPEELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEEEMEKEGNQYRVHYAK  375

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q+R Y+ E  W + +HVP FEEY++V+L SS Y ++ATT  VGMG+I TKE  DW
Sbjct  376   EVMKNQVRAYFAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMGEIATKEAFDW  435

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             VTS+P  + ++  I RLMDD+  H+FEQ+RGHV SAVECYMK Y VS+++ Y E +K I 
Sbjct  436   VTSDPKIMSSSNFITRLMDDIKSHKFEQKRGHVTSAVECYMKQYGVSEEQVYSEFQKQIE  495

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AW DINQECL P  V M +L R+LN  R + +IYK+ D YT      +  I +  +  V
Sbjct  496   NAWLDINQECLKPTAVSMPLLARLLNFTRTMDVIYKEQDSYTHVGKVMRDNIASVFINAV  555



>gb|KHN11075.1| (-)-germacrene D synthase [Glycine soja]
Length=567

 Score =   530 bits (1366),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 266/545 (49%), Positives = 368/545 (68%), Gaps = 10/545 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE-KLELVD  1789
             R +  + P+VWGDYFL Y     E D S  ++ Q  KEEVRK+LIA    +   KLE +D
Sbjct  23    RNTANFSPSVWGDYFLYYVPSSVE-DDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
              +QRLGV YHFE+EI  ++  I++     +N I  DD+  L  V+L FRLLRQ+G+HIS 
Sbjct  82    SVQRLGVSYHFEHEIDGALHQIYNISTKDNNIITHDDD--LCHVALLFRLLRQQGYHISS  139

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL-ESILPGL  1441
              VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F    L +S+   L
Sbjct  140   NVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQL  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLDFN+LQ++HQ+E
Sbjct  200   SPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKE  259

Query  1260  LSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ++ +TRWW K+L V   LPF R R+AECYFWILG+YFEPQY  +RRITT++I + SV+DD
Sbjct  260   VNNVTRWWIKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITTKVIALCSVIDD  319

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE M K+ K++ +
Sbjct  320   MYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCI  379

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y   EMK+ I+    E  W +  H P  EEY++V  VSS Y M+ T C VGM D  T+E
Sbjct  380   KYAKKEMKRLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITICFVGMKD-TTEE  438

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W TS+P+ + A   ICRLMDD++G+EFEQER HVAS++E YMK +N S+Q+A  ++ 
Sbjct  439   VLIWATSDPIIIGAASIICRLMDDIVGNEFEQERRHVASSIESYMKQHNTSRQDAINKLL  498

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT +    K  I T L
Sbjct  499   EMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAGGLMKDYIKTLL  558

Query  363   VQPVT  349
             V  ++
Sbjct  559   VNKMS  563



>ref|XP_008452330.1| PREDICTED: (+)-gamma-cadinene synthase-like [Cucumis melo]
Length=570

 Score =   531 bits (1367),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 253/547 (46%), Positives = 376/547 (69%), Gaps = 10/547 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             R    +HP +W ++FL++  D  L ++D   +   ++LKEE+R ++IA     L KL LV
Sbjct  23    RSLANFHPNIWKEHFLSFTFDDAL-KVDEGMKERTEKLKEEIRMMMIAYVENQLVKLNLV  81

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCI----KGDDENNLYVVSLRFRLLRQEGHHI  1624
             D IQRLGV YHFE+EI   ++HI+ +Y+N +    K  +  +L++ +L FRLLRQ+G+ I
Sbjct  82    DSIQRLGVSYHFEDEIDEFLEHIYVSYNNSLLLSNKDSEGEDLHITALLFRLLRQQGYRI  141

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESIL--  1450
             SC +F KF+D +GKFK+SL +D  G+LSLYEAS++ VHGE  L+EAL FT +HL++ +  
Sbjct  142   SCDIFLKFMDDNGKFKESLVEDERGILSLYEASHMMVHGEALLEEALEFTTTHLQTYIHR  201

Query  1449  -PGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
                +N   A++VS+ALKLPIR+ +PR+ A+EY++IY+Q  +HN+ LL F+KLDFN LQK+
Sbjct  202   YSNINPSFASEVSNALKLPIRKGVPRIKAREYLEIYQQHPSHNETLLTFSKLDFNTLQKL  261

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQ+EL+ I RWWKDL V    PFAR R+ ECYFWIL +YFEP + F R+I T++I + S+
Sbjct  262   HQKELAEICRWWKDLNVSTNFPFARDRIVECYFWILSIYFEPHFKFGRKILTKVIAMTSI  321

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YD YGT +ELQ+FT AI+R+D S  N +P+Y+K  Y  +LD+  E+++ +  +   
Sbjct  322   MDDIYDAYGTFEELQVFTLAIKRWDMSMINLLPKYMKVYYTTLLDLFEEIDKEIVNDETS  381

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             +   +    MK+Q  +Y++E  W    + P +EEY++V+L SS Y +++T   V MGDI 
Sbjct  382   YRSHFAKEAMKRQAESYFKEAEWLNKNYKPKYEEYMEVALASSGYELLSTISFVCMGDIA  441

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             T+E+ DW+   P  +KA+ +I RLMDD++ ++FE+ER HV SAVECYM  Y  S++E   
Sbjct  442   TEEIFDWLFDCPKILKASTTISRLMDDVVSYKFEKEREHVVSAVECYMNNYGCSEEETCA  501

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
              + K +  AWK+IN+ CLHP+ VP+  L+ VLNL R + L+Y D D YT S+ + K LI 
Sbjct  502   NLLKQVKDAWKNINKCCLHPMTVPVPFLVCVLNLTRVMALLYSDEDGYTNSKGRTKLLIQ  561

Query  372   TTLVQPV  352
             + L+ P+
Sbjct  562   SLLIDPL  568



>ref|XP_002283344.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CBI20175.3| unnamed protein product [Vitis vinifera]
 gb|ADR74228.1| (E)-beta-caryophyllene/2-epi-(E)-beta-caryophyllene synthase 
[synthetic construct]
Length=560

 Score =   530 bits (1365),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/552 (49%), Positives = 364/552 (66%), Gaps = 4/552 (1%)
 Frame = -2

Query  1998  TEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPP  1819
             T   V+     R +  + P +WGD FL Y          +E+++++LKEEVRK L A+  
Sbjct  12    TTPGVDHQGVARSTANFPPNIWGDRFLIYTPDDAITHECKEQQIEELKEEVRKELKASAS  71

Query  1818  ASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQ  1639
              S E L+L+D IQ LG+ +HFE EI+ +++ ++  Y      DD  N    SLRFRLLRQ
Sbjct  72    KSPELLKLIDSIQLLGLAHHFEREIEEALKDMYGTYSLVDDNDDFTN---ASLRFRLLRQ  128

Query  1638  EGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLE  1459
             EG+ I   VF KF DK+G FK+ L  D  GML+LYEA++L VHGE  L+EAL FT +HL+
Sbjct  129   EGYPIPSDVFNKFKDKEGNFKEYLIGDSLGMLALYEATHLMVHGEDILEEALAFTTTHLQ  188

Query  1458  SILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQ  1279
             S+    N   A +V  ALK PIR+ L RV A  Y+ IY+QD +HNK LL+ AKLDFNLLQ
Sbjct  189   SMATDPNNPLAKQVIRALKRPIRKGLTRVEATHYISIYQQDGSHNKSLLKLAKLDFNLLQ  248

Query  1278  KVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIW  1099
              +H++ELS I+RWWK L V   LPFAR RL E YFW LGVYFEPQY  +RR  T++  + 
Sbjct  249   SLHRKELSEISRWWKGLDVATKLPFARDRLVESYFWTLGVYFEPQYFPARRFLTKMTAML  308

Query  1098  SVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVP-QYLKKIYLAILDITTEMEEVMAKE  922
             +++DD+YD YGT +EL+L T A++R+D S  +++P  Y+K  Y A+LD+  EMEE MAKE
Sbjct  309   TIMDDIYDAYGTIEELELLTEAVERWDASCIDQLPADYMKWFYRALLDVYEEMEEEMAKE  368

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
              KL+ V Y    MK+QI+ Y+ E  W   ++VP F+EY+  +LVS  Y ++  T  VGMG
Sbjct  369   GKLYRVHYAKEAMKRQIQAYFIEAKWLNQRYVPTFDEYISNTLVSCGYTLLIATSFVGMG  428

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
             D++T+E   WV S    ++A+ +I RLMDD++ HEFEQ R H  S++ECYMK Y V+KQE
Sbjct  429   DVVTEEAFQWVLSHAKMIRASETISRLMDDLVSHEFEQTRMHAPSSIECYMKQYEVTKQE  488

Query  561   AYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
             A  E+ K I +AWKDINQECL P  VPM ++ RVLN +R I ++YKD D YT +    K 
Sbjct  489   ACDELNKQIVRAWKDINQECLRPTQVPMPLVTRVLNFSRVIDILYKDEDEYTHNGKLIKD  548

Query  381   LITTTLVQPVTI  346
             LIT  L+ PV +
Sbjct  549   LITWMLIDPVPM  560



>ref|XP_006592517.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Glycine 
max]
Length=567

 Score =   530 bits (1365),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 265/545 (49%), Positives = 367/545 (67%), Gaps = 10/545 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE-KLELVD  1789
             R +  + P++WGDYFL Y     E D S  ++ Q  KEEVRK+LIA    +   KLE +D
Sbjct  23    RNTANFSPSIWGDYFLYYVPSSVE-DDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
              +QRLGV YHFE+EI   +  I++     +N I  DD+  L  V+L FRLLRQ+G+HIS 
Sbjct  82    SVQRLGVSYHFEHEIDGVLHQIYNISTKDNNIITHDDD--LCHVALLFRLLRQQGYHISS  139

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL-ESILPGL  1441
              VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F    L +S+   L
Sbjct  140   NVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQL  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLDFN+LQ++HQ+E
Sbjct  200   SPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKE  259

Query  1260  LSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ++ +TRWW K+L V   LPF R R+AECYFW LG+YFEPQY  +RRITT++I + SV+DD
Sbjct  260   VNNVTRWWIKNLNVSTKLPFVRDRIAECYFWSLGIYFEPQYSLARRITTKVIALCSVIDD  319

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE M K+ K++ +
Sbjct  320   MYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCI  379

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y   EMK+ I+    E  W +  H P  EEY++V  VSS Y M+ T C VGM D  T+E
Sbjct  380   KYAKKEMKRLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSAYSMVITICFVGMKD-TTEE  438

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W TS+P+ + A   ICRLMDD++G+EFEQER HVAS++ECYMK +N S+Q+A  ++ 
Sbjct  439   VLIWATSDPIIIGAASIICRLMDDIVGNEFEQERRHVASSIECYMKQHNTSRQDAINKLL  498

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT +    K  I T L
Sbjct  499   EMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAGGLMKDYIKTLL  558

Query  363   VQPVT  349
             V  ++
Sbjct  559   VNKMS  563



>ref|XP_011030746.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Populus 
euphratica]
Length=558

 Score =   530 bits (1364),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 263/544 (48%), Positives = 375/544 (69%), Gaps = 12/544 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HP++WGDYF+ +    +  D   E+E  +LKEEV+++L A      E+L  +D 
Sbjct  21    RRSANFHPSIWGDYFVCHTFN-SMFDDHFEQEFYRLKEEVKEMLYATTNKLSEQLNFIDV  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD---ENNLYVVSLRFRLLRQEGHHISCG  1615
             IQRLGV Y FE++I    Q + D Y     GDD   +++L +V+LRFRLLRQ+GH++SC 
Sbjct  80    IQRLGVSYLFESDID---QMLCDLYYQG-SGDDYVHDHDLQMVALRFRLLRQQGHYVSCD  135

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF+KF D +G FK  LT D++GMLSLYEA++L VHGE  L+EALTF  +HL+SI   +  
Sbjct  136   VFKKFKDTEGNFKVCLTNDIQGMLSLYEATHLRVHGEDILEEALTFATTHLKSITTDMCP  195

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 K+ HAL  PI + LP +GAK Y+  Y+Q+ +H +VLL+FAKL+FN LQ +HQ+EL+
Sbjct  196   PLLVKLRHALDQPIHKDLPWLGAKRYISSYKQEASHGEVLLKFAKLNFNFLQNMHQKELA  255

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              IT WWK + + K LPFAR RL ECYFWILGV FEPQY F+R I T++I + SV+DD+YD
Sbjct  256   DITMWWKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFTRIIMTKVIAMTSVMDDVYD  315

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VYGT +EL LFT+AI+R+D S  + +P+Y+K  Y  + D+  E+E  +A+  + + V Y 
Sbjct  316   VYGTMEELVLFTDAIERWDISKIDHLPEYMKFFYKQLFDVFKEIETGLAEPGRSYRVDYA  375

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
                MKKQ++ Y+ E  W +   +P  +EY+++SL+SS Y ++     VGMGDI+TK+  +
Sbjct  376   KEAMKKQVQAYFVEARWLHENCMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFE  435

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+  +P  VKA   I RLMDD + H+FEQER HVASA+ECYM  + V++++AY E+ + +
Sbjct  436   WLNKDPKIVKAASVIARLMDDTVSHKFEQERAHVASAIECYMNQHEVAEEQAYDELRRQV  495

Query  534   SKAWKDINQECLHPLP---VPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
              +AWKDIN+E L  +P   VP+ +L RVLNLAR + ++YKD D YT +  K ++ IT+ L
Sbjct  496   VEAWKDINEELL-IIPKDHVPIPLLTRVLNLARVMDVMYKDGDGYTNANGKVRNYITSLL  554

Query  363   VQPV  352
             ++PV
Sbjct  555   IEPV  558



>gb|AGL98419.1| B-caryophyllene synthase [Lavandula angustifolia]
Length=548

 Score =   529 bits (1363),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 261/546 (48%), Positives = 365/546 (67%), Gaps = 6/546 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             NV S   R VTYHP VW DYFL Y S+LTEI  +++ E ++ KE +R +L+     S  K
Sbjct  9     NVCSDDARPVTYHPNVWSDYFLRYTSELTEISVAKKEEHERQKEAIRNLLLQTRDDSTLK  68

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHI  1624
             LELVD IQRLG+ YHFE EI  S+++I+D   N I   +++NL V +LRFRL+RQ+G   
Sbjct  69    LELVDAIQRLGIGYHFEEEIHNSLRNIYDT--NPIYNAEDDNLRVAALRFRLIRQQGFPA  126

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
              C VF KF+D++G+FK  ++ DVEG+L+LYEAS   VHGE  L++AL F +  LE +  G
Sbjct  127   PCDVFRKFVDEEGEFKSWVSNDVEGLLNLYEASNFAVHGEEILEKALEFCSLRLEFLTQG  186

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             +    + +V  ALK+PI +TL R+GA+++M +Y++D++HN+ LL FAKLDFNL+QK+HQ+
Sbjct  187   MTNSLSMRVKEALKIPISKTLTRLGARKFMSMYQEDESHNETLLNFAKLDFNLVQKIHQK  246

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL+ ITRWWK+L   K LPFAR R  ECYFWI+GVYFEP+Y  +R + T+II + SVLDD
Sbjct  247   ELNQITRWWKELDFGKNLPFARDRPVECYFWIVGVYFEPRYGIARTLLTKIIYLASVLDD  306

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT  EL +FT  I+R+D+ A +++P Y++    A+ D+  EMEE M K  K + V
Sbjct  307   IYDVYGTLAELTIFTQIIRRWDSDAMDQLPPYMRIYCKALFDVYVEMEEEMGKIRKSYAV  366

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y   EMK+    Y+QE  W ++K+ P  +EYLKV+L+SS YMM+    L  + D+IT+E
Sbjct  367   EYAKKEMKRLAEMYFQEAQWAFSKYKPTMKEYLKVALISSGYMMMTINSLTTIEDLITEE  426

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
               +W+ SEP  ++A+ +I RLMDD+ G+  E +     SAV  YM    VS+ EA+ E+ 
Sbjct  427   EFNWILSEPRILRASLTITRLMDDLAGYGTEGK----MSAVHYYMAENGVSEGEAFKEVS  482

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
              +I  AWKD+N EC+ P      +L  V++  R I L+Y D D Y  SQ K K LI + L
Sbjct  483   GIIKSAWKDVNAECVEPRAASTTILRCVVDFTRVIVLLYSDEDAYGNSQTKTKDLIKSVL  542

Query  363   VQPVTI  346
             V P+ I
Sbjct  543   VDPLII  548



>gb|AEP82781.1| TPS16 [Solanum lycopersicum]
Length=553

 Score =   529 bits (1363),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 263/543 (48%), Positives = 375/543 (69%), Gaps = 13/543 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR  ++HPTVWGD+FLAY + L+     EE++ + LKEEVRK+L+ AP  +LEKLEL++ 
Sbjct  18    RRVGSHHPTVWGDHFLAY-ANLSGASEEEEKQHEDLKEEVRKMLVMAPSNALEKLELINT  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI++ +   ++ Y      DD   L+ ++L FRLLRQ+G+ +SC  ++
Sbjct  77    IQCLGVAYHFEHEIESYMCTHYEEY----WIDD---LHAIALCFRLLRQQGYRVSCDAYK  129

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NELA  1429
             KF D  G FK  L  DV GMLSLYEA+   VHGE  LDEAL FT + L+ ILP L N   
Sbjct  130   KFTDDQGNFKIELINDVHGMLSLYEAAQFRVHGEEILDEALNFTTTQLKLILPKLSNSPL  189

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +V++ALK PI+  + RV A++Y+  Y+Q+Q HN++LL FAKLDFN+LQ +H++EL  I
Sbjct  190   AQQVANALKFPIKDGIVRVEARKYISFYQQNQNHNQLLLNFAKLDFNILQMLHKKELCDI  249

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK+L + K LP+ R RLAE YFW LGVYFEPQY  +R+I T+ I + S++DD YD+Y
Sbjct  250   TRWWKELEIVKTLPYVRDRLAEVYFWSLGVYFEPQYSTARKILTKNISMISLIDDTYDIY  309

Query  1068  GTQDELQLFTNAIQRFDTSASN--EVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             GT DEL LFT AI+R++  AS   ++P Y+K IY  +LD+  E+++ +A ENK F ++Y+
Sbjct  310   GTLDELTLFTEAIERWNIDASQQLQLPSYMKIIYCGLLDVYDEIKKDLANENKSFLINYS  369

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
             I EMKK +  Y+QE  W+Y K +P  EEY+K  + +S Y+ +ATT  +GMG++ TK+  D
Sbjct  370   IIEMKKMVMAYFQEAKWYYGKTIPKMEEYMKSGISTSAYVQVATTSWLGMGNVATKDSFD  429

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+ +EP  + A+  I RL++D++ HE EQ+RG   S VECYMK Y V+K+EA+++I   I
Sbjct  430   WIVNEPPILVASSIIARLLNDLLSHEEEQKRGDAPSGVECYMKEYGVTKEEAHIKIRNTI  489

Query  534   SKAWKDINQEC--LHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
               +WKD+ +E   ++   +P  +L+ ++NLAR I  IYKD D YTF +   K +I   L+
Sbjct  490   ENSWKDLYEEYFKVNGTIIPRVLLMCIINLARVIEFIYKDEDAYTFPKNNLKDVIYRILI  549

Query  360   QPV  352
              P+
Sbjct  550   DPI  552



>ref|XP_011030745.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Populus 
euphratica]
Length=563

 Score =   529 bits (1363),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 265/548 (48%), Positives = 378/548 (69%), Gaps = 15/548 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFL--AYDSKLTEI--DPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  +HP++WGDYF+   ++S +  I  D   E+E  +LKEEV+++L A      E+L 
Sbjct  21    RRSANFHPSIWGDYFVCHTFNSMVNVIYFDDHFEQEFYRLKEEVKEMLYATTNKLSEQLN  80

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD---ENNLYVVSLRFRLLRQEGHH  1627
              +D IQRLGV Y FE++I    Q + D Y     GDD   +++L +V+LRFRLLRQ+GH+
Sbjct  81    FIDVIQRLGVSYLFESDID---QMLCDLYYQG-SGDDYVHDHDLQMVALRFRLLRQQGHY  136

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +SC VF+KF D +G FK  LT D++GMLSLYEA++L VHGE  L+EALTF  +HL+SI  
Sbjct  137   VSCDVFKKFKDTEGNFKVCLTNDIQGMLSLYEATHLRVHGEDILEEALTFATTHLKSITT  196

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              +      K+ HAL  PI + LP +GAK Y+  Y+Q+ +H +VLL+FAKL+FN LQ +HQ
Sbjct  197   DMCPPLLVKLRHALDQPIHKDLPWLGAKRYISSYKQEASHGEVLLKFAKLNFNFLQNMHQ  256

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +EL+ IT WWK + + K LPFAR RL ECYFWILGV FEPQY F+R I T++I + SV+D
Sbjct  257   KELADITMWWKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFTRIIMTKVIAMTSVMD  316

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D+YDVYGT +EL LFT+AI+R+D S  + +P+Y+K  Y  + D+  E+E  +A+  + + 
Sbjct  317   DVYDVYGTMEELVLFTDAIERWDISKIDHLPEYMKFFYKQLFDVFKEIETGLAEPGRSYR  376

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             V Y    MKKQ++ Y+ E  W +   +P  +EY+++SL+SS Y ++     VGMGDI+TK
Sbjct  377   VDYAKEAMKKQVQAYFVEARWLHENCMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTK  436

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             +  +W+  +P  VKA   I RLMDD + H+FEQER HVASA+ECYM  + V++++AY E+
Sbjct  437   DAFEWLNKDPKIVKAASVIARLMDDTVSHKFEQERAHVASAIECYMNQHEVAEEQAYDEL  496

Query  546   EKLISKAWKDINQECLHPLP---VPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
              + + +AWKDIN+E L  +P   VP+ +L RVLNLAR + ++YKD D YT +  K ++ I
Sbjct  497   RRQVVEAWKDINEELL-IIPKDHVPIPLLTRVLNLARVMDVMYKDGDGYTNANGKVRNYI  555

Query  375   TTTLVQPV  352
             T+ L++PV
Sbjct  556   TSLLIEPV  563



>ref|XP_009768421.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Nicotiana 
sylvestris]
Length=548

 Score =   528 bits (1361),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 262/550 (48%), Positives = 368/550 (67%), Gaps = 3/550 (1%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS  1813
             MD +     RR   +HPTVWGD+FLAY + L+  +  E+++ + LKEEVRK+L+ AP  S
Sbjct  1     MDRSSGEVKRRCDNHHPTVWGDHFLAY-AHLSGANEWEKKQHEHLKEEVRKMLVMAPSKS  59

Query  1812  LEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L+ L L+  IQ LGV YHFE+EI+ S+  I+  Y+       E +L++V+LRFRLLRQ G
Sbjct  60    LQNLNLISAIQCLGVAYHFEHEIEESLACIYSCYEELNGEAYETDLHLVALRFRLLRQHG  119

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             +++S   F KF D  G +K +L  DV+G+LSL+EA+   VHGE  LDEA  FT +HL+ +
Sbjct  120   YYVSSDAFRKFADDQGNYKKALVSDVQGLLSLFEAAQFRVHGEEILDEADNFTTTHLKLL  179

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             LP L+   A +V +ALK PI  T+  V A++Y+  Y++D++ ++VLL FAKLDFN+LQK+
Sbjct  180   LPTLSNSLAMQVRNALKYPINYTMVIVAARKYISFYQEDKSCDEVLLNFAKLDFNILQKM  239

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H+REL  ITRWWK+L + K LPFAR R+ E YFW LG+YFEPQY FSR I T+++C  SV
Sbjct  240   HKRELCDITRWWKELDLAKALPFARDRIVELYFWSLGMYFEPQYRFSRNILTKMLCFVSV  299

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE-NK  916
              DD+YD YGT DEL L TN+I+R++  A  ++P Y+K  Y A+LD+ +E+E+ +A + NK
Sbjct  300   TDDIYDTYGTLDELTLLTNSIERWNIDAVEQLPSYMKPFYRALLDVYSEVEKELASDHNK  359

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
              F V+Y+I   KK  R Y+QE  W++   VP  E+Y+K  + SS    +     +GMG+ 
Sbjct  360   SFRVNYSITTKKKLTRAYFQEAEWYHGNIVPTMEQYVKNGIRSSTIPYLTAASWLGMGNE  419

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
               KE  DW+ SEP  + A+  I RL +D++ HE E ERG V + VECYM  Y V+K+EA 
Sbjct  420   AMKEAYDWIASEPPVLVASSIIGRLSNDVVSHEREVERGDV-TGVECYMNEYGVTKEEAC  478

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
              EI K++   WKD+N+ CL P  VP  +L+ +LNLAR    +YKD D YT S+  FK ++
Sbjct  479   TEIRKILENKWKDLNRGCLEPTDVPKVLLMPMLNLARMCEFVYKDEDAYTVSKNNFKDIV  538

Query  375   TTTLVQPVTI  346
             +  LV P+TI
Sbjct  539   SLVLVDPITI  548



>ref|XP_010038257.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW50081.1| hypothetical protein EUGRSUZ_K03518 [Eucalyptus grandis]
Length=567

 Score =   529 bits (1363),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 258/546 (47%), Positives = 369/546 (68%), Gaps = 6/546 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEID----PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  YHP+VWGDYFL YDS    +        E ++++LK EV+K+LI      L+KL 
Sbjct  22    RRSAGYHPSVWGDYFLKYDSPSNSVKFKFLGRVEGQIEELKGEVKKMLIDVVEKPLQKLH  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE-NNLYVVSLRFRLLRQEGHHIS  1621
             L+D+IQRLG++YHFE+E+   ++ I  +Y      D + ++L++V+L FRLLRQ G++IS
Sbjct  82    LIDQIQRLGIEYHFEHEVDEQLEQIHKSYSRLDHEDFKVDDLHMVALIFRLLRQHGYNIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
               VF+KF D  G F++SLT DV G+LSLYEA +L  HG++ LDEAL F  +HLES     
Sbjct  142   SEVFDKFKDSKGNFRESLTSDVRGLLSLYEACHLRCHGDSILDEALPFATTHLESSNKSK  201

Query  1440  NELAAAK-VSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
                + AK VSHALK P+R+ LPR+ A  Y+ +Y+++ +H++VLL  AKLDFNLLQ+ HQ+
Sbjct  202   VSTSLAKQVSHALKQPLRKGLPRLEASRYIPLYQEEPSHDEVLLTLAKLDFNLLQEQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  ITRWWK++ VP+  PFAR R+ E +FW  G+YFEP++  +R I T++I + S++DD
Sbjct  262   ELGKITRWWKNIDVPRKFPFARDRIVELFFWTTGIYFEPEFAMAREILTKVISLTSIMDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL L    IQ++D  A + +P+Y++  +   L +   +   +A + + + +
Sbjct  322   IYDVYGTVEELALLNEVIQKWDVDAMDGLPEYMQTYFKEFLQLYEYIGNQLAAKGRSYRL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MKK +R Y+QE  WF+T ++P  EEY+ + L+++ Y M+ATT LVGMGD++T+ 
Sbjct  382   IYAKEVMKKLVRAYFQEAKWFHTNYIPTLEEYMPLQLITTGYGMLATTSLVGMGDVVTEH  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W  S+  +VKAT +ICRLMDD+  HEFEQ+RGHV SAVE  MK + VS+QEA  E+ 
Sbjct  442   VLKWSVSDCKSVKATQTICRLMDDVSSHEFEQKRGHVVSAVELLMKYHGVSEQEAGEELL  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD N+E L P  VPM VL R+LN +R I ++Y D D YT S+ K K  +T   
Sbjct  502   KGVIDAWKDTNEEFLRPTAVPMSVLTRMLNFSRVIDVLYSDGDNYTHSKTKLKDYVTLLF  561

Query  363   VQPVTI  346
             V P+ +
Sbjct  562   VNPLPM  567



>gb|AGV28055.1| sesquiterpene synthase [Azadirachta indica var. indica]
Length=547

 Score =   528 bits (1360),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 263/547 (48%), Positives = 366/547 (67%), Gaps = 23/547 (4%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLT-EIDPSEEREVQQLKEEVRKVLIA-APPASLEKLE  1798
             S RRS +YHP++WGD+FL+Y S  + E     + E Q+LKEE+ ++L+      S +K +
Sbjct  19    SNRRSASYHPSIWGDHFLSYASNDSMETTDIIDAEHQELKEEIGRMLMGDINKPSQKKPD  78

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFD-NYDNCIKGDDEN--NLYVVSLRFRLLRQEGHH  1627
              +D IQRLGV YHFENEI   +  I++ ++  C   DDEN  +LY +SL FRLLRQ G+ 
Sbjct  79    FIDSIQRLGVSYHFENEIDGILGKIYNTDHHAC---DDENIDDLYYISLHFRLLRQHGYK  135

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             I+  VF KF D DG FKDSL  D+ GMLSLYE ++L VHGE  LDEA  F   + +    
Sbjct  136   ITADVFNKFKDSDGNFKDSLVGDLRGMLSLYEVTHLKVHGENILDEAFAFVTKYFKLTTT  195

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
               N    A++ HALK PI ++L R+ A+ YM IY++D  H+KVLL FAKLDFN LQK+HQ
Sbjct  196   QFNSPLVAQIKHALKRPIHKSLQRLEARYYMSIYQEDPPHDKVLLTFAKLDFNKLQKLHQ  255

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +ELSGITR                R+ ECYFW L VYFEP+Y  +RRI T++I + SV+D
Sbjct  256   KELSGITR---------------DRVVECYFWTLEVYFEPKYSLARRIVTKVIAMTSVID  300

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D+YDVYGT + L+ FT AI+R+D S  +++P+Y+K  Y  +LD+ +E+E+ +  + KL+ 
Sbjct  301   DIYDVYGTIEGLEFFTVAIERWDISVVDQLPEYMKLCYQVLLDVYSEIEKDLVYQRKLYR  360

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             + +    MK  ++ Y+ E  W + K+VP   EY+ V+LV+S Y M+ATT  VGMGDI+TK
Sbjct  361   LYHAKEAMKTVVKNYFLETKWCHKKYVPKMNEYMIVALVTSAYSMLATTSFVGMGDIVTK  420

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W+ S P  + A+  +CRLMDD++ H+FEQ+RGHVAS++EC+MK +  S++EA  E 
Sbjct  421   EAFEWLFSNPKMIIASSVVCRLMDDIVSHKFEQKRGHVASSIECFMKEHGASEEEACNEF  480

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
             +K I+ AWKDIN+ECL P  VPM +LLR+LNL R I +IYKD D YT + V  K  + + 
Sbjct  481   QKKITNAWKDINEECLRPTSVPMPLLLRILNLTRVIDVIYKDEDGYTHAGVVLKGYVASF  540

Query  366   LVQPVTI  346
             L+ PV +
Sbjct  541   LIDPVPV  547



>ref|XP_006592518.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Glycine 
max]
Length=566

 Score =   528 bits (1360),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 264/545 (48%), Positives = 367/545 (67%), Gaps = 11/545 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE-KLELVD  1789
             R +  + P++WGDYFL Y    +  D S  ++ Q  KEEVRK+LIA    +   KLE +D
Sbjct  23    RNTANFSPSIWGDYFLYYVP--SSEDDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFID  80

Query  1788  KIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
              +QRLGV YHFE+EI   +  I++     +N I  DD+  L  V+L FRLLRQ+G+HIS 
Sbjct  81    SVQRLGVSYHFEHEIDGVLHQIYNISTKDNNIITHDDD--LCHVALLFRLLRQQGYHISS  138

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL-ESILPGL  1441
              VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F    L +S+   L
Sbjct  139   NVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQL  198

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLDFN+LQ++HQ+E
Sbjct  199   SPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKE  258

Query  1260  LSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ++ +TRWW K+L V   LPF R R+AECYFW LG+YFEPQY  +RRITT++I + SV+DD
Sbjct  259   VNNVTRWWIKNLNVSTKLPFVRDRIAECYFWSLGIYFEPQYSLARRITTKVIALCSVIDD  318

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE M K+ K++ +
Sbjct  319   MYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCI  378

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y   EMK+ I+    E  W +  H P  EEY++V  VSS Y M+ T C VGM D  T+E
Sbjct  379   KYAKKEMKRLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSAYSMVITICFVGMKD-TTEE  437

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W TS+P+ + A   ICRLMDD++G+EFEQER HVAS++ECYMK +N S+Q+A  ++ 
Sbjct  438   VLIWATSDPIIIGAASIICRLMDDIVGNEFEQERRHVASSIECYMKQHNTSRQDAINKLL  497

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT +    K  I T L
Sbjct  498   EMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAGGLMKDYIKTLL  557

Query  363   VQPVT  349
             V  ++
Sbjct  558   VNKMS  562



>sp|F6M8H5.1|SAUST_SANAS RecName: Full=Probable sesquiterpene synthase; Short=SauSTPS 
[Santalum austrocaledonicum]
 gb|AEF32535.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=562

 Score =   528 bits (1359),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 255/549 (46%), Positives = 361/549 (66%), Gaps = 5/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             ++N   R    + P++WGD F+ Y  +       +E++V++LKE VR+ L       L++
Sbjct  16    DLNMISRPVANFPPSIWGDRFINYACEDENDQAQKEKQVEELKELVRRELAITVDKPLQQ  75

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNY---DNCIKGDDENNLYVVSLRFRLLRQEG  1633
             L ++D  QRLG+ Y FENEI+ S++HI+ +    + C +G D  +LY V+L FRLLRQ  
Sbjct  76    LNIIDATQRLGIAYLFENEIEESLEHIYLHTYVENTCFEGSD--DLYSVALWFRLLRQND  133

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
             + +SC VF KF D +G FK++L +D +G+L LYEA++L VHGE  LD+AL FT + LES+
Sbjct  134   YRVSCDVFNKFRDNEGNFKNNLMEDTKGLLELYEATHLSVHGEEMLDDALEFTKTRLESV  193

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
             +  LN   A +V HAL  P+ + LPR+ A  + +IYE   +HNK LL+ AKLDFNLLQ  
Sbjct  194   VSHLNYPLAEQVRHALYQPLHKGLPRLEAVYFFRIYEAHASHNKALLKLAKLDFNLLQSF  253

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H++ELS I RWWK L      PFAR RL E YFW+LGVYFEPQY  +R+I  ++  + S 
Sbjct  254   HKKELSDIARWWKSLDFAAKFPFARDRLVEGYFWVLGVYFEPQYSLARKIIIKVFTMIST  313

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD+YD YGT DEL+LFT A+QR+D  + +++P+Y+K  Y +ILD+  E+E  M  +  L
Sbjct  314   IDDIYDAYGTLDELELFTKAMQRWDVGSLDQLPEYMKPCYKSILDVYNEIEVEMDNQGSL  373

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             F + Y    MKK +  Y  E  W + K+VP F+EY+ V+LV+S Y  + T   +GMG+I 
Sbjct  374   FRMHYAKEVMKKLVEGYMDEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTISYLGMGEIA  433

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             +KE  DW+ S P  ++A+ S+ RLMDD   H+FEQERGHVAS +ECYMK Y V+++EA  
Sbjct  434   SKEAFDWLFSHPPVIEASESVGRLMDDTRSHKFEQERGHVASGIECYMKQYGVTEEEARD  493

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E  K + KAWKDIN+ECL P  VP  +L+R+LNL R I +IYK+ D YT  +   K  I 
Sbjct  494   EFRKRLVKAWKDINEECLRPYRVPKPLLMRILNLTRVIDVIYKNEDGYTHVKKAMKDNIA  553

Query  372   TTLVQPVTI  346
             + L+ P+ +
Sbjct  554   SLLIDPMIV  562



>ref|XP_009349849.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=561

 Score =   527 bits (1357),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 263/545 (48%), Positives = 369/545 (68%), Gaps = 9/545 (2%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS-LEKLELV  1792
              RRS  + P  WGDYFL+Y S   E +   ER VQ+LKE V+++++A  P+   +KL+LV
Sbjct  18    NRRSANFPPNFWGDYFLSYAS--VEKNIEAERLVQELKENVKRMILAPTPSKHSDKLDLV  75

Query  1791  DKIQRLGVDYHFENEIQASIQHIF-DNYDNCIK---GDDENNLYVVSLRFRLLRQEGHHI  1624
             D IQRLGV YH+E+EI   +Q I  D+YD   +    DD++NL+  +L FRLLRQ+G+ I
Sbjct  76    DTIQRLGVSYHYEDEIDEVLQQIRKDSYDGSHQHQGSDDDHNLHAAALYFRLLRQQGYDI  135

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
             SC +F KF D DGKFKDSL  +V G+LSLYEA+ L VHGE  LDEALTFT +HL+S+   
Sbjct  136   SCEMFNKFKDDDGKFKDSLVNNVIGLLSLYEATQLSVHGEDILDEALTFTTTHLKSVENR  195

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             L+   +  V+HAL  P  +  PR+ A+ Y+ IY++D +HN+ LL FAKLDFNLLQ+VH +
Sbjct  196   LSSPLSKLVTHALYQPFWKGNPRLEARRYLSIYQEDDSHNETLLTFAKLDFNLLQQVHLK  255

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ELS I+RW KDL     LPF+R R+ E Y W LG  FEPQY F+R   +++I +   +DD
Sbjct  256   ELSEISRWSKDLDFVSKLPFSRDRVVESYLWGLGCCFEPQYEFARMTLSKVIVLIVAIDD  315

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL+LFT  ++R+D S  + + QY+K  Y A+LD+ TEMEE +  E  L+ +
Sbjct  316   IYDVYGTFEELELFTEVVERWDISVMDRLQQYMKVCYQAMLDLYTEMEEKLRNEGNLYRI  375

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK  +R Y +E  WF+ K+ P  +EYL  +L +S + + A T  +GMGDI+TK+
Sbjct  376   YYAREAMKVLVRGYLREAKWFHRKYTPTLDEYLSAALDTSSFSL-AITSFIGMGDIVTKD  434

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
              LDW  S+P  +KA   I RL +D+  H+FEQ+RGHVASAVECYMK Y+V+++EA + + 
Sbjct  435   SLDWAFSDPKILKAASLIGRLKNDIKSHQFEQKRGHVASAVECYMKQYDVTEEEATLGLS  494

Query  543   KLISKAWKDINQECLH-PLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
             K ++ AWKDIN+  LH   P+PM ++LR+LNL R + ++YK  D +T +    K ++ + 
Sbjct  495   KQVNNAWKDINEALLHQTTPIPMPLMLRILNLTRVVEVLYKHGDAFTNAGTFLKDIVVSL  554

Query  366   LVQPV  352
              V+PV
Sbjct  555   FVEPV  559



>ref|XP_008371257.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Malus domestica]
Length=562

 Score =   526 bits (1355),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 265/545 (49%), Positives = 372/545 (68%), Gaps = 8/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS-LEKLELV  1792
              RRS  + P  WGDYFL+Y S + E +   E+ VQ+LKE V+++++A  P    +KL+LV
Sbjct  18    NRRSANFPPNFWGDYFLSYAS-VVEKNIEAEKLVQELKENVKRMILAPTPCKHSDKLDLV  76

Query  1791  DKIQRLGVDYHFENEIQASIQHIF-DNYDNCIKG---DDENNLYVVSLRFRLLRQEGHHI  1624
             D IQRLGV YHFE+EI   +Q I  D+YD   +    DD++NL+  +L FRLLRQ+G+ I
Sbjct  77    DTIQRLGVSYHFEDEIDEVLQQIRKDSYDGSHQHQGRDDDHNLHADALYFRLLRQQGYDI  136

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
             SC +F KF D +GKFK+SL  DV G+LSLYEA+ L VHGE  L+ ALTFT +HL+S+   
Sbjct  137   SCEMFNKFKDDEGKFKESLVNDVIGLLSLYEATQLRVHGEDILEXALTFTTTHLKSVENR  196

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             L+   +  V+HAL  P  +  PR+ A+ Y+ IY++D +HN+ LL  AKLDFNLLQ+VHQ+
Sbjct  197   LSSPLSKLVTHALYQPFWKGNPRLEARRYLSIYQEDDSHNETLLTXAKLDFNLLQQVHQK  256

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ELS I+RW KDL     LPFAR R+ E Y W LG YFEPQY F+R   +++I +   +DD
Sbjct  257   ELSEISRWSKDLDFVSKLPFARDRIVESYLWGLGCYFEPQYDFARMTLSKVIGLIVGIDD  316

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL+LFT+A++R+D SA + +PQY+K  Y A+LD  TEMEE +  E  L+ +
Sbjct  317   IYDVYGTFEELELFTBAVERWDISAMDRLPQYMKVCYQAMLDSYTEMEEKLRNEGNLYRI  376

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK  +R Y +E  WF+ K+ P  +EYL  +L +S + + A T  +GMGDI+TK+
Sbjct  377   HYAREAMKVLVRGYMREAKWFHRKYTPTLDEYLSAALDTSSFSL-AVTSFIGMGDIVTKD  435

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
              LDWV ++P  +KA   I RL +D+  H+FEQ+RGHVASAVECYMK Y+V+++EA + + 
Sbjct  436   SLDWVFNDPKILKAASLIGRLKNDIKSHQFEQKRGHVASAVECYMKQYDVAEEEATLGLS  495

Query  543   KLISKAWKDINQECLH-PLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
             K ++ AWKDIN+  LH    +PM +LLR+LNL R + ++YK  D +T +    K ++ + 
Sbjct  496   KQVNNAWKDINEALLHQTTTIPMPLLLRILNLTRVVEVLYKHGDAFTNTGTFLKDIVVSL  555

Query  366   LVQPV  352
              V+PV
Sbjct  556   FVEPV  560



>ref|XP_006592520.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Glycine 
max]
Length=579

 Score =   526 bits (1356),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 265/556 (48%), Positives = 370/556 (67%), Gaps = 20/556 (4%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEI-----------DPSEEREVQQLKEEVRKVLIAAPP  1819
             R +  + P+VWGDYFL Y     ++           D S  ++ Q  KEEVRK+LIA   
Sbjct  23    RNTANFSPSVWGDYFLYYVPSSVDLLMYTPGRNHMEDDSHIKQAQLTKEEVRKMLIAPID  82

Query  1818  ASLE-KLELVDKIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFR  1651
              +   KLE +D +QRLGV YHFE+EI  ++  I++     +N I  DD+  L  V+L FR
Sbjct  83    NNFYFKLEFIDSVQRLGVSYHFEHEIDGALHQIYNISTKDNNIITHDDD--LCHVALLFR  140

Query  1650  LLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTA  1471
             LLRQ+G+HIS  VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F  
Sbjct  141   LLRQQGYHISSNVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFAL  200

Query  1470  SHL-ESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLD  1294
               L +S+   L+    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLD
Sbjct  201   VQLTKSLTTQLSPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLD  260

Query  1293  FNLLQKVHQRELSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITT  1117
             FN+LQ++HQ+E++ +TRWW K+L V   LPF R R+AECYFWILG+YFEPQY  +RRITT
Sbjct  261   FNMLQELHQKEVNNVTRWWIKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITT  320

Query  1116  QIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEE  937
             ++I + SV+DD+YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE
Sbjct  321   KVIALCSVIDDMYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEE  380

Query  936   VMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTC  757
              M K+ K++ + Y   EMK+ I+ +  E  W +  H P  EEY++V  VSS Y M+ T C
Sbjct  381   EMRKQGKVYCIKYAKKEMKRLIKAHMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITIC  440

Query  756   LVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYN  577
              VGM D  T+EVL W TS+P+ + A   ICRLMDD++G+EFEQER HVAS++E YMK +N
Sbjct  441   FVGMKD-TTEEVLIWATSDPIIIGAASIICRLMDDIVGNEFEQERRHVASSIESYMKQHN  499

Query  576   VSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQ  397
              S+Q+A  ++ +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT + 
Sbjct  500   TSRQDAINKLLEMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAG  559

Query  396   VKFKSLITTTLVQPVT  349
                K  I T LV  ++
Sbjct  560   GLMKDYIKTLLVNKMS  575



>gb|AEM23830.1| sesquiterpene synthase [Solanum habrochaites]
Length=540

 Score =   525 bits (1352),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 255/540 (47%), Positives = 364/540 (67%), Gaps = 5/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HPTVWGD+FLAY + L+  +  EE+E +  K EVRK+L+ +P  SL+KLEL++ 
Sbjct  2     RRSDNHHPTVWGDHFLAY-ANLSGANEWEEKEHEDQKGEVRKMLVLSPSKSLQKLELINT  60

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+ S+  I++ Y+  I     ++L+VV+L FRLLRQ+G+++S  VF 
Sbjct  61    IQLLGVSYHFEHEIEESLSEIYNGYEEWIGKS--HDLHVVALSFRLLRQQGYYVSSDVFR  118

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G +  +L  D  G+LSLYEA+   VH E  LDEA+ FT +HL  +LP L+   +
Sbjct  119   KFTDDQGNYNKALVNDTHGLLSLYEAAQFRVHDEEILDEAINFTTTHLNLLLPKLSNSLS  178

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTH-NKVLLRFAKLDFNLLQKVHQRELSGI  1249
              +VS+ALK PI +T+ R   ++Y+  Y+++++  +++L+ FAKLDFN+LQK+++RE+  I
Sbjct  179   MQVSYALKYPINKTMARAATRKYISFYQEEKSSCDQLLINFAKLDFNILQKMYKREMCDI  238

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWWK+L +   L FAR R+ E YFW LGVYFEPQY  +R I T+++C  S+ DD+YD Y
Sbjct  239   TRWWKELDLVNELGFARDRVVELYFWSLGVYFEPQYKVARNILTKVLCFVSITDDIYDTY  298

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT  EL L TNAI+R +  A   +  Y+K  Y A+L    E+E+ + KENK F V++ I 
Sbjct  299   GTLHELTLLTNAIERRNIDAIENLTSYMKLFYTALLHFYDEVEKELEKENKSFRVNFAIS  358

Query  888   EMKKQIRTYYQEFMWFYTKHVPPF-EEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
             EMKK +R Y+QE  W++   VP   EEY+K  + SS    +AT   +GMGD  TKE  +W
Sbjct  359   EMKKLVRAYFQEAKWYHGNTVPKMEEEYMKNGIQSSASPTLATASWLGMGDEATKEAFEW  418

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             +++EP  + A+ +I RL++D++ HE E ERG VAS++ECYMK Y  +K+EAY+EI K+I 
Sbjct  419   ISTEPPILVASSNIARLLNDIVSHEREIERGDVASSIECYMKEYGATKEEAYMEIRKIIE  478

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
               WKD+N+ CL P  VP  +L+ VLNL R    +YKD D YTFS+   K +I   L  P+
Sbjct  479   NNWKDLNRGCLKPTTVPRVLLMPVLNLTRVAEFVYKDEDAYTFSKNNLKDVIFMVLDDPI  538



>ref|XP_006473871.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=547

 Score =   525 bits (1352),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 253/547 (46%), Positives = 367/547 (67%), Gaps = 15/547 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR+  YHP +WGD F+ Y+S+      ++ +E+++LKEEVR+ L+     SL +L+L+D 
Sbjct  9     RRTANYHPDIWGDRFINYNSEDEIYHGAQSQEIEELKEEVRRELLGCSADSLTQLKLIDA  68

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             I RLGV Y FE E++ ++Q++ D Y N     ++++ Y V+LRFRLLRQ G+ +SC +F 
Sbjct  69    ILRLGVGYQFERELEEALQNLCDAYSNNFYNIEDDDPYHVALRFRLLRQRGYKVSCDIFN  128

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             +F D  G FK+SL  DV GMLSLYEA++LGVHGE  LDEA+ FT +HL+S +       A
Sbjct  129   QFKDGKGNFKESLKTDVSGMLSLYEAAHLGVHGEDILDEAIAFTTAHLQSSM-------A  181

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQT--HNKVLLRFAKLDFNLLQKVHQRELSG  1252
              +V HAL+ P+ + +PR+ A+ ++  + QD    HNK LL+ AKLDFN +Q +H+ ELS 
Sbjct  182   PQVIHALRQPLHKGMPRLEARSFIS-FSQDHEPLHNKALLKLAKLDFNHVQSLHKIELSE  240

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             I+RWWKDL     LPFAR R+ E YFWI+GVYFEP+Y  +R++  +I+ + S++DD+YDV
Sbjct  241   ISRWWKDLNFAGKLPFARDRVVESYFWIVGVYFEPEYSLARKLLAKILSMTSIIDDIYDV  300

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             + T  EL LFT AI R+D S  +++P+Y++  Y A+LD+  E+EE +A +   + V Y  
Sbjct  301   FATPKELDLFTAAIDRWDMSCMDQLPEYMQIFYEALLDLYKEIEEELATKGWSYRVHYAK  360

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              EMK  +  Y+ E  WF+  +VP  EEY++VSLV+S Y M+     +GM  ++TKE  DW
Sbjct  361   EEMKILVHGYHDESKWFHNNYVPTMEEYMRVSLVTSAYSMLTAASFLGMDSVVTKEAFDW  420

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMK-----GYNVSKQEAYVEI  547
             V+ +P  ++A+  I RL++D+  H+FEQERGH ASA+ECYMK     G +V++QE + E+
Sbjct  421   VSEKPRIIRASTIIGRLVNDIKSHKFEQERGHPASAIECYMKEKEREGVSVTQQEVHEEL  480

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K +  AWKDIN+ECL P  VP  +L+RVLNL+R I +IYK+ D YT      K  I + 
Sbjct  481   YKKVGDAWKDINEECLMPTEVPRALLMRVLNLSRVIDIIYKEADDYTHVGQVMKDNIASV  540

Query  366   LVQPVTI  346
             L+ PV I
Sbjct  541   LIHPVAI  547



>ref|XP_008371258.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Malus domestica]
Length=561

 Score =   525 bits (1353),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 265/545 (49%), Positives = 371/545 (68%), Gaps = 9/545 (2%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS-LEKLELV  1792
              RRS  + P  WGDYFL+Y S   E +   E+ VQ+LKE V+++++A  P    +KL+LV
Sbjct  18    NRRSANFPPNFWGDYFLSYAS--VEKNIEAEKLVQELKENVKRMILAPTPCKHSDKLDLV  75

Query  1791  DKIQRLGVDYHFENEIQASIQHIF-DNYDNCIKG---DDENNLYVVSLRFRLLRQEGHHI  1624
             D IQRLGV YHFE+EI   +Q I  D+YD   +    DD++NL+  +L FRLLRQ+G+ I
Sbjct  76    DTIQRLGVSYHFEDEIDEVLQQIRKDSYDGSHQHQGRDDDHNLHADALYFRLLRQQGYDI  135

Query  1623  SCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG  1444
             SC +F KF D +GKFK+SL  DV G+LSLYEA+ L VHGE  L+ ALTFT +HL+S+   
Sbjct  136   SCEMFNKFKDDEGKFKESLVNDVIGLLSLYEATQLRVHGEDILEXALTFTTTHLKSVENR  195

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             L+   +  V+HAL  P  +  PR+ A+ Y+ IY++D +HN+ LL  AKLDFNLLQ+VHQ+
Sbjct  196   LSSPLSKLVTHALYQPFWKGNPRLEARRYLSIYQEDDSHNETLLTXAKLDFNLLQQVHQK  255

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ELS I+RW KDL     LPFAR R+ E Y W LG YFEPQY F+R   +++I +   +DD
Sbjct  256   ELSEISRWSKDLDFVSKLPFARDRIVESYLWGLGCYFEPQYDFARMTLSKVIGLIVGIDD  315

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL+LFT+A++R+D SA + +PQY+K  Y A+LD  TEMEE +  E  L+ +
Sbjct  316   IYDVYGTFEELELFTBAVERWDISAMDRLPQYMKVCYQAMLDSYTEMEEKLRNEGNLYRI  375

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK  +R Y +E  WF+ K+ P  +EYL  +L +S + + A T  +GMGDI+TK+
Sbjct  376   HYAREAMKVLVRGYMREAKWFHRKYTPTLDEYLSAALDTSSFSL-AVTSFIGMGDIVTKD  434

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
              LDWV ++P  +KA   I RL +D+  H+FEQ+RGHVASAVECYMK Y+V+++EA + + 
Sbjct  435   SLDWVFNDPKILKAASLIGRLKNDIKSHQFEQKRGHVASAVECYMKQYDVAEEEATLGLS  494

Query  543   KLISKAWKDINQECLH-PLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
             K ++ AWKDIN+  LH    +PM +LLR+LNL R + ++YK  D +T +    K ++ + 
Sbjct  495   KQVNNAWKDINEALLHQTTTIPMPLLLRILNLTRVVEVLYKHGDAFTNTGTFLKDIVVSL  554

Query  366   LVQPV  352
              V+PV
Sbjct  555   FVEPV  559



>gb|AII32473.1| terpene synthase [Populus trichocarpa]
Length=569

 Score =   526 bits (1354),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 259/543 (48%), Positives = 375/543 (69%), Gaps = 5/543 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HP++WGDYF  +    +  D   E+E  +LKEEV+++L A      ++L  +D 
Sbjct  21    RRSANFHPSIWGDYFACHTFN-SMFDDHFEQEFIRLKEEVKEMLYATTNKLSQQLNFIDV  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV Y FE+EI   ++ ++          D ++L +V+LRFRLLRQ+GH++SC VF+
Sbjct  80    IQRLGVSYLFESEIDEMLRDLYYQGSGGAYVHD-HDLQMVALRFRLLRQQGHYVSCDVFK  138

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D +G +K  L  D++GMLSLYEA +L VHGE  L++ALTF  +HL+SI   +     
Sbjct  139   KFKDTEGNYKVCLANDIQGMLSLYEAIHLRVHGEDILEDALTFATTHLKSITTDMCPPPL  198

Query  1425  -AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
               K+ HAL  PI + LP +GAK Y+ IYEQ+ +H++VLL+FAKL+FN LQ +HQ+EL+ +
Sbjct  199   LVKLRHALDQPIHKDLPWLGAKHYISIYEQEASHSEVLLKFAKLNFNFLQNMHQKELADM  258

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             T WWK + + K LPFAR RL ECYFWILGV FEPQY F+R I T++I + SV+DD+YDVY
Sbjct  259   TMWWKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFARIIMTKVIAMTSVMDDVYDVY  318

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL LFT+AI+R+D S  + +P+Y+K  Y  + D+  E+E  +A + + + V Y   
Sbjct  319   GTMEELVLFTDAIERWDISNIDHLPEYMKFFYKQLSDVYKEIETELAAQGRSYRVDYAKE  378

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MKKQ++ Y+ E  W +  ++P  +EY+++SL+SS Y ++     VGMGDI+TK+  +W+
Sbjct  379   AMKKQVQAYFVEARWLHENYMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWL  438

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
               +P  VKA   I RLMDD++ H+FEQERGHVASAVECYM  + VS+++AY E+ + + +
Sbjct  439   NKDPKIVKAASLIARLMDDIVSHKFEQERGHVASAVECYMNQHEVSEEQAYDELRRQVVE  498

Query  528   AWKDINQECL-HPLP-VPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             AWKDIN+E L  P   VP+ +L RVLNLAR + ++YKD D YT ++ K ++ IT+ L++P
Sbjct  499   AWKDINEELLIGPEDHVPIPLLTRVLNLARVMDVMYKDGDGYTNAKGKVRNYITSLLIEP  558

Query  354   VTI  346
             V +
Sbjct  559   VQL  561



>gb|AJD19682.1| sesquiterpene synthase Tps1 [Cucumis melo]
Length=570

 Score =   526 bits (1354),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 257/560 (46%), Positives = 382/560 (68%), Gaps = 17/560 (3%)
 Frame = -2

Query  1992  MDVNVNSSGRRSVT-YHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAP  1822
             M  N     +RS+  +HP +W ++FL++  D  L ++D   +   ++LKEE+R ++IA  
Sbjct  13    MKTNDIPDVKRSLAIFHPNIWKEHFLSFTFDDAL-KVDEGMKERTEKLKEEIRMMMIAYV  71

Query  1821  PASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNC-------IKGDDENNLYVVS  1663
                L KL LVD IQRLGV YHFE+EI   ++HI+ +Y+N        I+G+D   L++ +
Sbjct  72    ENQLVKLNLVDSIQRLGVSYHFEDEIDEFLKHIYVSYNNSLLLSNKDIEGED---LHITA  128

Query  1662  LRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEAL  1483
             L FRLLRQ+G+ ISC +F KF+D +GKFK+SL +D  G+LSLYEAS++ VHGE  L+EAL
Sbjct  129   LLFRLLRQQGYRISCDIFLKFMDDNGKFKESLVEDERGILSLYEASHMMVHGEALLEEAL  188

Query  1482  TFTASHLESIL---PGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLL  1312
              FT +HL++ +     +N   A++VS+ALKLPIR+ +PR+ A+EY++IY+Q  +HN+ LL
Sbjct  189   EFTTTHLQTYVHRYSNINPSFASEVSNALKLPIRKGVPRMKAREYLEIYQQHPSHNETLL  248

Query  1311  RFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFS  1132
              F+KLDFN LQK+HQ+EL+ I RWWKDL V    PFAR ++ ECYFWIL +YFEP++ F 
Sbjct  249   TFSKLDFNALQKLHQKELAEICRWWKDLNVSTNFPFARDQIVECYFWILSIYFEPRFKFG  308

Query  1131  RRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDIT  952
             R+I T++I + S++DD+YD YGT +ELQ+FT AI+R+D S  N +P+Y+K  Y  +LD+ 
Sbjct  309   RKILTKVIAMTSIMDDIYDAYGTFEELQVFTLAIKRWDMSMINLLPKYMKVYYTTLLDLF  368

Query  951   TEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMM  772
              E+++ +  +   +   +    MK+Q  +Y++E  W    + P +EEY++V+L SS Y +
Sbjct  369   EEIDKEIVNDETSYRFHFAKEAMKRQAESYFKEAEWLNKNYKPKYEEYMEVALASSGYEL  428

Query  771   IATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECY  592
             ++T   V MGDI TKE+ DW+   P  +KA+ +I RLMDD++ ++FE+ER HV SAVECY
Sbjct  429   LSTISFVCMGDIATKEIFDWLFDCPKILKASTTISRLMDDVVSYKFEKEREHVVSAVECY  488

Query  591   MKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDI  412
             M  Y  S++E   ++ K +  AWK IN+ CLHP+ VP+  L+ VLNL R + L+Y   D 
Sbjct  489   MNNYGCSEEETCADLLKQVEDAWKTINKCCLHPMTVPIPFLICVLNLTRVMALLYSGEDG  548

Query  411   YTFSQVKFKSLITTTLVQPV  352
             YT S+ + K LI + L+ P+
Sbjct  549   YTNSKGRTKLLIQSLLIDPL  568



>ref|XP_010042263.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
Length=567

 Score =   525 bits (1352),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 255/544 (47%), Positives = 366/544 (67%), Gaps = 6/544 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEID----PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  YHP+VWGDYFL YDS    +        E ++++LK EV+K+LI      L KL 
Sbjct  22    RRSAGYHPSVWGDYFLKYDSPSNSVKFKFLGRVEGQIEELKGEVKKMLIDVVDKPLPKLH  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE-NNLYVVSLRFRLLRQEGHHIS  1621
             L+D+IQRLG++YHFE E+   ++ I  +Y      D + ++L++V+L FRLLRQ G++IS
Sbjct  82    LIDQIQRLGIEYHFEREVDEQLEQIHKSYSRLDHEDFKVDDLHMVALIFRLLRQHGYNIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
               +F+KF D  G F++SL  DV G+LSLYEA +L  HG++ LDEAL F  +HLESI    
Sbjct  142   SEIFDKFKDSKGNFRESLISDVRGLLSLYEACHLRCHGDSILDEALPFATTHLESINESK  201

Query  1440  NELAAAK-VSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
                + AK VSHALK P+R+ LPR+ A  Y+ +Y+++ +H++VLL  AKLDFNLLQ+ HQ+
Sbjct  202   VSTSLAKQVSHALKQPLRKGLPRLEASRYIPLYQEEPSHDEVLLTLAKLDFNLLQEQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  ITRWWK++ VP+  PFAR R+ E +FW  G+YFEP++  +R I T++I + S++DD
Sbjct  262   ELGKITRWWKNIDVPRKFPFARDRIVELFFWTTGIYFEPEFAMAREILTKVISLASIMDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL L   AIQ++D  A + +P+Y++  +   L +   +   +A + + + +
Sbjct  322   IYDVYGTLEELALLNEAIQKWDFDAMDGLPEYMQAYFKEFLQLYEYIGNQLAAKGRSYRL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MKK +  Y+QE  WF+T ++P  EEY+ + L+++ Y M++TT LVGMGD++T+ 
Sbjct  382   IYAKEVMKKLVGAYFQEAKWFHTNYIPTLEEYMPLQLITTGYGMLSTTSLVGMGDVVTEH  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W  S+  +VKAT +ICRLMDD+  HEFEQ+RGHV SAVE  MK   VS+QEA  E++
Sbjct  442   VLKWSVSDCKSVKATQTICRLMDDVSSHEFEQKRGHVVSAVELLMKYRGVSEQEAAEELQ  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD N+E L P  VPM +L R+LN +R I ++Y D D YT S  K K  +T+  
Sbjct  502   KGVIDAWKDTNEEFLRPTAVPMSILTRMLNFSRVIDVLYSDGDNYTHSNTKLKDYVTSLF  561

Query  363   VQPV  352
             V P+
Sbjct  562   VNPL  565



>ref|XP_009757760.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009757761.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Nicotiana 
sylvestris]
Length=553

 Score =   524 bits (1350),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 257/532 (48%), Positives = 362/532 (68%), Gaps = 3/532 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR   +HPTVWGD+FLAY S L+  +  E+++ + LKEEVRK+L+ AP  SL+ L+L++ 
Sbjct  12    RRCGNHHPTVWGDHFLAY-SHLSGANEWEKKQHEHLKEEVRKMLVMAPSKSLQNLDLINA  70

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQ LGV YHFE+EI+ S+  I+  YD      DE +L+ V+LRFRLLRQ G+++S  VF 
Sbjct  71    IQCLGVAYHFEHEIEESLAFIYSCYDQLNGEADETDLHTVALRFRLLRQHGYYVSSDVFR  130

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D  G +K +L  DV+G+LSLYEA+   VH E  L EA+ FT +HL+ +LP L+   A
Sbjct  131   KFTDDQGNYKKALVGDVQGLLSLYEATQFRVHSEEILGEAVNFTTTHLKLLLPTLSNSFA  190

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              K+S+ALK PI  T+     ++Y+  Y++D+ H+ VLL  AKLD+N+LQK+++ EL  IT
Sbjct  191   MKISNALKYPINCTMVTAATRKYISFYQEDKAHDDVLLNLAKLDYNILQKMYKTELCDIT  250

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWK+L   K LPF R R+ E YFW L VYFEPQY   R I T+++C  S+ DD+Y  YG
Sbjct  251   RWWKELDFTKALPFTRDRVVELYFWSLSVYFEPQYKVGRNILTKVLCFISIADDIYGTYG  310

Query  1065  TQDELQLFTNAIQRFDT-SASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             T DEL L TNAI+R++    S ++P Y+K  YLA+LD+ +E+E+ +AKENK F ++Y+I 
Sbjct  311   TIDELTLLTNAIERWNIDDISEKLPSYMKLYYLALLDVYSEIEKELAKENKSFQLNYSIA  370

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             EMKK I+ Y+QE  W++  +VP  E+Y+K  + SS    + T   +G+G+  TKE  DW+
Sbjct  371   EMKKLIKAYFQEAKWYHGNNVPTMEQYVKNGIRSSTIPCLVTLSWLGIGNEATKEAHDWL  430

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              SEP  + A+  I RL +D++ HE EQE G + S V CYM  Y V+K+EAY+EI K++  
Sbjct  431   ASEPPILVASSIIARLSNDIVSHEREQEGGDI-SGVVCYMNEYGVTKEEAYMEIRKIMDN  489

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             +WKD+N+ECL P+ +P  +L+ VLNLAR     YKD D YTFS+   K +I+
Sbjct  490   SWKDLNRECLKPIVIPRVLLMPVLNLARMSEFSYKDEDSYTFSKNNLKDIIS  541



>ref|XP_009338866.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=555

 Score =   524 bits (1350),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 258/542 (48%), Positives = 374/542 (69%), Gaps = 12/542 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             + S T+ P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR++L+ +P    +KL L+D 
Sbjct  24    KPSATFSPSIWGDHFLSYAS--LEVDAELEQHVQELKEEVRRMLMTSPENVSQKLNLIDD  81

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHF NEI+  +Q I ++        D ++L   +LRFRLLRQ+G+++SC +F 
Sbjct  82    IQRLGVSYHFGNEIEEILQKIHES------SYDLDDLCTAALRFRLLRQQGYNVSCDLFN  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D +G FK+SL  DV G+LSLYEA++L +HGE  LDEAL FT ++LES    L+   A
Sbjct  136   KFKDGNGNFKESLVDDVVGLLSLYEATHLRIHGEEILDEALNFTTTNLESATFRLSPPLA  195

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
               V+HAL  P+R+ LPRV A+ Y+ +Y++  ++ N+ LL FAKLDFN LQ+VHQ+ELS I
Sbjct  196   KAVTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELSKI  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             TRWWKDL VP  LPF+R RL E YF + + V+F+PQY F+RR + ++  I S++DD+Y+ 
Sbjct  256   TRWWKDLDVPNKLPFSRDRLVEVYFCFSMSVHFQPQYSFARRTSCKVAAIVSIIDDIYE-  314

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             Y T +EL+LFT AI+R+D SA +++ +Y+K  Y A+LD+ +E++E +A + KL  + +  
Sbjct  315   YDTNEELKLFTEAIERWDVSAMDQLTEYMKVCYRALLDVYSEIQEKLAHDGKLHQIHHAR  374

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MKKQ+R Y+ E   F  KH+P  +EY+ VSLV+   +++ TT  VGM +  T +  DW
Sbjct  375   EAMKKQVRGYFDEAKLFRQKHMPSLDEYMSVSLVTGGCLLLITTSFVGMAEA-TIDSFDW  433

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             + + P  VKAT +I RLMDD++ H+FEQE+ H    V CYMK Y  +++EA  E++  ++
Sbjct  434   LLTSPPVVKATSTIIRLMDDIVEHKFEQEKEHFIGVVNCYMKKYGATEEEAITELQGQVN  493

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKDIN+ CLHP  VPM +L+R LN AR + ++YK  D YT ++   K LI +TLV+PV
Sbjct  494   NAWKDINEACLHPTAVPMPLLIRFLNFARVMDVVYKHEDGYTNAKGVVKDLIISTLVEPV  553

Query  351   TI  346
              +
Sbjct  554   AL  555



>ref|XP_010241001.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score =   524 bits (1350),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 250/542 (46%), Positives = 362/542 (67%), Gaps = 4/542 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R +  +HP++WGD F+ Y     +++ S  ++V++LKEEVR +L  +    LE L L+D 
Sbjct  25    RHTTNFHPSIWGDRFITYTCDNMKLE-SYNQQVEELKEEVRSILRNSANKPLEMLSLIDA  83

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLG+ YHFE EI   ++ IFD +      D ++NL  V+L FRLLRQ G++I C VF+
Sbjct  84    VQRLGLGYHFEREINKMLEQIFDAHI-VYFNDMDDNLNAVALLFRLLRQHGYNIPCDVFK  142

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG--LNEL  1432
             KF D+DGK ++SL +D++GMLSLYEA+YLG  GE  LDEAL FT +HL+S +     +  
Sbjct  143   KFKDEDGKLRESLARDIQGMLSLYEAAYLGKRGEEVLDEALAFTTAHLKSTVATDTTSPT  202

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
                +V HAL+ P+ R +P++ A+ Y+  YE+D++ N+VLL+ AKLDFN  Q ++  ELS 
Sbjct  203   LVKQVKHALEQPLHRGIPKIEARHYISFYEEDKSRNQVLLKLAKLDFNRTQLLYLNELSQ  262

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             ++RWWK++      P+AR RLAECYFW  G   EPQY   R+   +I+ I ++LDD YD 
Sbjct  263   VSRWWKNIDFTSKTPYARDRLAECYFWSAGALPEPQYSLGRKTLAKIVAINTILDDTYDA  322

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +ELQL T+AI+R+D + ++++P+Y+K IY+ +LDI  E+EE M KE + F VSY  
Sbjct  323   YGTFEELQLLTDAIRRWDANETDKLPEYMKVIYVTLLDIYNEIEEEMRKEGRCFCVSYAK  382

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK  I  Y  E  W    H+P FEE+ K+ L++S Y+M+       MG++ TKEV DW
Sbjct  383   EAMKDLIEAYQIEATWLKEGHIPTFEEFSKLGLITSTYIMMTNVIFACMGEMATKEVFDW  442

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             ++  P AVK++C I R  DD++ +EFEQERGHV SA+ECYMK Y VS++EA  E+ K+++
Sbjct  443   LSKTPDAVKSSCIIGRFSDDIMTNEFEQERGHVCSAIECYMKQYGVSREEANNELRKIVT  502

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             KAWK +N+EC+ P   PM +L+ V+NLAR I ++YK  D +T      K+ I   L+ P+
Sbjct  503   KAWKVLNEECITPTAAPMPLLIPVVNLARLIEVVYKHGDAFTNVTTGLKTHIKLLLIDPI  562

Query  351   TI  346
             TI
Sbjct  563   TI  564



>gb|AGL98420.1| germacrene-D synthase [Lavandula angustifolia]
Length=549

 Score =   523 bits (1348),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/542 (49%), Positives = 369/542 (68%), Gaps = 15/542 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HPTVWGDYFLAY+S  TEI  +E  E  + KE V+K+L  AP    +K++L+D 
Sbjct  21    RRSAKFHPTVWGDYFLAYNSDNTEITAAEHEEHAKQKEMVKKLLTLAPNDPTDKMQLIDA  80

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLG+ YHFE EIQ  +Q I  N+    K D   +L+ V+LRFRLLRQ G++++C VF 
Sbjct  81    IQRLGLQYHFEKEIQEILQSIHANF----KAD--KDLHTVALRFRLLRQHGYNVACDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
              FL+K+G F +S+T D EG+LSLYEA+YLG HGE  LD+A+ F + HL+S LP ++ ++ 
Sbjct  135   NFLNKEGDFMESITNDFEGLLSLYEAAYLGTHGEEILDKAIEFCSFHLQSSLPQISNVSL  194

Query  1425  AK-VSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             +K V  AL +P  ++L R GA++++ IYE+D++H KVLL  AKLDFN++QK+HQ+ELS +
Sbjct  195   SKRVEEALYIPTHKSLTRFGARKFIPIYEEDESHKKVLLNLAKLDFNIVQKIHQKELSDL  254

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             TRWW  L VPK +P++R RL E +FWI+GVYFEPQ+  +RRI  + I + S++DD Y+ +
Sbjct  255   TRWWTKLEVPKNMPYSRDRLVELFFWIVGVYFEPQFTTARRILVKAISMASLIDDTYE-H  313

Query  1068  GTQDELQLFTNAIQRFDTSAS-NEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
              T DEL++ T+ I+R+DT+A   + P Y +  Y  + D T    E   +E + + V Y  
Sbjct  314   ATLDELKVLTDVIERWDTNAVIKDWPPYTQMCYKYLFD-TYAEIEDEVEERESYRVQYAK  372

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
              EM+K +R Y+ E  W Y  ++P +EEY+KVS V+  YMM++TT LVGMGD++TK+  DW
Sbjct  373   KEMQKLVRAYFDEAKWLYKNYLPTWEEYMKVSTVTGAYMMLSTTSLVGMGDLVTKQDFDW  432

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V  EPL V+A+  I RLMDD++G E EQ+     S   CYMK Y VSK+EA  E+ K + 
Sbjct  433   VVREPLIVRASSVISRLMDDLVGDEDEQK----PSGALCYMKQYGVSKEEACAEVRKHVK  488

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWKD+NQECL P P  M+VL RV+NL R I L+Y  +D Y  + +  K  +    V+P+
Sbjct  489   NAWKDMNQECLEPRPASMQVLTRVVNLGRVINLLYTGDDWYG-NPLGSKEWVKMVFVEPL  547

Query  351   TI  346
             TI
Sbjct  548   TI  549



>gb|KGN56189.1| hypothetical protein Csa_3G097040 [Cucumis sativus]
Length=567

 Score =   524 bits (1350),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 253/553 (46%), Positives = 377/553 (68%), Gaps = 10/553 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL  1810
             ++  + R    +HPT+W ++FL++  D  L ++D   +  +++LKEE+R ++IA+    L
Sbjct  14    DIYDTKRSLANFHPTIWKEHFLSFTFDDAL-KVDGGMKERIEKLKEEIRMMVIASVQNPL  72

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCI----KGDDENNLYVVSLRFRLLR  1642
              KL LVD IQRLGV YHFE+EI+   +HI+ +Y+N +        +++L++ +L FRLLR
Sbjct  73    VKLNLVDSIQRLGVSYHFEDEIEQFSEHIYVSYNNSLLFSSNDSQDDDLHISALLFRLLR  132

Query  1641  QEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL  1462
             Q G+ ISC +F KF+D +GKFK+SL +D  G+LSLYEAS++  HGE  L+EAL FT +HL
Sbjct  133   QHGYRISCDIFLKFMDNNGKFKESLVEDERGILSLYEASHMRGHGEALLEEALEFTTTHL  192

Query  1461  ES---ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDF  1291
             ++   +   +N   A++VS+ALKLPIR+ +PRV A+EY +IY+Q  +HN+ LL F+KLDF
Sbjct  193   KAYIHLYSNINPNFASEVSNALKLPIRKCVPRVKAREYFEIYQQQPSHNETLLTFSKLDF  252

Query  1290  NLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             N+LQK+HQ+E++ I RWWKDL V    PFAR R+ ECYFWIL +YFEP + F R+I T++
Sbjct  253   NILQKLHQKEIAEICRWWKDLNVSTNFPFARDRIVECYFWILSIYFEPYFKFGRKILTKV  312

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
             I + S++DD+YD YGT +ELQLFT AI+R+D S  N +PQY+K  Y  +LD+  EM++ +
Sbjct  313   IAMTSIMDDIYDAYGTFEELQLFTLAIKRWDMSMVNLLPQYMKVHYTTLLDLFEEMDKGI  372

Query  930   AKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLV  751
               +   +   +    MK+Q  +Y++E  W    + P + EY++V+L SS Y +++T   V
Sbjct  373   VNDGISYRSCFAKEAMKRQAESYFKEAEWLNKNYKPKYGEYMEVALASSGYELLSTISFV  432

Query  750   GMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVS  571
              MGDI TKEV +W+   P  +KA+ +I RLMDD++ ++FE+ER H+ SAVECYM  +  S
Sbjct  433   CMGDIATKEVFEWLFDCPKILKASTTISRLMDDVVSYKFEKEREHIVSAVECYMSNHGRS  492

Query  570   KQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVK  391
             + E   E+ K +  AWK IN+ CLHP+ VPM  L+ +LNL R + L+Y   D YT S+ +
Sbjct  493   EDETCAELLKQVEDAWKTINECCLHPMNVPMPFLICLLNLTRVMALLYSHEDGYTNSKGR  552

Query  390   FKSLITTTLVQPV  352
              K LI + L+ P+
Sbjct  553   TKLLIQSLLIDPL  565



>gb|KCW52014.1| hypothetical protein EUGRSUZ_J01453 [Eucalyptus grandis]
Length=569

 Score =   524 bits (1350),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 261/545 (48%), Positives = 361/545 (66%), Gaps = 7/545 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSE----EREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRSV YHP++W DY   Y S    +D       E+E+Q+LK+EV+ +L A       K +
Sbjct  22    RRSVDYHPSLWEDYLAKYSSPSNSMDDGHDQQAEQEIQKLKDEVKWMLCAHADKPSLKRD  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGD-DENNLYVVSLRFRLLRQEGHHIS  1621
             ++D+IQRLG+ YHF +EI   +  + + Y     GD D ++LY V+L FRLLRQ+G+ IS
Sbjct  82    MIDQIQRLGIAYHFASEIDNVLIKLSETYFVSNNGDHDNDDLYTVALLFRLLRQQGYRIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI-LPG  1444
             C +F KF D  GKF +    D+ G+LSLYEAS+L VHGE  LD+AL+F+  HLESI    
Sbjct  142   CDIFNKFKDTSGKFGEKHASDIRGLLSLYEASHLSVHGEDVLDQALSFSLKHLESIDKEQ  201

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             L+   AA+V HALK  I R +PR+ A++Y+ IYE +  HNKVLL  AKLDFN LQK HQ+
Sbjct  202   LSPPLAAQVQHALKQTIHRGVPRLEARQYISIYEAEPLHNKVLLSLAKLDFNHLQKQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  + RWW  L     LPFAR RL E YFWILGV+FEP+    RR+ T++I + SVLDD
Sbjct  262   ELFDLARWWMGLDFKNKLPFARDRLVEGYFWILGVHFEPELALVRRMMTKVIAMTSVLDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL+LFT A+QR+D    NE+P+Y++  Y A++D+  E+ E +A   + + +
Sbjct  322   IYDVYGTYEELELFTRAVQRWDIDCINELPEYMQVFYKALIDVYVEIGEKLASAGRSYGL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK+Q R+Y+ E  W + +H P  +EY+ V+LVSS Y ++A T  VGM DI+TK+
Sbjct  382   DYAKEAMKRQDRSYFAEAKWLHRQHKPTMDEYMSVALVSSGYHLLAITSFVGMQDIVTKD  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
              LDW+ ++P  +KA+  ICRLMDD+  H+FEQ R H  SAV+CYMK YNV++QEA  ++ 
Sbjct  442   DLDWLFNDPKILKASTVICRLMDDLATHKFEQGREHADSAVQCYMKQYNVTEQEAENDLR  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKSLITTT  367
             K +  AWKD+N+ECL P  V   +L+ +LNL R + ++YKD  D YT   +  K  I + 
Sbjct  502   KQVDDAWKDLNEECLCPTAVAKPLLMGILNLTRVMDVLYKDGGDHYTNPHIMLKDYIRSV  561

Query  366   LVQPV  352
             L+ PV
Sbjct  562   LMDPV  566



>ref|XP_003614996.1| (+)-delta-cadinene synthase isozyme A [Medicago truncatula]
 gb|AES97954.1| sesquiterpene synthase [Medicago truncatula]
Length=553

 Score =   523 bits (1348),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 367/549 (67%), Gaps = 6/549 (1%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             N ++  R    +HP VWG+YF+ Y S+  E+D +   ++  LK+EVR +L++     L K
Sbjct  8     NPDAKQRNLAEFHPNVWGEYFIQYASESMELDQNIAAQIVTLKDEVRNMLLSKTEMPLAK  67

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD---ENNLYVVSLRFRLLRQEG  1633
             L L+D I RLGV YHFENEI   +QHI   +++C++  +   +++LY +++ FR+LRQ+G
Sbjct  68    LTLIDSICRLGVSYHFENEIDEVLQHI---HNSCVENGEIILKDSLYSLAVLFRVLRQQG  124

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
              ++S  VF KF D++G F   LT DVEGMLSLYEAS++ +HGE  L+EAL FT++HLESI
Sbjct  125   FYVSPNVFTKFKDEEGNFNKGLTTDVEGMLSLYEASHMIIHGEEILEEALAFTSTHLESI  184

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
                ++   AA+V +AL+  + + LPR+ A+ Y+ IYEQ+ +H+++LL  AKLDFNLLQ +
Sbjct  185   ATQMSHFLAAQVKYALRQALHKNLPRLEARRYISIYEQNPSHDEILLTLAKLDFNLLQSL  244

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQ+E   I +WWK+L     LP+ARHR+ EC FWIL  YFEPQY  +R++ T++I + S+
Sbjct  245   HQKEFGNICKWWKELDFSSKLPYARHRIVECCFWILTAYFEPQYSLARKLATKVIAMLSI  304

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD YD YGT DEL+LFT AI+R+D S  +++P Y+K IY  + +I  E+E+ M KE KL
Sbjct  305   IDDTYDAYGTIDELELFTKAIERWDISILDDLPDYMKLIYGTLWNIFEEIEQEMRKEGKL  364

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             + + Y I E+K  ++ +  E  W   K++P  EEY+  S  S  Y ++  T  +GMG+  
Sbjct  365   YTMKYFIKELKVAVQGFITEARWLNEKYIPTIEEYMLKSTKSCAYTLLILTSYIGMGENT  424

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             T+ + +WVT++P  V A  ++CRLMD+++  EFE +R HV S ++CYMK Y++S++ A  
Sbjct  425   TENIFNWVTNDPKIVSAAANLCRLMDEIVSSEFEHKREHVCSLLDCYMKQYDMSREAAIQ  484

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E  K I+ AWKDIN+ECL P  VPM  L+R LN +R + + YKD D YT S+   K  + 
Sbjct  485   ECHKGIAIAWKDINEECLRPTKVPMPFLIRALNFSRFMDVNYKDKDNYTHSEGLMKKYVK  544

Query  372   TTLVQPVTI  346
               LV+ V I
Sbjct  545   EVLVESVPI  553



>ref|XP_010032599.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW52013.1| hypothetical protein EUGRSUZ_J01451 [Eucalyptus grandis]
Length=569

 Score =   524 bits (1349),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 262/545 (48%), Positives = 361/545 (66%), Gaps = 7/545 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSE----EREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRSV YHP++W DY   Y S    +D       E+E+Q+LK+EV+++L A       KL+
Sbjct  22    RRSVDYHPSLWEDYLAKYSSPSNSMDDGHDQQAEQEIQKLKDEVKRMLCAHADKPSLKLD  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGD-DENNLYVVSLRFRLLRQEGHHIS  1621
             ++D+IQRLG+ YHF +EI   ++ +   Y     G+ D ++LY V+L FRLLRQ+G  IS
Sbjct  82    MIDQIQRLGIAYHFASEIDNVLKKLSQTYFVSNNGNYDNDDLYTVALLFRLLRQQGCRIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI-LPG  1444
             C +F KF D  GKF +    DV G+LSLYEAS+L VHGE  LD+AL+F+  HLESI    
Sbjct  142   CDIFNKFKDTSGKFTEKHASDVRGLLSLYEASHLSVHGEDVLDQALSFSLKHLESIDKEQ  201

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             L+   AA+V HALK  IRR +PR+ A+ Y+ +YE +  HNKVLL  AKLDFN LQK HQ 
Sbjct  202   LSPPLAAQVQHALKQTIRRGVPRLEARRYISMYEAEPLHNKVLLSLAKLDFNHLQKQHQE  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  + RWW  L     LPFAR RL E YFWILGV+FEP+    RR+ T++I + SVLDD
Sbjct  262   ELFDLARWWMGLDFKSKLPFARDRLVEGYFWILGVHFEPELAPVRRMMTKVIAMTSVLDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL+LFT A+QR+D    NE+P+Y++  Y A++D+  E+ E +A   + + +
Sbjct  322   IYDVYGTYEELELFTRAVQRWDIDCINELPEYMQVFYKALIDVYVEIGEKLACTGRSYGL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK+Q R+Y+ E  W + +H P  +EY+ V+LVSS Y ++A T  VGM DI+TK+
Sbjct  382   DYAKEAMKRQARSYFAEAKWLHQQHKPTMDEYMSVALVSSGYPLLAITSFVGMQDIVTKD  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
              LDW+ ++P  +KA+  ICRLMDD+  H+FEQ R H  SAV+CYMK YNV++QEA  ++ 
Sbjct  442   DLDWLFNDPKILKASTVICRLMDDLATHKFEQGREHADSAVQCYMKQYNVTEQEAENDLR  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKSLITTT  367
             K +  AWKD+N+ECL P  V   +L+ +LNL R + ++YKD  D YT   +  K  I + 
Sbjct  502   KQVDDAWKDLNEECLCPTAVAKPLLMGILNLTRVMDVLYKDGGDHYTNPHIMLKDYIRSV  561

Query  366   LVQPV  352
             L+ PV
Sbjct  562   LMDPV  566



>ref|XP_004505471.1| PREDICTED: (-)-germacrene D synthase-like [Cicer arietinum]
Length=563

 Score =   523 bits (1348),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 250/543 (46%), Positives = 373/543 (69%), Gaps = 4/543 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPAS---LEKLEL  1795
             RRS  +HPT+WGD+F+ Y S+  EID    +++  LKE+V K+L+    ++   LE+  L
Sbjct  22    RRSANFHPTIWGDHFIQYVSEPMEIDEIM-KQIVMLKEKVSKMLVLMNESATRPLEEANL  80

Query  1794  VDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             +D IQRLG+ +HFE+EI   +QHI ++Y          +L+ V+L FRLLRQ+G+HI   
Sbjct  81    IDSIQRLGLYHHFEHEIGEVLQHIHNSYVENGAITLNEDLHCVALVFRLLRQQGYHILPD  140

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
             VF+KF ++ G F ++L  DVEGM+SL+E +++ +HGE  LDEA  FT+SHLE + P L+ 
Sbjct  141   VFKKFKNEQGNFNETLFGDVEGMISLFEVTHMRIHGEDILDEAFVFTSSHLEMMTPQLSL  200

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
               AAKV+H+LK P+ + LPR+ A+ Y+  YE+D +H+  LL  AKLDFNLLQK H++E  
Sbjct  201   SLAAKVNHSLKWPLFKNLPRLVARYYISTYEEDPSHDATLLLLAKLDFNLLQKQHKKEAG  260

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              +++WWKDL +    PFAR+R+ E YFW +GVYFEPQY   RRI T+++ + S++DD YD
Sbjct  261   ELSKWWKDLDLETKFPFARNRIIELYFWSMGVYFEPQYSLGRRIMTKVLSLVSIIDDTYD  320

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYT  895
             VYGT +ELQLFT+AI+R+D    + +P+Y+K +Y ++LD+  E+E+ MAKE +     Y 
Sbjct  321   VYGTIEELQLFTDAIERWDIKCMDFLPEYMKCVYNSLLDLYEEIEQEMAKEGRTLSAIYV  380

Query  894   IGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLD  715
               E+ + +++Y+ E  WF +K++P  EEY+   +V+S   ++     +GMG I T+E   
Sbjct  381   KNELIRLVQSYFTEAKWFNSKYIPTVEEYVANGIVTSVNYLLTAISFIGMGSIATQETFR  440

Query  714   WVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLI  535
             W+T+ P  V A+C I RL++D++ +EFEQ+RGHVASA+ECYMK Y VS+++A  EI + +
Sbjct  441   WLTNRPKIVSASCIIGRLVNDLLSNEFEQKRGHVASAIECYMKQYGVSREDAINEISRQV  500

Query  534   SKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             + AWKDIN+  LHP+ VP  +L+RVLNL RAI ++YK+ D YT S    K+ I + ++ P
Sbjct  501   TNAWKDINENLLHPIQVPKPLLIRVLNLTRAIDVMYKEEDGYTHSLRLTKNYIQSIMLNP  560

Query  354   VTI  346
               I
Sbjct  561   CQI  563



>emb|CAN62114.1| hypothetical protein VITISV_032023 [Vitis vinifera]
Length=532

 Score =   522 bits (1345),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 253/539 (47%), Positives = 361/539 (67%), Gaps = 25/539 (5%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    +HP +WGD F+ Y  +       +E++V+ LKEEVR+ L+AA     + L  +D
Sbjct  18    NRPRAKFHPNIWGDLFITYTPEDEVSRACKEKQVEDLKEEVRRELMAAAGNPSQLLNFID  77

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              +QRLGV YHFE EI+ S+QHI+D + +    D  ++LY ++LRFRLLRQ+G++ISCG+F
Sbjct  78    AVQRLGVAYHFEREIEESLQHIYDRFHDA--DDTNDDLYNIALRFRLLRQQGYNISCGIF  135

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              KF D+ G FK+ L  +++GML LYEA++L VHGE  L+EAL FT +HL++ +  L    
Sbjct  136   NKFKDEKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALAFTTTHLKATVESLGYPL  195

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             A +VSHALK PIR+ L R+ A+ Y+ +Y+ + +H+K LL+ AKLDFNL+Q +H+ ELS +
Sbjct  196   AEQVSHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNL  255

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              RWWK+LG    LPFAR RL E YFWI+GVYFEPQY ++ RI T+II + +V+DD+YD Y
Sbjct  256   ARWWKELGFATKLPFARDRLVEGYFWIVGVYFEPQYLWAIRILTKIIVMTTVIDDIYDAY  315

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +E++ FT AI+R+D ++ + +P+Y+K  Y+A+LD+  E+EE M KE   + V Y I 
Sbjct  316   GTLEEIKHFTEAIERWDINSIDHLPEYMKLFYVALLDVYKEIEEEMEKERHQYRVHYAID  375

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MK Q+R Y+ E  WF+ +H+P  EEY++V+L+SS Y ++AT+  +GMG+I++KE  DWV
Sbjct  376   AMKNQVRAYFAEAKWFHEQHIPTMEEYMRVALLSSGYSLLATSSFIGMGEIVSKEAFDWV  435

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
              S+P  ++A+  I R MDDM  H+FEQERGHVAS +ECYMK                   
Sbjct  436   ISDPKIIRASTVIARFMDDMTSHKFEQERGHVASGIECYMKQCG----------------  479

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
                    ECL P  VPM +L RVLNL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  480   -------ECLKPTAVPMPLLTRVLNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  531



>gb|AAU05952.1| beta-caryophyllene synthase [Cucumis sativus]
Length=567

 Score =   523 bits (1347),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 252/553 (46%), Positives = 377/553 (68%), Gaps = 10/553 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL  1810
             ++  + R    +HPT+W ++FL++  D  L ++D   +  +++LKEE+R ++IA+    L
Sbjct  14    DIYDTKRSLANFHPTIWKEHFLSFTFDDAL-KVDGGMKERIEKLKEEIRMMVIASVQNPL  72

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCI----KGDDENNLYVVSLRFRLLR  1642
              KL LVD IQRLGV YHFE+EI   ++H++ +Y+N +        +++L++ +L FRLLR
Sbjct  73    VKLNLVDSIQRLGVSYHFEDEIDQFLEHMYVSYNNSLLFSSNDSQDDDLHISALLFRLLR  132

Query  1641  QEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL  1462
             Q G+ ISC +F KF+D +GKFK+SL +D  G+LSLYEAS++  HGE  L+EAL FT +HL
Sbjct  133   QHGYRISCDIFLKFMDNNGKFKESLVEDERGILSLYEASHMRGHGEALLEEALEFTTTHL  192

Query  1461  ES---ILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDF  1291
             ++   +   +N   A++VS+ALKLPIR+ +PRV A+EY +IY+Q  +HN+ LL F+KLDF
Sbjct  193   KAYIHLYSNINPNFASEVSNALKLPIRKCVPRVKAREYFEIYQQQPSHNETLLTFSKLDF  252

Query  1290  NLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             N+LQK+HQ+E++ I RWWKDL V    PFAR R+ ECYFWIL +YFEP + F R+I T++
Sbjct  253   NILQKLHQKEIAEICRWWKDLNVSTNFPFARDRIVECYFWILSIYFEPYFKFGRKILTKV  312

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
             I + S++DD+YD YGT +ELQLFT AI+R+D S  N +PQY+K  Y  +LD+  EM++ +
Sbjct  313   IAMTSIMDDIYDAYGTFEELQLFTLAIKRWDMSMVNLLPQYMKVHYTTLLDLFEEMDKGI  372

Query  930   AKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLV  751
               +   +   +    MK+Q  +Y++E  W    + P + EY++V+L SS Y +++T   V
Sbjct  373   VNDGISYRSCFGKEAMKRQAESYFKEAEWLNKNYKPKYGEYMEVALASSGYELLSTISFV  432

Query  750   GMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVS  571
              MGDI TKEV +W+   P  +KA+ +I RLMDD++ ++FE+ER H+ SAVECYM  +  S
Sbjct  433   CMGDIATKEVFEWLFDCPQILKASTTISRLMDDVVSYKFEKEREHIVSAVECYMSNHGRS  492

Query  570   KQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVK  391
             + E   E+ K +  AWK IN+ CLHP+ VPM  L+ +LNL R + L+Y   D YT S+ +
Sbjct  493   EDETCAELLKQVEDAWKTINECCLHPMNVPMPFLICLLNLTRVMALLYSHEDGYTNSKGR  552

Query  390   FKSLITTTLVQPV  352
              K LI + L+ P+
Sbjct  553   TKLLIQSLLIDPL  565



>ref|XP_007021117.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12642.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   522 bits (1345),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 254/547 (46%), Positives = 356/547 (65%), Gaps = 9/547 (2%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++ N   R    +HP +WGD FL    K  +ID + E + ++ KEEVR++L+A    S +
Sbjct  16    ISSNMENRPKADFHPGIWGDVFLTCPDK--DIDSTAELQYEESKEEVRRMLVAPMANSNQ  73

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             K  L+D +QRLGV YHFE EI+ +++ I+ +        D N+LY  +LRFR+LR+ G  
Sbjct  74    KWSLIDAVQRLGVKYHFEKEIEDALEQIYPD------NSDANDLYTAALRFRILREHGFD  127

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +SC +F KF D  G FK SLT DV G+L LYEASYL VHGE  LDEA++FT +HL     
Sbjct  128   VSCDIFNKFKDDKGNFKSSLTSDVHGLLELYEASYLRVHGEDILDEAISFTTTHLTLAAA  187

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+   + +V+HALK  IRR LPRV A++Y+ +Y+ D++HNK LL+FAK+DFNLLQ +H+
Sbjct  188   TLDYPLSEQVAHALKQSIRRGLPRVEARQYISLYQDDESHNKALLQFAKIDFNLLQLLHR  247

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +ELS I RWWKDL   + LPFAR R+ E YFWI+GVYFEPQY   RR+ T++I + S++D
Sbjct  248   KELSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFEPQYSLGRRMLTKVIAMASIVD  307

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD YGT DEL L+T AI+R+D    +++P Y+K  Y A+LD+  EME+++ +E K + 
Sbjct  308   DTYDSYGTYDELILYTEAIERWDIKCIDQLPDYMKISYKALLDVYEEMEQLL-EEGKQYR  366

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             V Y    M +  + Y  E  W +    P FEEY   +L +S Y M+A T  VGMGD++T+
Sbjct  367   VEYAKKAMIRLAQAYLLEAKWMHANCKPTFEEYKANALPTSGYAMLAITAFVGMGDVVTQ  426

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W   +P  ++A+  ICR MDD+  H+F Q R    SA+ECY++ Y VS QEAY E 
Sbjct  427   ETFNWAAKDPNIIRASTIICRFMDDIAEHKFNQRREDDCSAIECYVEQYGVSAQEAYDEF  486

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I  +WKD+N+E L P  +P+ VL R LNLAR + ++Y++ D YT      K  IT+ 
Sbjct  487   NKHIESSWKDVNKEFLKPTEMPVPVLNRSLNLARVMDVLYREGDGYTHVGKAAKDGITSL  546

Query  366   LVQPVTI  346
             L+ PV +
Sbjct  547   LIDPVPL  553



>ref|XP_010061274.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
Length=573

 Score =   523 bits (1347),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 258/545 (47%), Positives = 366/545 (67%), Gaps = 14/545 (3%)
 Frame = -2

Query  1962  RSVTYHPTVWGDYFLAY--DSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
             RS  +H T+WGDYFL Y  DS LT  D   E  +++LK EVRK+L  A     +KL L+D
Sbjct  24    RSEIFHLTIWGDYFLKYASDSNLTSSDGVVEEHIERLKGEVRKMLTGAMDKPSQKLNLID  83

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
             +IQRLG  YHFE+EI   ++ I  +Y     GD+++NL+ V++ FRLLRQ+G+++SC +F
Sbjct  84    EIQRLGFAYHFEHEIDEQLEQIHRSYFEFHYGDNDDNLHTVAVLFRLLRQQGYNVSCEIF  143

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI-----LPG  1444
              +F D +G F  S   DV+GMLSL+EA +L  HG+  L++AL FT SHLESI      P 
Sbjct  144   NRFKDSEGNFNKSSIADVQGMLSLFEACHLSYHGDDILNDALAFTISHLESIEKKKVSPN  203

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             L      +VSHAL  PI++ LPR+ A+ Y+Q Y+++  HN+VLL  AKLDFN LQ+ HQ+
Sbjct  204   L----VKQVSHALHQPIQKGLPRLEARRYIQFYQEEPLHNEVLLSLAKLDFNSLQEQHQK  259

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  +TRWWKD+ + +  PFAR RL E Y W+LG+YFEP+Y  +R I T+++ I S+LDD
Sbjct  260   ELGNLTRWWKDINIEE-FPFARDRLGELYVWMLGIYFEPEYEIARGIVTKMMVILSILDD  318

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL+LFT AI+R+D  A   +P+ ++  Y  +LD   E+   +A++ + + +
Sbjct  319   IYDVYGTLEELELFTEAIERWDVDAKEGLPKCMQVFYKTLLDFYDEISNELARKGRSYRL  378

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MK Q+R Y  E  WF+  HVP  EEY+ ++L+S    +   T  +GMGDI+TK+
Sbjct  379   FYAKEVMKIQVRAYLAEAKWFHHSHVPTMEEYMPIALISIGTQLTFVTAFLGMGDIVTKD  438

Query  723   VLDW-VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
               DW ++S+P  VKA+  I RLM+D+ GH+FEQERGHVAS+VEC+MK Y+V+++EA  E+
Sbjct  439   AFDWLLSSDPRIVKASQVIGRLMNDIAGHKFEQERGHVASSVECFMKQYSVTEEEAKKEL  498

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKD-NDIYTFSQVKFKSLITT  370
              K ++ AWKDIN+E   P  VPM +L+R++NLARA   +Y+D  D Y  +   FK  +T 
Sbjct  499   CKQVANAWKDINEELRRPTAVPMVLLMRIINLARATHAVYEDETDHYVNAGTNFKEFVTL  558

Query  369   TLVQP  355
              LV P
Sbjct  559   LLVNP  563



>sp|K4LMW2.1|STS2_THAGA RecName: Full=Sesquiterpene synthase 2; AltName: Full=Kunzeaol 
synthase STS2 [Thapsia garganica]
 gb|AFV09099.1| sesquiterpene synthase 2 [Thapsia garganica]
Length=561

 Score =   522 bits (1345),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 262/559 (47%), Positives = 358/559 (64%), Gaps = 12/559 (2%)
 Frame = -2

Query  1992  MDVNVNSSG-------RRSVTYHPTVWGDYFLAYDSKL---TEIDPSEEREVQQLKEEVR  1843
             M V VNS+        R S  +HP++WGD F+   +     T++D  EE  +Q LK+EV+
Sbjct  1     MAVYVNSTTGPPSSVVRNSAGFHPSIWGDTFIPSGNSAVQKTDVDRKEEENLQLLKQEVK  60

Query  1842  KVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVS  1663
             K+L A      + + L+D IQRLG+ YHFE EI   +QH+ D+Y       + +NL+ V+
Sbjct  61    KMLTAGDTCQQDLICLIDDIQRLGLSYHFEAEIDTLLQHVKDSYLEYYGTKNHDNLHDVA  120

Query  1662  LRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEAL  1483
             L FRLLRQEGH+IS  VF KF D DGKF + L KDV GMLSL+EA++L VHGE  L++AL
Sbjct  121   LSFRLLRQEGHNISSDVFSKFQDSDGKFNEKLVKDVRGMLSLFEAAHLSVHGENILEDAL  180

Query  1482  TFTASHLESIL-PGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRF  1306
              FT SHL S L    N   A  V  ALK P+R++  R+ A+ Y+ IY +   H +VLL  
Sbjct  181   EFTTSHLNSYLNSNPNAPLADLVRRALKYPLRKSFNRMVARHYISIYHKYYWHKQVLLDL  240

Query  1305  AKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRR  1126
             AK DFNL+QKVHQ+EL  ITRWWKDL     LPFAR R+ ECYFWI GVYFEP+Y   R+
Sbjct  241   AKCDFNLVQKVHQKELGYITRWWKDLDFTNKLPFARDRVVECYFWITGVYFEPRYAAPRK  300

Query  1125  ITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTE  946
               T++I + S++DD+YDVYGT +EL   T+AI ++D +  +++P+Y++  Y  +LD+  E
Sbjct  301   FLTKVISLTSIIDDIYDVYGTPEELVQLTDAIDKWDINILDQLPEYMRHAYKPLLDVFAE  360

Query  945   MEEVMAKEN-KLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMI  769
              EE MAKE    + V Y     K+   TY  E  W   ++ P FEEY+ V+LVS    M+
Sbjct  361   GEEEMAKEGLPTYGVDYAKEAFKRLTVTYLHEAKWLQAQYFPTFEEYMSVALVSGAVKML  420

Query  768   ATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYM  589
             + +  V MG+I T+E  +W++ +PL V     ICRL DD++GHEFE +R H+ SAVECYM
Sbjct  421   SVSSFVRMGNIATREAFEWLSKDPLIVNGLSVICRLSDDIVGHEFENQRPHIPSAVECYM  480

Query  588   KGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIY  409
             K ++V+K+ AY E+ K I  AWKD+N+ECL P   P  +L RV NLAR I  +Y  +D Y
Sbjct  481   KSHHVTKETAYAELRKPIINAWKDMNEECLQPEAPPKPLLERVFNLARVINFLYDGHDGY  540

Query  408   TFSQVKFKSLITTTLVQPV  352
             T S  + K +IT+ L+ P+
Sbjct  541   THSSTRTKDMITSVLINPI  559



>gb|AES74575.2| sesquiterpene synthase [Medicago truncatula]
Length=557

 Score =   522 bits (1345),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 249/541 (46%), Positives = 362/541 (67%), Gaps = 1/541 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVL-IAAPPASLEKLELVD  1789
             R    +HP VWGDYF+ YDS+  E+D +   ++  LK+EVR +  I+      EK+ L+D
Sbjct  17    RNLADFHPCVWGDYFIQYDSESVELDQNISAQIDALKKEVRNMFNISKTEKPSEKINLID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              I RLGV YH+ENEI   +Q+I  +Y    +   E+NL  +S+ FRLLRQ+G H+S  VF
Sbjct  77    SICRLGVSYHYENEIDEVMQYIHKSYVENGEITLEDNLCTLSVLFRLLRQQGFHVSPNVF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              +F D+ G F + L  DVEGMLSLYEAS++ VHGE  L++AL FT++HLESI+  L+   
Sbjct  137   NQFKDEQGNFSERLITDVEGMLSLYEASHMMVHGEEILEKALAFTSTHLESIVTQLSPFL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             AA+V H+LK  + R   R+ A+ Y+ IYE+D +HN+ LL  AKLDFN+LQ +H++E   I
Sbjct  197   AAQVKHSLKQALHRNFHRLEARRYISIYEKDPSHNETLLTLAKLDFNILQCLHRKEFGKI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              +WWK++ +PK LP+ R R+ E  FW+L VYFEPQY  +R++  ++I + S++DD YD Y
Sbjct  257   CKWWKEIDIPKNLPYVRDRIVEMCFWVLAVYFEPQYSQARKMMIKVITLLSIIDDTYDAY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G+ DEL+LFT AI+R+D S+ + +P Y+K IY+++L +  E+EE M KE +L+ + Y I 
Sbjct  317   GSIDELELFTKAIERWDISSMDGLPNYMKLIYISVLKVLEEVEEDMTKEGRLYTLKYYIK  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             E +  ++ Y  E  WF   +VP  EEYL++S ++ C+ ++ T+  +GMG+  T+ +  WV
Sbjct  377   EFQMVVQAYVTEARWFNNNYVPTVEEYLQISKITCCHSLLTTSSYIGMGETATENIFKWV  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             ++ P  V A  +ICRLMD+++  EFE++RGHV S ++CYMK Y +S++ A  E +K I+ 
Sbjct  437   SNWPKIVDAISTICRLMDEIVTSEFERKRGHVCSLLDCYMKQYGMSREAAIQECKKEIAI  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWK +N ECL P  VPM  L R LNLAR + ++YKD D YT S+   KS I   LV PV 
Sbjct  497   AWKVVNSECLRPTKVPMPFLTRALNLARFMDVVYKDEDNYTRSEGLMKSYIKAVLVDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>ref|XP_008226738.1| PREDICTED: (-)-alpha-pinene synthase-like isoform X2 [Prunus 
mume]
Length=564

 Score =   522 bits (1345),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 251/545 (46%), Positives = 361/545 (66%), Gaps = 7/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSK---LTEIDPSEEREVQQLKEEVRK-VLIAAPPASLEKL  1801
              RR+  +H ++WGD F+ YD     +T +D   + +V +LKE VR+ V   +    L +L
Sbjct  23    ARRTANFHKSIWGDQFINYDDSQDMITHVD--RQGQVDELKEVVRREVFTTSKGDLLHQL  80

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
             +L+D IQRLGV YHFE EI+ +++ +       +  DD+ +LY V+L FRLLRQ GH++S
Sbjct  81    KLIDAIQRLGVAYHFEREIEEALERMHTTLHEHV-SDDDGDLYNVALCFRLLRQHGHNVS  139

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C +F KF D++G FK+SL  DV GMLS YEA++L VHGE  L+EAL FT +HLES    +
Sbjct  140   CDIFNKFRDENGSFKESLIADVSGMLSFYEATHLRVHGEDILEEALAFTTTHLESATTRV  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +   AA+++ AL+ P+R++L R+GA+ Y+ IY+ + +HN+ LL+ A LDFNL+Q +H++E
Sbjct  200   SNPLAAQITQALERPLRKSLERLGARRYISIYQDEASHNECLLKLANLDFNLIQPLHKKE  259

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             L  ITRWW+ L   + LPFAR R+ E YFWI+GVYFEP+Y   R+I T++  + ++LDD+
Sbjct  260   LQEITRWWRALDFERKLPFARDRMVELYFWIVGVYFEPRYSVGRKIMTKVSVLLTILDDI  319

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD +GT +EL +FT AI R+D + SNE+P Y+K  Y A+L++  E+EE M KE + + V 
Sbjct  320   YDAFGTFEELVIFTEAIDRWDLNCSNELPDYMKIFYQALLNLFNEIEEEMVKEGRSYRVP  379

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y I  MK Q R+Y+ E  W +   +P  +EY+ V+ VS  Y  + T  L+GMGDI+TKE 
Sbjct  380   YAIQAMKDQARSYFNEARWLHEGRIPSMDEYMSVATVSISYTFLTTISLLGMGDIVTKES  439

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +W+ ++P  V+A  +I RLMDD++   FE+ERGH AS+V+CYMK Y VS+QE     +K
Sbjct  440   FEWLLNDPKIVRAANTIFRLMDDIVSTNFEKERGHAASSVDCYMKQYGVSEQETVDVFKK  499

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              I   WKDIN+E L P  VPM VL RVLNL R   L+YK  D +T      K  + +  +
Sbjct  500   QIMDLWKDINEEFLRPTAVPMPVLKRVLNLTRVADLLYKGEDGFTRVGKVTKDSVASVCI  559

Query  360   QPVTI  346
              PV +
Sbjct  560   NPVPL  564



>gb|ABB01625.1| terpene synthase [Medicago truncatula]
Length=553

 Score =   521 bits (1342),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 246/544 (45%), Positives = 364/544 (67%), Gaps = 0/544 (0%)
 Frame = -2

Query  1977  NSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             ++  R    YHP+VWG +FL Y S+  E+D +   ++  LK+EVR +L++     L K++
Sbjct  10    DAKQRNLADYHPSVWGGFFLQYASETMELDQNLASQIDTLKDEVRNMLVSKTEMPLTKVK  69

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
             L+D I RLGV YHFE EI   +QHI  +Y    +   E++L  +++ FR+ RQ+G H+S 
Sbjct  70    LIDSICRLGVGYHFEKEIDEVLQHIHKSYVENGEITLEDSLCSLAMLFRVFRQQGLHVSP  129

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
              VF KF DK G F ++L+ DVEGMLSLYEAS++ VH +  L+EAL FT++HLESI    +
Sbjct  130   NVFNKFKDKQGNFNENLSTDVEGMLSLYEASHMMVHEDDILEEALNFTSTHLESIASQSS  189

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                AA++ + LK  + + +PR+ A+ Y+ IYE+D T ++VLL FAKLDFNLLQ +HQ+E 
Sbjct  190   PSLAAQIEYTLKQALHKNIPRLEARHYISIYEKDPTCDEVLLTFAKLDFNLLQSLHQKEF  249

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
               I++WWK+L     LP+AR R+AEC FW+L  +FEPQY  +R++  ++I + S++DD Y
Sbjct  250   GNISKWWKELDFSTKLPYARDRIAECSFWVLTAFFEPQYSQARKMMIKVITLLSIIDDTY  309

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             D YGT DEL+LFT A++R+D S+ +E+P Y+K IY + L I  E+E+ M KE +++ + Y
Sbjct  310   DAYGTIDELELFTKAVERWDISSLDELPDYMKPIYRSFLTIYEEIEKEMRKEGRIYTLDY  369

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                E KK ++ +  E  W    H+P  EEY+++S  S  Y ++  T  +GMGDI TKE+ 
Sbjct  370   YKIEFKKSVQAFMTEARWLNENHIPTTEEYMRISKKSGAYPLLILTSYIGMGDIATKEIF  429

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             +WV++EP  V A  ++CRLMD+++  EFEQ+RGHV S ++CYMK +++S++ A  E +  
Sbjct  430   NWVSNEPRIVNAAATLCRLMDEIVSSEFEQKRGHVCSLLDCYMKQFDMSREAAIQECKNR  489

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             ++  WKDIN+ECL P  VPM  + RVLNL+R + +IYK+ D YT S    K+ I   LV 
Sbjct  490   MTIVWKDINEECLRPTEVPMPFMTRVLNLSRFMDVIYKNKDNYTDSDGLMKTCIKEVLVD  549

Query  357   PVTI  346
             PV I
Sbjct  550   PVPI  553



>gb|KEH29688.1| sesquiterpene synthase [Medicago truncatula]
Length=561

 Score =   521 bits (1343),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 249/549 (45%), Positives = 368/549 (67%), Gaps = 9/549 (2%)
 Frame = -2

Query  1983  NVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEK  1804
             NVN   R    YHP++W DYFL Y S+  E+D     +++ LK+EVR ++++       K
Sbjct  19    NVN---RNVADYHPSIWKDYFLQYASESMELDEKIRPQIESLKKEVRNMIVSKIENPFAK  75

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD---ENNLYVVSLRFRLLRQEG  1633
             + L+D I RLGV+YHF++EI  ++ H    ++NC++  D   E+NL+ +S+ FRLLRQ+G
Sbjct  76    VHLIDSICRLGVNYHFQHEIDEALLHF---HENCVENGDLIIEDNLHTISVLFRLLRQQG  132

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
               +S   F KF D  G F + L  DVEGMLSLYEAS++ +HGE  L++AL FT ++LESI
Sbjct  133   FCVSPNAFNKFKDTQGNFSEKLATDVEGMLSLYEASHVRIHGEDILEDALNFTYAYLESI  192

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
                LN   ++++ H+L+ P+ + +PR+ A+ Y+ IYEQD +HN++LL  AKLDFN+LQK+
Sbjct  193   ANQLNHSLSSQIKHSLRQPLHKNIPRLEARRYISIYEQDPSHNEILLSLAKLDFNMLQKL  252

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             HQ+E   I +WW +L VP+   FAR R+ EC FW L VYFEPQY  +R++  +I  + S+
Sbjct  253   HQKEFGNICKWWNELDVPRNFSFARDRIVECCFWTLTVYFEPQYSRARKMLPKINVMLSL  312

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             +DD YD YGT +EL+ FTNAI+R+D S  +++P+Y+K  Y A+L +  E+E+ M  E ++
Sbjct  313   IDDTYDAYGTIEELERFTNAIERWDISCLDDLPEYMKISYTALLKVYEEIEQEMIIEGRV  372

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             + ++Y I E KK ++ Y  E  W    + P  EEY+ +S VS CY ++ATT  +GMGDI 
Sbjct  373   YALNYGIKEFKKTVQAYITEARWLNCNYSPTTEEYINISSVSCCYQLLATTSYIGMGDIA  432

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             T+++  WVT++P  + A   +CRLMDD++  EFE +RGHV+S +ECYMK YN+S++ +  
Sbjct  433   TEDIFSWVTNKPKILYAASVLCRLMDDIVSSEFEHKRGHVSSFLECYMKEYNISREASIQ  492

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E +K +  AWKDIN+ECL P  VP   L R++NL+R + +IYK  D YT S+ + K+ I 
Sbjct  493   ECQKRVVNAWKDINEECLKPTKVPTLFLTRIVNLSRFMDVIYKHEDNYTHSKGEMKTYIK  552

Query  372   TTLVQPVTI  346
               LV PV I
Sbjct  553   ALLVDPVPI  561



>ref|XP_009338882.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=513

 Score =   520 bits (1338),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 254/521 (49%), Positives = 359/521 (69%), Gaps = 10/521 (2%)
 Frame = -2

Query  1902  LTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHI  1723
             + ++D   E+ VQ+LKEEVR++L  +P    +KL L+D IQRLGV YHF NEI+ S+Q I
Sbjct  1     MEDVDAELEQHVQELKEEVRRMLTTSPENVSQKLNLIDDIQRLGVSYHFGNEIEESLQKI  60

Query  1722  FDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGML  1543
               +        D ++LY  +LRFRLLRQ+G++ISC +F KF D DGKFK+SL  DV G+L
Sbjct  61    HKS------SYDLDDLYTAALRFRLLRQQGYNISCDLFNKFKDGDGKFKESLVDDVVGLL  114

Query  1542  SLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAK  1363
             SLYEA++L +HGE  LDEAL FT ++LES    L+   A  V+HAL  P+R+ LPRV A+
Sbjct  115   SLYEATHLRIHGEEILDEALIFTTTNLESATFRLSPPLAKAVTHALNQPLRKGLPRVEAR  174

Query  1362  EYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLA  1186
              Y+ +Y++  ++ NK LL FAKLDFN LQ+VHQ+ELS ITRWWKDL VP  LP    RL 
Sbjct  175   YYLSVYQELRESPNKTLLTFAKLDFNRLQRVHQKELSEITRWWKDLDVPNQLPSTGDRLV  234

Query  1185  ECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSA  1009
             E YF W L VYF+PQY F+RR + ++  I ++LDD+Y+ YGT ++L+LFT AI+R+D SA
Sbjct  235   EIYFCWGLSVYFQPQYSFARRTSCKVAAIVAILDDIYE-YGTNEQLELFTEAIERWDVSA  293

Query  1008  SNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKH  829
              N++P+Y+K  Y A+LD+ +E+ E +  + KL+ + +    MKKQ+R Y+ E   F+ KH
Sbjct  294   MNQLPKYMKICYRALLDVYSEIHEKLPHDGKLYRIHHAREAMKKQVRAYFDEAKLFHQKH  353

Query  828   VPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDM  649
             +P  +EY+ VSLV+  Y ++ TT  +GM +  T +  DW+ + P AVKA   +CRLMDD+
Sbjct  354   MPSLDEYMSVSLVTCGYQLLITTSFLGMEEA-TIDSFDWLLTSPPAVKAATIVCRLMDDI  412

Query  648   IGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVL  469
               H+FEQ++ H    V CYMK Y  +++EA  E+++ ++ AWKDIN+ CLHP  VPM +L
Sbjct  413   AEHKFEQDKEHFIGVVNCYMKKYGTTEEEAITELQRQVNNAWKDINEACLHPTAVPMALL  472

Query  468   LRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             +R+LN AR + ++YK  D YT +    K LI +TLV+PV +
Sbjct  473   IRILNFARTMDVVYKREDGYTNANGMIKDLIVSTLVEPVAL  513



>gb|AAX44033.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score =   521 bits (1342),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 355/540 (66%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD+FL    K   ID   ++  QQLKEEVRK+++A    S +KL  +D 
Sbjct  22    RPKADFQPSIWGDFFLNCPDK--NIDAETQKRHQQLKEEVRKMIVAPMANSTQKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY  SLRFRLLR+ G ++SC VF 
Sbjct  80    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSLRFRLLREHGFNVSCDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT++HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHLSLAVASLDHPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNKVLL FAK+DFN++Q +H++ELS I+
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +TNAI+R+D    +E+P+Y+K  Y A+LD+  EME+++A+  + + V Y    
Sbjct  315   TYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGRQYRVEYAKNA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  375   MIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             ++P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY    K +  A
Sbjct  435   NDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQE L P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++P+ +
Sbjct  495   WKDVNQEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPIAL  554



>ref|XP_006370589.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 ref|XP_006370592.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67158.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67161.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=500

 Score =   519 bits (1336),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 243/492 (49%), Positives = 342/492 (70%), Gaps = 4/492 (1%)
 Frame = -2

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDN----YDNCIKGDDENNLYVVSLRFRLLR  1642
             + L+ +D IQRLG+ YHFE EI   ++ ++ +     +        N+LY +SL+FRLLR
Sbjct  9     QTLDFIDAIQRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFRLLR  68

Query  1641  QEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL  1462
             Q+G+ ISC VF KF +  G F DSL  D   +LS YEA++L VHG+  L+EAL FT SHL
Sbjct  69    QQGYKISCDVFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTTSHL  128

Query  1461  ESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             E +    +    AK++HALK PIR+ +PR+ A+ Y  +Y++D + ++VLL FAKLDFN+L
Sbjct  129   EFLATHSSSPLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDFNIL  188

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QK HQ+ELS I +WWK+L   K LPFAR R+ ECYFWILGVYFEP++  +RR+ T++I +
Sbjct  189   QKQHQKELSDIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEHFLARRMLTKVIAM  248

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKE  922
              SV+DD+YDVYG  +EL+LFT+AI+R++ +A + +P+Y+K  Y A+LD+ TE+EE M  E
Sbjct  249   TSVIDDIYDVYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENMVNE  308

Query  921   NKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG  742
              + + V Y    MK Q+R YY E  WF+ KH P  EEY+ V+LV+S Y M+A T  VGMG
Sbjct  309   ERSYRVYYAKEAMKNQVRAYYHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMG  368

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
              ++TK+  DW+   P  +KA+  ICRLMDD++ H+FEQ+RGHVAS++ECYMK +  ++QE
Sbjct  369   RVVTKDSFDWLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQE  428

Query  561   AYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
                E  K ++ AWKD+N+E LHP  VPM +L R+LNLAR I ++YKD D YT +    K 
Sbjct  429   TVHEFRKQVTDAWKDVNEEFLHPTAVPMPLLTRMLNLARVIDVVYKDEDGYTNAGTALKD  488

Query  381   LITTTLVQPVTI  346
             L++  L+ PV +
Sbjct  489   LVSALLIDPVPM  500



>gb|AAF74977.1|AF270425_1 (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=551

 Score =   521 bits (1341),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 355/540 (66%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD+FL    K   ID   ++  QQLKEEVRK+++A    S +KL  +D 
Sbjct  19    RPKADFQPSIWGDFFLNCPDK--NIDAETQKRHQQLKEEVRKMIVAPMANSTQKLAFIDS  76

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY  SLRFRLLR+ G ++SC VF 
Sbjct  77    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSLRFRLLREHGFNVSCDVFN  131

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT++HL   +  L+   +
Sbjct  132   KFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHLSLAVASLDHPLS  191

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNKVLL FAK+DFN++Q +H++ELS I+
Sbjct  192   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  251

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  252   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  311

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +TNAI+R+D    +E+P+Y+K  Y A+LD+  EME+++A+  + + V Y    
Sbjct  312   TYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGRQYRVEYAKNA  371

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  372   MIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  431

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             ++P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY    K +  A
Sbjct  432   NDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESA  491

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQE L P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++P+ +
Sbjct  492   WKDVNQEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPIAL  551



>gb|EYU19193.1| hypothetical protein MIMGU_mgv1a018094mg [Erythranthe guttata]
Length=561

 Score =   521 bits (1342),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 267/552 (48%), Positives = 381/552 (69%), Gaps = 24/552 (4%)
 Frame = -2

Query  1974  SSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAA---PPASLEK  1804
             S  RRSVTYHP+VWG++FL Y S   EI   E+ E+++ KE VR +L AA     + + K
Sbjct  24    SDARRSVTYHPSVWGNHFLRYTSH--EISVPEKEELERQKETVRNLLTAAQMEDDSLVHK  81

Query  1803  LELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHI  1624
             L+L+D IQRLGV YHFE+EI+ S++ ++D  ++ I   + N+L+ V+LRFRLLRQ+GHH+
Sbjct  82    LQLIDAIQRLGVAYHFEDEIEKSLRRMYDGGEDNI---NNNDLHFVALRFRLLRQQGHHV  138

Query  1623  SCGVFEKFLDKDGKFKDSLT-KDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESIL-  1450
              C VF KF+D++G FK+S+T  +V+G+LSLYEA++L + GE  LD+A++F  S LES L 
Sbjct  139   PCDVFNKFIDEEGDFKESITANNVQGVLSLYEAAHLAIDGEDILDKAISFCTSFLESYLV  198

Query  1449  --PGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQK  1276
                  N   A +VS AL  PI +++ R+GA++++ IY+++++H+K LL FAKLDFN++QK
Sbjct  199   DQKNNNIYLAKQVSEALDNPIHKSVIRLGARKFISIYQENESHDKTLLNFAKLDFNIVQK  258

Query  1275  VHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWS  1096
             +HQ+EL  +TRWWKDL     LPFAR R+ ECYFWIL VYFEP+Y+ +R I T+II + S
Sbjct  259   IHQKELGDLTRWWKDLDFANKLPFARDRMVECYFWILAVYFEPKYNVARTILTKIIALAS  318

Query  1095  VLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             + DD+YDV+GT DEL+LFT+ IQ      SN + QY++    A+LD+  E+E+ M K   
Sbjct  319   IADDIYDVHGTLDELELFTDFIQ------SNCLDQYMRIYSRALLDVYDEIEDEMTKIGT  372

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPP-FEEYLKVSLVSSCYMMIATTCLVGMG-  742
              + + Y   EMKK +R Y +E  W Y+ + P   EEY+KVSLVS+ YMM +T  LVGM  
Sbjct  373   SYRLHYANEEMKKLMRAYLEEAKWCYSNYTPSTMEEYMKVSLVSAGYMMASTLSLVGMDE  432

Query  741   DIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQE  562
             + +T E  DW+TSEPL V+A+ ++ RLMDD++G+E E++     SAV+CYMK    SK E
Sbjct  433   NTVTNEHFDWITSEPLIVRASSTVARLMDDIVGYECEEK----ISAVDCYMKENGCSKTE  488

Query  561   AYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKS  382
             A  E+ K +  A KDIN+EC+      + ++LRVLNL R I L+Y   D YT S+ K K 
Sbjct  489   AIAELGKQVKTARKDINKECISTTASDLPIVLRVLNLTRLIDLLYSGEDGYTNSKTKTKE  548

Query  381   LITTTLVQPVTI  346
             +I + LV+P++I
Sbjct  549   IIKSVLVEPLSI  560



>gb|KHG04498.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 gb|KHG30537.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
Length=555

 Score =   520 bits (1340),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 251/545 (46%), Positives = 354/545 (65%), Gaps = 5/545 (1%)
 Frame = -2

Query  1980  VNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL  1801
             ++S  R    +HP +WGD FL  +   T+ID + E + ++ K +VRK+++     S +KL
Sbjct  16    ISSENRPKADFHPGIWGDMFL--NCPDTDIDAATELQYEEFKAQVRKMIMEPVDDSNQKL  73

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
               +D +QRLGV YHFE EI+  +++I+ + +N    D EN+LY  +LRFRLLR+ G  IS
Sbjct  74    PFIDAVQRLGVSYHFEKEIEDELENIYRDTNN---NDAENDLYTTALRFRLLREHGFDIS  130

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C  F KF D+ G FK SLT DV+G+L LYEASY+ VHGE  LDEA++FT + L   LP L
Sbjct  131   CDAFNKFKDEAGNFKPSLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQLTLALPTL  190

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +   + +V HALK  IRR LPRV A+ ++ IY+  ++HNK LL+FAK+DFNLLQ +H++E
Sbjct  191   DHPLSEQVGHALKQSIRRGLPRVEARNFISIYQDLESHNKSLLQFAKIDFNLLQLLHRKE  250

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I RWWKDL   + LPFAR R+ E YFWI+GVYFEPQY   R++ T++I + S++DD 
Sbjct  251   LSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFEPQYSLGRKMLTKVIAMASIVDDT  310

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD Y T DEL  +TNAI+R+D    N++P Y+K  Y A+LD+  EME+++A + + + V 
Sbjct  311   YDSYATYDELIPYTNAIERWDIKCMNQLPDYMKISYKALLDVYEEMEQLLANQGRQYRVE  370

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    M +  + Y  E  W +  + P FEE+   +L +S Y M+A T  VGMG++IT E 
Sbjct  371   YAKKAMIRLAQAYLLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPET  430

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
               W  ++P  +KA+  ICR MDD+  H+F   R    SA+ECYM+ Y V+ QEAY E  K
Sbjct  431   FKWAANDPKIIKASTIICRFMDDIAEHKFNHRREDDCSAIECYMEQYGVTAQEAYNEFNK  490

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              I  +WKD+N+E L P  +P  VL R LNLAR + ++Y++ D YT      K  IT+ L+
Sbjct  491   HIESSWKDVNEEFLKPTEMPTPVLCRSLNLARVMDVLYREGDGYTHVGKAAKGGITSLLI  550

Query  360   QPVTI  346
              P+ I
Sbjct  551   DPIQI  555



>ref|XP_007021120.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12645.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   520 bits (1340),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 254/547 (46%), Positives = 358/547 (65%), Gaps = 9/547 (2%)
 Frame = -2

Query  1986  VNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE  1807
             ++ N   R    +HP +WGD FL    K  +ID + E + ++LKEEV ++L+A    S +
Sbjct  16    ISSNMENRPKADFHPGIWGDVFLTCPEK--DIDTTTELQYEELKEEVSRMLVAPMDNSNQ  73

Query  1806  KLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHH  1627
             KL L+D +QRLGV+YHFE EI+ +++ I+  +DN     D N+LY  +LRFR+LR+ G  
Sbjct  74    KLPLIDAVQRLGVNYHFEKEIEDALEQIY--HDNS----DANDLYTTALRFRILREHGFD  127

Query  1626  ISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP  1447
             +SC +F KF D  G F  SLT DV G+L LYEA+YL VHGE  LDEA++FT +HL     
Sbjct  128   VSCDIFNKFKDDKGNFMSSLTSDVRGLLELYEATYLRVHGEDILDEAISFTTTHLTLAAA  187

Query  1446  GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQ  1267
              L+   +  V+HALK  IRR LPRV A+ Y+ +Y+ D++HNK LL+FAK+DFNLLQ +H+
Sbjct  188   TLDYPLSEHVAHALKQSIRRGLPRVEARRYISLYQDDESHNKALLQFAKIDFNLLQLLHR  247

Query  1266  RELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLD  1087
             +ELS I RWWKDL   + LPFAR R+ E YFWI+GVYFE QY   RR+ T++I + S++D
Sbjct  248   KELSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFETQYSLGRRMLTKVIAMASIVD  307

Query  1086  DLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFH  907
             D YD YGT DEL L+T+AI+R+D    +++P Y+K  Y A+LD+  EME+++ +E K + 
Sbjct  308   DTYDSYGTYDELILYTDAIERWDIKCIDQLPDYMKISYKALLDVYEEMEQLL-EEGKQYR  366

Query  906   VSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITK  727
             V Y    M +  + Y  E  W +  + P FEEY   +L +S Y M+A T  +GMGD++T+
Sbjct  367   VEYAKKAMIRLAQAYLLEAKWMHANYKPTFEEYKANALPTSGYAMLAITAFIGMGDVVTQ  426

Query  726   EVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEI  547
             E  +W   +P  ++A+  ICR MDD+  H+F Q R    SA+ECYM+ Y VS QEAY E 
Sbjct  427   ETFNWAAKDPNIIRASTIICRFMDDIAEHKFNQRREDDCSAIECYMEQYGVSAQEAYDEF  486

Query  546   EKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              K I  +WKD+N+E L P  +P+ VL R LNLAR + ++Y++ D YT      K  IT+ 
Sbjct  487   NKHIESSWKDVNKEFLKPTEMPVPVLNRSLNLARVMDVLYREGDGYTHVGKAAKYGITSL  546

Query  366   LVQPVTI  346
             L+ PV +
Sbjct  547   LIDPVPL  553



>sp|O49853.1|DCS4_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme C2; Short=D-cadinene 
synthase C2 [Gossypium arboreum]
 emb|CAA76223.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=554

 Score =   520 bits (1340),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 249/540 (46%), Positives = 353/540 (65%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD+FL    K   ID   E+  QQLKEEVRK+++A    S +KL  +D 
Sbjct  22    RPKADFQPSIWGDFFLNCPDK--NIDAGTEKRHQQLKEEVRKMIVAPMANSTQKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY  SLRFRLLR+ G+++SC VF 
Sbjct  80    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSLRFRLLREHGYNVSCDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV+G+L LY+ASYL VHGE  LDEA++FT +HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSVTSDVQGLLELYQASYLRVHGEDILDEAISFTTNHLSLAVSSLDHPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNK LL FAK+DFN+LQ +H++ELS I 
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +TNAI+R+D    +E+P+Y+K  Y A+LD+  EME+++A+  + + V Y    
Sbjct  315   TYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYKEMEQLVAEHGRQYRVEYAKNA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  375   MIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             ++P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y VS QEAY    K +  A
Sbjct  435   NDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVSAQEAYDVFNKHVESA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQE   P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++P+ +
Sbjct  495   WKDVNQEFQKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPIAL  554



>emb|CAA77191.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   520 bits (1340),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 251/545 (46%), Positives = 354/545 (65%), Gaps = 5/545 (1%)
 Frame = -2

Query  1980  VNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL  1801
             ++S  R    +HP +WGD F+      T+ID + E + ++LK +VRK+++     S +KL
Sbjct  16    ISSENRPKADFHPGIWGDMFIICPD--TDIDAATELQYEELKAQVRKMIMEPVDDSNQKL  73

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
               +D +QRLGV YHFE EI+  +++I+ + +N    D + +LY  +LRFRLLR+ G  IS
Sbjct  74    PFIDAVQRLGVSYHFEKEIEDELENIYRDTNN---NDADTDLYTTALRFRLLREHGFDIS  130

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C  F KF D+ G FK SLT DV+G+L LYEASY+ VHGE  LDEA++FT + L   LP L
Sbjct  131   CDAFNKFKDEAGNFKASLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQLTLALPTL  190

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +   + +V HALK  IRR LPRV A+ ++ IY+  ++HNK LL+FAK+DFNLLQ +H++E
Sbjct  191   HHPLSEQVGHALKQSIRRGLPRVEARNFISIYQDLESHNKSLLQFAKIDFNLLQLLHRKE  250

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I RWWKDL   + LPFAR R+ E YFWI+GVYFEPQY   R++ T++I + S++DD 
Sbjct  251   LSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFEPQYSLGRKMLTKVIAMASIVDDT  310

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD Y T DEL  +TNAI+R+D    N++P Y+K  Y A+LD+  EME+++A + + + V 
Sbjct  311   YDSYATYDELIPYTNAIERWDIKCMNQLPNYMKISYKALLDVYEEMEQLLANQGRQYRVE  370

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    M + ++ Y  E  W +  + P FEE+   +L +S Y M+A T  VGMG++IT E 
Sbjct  371   YAKKAMIRLVQAYLLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPET  430

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
               W  S+P  +KA+  ICR MDD+  H+F   R    SA+ECYMK Y V+ QEAY E  K
Sbjct  431   FKWAASDPKIIKASTIICRFMDDIAEHKFNHRREDDCSAIECYMKQYGVTAQEAYNEFNK  490

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              I  +WKD+N+E L P  +P  VL R LNLAR + ++Y++ D YT      K  IT+ L+
Sbjct  491   HIESSWKDVNEEFLKPTEMPTPVLCRSLNLARVMDVLYREGDGYTHVGKAAKGGITSLLI  550

Query  360   QPVTI  346
              P+ I
Sbjct  551   DPIQI  555



>ref|XP_006370590.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67159.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=544

 Score =   519 bits (1337),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 250/545 (46%), Positives = 364/545 (67%), Gaps = 23/545 (4%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              RRS ++ P++WGD+FL+Y +    ++ S++ E ++LKEEV++ L+       + L+ +D
Sbjct  19    SRRSASFPPSIWGDHFLSYATD--SMETSDKAEHKKLKEEVKRELMTTINKPSQTLDFID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDN----YDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
              IQRLG+ YHFE EI   ++ ++ +     +        N+LY +SL+FRLLRQ+G+ IS
Sbjct  77    AIQRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKIS  136

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C VF KF +  G F DSL  D   +LS YEA++L VHG+  L+EAL FT SHLE +    
Sbjct  137   CDVFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTTSHLEFLATHS  196

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    AK++HALK PIR+ +PR+ A+ Y  +Y++D + ++VLL FAKLDFN+LQK HQ+E
Sbjct  197   SSPLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDFNILQKQHQKE  256

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I +                 + ECYFWILGVYFEP++  +RR+ T++I + SV+DD+
Sbjct  257   LSDIAK-----------------VIECYFWILGVYFEPEHFLARRMLTKVIAMTSVIDDI  299

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YDVYG  +EL+LFT+AI+R++ +A + +P+Y+K  Y A+LD+ TE+EE M  E + + V 
Sbjct  300   YDVYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENMVNEERSYRVY  359

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK Q+R YY E  WF+ KH P  EEY+ V+LV+S Y M+A T  VGMG ++TK+ 
Sbjct  360   YAKEAMKNQVRAYYHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDS  419

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+   P  +KA+  ICRLMDD++ H+FEQ+RGHVAS++ECYMK +  ++QE   E  K
Sbjct  420   FDWLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRK  479

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              ++ AWKD+N+E LHP  VPM +L R+LNLAR I ++YKD D YT +    K L++  L+
Sbjct  480   QVTDAWKDVNEEFLHPTAVPMPLLTRMLNLARVIDVVYKDEDGYTNAGTALKDLVSALLI  539

Query  360   QPVTI  346
              PV +
Sbjct  540   DPVPM  544



>gb|KDO83772.1| hypothetical protein CISIN_1g035568mg [Citrus sinensis]
Length=518

 Score =   518 bits (1334),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 247/519 (48%), Positives = 358/519 (69%), Gaps = 13/519 (3%)
 Frame = -2

Query  1884  SEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDN  1705
              + +E+++LKEEVR+ L+ +   SL +L+L+D I RLGV Y FE E++ ++Q+++D + N
Sbjct  7     GQSQEIEELKEEVRRELLGSGVDSLSRLKLIDAILRLGVGYQFERELEEALQNLYDAFSN  66

Query  1704  CIKGDDENNLYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEAS  1525
                  ++N+LY V+LRFR+LRQ G+ +SC +F KF D  G FK+SL  DV GMLSLYEA+
Sbjct  67    NFYNIEDNDLYHVALRFRILRQRGYKVSCDIFNKFKDGKGNFKESLKTDVSGMLSLYEAA  126

Query  1524  YLGVHGETTLDEALTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIY  1345
             +L VHGE  L+EA+ FT +HL+S +       A +V HAL+ P+ + LPR+ A+ ++ +Y
Sbjct  127   HLVVHGEDILNEAIAFTTAHLQSSM-------APQVIHALRQPLYKGLPRIEARFFISLY  179

Query  1344  -EQDQTHNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWI  1168
              E +  HNK LL+ AKLDFN +Q +++ ELS I+RWWKDL   + LPFAR R+ ECYFWI
Sbjct  180   QEHEPLHNKALLKLAKLDFNQVQSLYKIELSEISRWWKDLDFARKLPFARDRVVECYFWI  239

Query  1167  LGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQY  988
             +GVYFEPQY  +R++ T++I + S++DD+YDVYG  +EL LFT AI R+D S  +++P+Y
Sbjct  240   VGVYFEPQYSLARKLLTKVISMTSIIDDIYDVYGIPEELDLFTAAIDRWDVSCIDQLPEY  299

Query  987   LKKIYLAILDITTEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEY  808
             ++  Y+A+LD+  E+EE +A +   + V Y   EMK  +  Y+ E  WF+  +VP  EEY
Sbjct  300   MQTFYVALLDLYKEIEEELATKGWSYRVHYAKEEMKILVHGYHDESKWFHNNYVPTMEEY  359

Query  807   LKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQ  628
             ++VSLV+S Y M+     +GM  ++TKE  DWV+ +P  ++A+  I RLMDD+  H+FEQ
Sbjct  360   MRVSLVTSGYSMLTAASFLGMDSVVTKEAFDWVSGKPKIIRASTIIGRLMDDIKSHKFEQ  419

Query  627   ERGHVASAVECYMK-----GYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLR  463
             ERGH ASA+ECYMK     G +V++QE + E+ K +  AWKDIN+ECL P  VP  +L+R
Sbjct  420   ERGHAASAIECYMKEKEREGVSVTEQEVHEELYKKVGDAWKDINEECLMPTEVPRPLLMR  479

Query  462   VLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             VLNL+R I +IYK+ D YT      K  I + L+ PV I
Sbjct  480   VLNLSRVIDVIYKEGDGYTHVGQVMKDNIASVLIHPVAI  518



>ref|XP_006358819.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=563

 Score =   520 bits (1338),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 271/553 (49%), Positives = 383/553 (69%), Gaps = 4/553 (1%)
 Frame = -2

Query  2001  ITEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAP  1822
             +  +D + ++  R    +H TVWG+YFL+Y  +LTEI   E+ E+++LKE+V+K+LI  P
Sbjct  8     VAMVDSSSSNFKRPLANFHSTVWGNYFLSYTPQLTEISVDEKIELEELKEKVKKMLIEIP  67

Query  1821  PASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLR  1642
                 +KL L+D IQRLGV YHF+NEI+ S+Q+IFD  +   K +D+++LY+V+LRFRL+R
Sbjct  68    NNCTQKLVLIDTIQRLGVAYHFKNEIKTSLQNIFDESEQS-KNEDDDDLYIVALRFRLVR  126

Query  1641  QEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL  1462
             Q+ H++S  VF+KF D DGKFK +LTKDV+G++SLYEA++L VH E  L+EALTFT +HL
Sbjct  127   QQRHYMSADVFKKFTDHDGKFKKNLTKDVQGLVSLYEATHLRVHDEEILEEALTFTITHL  186

Query  1461  ESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLL  1282
             ES++P L+    A V  AL  PI   LPR+ A++Y+ +YE+ +  N +LL+FAKLDFN L
Sbjct  187   ESMVPKLSNSLKAHVREALSQPIYTNLPRLLARKYIGMYEKIELCNDLLLKFAKLDFNNL  246

Query  1281  QKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICI  1102
             QK++Q EL  +TRWWK+L   K  P+AR R+ ECYFW+ GVY EPQ+  +R++ T+++  
Sbjct  247   QKLYQGELGELTRWWKNLDFAKKFPYARDRMVECYFWVAGVYIEPQHGRARKMMTKLLTT  306

Query  1101  WSVLDDLYDVYGTQDELQLFTNAIQRF-DTSASNEVPQYLKKIYLAILDITTEMEEVMAK  925
             + ++DD YD Y T DEL  FTNAI R  D SA N V   L+ +Y A+LD   E+EE + K
Sbjct  307   YVIIDDTYDAYATYDELVAFTNAIVRCDDISAINSVSPNLRPVYRALLDRYDEIEEELTK  366

Query  924   ENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGM  745
             E+KL  + Y   EMKK  R Y +E +W    ++P  EEY+KV++VS+  MM ATT L  M
Sbjct  367   EDKLECIYYAKQEMKKVARAYLKEALWLNDVYIPKCEEYMKVAIVSTTVMMAATTFLCVM  426

Query  744   GDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQ  565
              + ITKE  +WV +EPL ++A+  I RL DD+  + FEQ+R HVAS +ECYMK Y VSKQ
Sbjct  427   EENITKETFEWVINEPLILRASLVIGRLKDDINTNNFEQQRSHVASFIECYMKEYGVSKQ  486

Query  564   EAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFK  385
             EA VE  K ++ AWKD+N+E L    VP  VL +V+N AR  + I+K+ D +  ++ +FK
Sbjct  487   EARVEARKELTNAWKDMNEEFLRSSEVPTFVLEQVINFARLAY-IFKEGD-FINTRSEFK  544

Query  384   SLITTTLVQPVTI  346
             ++IT   V+PV I
Sbjct  545   NMITLLFVEPVNI  557



>ref|XP_009785131.1| PREDICTED: (E,E)-germacrene B synthase-like [Nicotiana sylvestris]
Length=619

 Score =   521 bits (1343),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 263/547 (48%), Positives = 376/547 (69%), Gaps = 11/547 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +H +VWGDYFL+Y  +LTEI   E+ E ++LKE+VR++L+  P  S++KLEL+D 
Sbjct  77    RPLANFHSSVWGDYFLSYTPQLTEISSQEKVEFEELKEKVRQMLVEIPDNSIQKLELIDT  136

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHF+N+I+ SI++I          DD  NLY V+LRFRLLRQ+ HH+S  VF+
Sbjct  137   IQRLGVAYHFKNDIKTSIRNISHASQQSENEDD--NLYAVALRFRLLRQQRHHMSYDVFK  194

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NELA  1429
             KF +KDGKFK++LTKD++G+LSLYEA++L VHGE  L++AL+FT ++LES+ P L N   
Sbjct  195   KFTNKDGKFKETLTKDIQGLLSLYEAAHLRVHGEEILEQALSFTLTNLESMGPKLSNSSL  254

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKV--LLRFAKLDFNLLQKVHQRELS  1255
              A+VS AL  PI   LPR+ A+ Y+ +YE +++HN +  LL+FAKLDFN++QKVHQREL 
Sbjct  255   KAQVSAALSQPIHTNLPRMTARNYISMYENNESHNNLDFLLKFAKLDFNIVQKVHQRELG  314

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              +TRWWKDL   K  P+AR RL EC+F+ +G+YFEPQY  +R + T+++ I++V+DD YD
Sbjct  315   ELTRWWKDLNFAKKFPYARDRLVECHFYTVGIYFEPQYSRAREMMTKLLTIYTVIDDTYD  374

Query  1074  VYGTQDELQLFTNAIQRF--DTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
              Y T DEL  FT+AI +   D SA + VP  LK  Y A++D+  ++EE   +E KL  + 
Sbjct  375   AYATYDELVPFTDAIDKCGCDISAISSVPPSLKPAYQALVDLYAQIEEKFIREGKLDRLC  434

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y   EMKK  R +++E  W    ++P  +EY+K + +++  MM+ATT L  M + I KE 
Sbjct  435   YAKYEMKKLARAFFKEAEWLNAGYIPKCDEYMKNANITTTCMMVATTSLSFMEESIAKET  494

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +W+  EPL ++A+ +I RL  D IGH  EQ+R H+AS +ECY+K Y  SKQ+AY E +K
Sbjct  495   FEWMIDEPLILRASSAINRLKGDCIGHNLEQQRKHIASFIECYVKEYGGSKQDAYAEAQK  554

Query  540   LISKAWKDINQE--CLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTT  367
              I+ AWKD+N++  C     VP  VL  V+N+AR  + I+++ND +  +Q +FK  IT  
Sbjct  555   KITNAWKDMNKDFLCSTHNEVPTFVLELVINIARLAY-IFEEND-FASAQSEFKDKITML  612

Query  366   LVQPVTI  346
              V+PV +
Sbjct  613   FVEPVNL  619



>ref|XP_008226737.1| PREDICTED: (-)-alpha-pinene synthase-like isoform X1 [Prunus 
mume]
Length=564

 Score =   519 bits (1337),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/545 (46%), Positives = 359/545 (66%), Gaps = 7/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSK---LTEIDPSEEREVQQLKEEVRK-VLIAAPPASLEKL  1801
              RR+  +H ++WGD F+ YD     +T +D   + +V +LKE VR+ V   +    L +L
Sbjct  23    ARRTANFHKSIWGDQFINYDDSQDMITHVD--RQGQVDELKEVVRREVFTTSKGDLLHQL  80

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
             +L+D IQRLGV YHFE EI+ +++ +       +  DD+ +LY V+L FRLLRQ GH++S
Sbjct  81    KLIDAIQRLGVAYHFEREIEEALERMHTTLHEHV-SDDDGDLYNVALCFRLLRQHGHNVS  139

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C +F KF D++G FK+SL  DV GMLS YEA++L VHGE  L+EAL FT +HLES    +
Sbjct  140   CDIFNKFRDENGSFKESLIADVSGMLSFYEATHLRVHGEDILEEALAFTTTHLESATTRV  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +   AA+++ AL+ P+R++L R+GA+ Y+ IY+ + +HN+ LL+ AKLDFNL+Q +H++E
Sbjct  200   SNPLAAQITQALERPLRKSLERLGARRYISIYQDEASHNECLLKLAKLDFNLVQPLHKKE  259

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             L  ITRWW+ L   + LPFAR R+ E YFWI+GVYFEPQY   R+I TQ+  + + +DD+
Sbjct  260   LQEITRWWRALDFERKLPFARDRMVELYFWIVGVYFEPQYSVGRKIMTQMSVLLTTMDDI  319

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD +GT +EL +FT AI R+D + SNE+P Y+K  Y A+L++  E+E  M KE   + V 
Sbjct  320   YDAFGTFEELVVFTEAIDRWDLNCSNELPNYMKIFYHALLNLFNEIEVEMVKEGGSYRVP  379

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y I  MK Q R+Y+ E  W +   +P  EEY+ V+ VS CY  + T  L+GMGDI+TKE 
Sbjct  380   YAIQAMKDQARSYFDEARWLHEGRIPSMEEYMSVATVSICYTFLTTISLLGMGDIVTKES  439

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              +W+ ++P  V+A  +I RLMDD++   FE+ERGH AS+V+CYMK Y  S+QE     +K
Sbjct  440   FEWLLNDPKIVRAANTILRLMDDIVSTNFEKERGHAASSVDCYMKQYGFSEQETVDVFKK  499

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              I   WKDIN+E L P  VPM +L +VLNL R   L+YK  D +T      K  + +  +
Sbjct  500   QIMDLWKDINEEFLIPTAVPMPMLKQVLNLTRVADLLYKGEDGFTHVGKVTKDSVASVCI  559

Query  360   QPVTI  346
              PV +
Sbjct  560   NPVPL  564



>ref|XP_002317018.2| hypothetical protein POPTR_0011s14600g [Populus trichocarpa]
 gb|EEE97630.2| hypothetical protein POPTR_0011s14600g [Populus trichocarpa]
Length=569

 Score =   519 bits (1337),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 257/543 (47%), Positives = 373/543 (69%), Gaps = 5/543 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RRS  +HP++WGDYF  +    +  D   E+E  +LKEEV+++L A      ++L  +D 
Sbjct  21    RRSANFHPSIWGDYFACHTFN-SMFDDHFEQEFIRLKEEVKEMLYATTNKLSQQLNFIDV  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV Y FE+EI   ++ ++          D ++L +V+LRFRLLRQ+G ++SC VF+
Sbjct  80    IQRLGVSYLFESEIDEMLRDLYYQGSGGAYVHD-HDLQMVALRFRLLRQQGRYVSCDVFK  138

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D +G +K  L  D++GMLSLYEA +L VH E  L++ALTF  +HL+SI   +     
Sbjct  139   KFKDTEGNYKVCLANDIQGMLSLYEAIHLRVHREDILEDALTFATTHLKSITTDMCPPPL  198

Query  1425  -AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
               K+ HAL  PI + LP +GAK Y+ IYEQ+ +H++VLL+FAKL+FN LQ +HQ+EL+ +
Sbjct  199   LVKLRHALDQPIHKDLPWLGAKHYISIYEQEASHSEVLLKFAKLNFNFLQNMHQKELADM  258

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
             T WWK + + K LPFAR RL ECYFWILGV FEPQY F+R I T++I + SV+DD+YDVY
Sbjct  259   TMWWKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFARIIMTKVIAMTSVMDDVYDVY  318

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             GT +EL LFT+AI+R+D S  + +P+Y+K  Y  + D+  E+E  +A + + + V Y   
Sbjct  319   GTMEELVLFTDAIERWDISNIDHLPEYMKFFYKQLSDVYKEIETELAAQGRSYRVDYAKE  378

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
              MKKQ++ Y+ E  W +  ++P  +EY+++SL+SS Y ++     VGMGDI+TK+  +W+
Sbjct  379   AMKKQVQAYFVEARWLHENYMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWL  438

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
               +P  VKA   I RLMDD++ H+FEQERGHVASAVECYM  + VS+++AY E+ + + +
Sbjct  439   NKDPKIVKAASLIARLMDDIVSHKFEQERGHVASAVECYMNQHEVSEEQAYDELRRQVVE  498

Query  528   AWKDINQECL-HPLP-VPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQP  355
             AWKDIN+E L  P   VP+ +L RVLNLAR + ++YKD D YT ++ K ++ IT+ L++P
Sbjct  499   AWKDINEELLIGPEDHVPIPLLTRVLNLARVMDVMYKDGDGYTNAKGKVRNYITSLLIEP  558

Query  354   VTI  346
             V +
Sbjct  559   VQL  561



>ref|XP_007021067.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY12592.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=557

 Score =   518 bits (1335),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 347/507 (68%), Gaps = 7/507 (1%)
 Frame = -2

Query  1866  QQLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDD  1687
             ++LK+EV+++L        +KL L+D +QRLGV YHFE EI+ +++ I     N     D
Sbjct  54    EELKQEVQRMLTTPMDKPSQKLHLIDAVQRLGVAYHFEKEIEDALETI-----NGDCNSD  108

Query  1686  ENNLYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHG  1507
              N++Y+ SLRFRLLR+ G  + C  F KF D  G FK SL  DV+G+L LYEA+++ +HG
Sbjct  109   GNDIYITSLRFRLLREHGFDVQCETFNKFKDDKGNFKVSLKSDVKGLLGLYEAAHIRMHG  168

Query  1506  ETTLDEALTFTASHLESILPGLNELA-AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQT  1330
             E  L+EAL FT +HLE     +++   +A VS A K PIR+ LPR+ A+ ++ IY++D +
Sbjct  169   EHILEEALAFTTTHLEFAETSIDQYPLSALVSRARKRPIRKGLPRLEARRFISIYQEDGS  228

Query  1329  HNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFE  1150
             H+K LL+FAKLDFNL+Q +H+ ELS I+RWWKDL   + LP AR RL E YFWILGVYFE
Sbjct  229   HDKTLLKFAKLDFNLVQNLHKAELSKISRWWKDLDFKRKLPSARDRLVEGYFWILGVYFE  288

Query  1149  PQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYL  970
             PQY  +R+I T+ I + S +DD YD YGT +E QLFTNAI+R+D +  + +P Y+K +Y 
Sbjct  289   PQYSLARQILTKAIVMASTIDDTYDAYGTFEEFQLFTNAIERWDINCMDRLPAYMKLLYK  348

Query  969   AILDITTEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLV  790
             A+LD+  EMEEVMAK+ K++ V Y    MK+  + Y+ E  W++  +VP  EEY+   LV
Sbjct  349   ALLDVYEEMEEVMAKQGKIYRVQYAKEAMKQLSQAYFVEAKWYHENYVPTVEEYMTNGLV  408

Query  789   SSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVA  610
             SS Y+M+A T  VGMGDI+TKE+ DW ++ P  V+A+  I RLMDD++ H+FEQERGHVA
Sbjct  409   SSGYIMVAITSFVGMGDIVTKEIFDWASNNPKIVRASSMIARLMDDIVSHKFEQERGHVA  468

Query  609   SAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLH-PLPVPMKVLLRVLNLARAIFL  433
             SA+ECYMK + VS++ A  E+ K I  AWKDINQE +  P  VPM  L R+LNLAR +  
Sbjct  469   SAIECYMKQHGVSEENACNELTKQIENAWKDINQELVRPPAGVPMPALTRILNLARVMDF  528

Query  432   IYKDNDIYTFSQVKFKSLITTTLVQPV  352
             +YK+ D YT      K  IT+ L+ P+
Sbjct  529   LYKEGDGYTHVVEAAKGGITSLLIDPI  555



>sp|Q43714.1|DCS3_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme A; Short=D-cadinene 
synthase A [Gossypium arboreum]
 gb|AAB41259.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 emb|CAA65289.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   518 bits (1335),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 250/545 (46%), Positives = 354/545 (65%), Gaps = 5/545 (1%)
 Frame = -2

Query  1980  VNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKL  1801
             ++S  R    +HP +WGD F+      T+ID + E + ++LK +VRK+++     S +KL
Sbjct  16    ISSENRPKADFHPGIWGDMFIICPD--TDIDAATELQYEELKAQVRKMIMEPVDDSNQKL  73

Query  1800  ELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHIS  1621
               +D +QRLGV YHFE EI+  +++I+ + +N    D + +LY  +LRFRLLR+ G  IS
Sbjct  74    PFIDAVQRLGVSYHFEKEIEDELENIYRDTNN---NDADTDLYTTALRFRLLREHGFDIS  130

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
             C  F KF D+ G FK SLT DV+G+L LYEASY+ VHGE  LDEA++FT + L   LP L
Sbjct  131   CDAFNKFKDEAGNFKASLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQLTLALPTL  190

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +   + +V HALK  IRR LPRV A+ ++ IY+  ++HNK LL+FAK+DFNLLQ +H++E
Sbjct  191   HHPLSEQVGHALKQSIRRGLPRVEARNFISIYQDLESHNKSLLQFAKIDFNLLQLLHRKE  250

Query  1260  LSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
             LS I RWWKDL   + LPFAR R+ E YFWI+GVYFEPQY   R++ T++I + S++DD 
Sbjct  251   LSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFEPQYSLGRKMLTKVIAMASIVDDT  310

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD Y T DEL  +TNAI+R+D    N++P Y+K  Y A+L++  EME+++A + + + V 
Sbjct  311   YDSYATYDELIPYTNAIERWDIKCMNQLPNYMKISYKALLNVYEEMEQLLANQGRQYRVE  370

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    M + ++ Y  E  W +  + P FEE+   +L +S Y M+A T  VGMG++IT E 
Sbjct  371   YAKKAMIRLVQAYLLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPET  430

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
               W  S+P  +KA+  ICR MDD+  H+F   R    SA+ECYMK Y V+ QEAY E  K
Sbjct  431   FKWAASDPKIIKASTIICRFMDDIAEHKFNHRREDDCSAIECYMKQYGVTAQEAYNEFNK  490

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              I  +WKD+N+E L P  +P  VL R LNLAR + ++Y++ D YT      K  IT+ L+
Sbjct  491   HIESSWKDVNEEFLKPTEMPTPVLCRSLNLARVMDVLYREGDGYTHVGKAAKGGITSLLI  550

Query  360   QPVTI  346
              P+ I
Sbjct  551   DPIQI  555



>ref|XP_006592519.1| PREDICTED: (-)-germacrene D synthase-like isoform X3 [Glycine 
max]
Length=564

 Score =   519 bits (1336),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 262/545 (48%), Positives = 364/545 (67%), Gaps = 13/545 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLE-KLELVD  1789
             R +  + P++WGDYFL Y     E D S  ++ Q  KEEVRK+LIA    +   KLE +D
Sbjct  23    RNTANFSPSIWGDYFLYYVPSSVE-DDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFID  81

Query  1788  KIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFRLLRQEGHHISC  1618
              +QRLGV YHFE+EI   +  I++     +N I  DD+  L  V+L FRLLRQ+G+HIS 
Sbjct  82    SVQRLGVSYHFEHEIDGVLHQIYNISTKDNNIITHDDD--LCHVALLFRLLRQQGYHISS  139

Query  1617  GVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL-ESILPGL  1441
              VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F    L +S+   L
Sbjct  140   NVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQL  199

Query  1440  NELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRE  1261
             +    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLDFN+LQ++HQ+E
Sbjct  200   SPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKE  259

Query  1260  LSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             ++ +TRWW K+L V   LPF R R+AECYFW LG+YFEPQY  +RRITT++I + SV+DD
Sbjct  260   VNNVTRWWIKNLNVSTKLPFVRDRIAECYFWSLGIYFEPQYSLARRITTKVIALCSVIDD  319

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE M K+ K++ +
Sbjct  320   MYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCI  379

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y   EMK+ I+    E  W +  H P  EEY++V  VSS Y M+ T C VGM D  T+E
Sbjct  380   KYAKKEMKRLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSAYSMVITICFVGMKD-TTEE  438

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W TS+P+ + A   ICRLMDD++G+E   ER HVAS++ECYMK +N S+Q+A  ++ 
Sbjct  439   VLIWATSDPIIIGAASIICRLMDDIVGNE---ERRHVASSIECYMKQHNTSRQDAINKLL  495

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT +    K  I T L
Sbjct  496   EMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAGGLMKDYIKTLL  555

Query  363   VQPVT  349
             V  ++
Sbjct  556   VNKMS  560



>ref|XP_007021121.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12646.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=586

 Score =   518 bits (1335),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 263/584 (45%), Positives = 367/584 (63%), Gaps = 42/584 (7%)
 Frame = -2

Query  1998  TEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPP  1819
             T   ++ N+  R    +HP +WGD FL    K  +ID + E + ++LKEEVR+ L+A   
Sbjct  12    THNAISSNTENRPKADFHPGIWGDVFLNCPDK--DIDATTELQYEELKEEVRRTLLAPMD  69

Query  1818  ASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQ  1639
              S +KL L+D +QRLGV+YHFE EI+ +++ I+ + DN     D N+LY  +LRFR+LR+
Sbjct  70    DSNQKLPLIDAVQRLGVNYHFEKEIEDALEQIYHD-DN-----DANDLYTTALRFRILRE  123

Query  1638  EGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLE  1459
              G  +SC  F KF D  G FK SLT DV G+L LYEASYL VHGE  LD+A++F  +HL 
Sbjct  124   HGFDVSCDAFNKFKDDKGNFKSSLTSDVRGLLELYEASYLRVHGEDLLDDAISFATTHLT  183

Query  1458  SILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQ  1279
              + P L+   + +V+HALK  IRR LPRV A++Y+ +Y+ D++HNK LL+FAK+DFNLLQ
Sbjct  184   LVAPTLDYPLSEQVTHALKQSIRRGLPRVEARQYISLYQDDESHNKALLQFAKIDFNLLQ  243

Query  1278  KVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIW  1099
              +H++ELS I  WWKDL   K LPFAR R+ E YFWI+GVYFEPQY   RR+ T++I + 
Sbjct  244   LLHRKELSEICWWWKDLDFTKKLPFARDRVVEGYFWIMGVYFEPQYSLGRRMLTKVIAMA  303

Query  1098  SVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKEN  919
             S++DD YD YGT DEL L+T+AI+R+D    +++P Y+K  Y A+LD+  EME+++ + N
Sbjct  304   SIVDDTYDSYGTYDELILYTDAIERWDIECIDQLPDYMKISYKALLDVYEEMEQLLEQVN  363

Query  918   KLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGD  739
             K + V Y    M +  + Y  E  W +  + P FEEY   +L +S Y M+A T  VGMGD
Sbjct  364   K-YRVEYAKKAMIRLAQAYLLEAKWMHENYKPTFEEYKSNALPTSGYAMLAITAFVGMGD  422

Query  738   IITKEVLDWVTSEPLAVKATCSICRLMDDMIGH-----EFEQERGHVA------------  610
             ++T+E  +W  ++P  ++A+  ICR MDD+  H     EF+  RG  A            
Sbjct  423   VVTQETFNWAANDPNIIRASTIICRFMDDIAEHKHYYPEFKPSRGRAAYLPSIRVSNTTR  482

Query  609   ----------------SAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPM  478
                             SA+ECYM+ Y VS QEAY E  K I  +WKDIN+E L P  +P+
Sbjct  483   NVLYGWQFNQKREDDCSAIECYMEQYGVSAQEAYDEFNKHIESSWKDINKEFLKPTEMPV  542

Query  477   KVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             +VL R LNLAR + ++Y+D D YT      K  IT+ L+ PV +
Sbjct  543   RVLNRSLNLARVMDVLYRDGDGYTHVGKAAKGGITSLLIDPVPL  586



>emb|CAN60658.1| hypothetical protein VITISV_029939 [Vitis vinifera]
Length=520

 Score =   516 bits (1329),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 260/533 (49%), Positives = 362/533 (68%), Gaps = 23/533 (4%)
 Frame = -2

Query  1932  GDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFE  1753
             G+ F  Y S+ T      E++VQQLKE VRK+LI     S +KL L+D IQRLGV YH E
Sbjct  6     GESF-PYASECTNTHAYLEQQVQQLKE-VRKMLITDDDDSEQKLLLIDAIQRLGVAYHLE  63

Query  1752  NEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG--VFEKFLDKDGKF  1579
             +EI  ++Q +FD Y   I  +++++ Y  +LR RLLRQ+G+++SCG  VF K  + +G F
Sbjct  64    SEIDEALQLVFDGY--VISAEEDDDAYTAALRLRLLRQQGYNVSCGECVFNKLKNSEGNF  121

Query  1578  KDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAKVSHALKL  1399
             K+SL+ +V GML  YEA++L VHGE  LDEAL F  +HL+S+    +   A +V HALK 
Sbjct  122   KESLSSNVRGMLGSYEATHLKVHGEDILDEALAFCTTHLQSVAKYSSNPFAEEVDHALKQ  181

Query  1398  PIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVP  1219
             PIR+ L R+ A+ Y  IY+ D +HN  LL+ AKLDFNLLQK+HQ+ELS I+ WWKDL   
Sbjct  182   PIRKGLTRLEARHYFSIYQADDSHNTALLKLAKLDFNLLQKLHQKELSEISAWWKDLDFA  241

Query  1218  KMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFT  1039
               LPFAR R+ ECYFWILG           +I T++I + SV+DD+YDVYGT +EL+LFT
Sbjct  242   HKLPFARDRVVECYFWILG-----------KILTEVIAMTSVIDDIYDVYGTLEELKLFT  290

Query  1038  NAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGEMKKQIR--T  865
              A++R+D SA +++P+Y++  Y A+LD+ +E+EE MAKE + + + Y     K+ +R  +
Sbjct  291   EAVERWDISAIDQLPEYMRVCYRALLDVYSEIEEEMAKEGRSYRLYYA----KEAVRLVS  346

Query  864   YYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVK  685
             Y++E  W   + +P  EEY+ V+LV+S Y M+ATT  VGMGD +T+E  DWV S+P  V+
Sbjct  347   YHEEAKWLQVQQIPTMEEYMSVALVTSAYSMLATTSFVGMGDAVTEETFDWVFSQPKIVR  406

Query  684   ATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQE  505
             A+  ICRLMDDM+  +FEQ R HVASAVEC++K +  S+QE + E  K ++ AWKD+N+E
Sbjct  407   ASAIICRLMDDMVSPKFEQNREHVASAVECHVKQHGASEQETHKEFNKQVTNAWKDVNEE  466

Query  504   CLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
              L P  VPM +L RVLNL+R I +IYK+ D YT S+   K  +T+ L+  V I
Sbjct  467   YLIPTAVPMTILTRVLNLSRVIDVIYKNEDGYTHSRTVLKDFVTSMLIDSVPI  519



>ref|XP_010062944.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Eucalyptus 
grandis]
Length=567

 Score =   518 bits (1333),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 253/546 (46%), Positives = 364/546 (67%), Gaps = 6/546 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEID----PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  YHP+VWGD FL YDS    +        E ++++LK EV+K+LI A    L KL 
Sbjct  22    RRSAGYHPSVWGDCFLKYDSPSNSVKFKFLGRVEGQIEELKGEVKKMLIDAVDKPLPKLH  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE-NNLYVVSLRFRLLRQEGHHIS  1621
             L+D+IQRLG++YHFE E+   ++ +  +Y      D + ++L+ V+L FRLLRQ G++IS
Sbjct  82    LIDQIQRLGIEYHFEREVDEQLEQVHKSYSRLDHEDFKVDDLHTVALIFRLLRQHGYNIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL  1441
               VF+KF D  G F++SL  DV+G+LSLYEA +L  HG++ LDEAL F  +HLESI    
Sbjct  142   LEVFDKFKDSKGNFRESLISDVQGLLSLYEACHLRCHGDSILDEALPFATTHLESINESK  201

Query  1440  NELAAAK-VSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
                + AK VSHALK P+R+ LPR+ A  Y+ +Y+++ +H++VLL  AKLDFNLLQ+ HQ+
Sbjct  202   VSTSLAKQVSHALKQPLRKGLPRLEASCYIPLYQEEHSHDEVLLTLAKLDFNLLQEQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  ITRWWK++ VP+  PFAR R+ E +FW  G+YFEP++  +R I T++I + S++DD
Sbjct  262   ELGKITRWWKNIDVPRKFPFARDRIVELFFWTTGIYFEPEFAMAREILTKVISLTSIMDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL L   AIQ++D  A + +P+Y++  +   L +   +   +A + K   +
Sbjct  322   IYDVYGTLEELALLNEAIQKWDFDAMDGLPKYMQAYFKEFLQLYEYIGNQLAAKGKSHRL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MKK +  Y+QE  WF+T ++P  EEY+ + L+++ Y M++TT L+GMGD++T+ 
Sbjct  382   IYAKEVMKKLVGAYFQEAKWFHTNYIPTLEEYMPLQLITTGYGMLSTTSLIGMGDVVTEH  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W   +  +VKAT +ICRLMDD+  HEFEQ+RGHV SAVE  MK   +S+QEA  E+ 
Sbjct  442   VLKWSVGDCKSVKATQTICRLMDDVSSHEFEQKRGHVVSAVELLMKYRGISEQEAAEELH  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD N+E L P  VPM VL R+LN +R I ++Y D D YT S  K K  +T+  
Sbjct  502   KGVIDAWKDTNEEFLRPTAVPMSVLTRMLNFSRVIDVLYSDGDNYTHSNTKLKDYVTSLF  561

Query  363   VQPVTI  346
             + P+ +
Sbjct  562   INPLPM  567



>ref|XP_008388200.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=553

 Score =   517 bits (1331),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 258/540 (48%), Positives = 365/540 (68%), Gaps = 11/540 (2%)
 Frame = -2

Query  1959  SVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDKIQ  1780
             S T+ P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR  L+ +     +KL L+D IQ
Sbjct  23    SATFSPSIWGDHFLSYAS--LEVDXELEQHVQELKEEVRXXLMTSXENVSQKLNLIDDIQ  80

Query  1779  RLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFEKF  1600
             RLGV YHF NEI+  +Q I  +  N       ++LY V+LRFRLLRQ+G+++SC +F K 
Sbjct  81    RLGVSYHFGNEIEEILQKIHKSSYNL------DDLYTVALRFRLLRQQGYNVSCDLFNKL  134

Query  1599  LDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAAAK  1420
              D DGKFK+SL  DV G+LSLYEA++  +HGE  LDEALTFT + LE     L+   A  
Sbjct  135   KDGDGKFKESLVDDVVGLLSLYEATHHRIHGEEILDEALTFTTTXLEXXXXRLSPPLAKX  194

Query  1419  VSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELSGITR  1243
             V+HAL   +R+ LPRV A+ Y+ +YE+  ++ N+ LL FAKLDFN LQ+VHQ+ELS ITR
Sbjct  195   VTHALNQXLRKGLPRVEARYYLSVYEELRESPNETLLTFAKLDFNRLQRVHQKELSEITR  254

Query  1242  WWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             WWKDL VP  LPFAR RL E YF W + VYF+PQY F+RR + ++  I S++DD+YD +G
Sbjct  255   WWKDLDVPNKLPFARDRLVEVYFCWSMSVYFQPQYSFARRTSCKVTAITSIMDDIYDTHG  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
               +EL+LFT A+ R+D SA +++P+Y+K  Y A+L+I +E+ E +A E KL+ + +    
Sbjct  315   KFEELELFTEALXRWDVSAIDQLPEYMKLCYRALLNIYSEIHEKLAHEGKLYRIDHAREA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             MK Q+R ++ E   F   H+P  +EY+ VSL++  Y ++ TT  VGM +  T +  DW+ 
Sbjct  375   MKNQVRGFFDEAKXFRQNHMPSLDEYMSVSLMTCGYPLLITTSFVGMEE-ATIDSFDWLL  433

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             + P AVKA  ++ RLMDD+  H+ EQER H ASAV CYM+ Y  +++EA +E+ + ++ A
Sbjct  434   TSPQAVKAASTVTRLMDDIADHKLEQEREHFASAVNCYMRKYGATEEEAIIELRRQVNNA  493

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKDIN+ CLHP  V M +L+R+LN AR + ++YK  D Y  +    K  I +TLV+PV +
Sbjct  494   WKDINEACLHPTAVAMPLLIRILNFARVMDVVYKCEDGYNNADGGLKDFIVSTLVEPVAL  553



>emb|CAN72015.1| hypothetical protein VITISV_010524 [Vitis vinifera]
Length=545

 Score =   516 bits (1330),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 246/538 (46%), Positives = 359/538 (67%), Gaps = 12/538 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    +HP++WGD F+AY  +  +    +E++V+ LKEEVR+ L+AA     + L  +D 
Sbjct  19    RPXAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKEEVRRELMAAARNPSQLLNFIDA  78

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLG            IQHI+D + +    DD  NLY ++L+FRLLRQ+G++ISCG+F 
Sbjct  79    VQRLG----------RIIQHIYDRFHDADDTDD--NLYNIALQFRLLRQQGYNISCGIFN  126

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK+ L  +++GML LYEA++L VHGE  L+EAL FT +HL++ +  L    A
Sbjct  127   KFKDEKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALAFTTTHLKATVESLGYPLA  186

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +V+HALK PIR+ L R+ A+ Y+ +Y+ + +H+K LL+ AKLDFNL+Q +H+ ELS + 
Sbjct  187   EQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  246

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RW K+L     LPFAR R  E YFWILGVYFEPQY  +RRI T++  + S++DD+YD YG
Sbjct  247   RWXKELDFATKLPFARDRFVEGYFWILGVYFEPQYSXARRILTKLFAMASIIDDIYDAYG  306

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +ELQ FT AI+R+D  + + +P+Y+K  Y+ +LD+  E+++ + K+   + V Y    
Sbjct  307   TLEELQPFTEAIERWDIXSIDHLPEYMKLFYVTLLDLYKEIDQELEKDGNQYRVYYAKEV  366

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             +K Q+R Y+ E  W +  ++P  EEY+ V+LV++   ++AT   +GMG+I+TKE  DWV 
Sbjct  367   LKSQVRXYFAEAKWSHEGYIPTIEEYMLVALVTAGSCILATWSFIGMGEIMTKEAFDWVI  426

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             S+P  + A+  I RLMDD+  H+FEQ+RGHVAS +ECYMK Y VS+++ Y E  K +  A
Sbjct  427   SDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVENA  486

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             W DINQECL P  VPM +L RV+NL+R + +IYK+ D YT      K  I + L+ P+
Sbjct  487   WLDINQECLKPTAVPMPLLTRVVNLSRVMDVIYKEGDGYTHVGKVMKDNIGSVLIDPI  544



>sp|Q39760.1|DCS2_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme XC14; Short=D-cadinene 
synthase XC14 [Gossypium arboreum]
 gb|AAA93065.1| (+)-delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=554

 Score =   517 bits (1331),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/540 (46%), Positives = 352/540 (65%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD FL    K   ID   E+  QQLKEEVRK+++A    S +KL  +D 
Sbjct  22    RPKADFQPSIWGDLFLNCPDK--NIDAETEKRHQQLKEEVRKMIVAPMANSTQKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY  SLRFRLLR+ G ++SC VF 
Sbjct  80    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSLRFRLLREHGFNVSCDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT +HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSLAVASLDYPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNKVLL FAK+DFN++Q +H++ELS I+
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +T AI+R+D    +E+P+Y+K  Y A+LD+  EME+++AK  + + V Y    
Sbjct  315   TYEELIPYTKAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAKHGRQYRVEYAKNA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  375   MIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             ++P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY    K +  A
Sbjct  435   NDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+N+E L P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++PV +
Sbjct  495   WKDVNKEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPVAL  554



>ref|XP_003618357.1| (+)-delta-cadinene synthase isozyme A [Medicago truncatula]
Length=557

 Score =   516 bits (1330),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 248/541 (46%), Positives = 360/541 (67%), Gaps = 1/541 (0%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVL-IAAPPASLEKLELVD  1789
             R    +HP VWGDYF+ YDS+  E+D +   ++  LK+EVR +  I+      EK+ L+D
Sbjct  17    RNLADFHPCVWGDYFIQYDSESVELDQNISAQIDALKKEVRNMFNISKTEKPSEKINLID  76

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
              I RLGV YH+ENEI   +Q+I  +Y    +   ++NL  +S+ FRLLRQ+G H+S  VF
Sbjct  77    SICRLGVSYHYENEIDEVMQYIHKSYVENGEITLQDNLCTLSVLFRLLRQQGFHVSPNVF  136

Query  1608  EKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA  1429
              +F D+ G F + L  DVEGMLSLYEAS++ VHGE  L++AL FT++HLESI+  L+   
Sbjct  137   NQFKDEQGNFSERLITDVEGMLSLYEASHMMVHGEEILEKALAFTSTHLESIVTQLSPFL  196

Query  1428  AAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGI  1249
             AA+V H+LK  + R   R+ A+ Y+ IYE+D +HN+ LL  AKLDFN+LQ +H++E   I
Sbjct  197   AAQVKHSLKQALHRNFHRLEARRYISIYEKDPSHNETLLTLAKLDFNILQCLHRKEFGKI  256

Query  1248  TRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVY  1069
              +WWK++ +PK LP+ R R+ E  FW+L VYFEPQY  +R   T++  + S++DD YD Y
Sbjct  257   CKWWKEIDIPKNLPYVRDRIVEMCFWVLAVYFEPQYSQARIKLTKLGALLSIIDDTYDAY  316

Query  1068  GTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIG  889
             G+ DEL+LFT AI+R+D S+ + +P Y+K IY+++L +  E+EE M KE +L+ + Y I 
Sbjct  317   GSIDELELFTKAIERWDISSMDGLPNYMKLIYISVLKVLEEVEEDMTKEGRLYTLKYYIK  376

Query  888   EMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWV  709
             E +  ++ Y  E  WF   +VP  EEYL++S ++ C+ ++ T+  +GMG+  T+ +  WV
Sbjct  377   EFQMVVQAYVTEARWFNNNYVPTVEEYLQISKITCCHSLLTTSSYIGMGETATENIFKWV  436

Query  708   TSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISK  529
             ++ P  V A  +ICRLMD+++  EFE++RGHV S ++CYMK Y +S++ A  E +K I+ 
Sbjct  437   SNWPKIVDAISTICRLMDEIVTSEFERKRGHVCSLLDCYMKQYGMSREAAIQECKKEIAI  496

Query  528   AWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVT  349
             AWK +N ECL P  VPM  L R LNLAR + ++YKD D YT S+   KS I   LV PV 
Sbjct  497   AWKVVNSECLRPTKVPMPFLTRALNLARFMDVVYKDEDNYTRSEGLMKSYIKAVLVDPVP  556

Query  348   I  346
             I
Sbjct  557   I  557



>gb|ABK63808.1| sesquiterpene cyclase [Centella asiatica]
Length=563

 Score =   516 bits (1330),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 256/544 (47%), Positives = 363/544 (67%), Gaps = 5/544 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSK--LTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             R +V YHP+VWGD+FL+Y +   LT  D  +  E++ LKEEV+++L  A     ++L L+
Sbjct  21    RPTVQYHPSVWGDHFLSYPTHGHLTAGDSDKVEEIKLLKEEVKQMLFKAGDNPQQQLVLI  80

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCI-KGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHF +EI  +++ + ++Y     K  ++ + ++ +L FRLLRQ+GH++S  
Sbjct  81    DDIQRLGVAYHFVSEIDEALKCMSESYQQLSEKMIEDQDFHMTALLFRLLRQQGHNVSAD  140

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNE  1435
              F KF D +G F++ L KDV G+LSLYEA++L VHGE  L+EAL FT S +E +L   + 
Sbjct  141   EFLKFKDNNGAFQECLMKDVRGILSLYEATHLRVHGEDILEEALAFTTSQIE-LLEFSDN  199

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
             + A +   ALK PIR+ L RV A+ Y+ IYE+  +HNKVL++ AKLDFN LQK+HQ ELS
Sbjct  200   MLANEAKRALKRPIRKDLNRVIAQHYISIYEKIDSHNKVLMKLAKLDFNYLQKLHQGELS  259

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I  WW+ L   +  PFAR R+ E YF ILGVYFEPQY  +RRI T+ I + S+LDD+YD
Sbjct  260   YICSWWRGLNAKEKFPFARDRIVEDYFRILGVYFEPQYLLARRILTKCIAMNSILDDIYD  319

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK-LFHVSY  898
              YGT DEL +FT+AIQR+D +A +++P+Y+K  Y A+LD   E+E+ M +  + LF V +
Sbjct  320   AYGTLDELLIFTDAIQRWDINAMDQLPEYMKHYYQALLDFFCEIEKYMVETGRPLFRVQH  379

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                + K+  R Y QE  W    +VP  EEY+  +L+++ Y  + T   VGMGD+ T+E  
Sbjct  380   AKDKYKQLARAYLQEAQWSNKSYVPTMEEYITNALITTGYTFLGTCSFVGMGDVATREAF  439

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DWVT++PL ++A   +CR+ DD++GHE EQER HVASA+ECYMK Y  SK E   E +K 
Sbjct  440   DWVTNDPLMIRAASVVCRICDDIVGHEMEQERQHVASAIECYMKQYGASKDETVAEFKKW  499

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             ++ AWKD+N+ECL+P  + M +  R+ N+   I  +Y+  D YTFS    K +IT+ LV 
Sbjct  500   VANAWKDLNKECLNPTTMAMPLCTRIFNMTCVIHCLYQQKDAYTFSNNSTKEMITSVLVD  559

Query  357   PVTI  346
             PV I
Sbjct  560   PVPI  563



>ref|XP_006475310.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=983

 Score =   531 bits (1367),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/508 (51%), Positives = 354/508 (70%), Gaps = 3/508 (1%)
 Frame = -2

Query  1863  QLKEEVRKVLIAAPPASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE  1684
             +LK+E+R++L A    S   L+L+D IQRLGV YHFE+EI   +  +     +    D+E
Sbjct  477   ELKKEIRRMLKADNKPS-RTLQLIDAIQRLGVSYHFESEIDEILGKMHKASQDSDLCDNE  535

Query  1683  NN-LYVVSLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHG  1507
             N+ LY +SL FRLLRQ G+ IS  VF+KF D DG FK SL KDV GMLSLYEA++LGVH 
Sbjct  536   NDELYYISLHFRLLRQNGYKISADVFKKFKDTDGNFKTSLAKDVRGMLSLYEATHLGVHE  595

Query  1506  ETTLDEALTFTASHLESILP-GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQT  1330
             E  LDEAL FT SHLESI    +      +V HAL  PI R L R+ A++Y+ IY+++  
Sbjct  596   EDILDEALAFTTSHLESIATHQIRSPLVEQVKHALVQPIHRGLQRLEARQYIPIYQEESP  655

Query  1329  HNKVLLRFAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFE  1150
             HN+ LL FAKLDFN LQK+HQ+EL  I+RWWK+L     LPF R R+AECYFWILGVYFE
Sbjct  656   HNEALLTFAKLDFNKLQKLHQKELGDISRWWKELDFAHKLPFIRDRVAECYFWILGVYFE  715

Query  1149  PQYHFSRRITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYL  970
             PQY F+RRI T++I + SV+DD+YDVYG  +EL+LFT+AI+R+D SA +++P+Y+K  Y 
Sbjct  716   PQYSFARRILTKVISMTSVIDDIYDVYGKIEELELFTSAIERWDISAIDQLPEYMKLCYR  775

Query  969   AILDITTEMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLV  790
             A+LD+ +E E+ +A + K + + Y    MK  ++ Y+ E  W    +VP  +EY+ V+LV
Sbjct  776   ALLDVFSEAEKDLAPQGKSYRLYYAKEAMKNMVKNYFYEAKWCLQNYVPTVDEYMTVALV  835

Query  789   SSCYMMIATTCLVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVA  610
             +S   M++TT  VGMGDI+TKE  +W+ S P  ++A+  +CRLMDD++ H+FEQ RGHVA
Sbjct  836   TSGSPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRASSIVCRLMDDIVSHKFEQSRGHVA  895

Query  609   SAVECYMKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLI  430
             S+VECYMK +  +++EA  E  K +S AWKDIN++CL P  +PM +L+R+LNL R I +I
Sbjct  896   SSVECYMKQHGATEEEACNEFRKQVSNAWKDINEDCLRPTVLPMPLLMRILNLTRVIDVI  955

Query  429   YKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             YK  D YT S V  K  + + L+ PV I
Sbjct  956   YKYEDGYTHSAVVLKDFVASLLINPVPI  983


 Score =   465 bits (1197),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/447 (51%), Positives = 311/447 (70%), Gaps = 4/447 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             S RRS  +HP++WGD FL+Y S   E D    +  Q+LKEE+R++L    P S   L+L+
Sbjct  21    STRRSANFHPSIWGDRFLSYTSDSMEKDDGSAKH-QELKEEIRRMLKINKP-SQNNLDLI  78

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENN-LYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFE+EI   +  + + + +C  GD+EN+ LY +SL+FRLLRQ G+ IS  
Sbjct  79    DAIQRLGVSYHFESEIDEILGKLHEAHQDCGLGDNENDELYYISLQFRLLRQHGYKISAD  138

Query  1614  VFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP-GLN  1438
             VF++F D DG FK SL KDV GMLSL+EA++LGVH E  LDEAL FT S LESI    ++
Sbjct  139   VFKRFKDSDGNFKTSLAKDVRGMLSLFEATHLGVHEENILDEALAFTTSQLESIAAHQIS  198

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                A +V HAL  PI R L R+ A  Y+ IY++  +HN+ LL FAKLDFN LQK+HQ+EL
Sbjct  199   SPLAEQVKHALIQPIHRGLQRLEATHYIPIYQEQSSHNEALLTFAKLDFNKLQKLHQKEL  258

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
               I+RWWK+L     LPF R R+AECYFWILGVYFEPQY F+RRI T++I + S +DD+Y
Sbjct  259   GDISRWWKELDFAHKLPFIRDRIAECYFWILGVYFEPQYSFTRRILTKVISMTSTIDDIY  318

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             DV G  +EL+LFT+AI+R+D SA +++P+Y+K  Y A+LD+ +E E+ +A + KL+ + Y
Sbjct  319   DVCGKIEELELFTSAIKRWDISAIDQLPEYMKLCYRALLDVYSEAEKDLAPQGKLYRLHY  378

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MK  ++  + E  W +  ++P  +EY+ V+LV+S Y M++TT  VGMGDI+TKE  
Sbjct  379   AKKAMKNIVKNCFFEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESF  438

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHE  637
             +W+ S P  ++A+  +CRLMDDM  HE
Sbjct  439   EWLFSNPRFIRASSVVCRLMDDMASHE  465



>sp|E2E2N7.1|BCGS_ORIVU RecName: Full=Bicyclogermacrene synthase; Short=Ovtps4 [Origanum 
vulgare]
 gb|ADK73618.1| terpene synthase 4 [Origanum vulgare]
Length=555

 Score =   516 bits (1329),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 252/547 (46%), Positives = 372/547 (68%), Gaps = 21/547 (4%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R+S  +HP++WGD+FL+Y+S  T+I  +EE EV + KE VR++L   P  S  K+EL+D 
Sbjct  21    RKSAKFHPSIWGDFFLSYNSDNTQISEAEEEEVAKQKEAVRELLAQVPEGSTYKMELIDL  80

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV+YHFE EI  S+ +I   ++N    DDE  +   +LRFRLLRQ+G+ + C VF 
Sbjct  81    IQRLGVNYHFEKEIHDSLNYI---HENSQHNDDE--VRTTALRFRLLRQQGYRVPCDVFR  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILP----GLN  1438
             KF D +G F  +LT DVEG+L LYEAS+L   GE  LD A+ F++SHL+++L     G  
Sbjct  136   KFTDGEGNFATALTNDVEGLLELYEASHLATRGEEILDRAMEFSSSHLQALLNQHLVGSV  195

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
              L+  +V  ALK+PIR+TL R+GA++++ +Y++D++ N++LL FAKLDFN++QK+HQREL
Sbjct  196   SLSK-RVDEALKMPIRKTLTRLGARKFISLYQEDESRNELLLNFAKLDFNMVQKMHQREL  254

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
             S  TRWWK L V K +P+AR R+ EC+FWI+GVYFEP Y  +RRI ++ I + S++DD Y
Sbjct  255   SDATRWWKKLEVAKRMPYARDRVVECFFWIVGVYFEPCYATARRILSKAINMASIVDDTY  314

Query  1077  DVYGTQDELQLFTNAIQRFDTSAS-NEVPQYLKKIYLAILDITTEMEEVMAKE---NKLF  910
             + Y T DELQ+ T+AIQR+D + +  + P +++  Y A++    E+E+ + +     +L+
Sbjct  315   E-YATLDELQILTDAIQRWDVNETLEDSPPHVQMCYKALIQAYAEIEDEVVENFGGEELY  373

Query  909   HVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMG-DII  733
              V Y I  +K+    +++E  W Y   +P  EEY+KV+ V+  YMM++TT LVG+G D +
Sbjct  374   RVQYAIEHVKQSAVAFFEEAKWIYNNSIPTVEEYMKVAFVTCGYMMLSTTSLVGVGSDRV  433

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             +K   DW+ +EPL V+A+C ICRLMDD++G E+E++     S+V CYMK Y VSK EA  
Sbjct  434   SKADFDWIVNEPLIVRASCVICRLMDDLVGDEYEEK----PSSVLCYMKQYVVSKDEARA  489

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
              +E+ +  AWKD+N+EC+ P P  M++L RVLNL R I L+Y++ D YT    + K  + 
Sbjct  490   RLEQQVKDAWKDMNEECIEPRPASMQILTRVLNLGRVIHLLYREGDSYTDPN-RSKEWVK  548

Query  372   TTLVQPV  352
                V P+
Sbjct  549   MVFVDPI  555



>sp|P93665.1|DCS1_GOSHI RecName: Full=(+)-delta-cadinene synthase; Short=D-cadinene synthase 
[Gossypium hirsutum]
 gb|AAC12784.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score =   516 bits (1328),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 247/540 (46%), Positives = 352/540 (65%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD+FL    K   ID   ++  QQLKEEVRK+++A    S  KL  +D 
Sbjct  22    RPKADFQPSIWGDFFLNCPDK--NIDAETQKRHQQLKEEVRKMIVAPMANSTLKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +Q LGV YHF  EI+  +++I+ N       D EN+LY  SLRFRLLR+ G H+SC VF 
Sbjct  80    VQGLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSLRFRLLREHGFHVSCDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT++HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHLSLAVASLDHPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNKVLL FAK+DFN++Q +H++ELS I+
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +TNAI+R+D    +E+P+Y+K  Y A+LD+  EME+++A+  + + V Y    
Sbjct  315   TYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGRQYRVEYAKNA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  375   MIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             ++P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY    K +  A
Sbjct  435   NDPKIIQASTIICRFMDDVTEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQ  L P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++P+ +
Sbjct  495   WKDVNQGFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPIAL  554



>gb|AIK19227.1| sesquiterpene synthase [Eugenia uniflora]
Length=582

 Score =   516 bits (1330),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 248/546 (45%), Positives = 365/546 (67%), Gaps = 6/546 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEID----PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  +HP++WGDYFL Y S    +        E  +++LK EVRK+L       L+KL 
Sbjct  22    RRSAGFHPSIWGDYFLKYASPSNSMKFKFLGRVEGHIEELKGEVRKMLAGTVDKPLQKLH  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE-NNLYVVSLRFRLLRQEGHHIS  1621
             L+D+IQRLG++YHFE EI   ++HI  +Y    + D + ++L++V+L FRLLRQ+G+++S
Sbjct  82    LIDQIQRLGIEYHFEREIDEQLEHIHKSYSPLCREDYKVDDLHMVALIFRLLRQQGYYVS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG-  1444
                F KF D +GKF++SL KD  G+LSLYEA +L  HG++ L+EAL F  +HLES+    
Sbjct  142   SEAFNKFKDSEGKFRESLIKDPRGLLSLYEACHLRCHGDSILEEALPFAITHLESMDESK  201

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
              + + A +VSHALK P+R+ LPR+ A+ Y+ +Y+++ +H++VLL  AKLDFN  Q+ HQ+
Sbjct  202   TSSILAKQVSHALKQPLRKGLPRLEARRYIPLYQEEPSHDEVLLALAKLDFNTQQEQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  ITRWWKD+ VP+  PFAR R+ E +FW  GVYFEP++  +R I T++I + S+LDD
Sbjct  262   ELGNITRWWKDIDVPRKFPFARDRIVELFFWTSGVYFEPEFAVAREILTKVISLTSILDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL L T AIQ++D  A + +P+Y++  Y  +L +   +   +A + + + +
Sbjct  322   IYDVYGTPEELALLTEAIQKWDVDAMDGLPEYMQAYYKELLHLYEYIGNEVATKGRSYRL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
             +Y    MKK ++ Y+QE  WF+T ++P  EEY+ + L+++ Y M+AT  LVGMGD++T+ 
Sbjct  382   AYAKEVMKKLVKAYFQEAEWFHTNYMPTLEEYMSLQLITTGYGMLATASLVGMGDVVTER  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
               +W       VKA  +ICRLMDD+  H+FEQERGHV SAVE  MK   VS+QEA  E++
Sbjct  442   AFEWSVGCCKIVKAAQTICRLMDDLSSHQFEQERGHVVSAVELLMKYRGVSEQEAGEELQ  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD N+E LHP  V   +L R+LN +R + ++Y D D YT S  K K  +T+  
Sbjct  502   KGVVDAWKDTNEEFLHPTAVSTPILTRMLNFSRVMDVLYSDGDNYTHSGTKLKDYVTSLF  561

Query  363   VQPVTI  346
             V P+ +
Sbjct  562   VSPLPM  567



>sp|Q39761.1|DCS1_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme XC1; Short=D-cadinene 
synthase XC1 [Gossypium arboreum]
 pdb|3G4D|A Chain A, Crystal Structure Of (+)-Delta-Cadinene Synthase From 
Gossypium Arboreum And Evolutionary Divergence Of Metal Binding 
Motifs For Catalysis
 pdb|3G4D|B Chain B, Crystal Structure Of (+)-Delta-Cadinene Synthase From 
Gossypium Arboreum And Evolutionary Divergence Of Metal Binding 
Motifs For Catalysis
 pdb|3G4F|A Chain A, Crystal Structure Of (+)- -Cadinene Synthase From Gossypium 
Arboreum In Complex With 2-Fluorofarnesyl Diphosphate
 pdb|3G4F|B Chain B, Crystal Structure Of (+)- -Cadinene Synthase From Gossypium 
Arboreum In Complex With 2-Fluorofarnesyl Diphosphate
 gb|AAA93064.1| (+)-delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=554

 Score =   515 bits (1326),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 350/540 (65%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD FL    K   ID   E+  QQLKEEVRK+++A    S +KL  +D 
Sbjct  22    RPKADFQPSIWGDLFLNCPDK--NIDAETEKRHQQLKEEVRKMIVAPMANSTQKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY  S+RFRLLR+ G+++SC VF 
Sbjct  80    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSIRFRLLREHGYNVSCDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT  HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTHHLSLAVASLDHPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNK LL FAK+DFN+LQ +H++ELS I 
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +TNAI+R+D    +E+P+Y+K  Y A+LD+  EM +++A+  + + V Y    
Sbjct  315   TYEELIPYTNAIERWDIKCIDEIPEYMKPSYKALLDVYEEMVQLVAEHGRQYRVEYAKNA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  375   MIRLAQSYLVEAKWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             S+P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY    K +  A
Sbjct  435   SDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQE L P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++P+ +
Sbjct  495   WKDLNQEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPIAL  554



>ref|XP_010062945.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW70096.1| hypothetical protein EUGRSUZ_F03400 [Eucalyptus grandis]
Length=567

 Score =   515 bits (1327),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 250/546 (46%), Positives = 369/546 (68%), Gaps = 6/546 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEID----PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  YHP+VWGDYFL YDS    +        E ++++LK EV+K+L       L+KL 
Sbjct  22    RRSAGYHPSVWGDYFLKYDSPSNSVKFKFLGRVEGQIEELKGEVKKMLTDIMDKPLQKLH  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE-NNLYVVSLRFRLLRQEGHHIS  1621
             L+D+IQRLG++YHFE EI   ++ I  +Y      D + ++L++V+L FRLLRQ G++IS
Sbjct  82    LIDQIQRLGIEYHFEREIDEQLEQIHKSYSRLDHEDFKVDDLHIVALIFRLLRQHGYNIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG-  1444
               VF+KF D  G F++SL  +V G+LSLYEA +L  HG++ LDEAL F  +HLESI    
Sbjct  142   SEVFDKFKDSGGNFRESLISNVLGLLSLYEACHLRCHGDSILDEALLFATTHLESINESK  201

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             ++   A +VSHALK P+R+ LPR+ A+ Y+ +Y+++ +H++VLL  AKLDFNLLQ+ HQ+
Sbjct  202   VSTNLAKQVSHALKQPLRKGLPRLEARHYIPLYQEEPSHDEVLLTLAKLDFNLLQEQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL  ITRWWK++ VP+   FAR RL E +FW  GVYFEP++  +R I T++I + S++DD
Sbjct  262   ELGKITRWWKNIDVPRKFLFARDRLVELFFWTTGVYFEPEFAMARDILTKVISLTSIIDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL LF  A+Q++D  A + +P+Y++ ++   + +   +   +A + + +++
Sbjct  322   VYDVYGTLEELALFNEAVQKWDVDAMDGLPEYMQALFKEFIQLYEYIGNELATKGRSYYL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MKK +  Y+QE  WF+T ++P  EEY+ + L++S Y M+ATT L+GMG+++T+ 
Sbjct  382   VYAKEVMKKLVSAYFQEAKWFHTNYIPTLEEYMSLQLITSGYEMLATTSLMGMGNVVTEH  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
              L W  S+    KA  +I RLMDD++ HEFEQ+RGHV SAVE  +K   VS+QEA  E++
Sbjct  442   ALKWSISDCKIRKAAQTIGRLMDDIVSHEFEQKRGHVVSAVELLIKYRGVSEQEAVEELQ  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD N+E L P  VPM +L RVLNL+R + ++Y D D YT S+ K K  +T+  
Sbjct  502   KRVIDAWKDTNEEFLRPTAVPMPILTRVLNLSRVVDVLYSDGDNYTHSETKLKDYVTSLF  561

Query  363   VQPVTI  346
             V P+ +
Sbjct  562   VNPLPM  567



>ref|XP_004308569.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=566

 Score =   514 bits (1325),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 250/542 (46%), Positives = 363/542 (67%), Gaps = 9/542 (2%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             RR   + P+VWGD+FL+Y S +   D   ++ V  LKEE++++++A      +KL  ++ 
Sbjct  32    RRVANFSPSVWGDHFLSY-SSMEAADGKSKKHVHDLKEELKRMILAPAERPSQKLHFINN  90

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHF+NEI   ++ +    D     DD+ +L   +L+FRLLRQ+G++ SC +F 
Sbjct  91    IQRLGVSYHFQNEIDKILEQVHREED-----DDDADLCTTALKFRLLRQQGYNASCNMFN  145

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL--NEL  1432
             K  D DGKFK+S   DV G+LSLYEAS+L V GE  L EALTF  +HLES    L  +  
Sbjct  146   KLKDDDGKFKESDINDVVGLLSLYEASHLLVPGEDALMEALTFCTTHLESAAHRLIPSSQ  205

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              + +V+HAL  P+ + +PR+ A+ Y+ +Y++D+++N+ LL FAKLDFN +QKVHQ+ELS 
Sbjct  206   LSKQVTHALYQPLWKGMPRIEARHYLSVYQEDESNNETLLNFAKLDFNFVQKVHQKELSE  265

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             ITRWWKDL     LPFAR R+ E YFW LGVYFEP+Y+F+R I+ +   I +V+DD+YDV
Sbjct  266   ITRWWKDLDFATKLPFARDRVVEAYFWALGVYFEPEYYFARMISAKATSIITVIDDIYDV  325

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             +GT +EL+ FT AI+R+D SA +++P Y+K  Y A+L+  TE+EE +A +   + + Y  
Sbjct  326   HGTYEELKSFTEAIERWDISAVDQLPDYMKVCYTALLNFFTEIEESLANKGISYRLHYAR  385

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
                K Q+R Y+QE  WF  K+ P  EEY+ V   +S + M+A    VG+G I+T++ +DW
Sbjct  386   EGFKVQVRAYFQEAKWFKQKYTPTLEEYMSVERYTS-FFMVAIVSFVGLGAIVTEDSMDW  444

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             V SEP  +KAT  I RLM+D++GH+FEQ+R H ASA+ECYMK Y  +++EA VE+ K ++
Sbjct  445   VFSEPKILKATSIIGRLMNDLVGHKFEQKREHNASAIECYMKQYGATEEEAEVELTKQVN  504

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
             +AWKDIN+E L   P+P  +L  +LN AR   L+YK  D+YT S    K  + +  ++ V
Sbjct  505   EAWKDINEEWLEATPIPRLLLSLILNFARTSELLYKGEDVYTHSGNVLKGYVASLFIESV  564

Query  351   TI  346
              +
Sbjct  565   PM  566



>ref|XP_006475306.1| PREDICTED: (E)-beta-farnesene synthase-like [Citrus sinensis]
Length=555

 Score =   514 bits (1324),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 251/555 (45%), Positives = 365/555 (66%), Gaps = 14/555 (3%)
 Frame = -2

Query  1986  VNVNSSGRRSV----TYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPP  1819
               V+SS  ++V     +HP +WGDYFL   S     D + + E + LK+EVR ++ A   
Sbjct  7     ATVSSSTEKTVRPIAGFHPNLWGDYFLTLASDCKTNDTTHQEEYEALKQEVRSMITATAD  66

Query  1818  ASLEKLELVDKIQRLGVDYHFENEIQASIQHIFDN-YDNCIKGDDENNLYVVSLRFRLLR  1642
                +KL+LVD +QRLGV YHFE EI+ ++++IF N +DN    +D+ +L+ VSLRFRLLR
Sbjct  67    TPAQKLQLVDAVQRLGVGYHFEQEIEDALENIFHNSFDN----NDDVDLHTVSLRFRLLR  122

Query  1641  QEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHL  1462
             Q+G  +SC VFEKF D +GKFK SL K+V+G+LSLYEA +L + GE  LDEA+ FT +HL
Sbjct  123   QQGFKVSCDVFEKFKDDEGKFKASLVKEVQGILSLYEAGHLAIRGEDILDEAIAFTRTHL  182

Query  1461  ESILP---GLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDF  1291
             +S++      N LA  +++HAL  P+RR LPRV  + ++ +Y +D  H+K LL+FAKLDF
Sbjct  183   QSMVSHDVRPNNLAE-QINHALDCPLRRALPRVETRFFLSVYPRDDKHDKTLLKFAKLDF  241

Query  1290  NLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQI  1111
             NL+Q++HQ+ELS ITRWWKDL     LP+AR R+ E YFWI+G YFEP+Y  +R+I T+ 
Sbjct  242   NLVQRIHQKELSAITRWWKDLDFTTKLPYARDRIVELYFWIVGTYFEPKYTLARKIMTKT  301

Query  1110  ICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVM  931
             I   S++DD +D YG  +EL+LF  A+QR+D  A + +P+Y+K +Y A+LD   E+E+ +
Sbjct  302   IYTASIIDDTFDAYGFFEELKLFAEAVQRWDIGAMDILPEYMKVLYKALLDTFNEIEQDL  361

Query  930   AKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLV  751
             AKE +  ++ Y   +M++ ++ Y+ +  WF   +VP ++EY  V LVS  Y M+AT   +
Sbjct  362   AKEGRSSYLPYGKEKMQELVQMYFVQAKWFSEGYVPTWDEYYPVGLVSCGYFMLATNSFL  421

Query  750   GMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVS  571
             GM D+  KE  +W++ +P    A+  ICRL +D++  +FEQ+RGH+AS VECY+K Y VS
Sbjct  422   GMCDVANKEAFEWISKDPKISTASSVICRLRNDIVSQQFEQKRGHIASGVECYIKQYGVS  481

Query  570   KQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVK  391
             ++E      + +  AWKD+N+E L P   P+ ++ R  N+AR I  + K  D YT S   
Sbjct  482   EEEVVTVFTEEVENAWKDMNEEFLKPTAFPVALIERPFNIARVIEFLNKKGDWYTHSHA-  540

Query  390   FKSLITTTLVQPVTI  346
              K  I   L  PVTI
Sbjct  541   IKDQIAAVLRDPVTI  555



>ref|XP_006592521.1| PREDICTED: (-)-germacrene D synthase-like isoform X3 [Glycine 
max]
Length=576

 Score =   514 bits (1325),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 262/556 (47%), Positives = 367/556 (66%), Gaps = 23/556 (4%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEI-----------DPSEEREVQQLKEEVRKVLIAAPP  1819
             R +  + P+VWGDYFL Y     ++           D S  ++ Q  KEEVRK+LIA   
Sbjct  23    RNTANFSPSVWGDYFLYYVPSSVDLLMYTPGRNHMEDDSHIKQAQLTKEEVRKMLIAPID  82

Query  1818  ASLE-KLELVDKIQRLGVDYHFENEIQASIQHIFD---NYDNCIKGDDENNLYVVSLRFR  1651
              +   KLE +D +QRLGV YHFE+EI  ++  I++     +N I  DD+  L  V+L FR
Sbjct  83    NNFYFKLEFIDSVQRLGVSYHFEHEIDGALHQIYNISTKDNNIITHDDD--LCHVALLFR  140

Query  1650  LLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTA  1471
             LLRQ+G+HIS  VF KF D+   F +    D++GMLSLYEA+ L +HGE  L+EA  F  
Sbjct  141   LLRQQGYHISSNVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFAL  200

Query  1470  SHL-ESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLD  1294
               L +S+   L+    A+V H+L+  +R+ LPR+ A  YM  YE+D +H++ LL FAKLD
Sbjct  201   VQLTKSLTTQLSPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLD  260

Query  1293  FNLLQKVHQRELSGITRWW-KDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITT  1117
             FN+LQ++HQ+E++ +TRWW K+L V   LPF R R+AECYFWILG+YFEPQY  +RRITT
Sbjct  261   FNMLQELHQKEVNNVTRWWIKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITT  320

Query  1116  QIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEE  937
             ++I + SV+DD+YD YGT DEL+LFTNAI+R+D    +++P+Y+K  Y+ IL++  E+EE
Sbjct  321   KVIALCSVIDDMYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEE  380

Query  936   VMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTC  757
              M K+ K++ + Y   EMK+ I+ +  E  W +  H P  EEY++V  VSS Y M+ T C
Sbjct  381   EMRKQGKVYCIKYAKKEMKRLIKAHMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITIC  440

Query  756   LVGMGDIITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYN  577
              VGM D  T+EVL W TS+P+ + A   ICRLMDD++G+E   ER HVAS++E YMK +N
Sbjct  441   FVGMKD-TTEEVLIWATSDPIIIGAASIICRLMDDIVGNE---ERRHVASSIESYMKQHN  496

Query  576   VSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQ  397
              S+Q+A  ++ +++  AWKDIN+ CL+P  VPM  LLRV+NL R I ++YKD D YT + 
Sbjct  497   TSRQDAINKLLEMVKSAWKDINEACLNPTEVPMNFLLRVVNLVRMIDVLYKDEDNYTNAG  556

Query  396   VKFKSLITTTLVQPVT  349
                K  I T LV  ++
Sbjct  557   GLMKDYIKTLLVNKMS  572



>ref|XP_004301355.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=554

 Score =   514 bits (1323),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 254/545 (47%), Positives = 367/545 (67%), Gaps = 7/545 (1%)
 Frame = -2

Query  1971  SGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELV  1792
             + R +  Y P++WGD+FL+Y +   E+D S +++ Q+LK +V+ +L+       EKL LV
Sbjct  14    NARPTANYTPSIWGDHFLSYAT--AEVDFSHKQQFQELKRQVKMMLMVPVKEPSEKLNLV  71

Query  1791  DKIQRLGVDYHFENEIQASIQHIFD-NYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCG  1615
             D IQRLGV YHFENEI   ++ I+   + N ++ DD  +LY  +LRFRLLRQ+G+++SC 
Sbjct  72    DDIQRLGVSYHFENEIDEVLEQIYQATHGNDMENDD--DLYTTALRFRLLRQQGYNVSCD  129

Query  1614  VFEKFLD-KDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLN  1438
             +F KF +  D  FK +L  DV G+LSLYEA++L +HGE  L+EAL FT +HLESI   L+
Sbjct  130   IFNKFKEGSDQTFKQTLQSDVSGLLSLYEATHLRIHGEDILEEALDFTTTHLESIKHSLS  189

Query  1437  ELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQREL  1258
                + +VSH+L  P+R+ + RV A+ Y+ IY +  +HN+ LL FAKLDFNLLQ+VHQ EL
Sbjct  190   HSLSKQVSHSLNQPLRKGIIRVEARYYLSIYHECDSHNETLLTFAKLDFNLLQQVHQIEL  249

Query  1257  SGITRWWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDL  1081
               ITRWWKDL V   LPF R R+ E YF W L + FEP+Y F+RR   ++  + S+LDD+
Sbjct  250   CEITRWWKDLDVRNELPFTRDRVTEVYFCWALSICFEPEYAFARRTLCKVTALTSILDDI  309

Query  1080  YDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVS  901
             YD+YGT +EL+LFT AI+R+D    + +P Y+K  Y A+LD+ TE+EE +AKE KL+ + 
Sbjct  310   YDLYGTLEELELFTEAIERWDIRVIDALPNYMKVCYKALLDVYTEVEEELAKERKLYLIH  369

Query  900   YTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEV  721
             Y    MK Q R+YY E  WF+ K++P  +EY+ +S ++S Y ++ TT  V M +I T++ 
Sbjct  370   YAREAMKLQARSYYLEAKWFHQKYIPTMDEYIALSSLTSGYPLLITTTFVTMEEITTQDP  429

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
              DW+ + P +VK +  + RLMDD++ H+FEQ+RGHVASAVECYMK +  +++E  +E+  
Sbjct  430   FDWLATYPKSVKGSAVVARLMDDLVSHKFEQKRGHVASAVECYMKEFGATEEETIIELRS  489

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
              +S AWKDIN+  L P  V   +L R+LN A  + ++YK  D YT      K LIT+ L+
Sbjct  490   KVSDAWKDINESFLVPNYVSRPLLTRILNFACVMDVVYKYEDGYTTQHGMLKDLITSVLI  549

Query  360   QPVTI  346
             + V +
Sbjct  550   EQVPV  554



>ref|XP_010062943.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Eucalyptus 
grandis]
Length=567

 Score =   514 bits (1324),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/546 (46%), Positives = 366/546 (67%), Gaps = 6/546 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEID----PSEEREVQQLKEEVRKVLIAAPPASLEKLE  1798
             RRS  YHP+VWGD FL YDS    +        E ++++LK EV+K+L       L+KL 
Sbjct  22    RRSAGYHPSVWGDCFLKYDSPSNSVKFKFLGRVEGQIEKLKGEVKKMLTDIMDKPLKKLH  81

Query  1797  LVDKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDE-NNLYVVSLRFRLLRQEGHHIS  1621
             L+D+IQRLG++YHFE EI   ++ I  +Y      D + ++L++V+L FRLLRQ G++IS
Sbjct  82    LIDQIQRLGIEYHFEREIDEQLEQIHKSYSRLDHEDFKVDDLHIVALIFRLLRQHGYNIS  141

Query  1620  CGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG-  1444
               VF+KF D  G F++SL  DV G+LSLYEA +L  HG++ LDEAL F  +HLESI    
Sbjct  142   SEVFDKFKDSKGNFRESLISDVRGLLSLYEACHLRCHGDSILDEALPFATTHLESINESK  201

Query  1443  LNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQR  1264
             ++   A +VSHALK P+R+ LPR+ A  Y+ +Y+++ +H++VLL  AKLDFNLLQ+ HQ+
Sbjct  202   VSANLAKQVSHALKQPLRKGLPRLEASCYIPLYQEEPSHDEVLLSLAKLDFNLLQEQHQK  261

Query  1263  ELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDD  1084
             EL+ ITRWWK++ VP+   FAR R+ E +FW  G+YFEP++  +R I T++I + S++DD
Sbjct  262   ELAKITRWWKNIDVPRKFSFARDRIVELFFWTTGIYFEPEFAMAREILTKVISLTSIMDD  321

Query  1083  LYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV  904
             +YDVYGT +EL L   AIQ++D  A + +P+Y++  +   L +   +   +A + + + +
Sbjct  322   IYDVYGTLEELALLNEAIQKWDFDAMDGLPEYMQAYFKEFLQLYEYIGNQLAAKGRSYRL  381

Query  903   SYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKE  724
              Y    MKK +  Y+QE  WF+T ++P  EEY+ + L+++ Y M++TT L+GMGD++T+ 
Sbjct  382   IYAKEVMKKLVGAYFQEAKWFHTNYIPTLEEYMPLQLITTGYGMLSTTSLIGMGDVVTEH  441

Query  723   VLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIE  544
             VL W   +  +VKAT +ICRLMDD+  HEFEQ+RGHV SAVE  MK   +S+QEA  E+ 
Sbjct  442   VLKWSVGDCKSVKATQTICRLMDDVSSHEFEQKRGHVVSAVELLMKYRGISEQEAAEELH  501

Query  543   KLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTL  364
             K +  AWKD N+E L P  VPM VL R+LN +R I ++Y D D YT S+ K K  +T+  
Sbjct  502   KGVIDAWKDTNEEFLRPTAVPMSVLTRMLNFSRVIDVLYSDGDNYTHSKTKLKDYVTSLF  561

Query  363   VQPVTI  346
             + P+ I
Sbjct  562   LNPLLI  567



>gb|KHG14851.1| (+)-delta-cadinene synthase isozyme C2 [Gossypium arboreum]
Length=564

 Score =   514 bits (1323),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/550 (45%), Positives = 354/550 (64%), Gaps = 17/550 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD+FL    K   ID   E+  QQLKEEVRK+++A    S +KL  +D 
Sbjct  22    RPKADFQPSIWGDFFLNCPDK--NIDAGTEKRHQQLKEEVRKIIVAPMANSTQKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY +SLRFRLLR+ G+++SC VF 
Sbjct  80    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTISLRFRLLREHGYNVSCDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT +HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSLAVASLDHPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNK LL FAK+DFN+LQ +H++ELS I 
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQ----------RFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENK  916
             T +EL  +TNAI+          R+D    +E+P+Y+K  Y A+LD+  EME+++A+  +
Sbjct  315   TYEELIPYTNAIERLDFFNFVGNRWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGR  374

Query  915   LFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI  736
              + V Y    M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI
Sbjct  375   QYRVEYAKKAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  434

Query  735   ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAY  556
             +T E   W  S+P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY
Sbjct  435   VTPETFKWAASDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAY  494

Query  555   VEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLI  376
                 K +  AWKD+NQE L P  +P +VL R LNLAR + ++Y++ D YT+     K  I
Sbjct  495   DIFNKHVESAWKDVNQEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGI  554

Query  375   TTTLVQPVTI  346
             T+ L++P+ +
Sbjct  555   TSLLIEPIAL  564



>ref|XP_007028200.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY08702.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=556

 Score =   513 bits (1322),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 255/549 (46%), Positives = 356/549 (65%), Gaps = 7/549 (1%)
 Frame = -2

Query  1989  DVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASL  1810
             D   N+  R    + P +WG+ FL+  S++  ++ + +   ++LK+EVR +L        
Sbjct  14    DTMSNNENRHLANFRPNIWGELFLSCPSEVN-MNATTQLRFEELKQEVRSMLATPMDKPS  72

Query  1809  EKLELVDKIQRLGVDYHFENEIQASIQHIFDNYDNC-IKGDDENNLYVVSLRFRLLRQEG  1633
             +KL L+D +QRLGV YHFE EI+ S++ I   Y NC ++ DD  +L   ++RFRLLR+ G
Sbjct  73    QKLYLIDAVQRLGVAYHFEKEIEDSLEII---YPNCNVERDD--DLCSTAVRFRLLREHG  127

Query  1632  HHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESI  1453
              ++ C  F KF D+ G FK SL  DV G+L LYEA++L VHGE  L+EAL FT+SHL+S 
Sbjct  128   FNVHCESFNKFKDEKGNFKASLISDVRGLLELYEAAHLRVHGEQILEEALAFTSSHLKSA  187

Query  1452  LPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKV  1273
                +    + ++++ALK P+R++LPR+ A+ Y+ IYE+  T    LL FAKLDF LLQ +
Sbjct  188   ETMVEYPLSTQINNALKRPLRKSLPRLVARNYISIYERYVTQEDTLLEFAKLDFKLLQHL  247

Query  1272  HQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSV  1093
             H++E+  + RWWK L V K  PF R RL ECY W+LGVYFEP Y  +R   T++  + S+
Sbjct  248   HKKEIKEVYRWWKGLDVAKNFPFIRDRLVECYLWMLGVYFEPHYSLARTFLTKVSALTSI  307

Query  1092  LDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKL  913
             LDD+YD YGT++EL++FTNAIQR+D S  N++P Y+K  Y  +L +  EMEE+MA++ K 
Sbjct  308   LDDIYDAYGTREELKIFTNAIQRWDISCINQLPHYMKVCYSELLSVYKEMEELMAEQGKS  367

Query  912   FHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDII  733
             + V      MK+Q++ +Y E  W +  + P  EEY+ ++ V+  Y M+  T  VGM D I
Sbjct  368   YRVQLAKEAMKQQVQAFYAEAKWLHENYTPKLEEYMSIASVTCAYHMLTITSFVGMEDTI  427

Query  732   TKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYV  553
             TKE   W  + P  ++A+  I RLM+D+  H+FEQERGHVASAVECYMK Y VS+QEAY 
Sbjct  428   TKETFIWAYNYPKILRASTIISRLMNDIASHKFEQERGHVASAVECYMKQYGVSEQEAYN  487

Query  552   EIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLIT  373
             E +K I  AWKDINQE L P  VP   L R+LNL R I L+YKD D YT +    K+ IT
Sbjct  488   EFDKQIKNAWKDINQEFLKPTVVPKPALNRILNLTRVIDLLYKDEDAYTNAGEAAKTSIT  547

Query  372   TTLVQPVTI  346
             + L+  V I
Sbjct  548   SLLIDQVPI  556



>ref|XP_009338867.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=557

 Score =   513 bits (1321),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 261/544 (48%), Positives = 372/544 (68%), Gaps = 14/544 (3%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             + S TY P++WGD+FL+Y S   E+D   E+ VQ+LKEEVR++L+ +     +KL L+D 
Sbjct  24    KPSATYSPSIWGDHFLSYAS--LEVDAELEQHVQELKEEVRRMLMTSLENVSQKLNLIDD  81

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             IQRLGV YHF NEI+  +Q I ++        D ++L   +L FRLLRQ+G+++SC +F 
Sbjct  82    IQRLGVSYHFGNEIEEILQKIHES------SYDLDDLCTAALFFRLLRQQGYNVSCDLFN  135

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELA-  1429
             KF D +G FK SL  DV G+LSLYEA++L +HGE  LDEALTFT ++LES    L+  + 
Sbjct  136   KFKDGNGNFKGSLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTNLESATFRLSPPSP  195

Query  1428  -AAKVSHALKLPIRRTLPRVGAKEYMQIYEQ-DQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
              A  V+HAL  P+ + LPRV A+ Y+ +Y++  ++ N+ LL+FAKLDFN LQ+VHQ+ELS
Sbjct  196   LAKAVTHALNQPLLKGLPRVEARYYLSVYQELRESPNETLLKFAKLDFNRLQRVHQKELS  255

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYF-WILGVYFEPQYHFSRRITTQIICIWSVLDDLY  1078
              ITRWWK+L VP  LPFAR RL E YF W L V F+PQY F+RRI++++  I S++DD+Y
Sbjct  256   EITRWWKNLDVPNKLPFARDRLVEVYFCWGLTVDFQPQYSFARRISSKVTAIISLIDDIY  315

Query  1077  DVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSY  898
             + YGT ++L+LFT AI+ +D SA +++P+Y+K  Y A+LD+ TE+ E +A + KL+ + +
Sbjct  316   E-YGTNEQLELFTEAIESWDVSAIDQLPEYMKVCYRALLDVYTEIHEKLAHDGKLYRIHH  374

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVL  718
                 MKK +R Y+ E   F  KH+P  +EY+ VSLV+   +++ TT  VGM +  T E  
Sbjct  375   AREAMKKVVRGYFDEAKLFRQKHMPSLDEYMSVSLVTGGCLLLITTSFVGMEEA-TIESF  433

Query  717   DWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKL  538
             DW+ + P  VKAT +I RLMDD+  H+FEQE+ H    V CYMK Y  +++EA  E++  
Sbjct  434   DWLLTSPPVVKATSTIQRLMDDIAEHKFEQEKEHFIGVVNCYMKKYGATEEEAITELQGQ  493

Query  537   ISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQ  358
             ++ AWKDIN+ CLHP  VPM +L+R LN AR + + YK  D YT ++   K LI +TLV+
Sbjct  494   VNNAWKDINEACLHPTAVPMPLLIRFLNFARVMDVAYKHEDGYTNAKGVVKDLIISTLVE  553

Query  357   PVTI  346
             PV +
Sbjct  554   PVAL  557



>ref|XP_006367763.1| PREDICTED: germacrene C synthase-like, partial [Solanum tuberosum]
Length=596

 Score =   514 bits (1324),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 259/545 (48%), Positives = 368/545 (68%), Gaps = 6/545 (1%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVD  1789
              R    + PT+WGD+FL+Y  + TEI   E+ EV +LK  +RK L+  P  S +KL L+D
Sbjct  54    SRHLADFEPTLWGDHFLSYTPQQTEISSQEKVEVDELKVMIRKTLVETPDNSTQKLVLID  113

Query  1788  KIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVF  1609
             +IQRLGV YHF NEI+ SI++IFD+       DD  NL+VV+LRFRLLRQ+ H+IS  VF
Sbjct  114   RIQRLGVAYHFHNEIEISIKNIFDSQLQSETNDD--NLHVVALRFRLLRQQRHYISSDVF  171

Query  1608  EKFLDKDGKFKDSLTK-DVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGL-NE  1435
             ++F+D +G FK++L   DV+G+LSLYEAS++ +H E  L+EAL FT + LES+LP L N 
Sbjct  172   KQFMDHNGNFKETLINYDVQGLLSLYEASHMRMHDEEILEEALIFTTTRLESLLPNLTNN  231

Query  1434  LAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELS  1255
                 +V+ AL  PI  T+PRVGA++Y+ IYE  ++HN +LL+FAKLDFN+LQKVHQ EL+
Sbjct  232   SLKIQVTEALSQPIHETVPRVGARKYIHIYENIKSHNDLLLKFAKLDFNMLQKVHQDELN  291

Query  1254  GITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYD  1075
              I+RWWKDL +   LP+A+ R  E YFWI+G+  EPQY   RR+ T+++ + S++DD YD
Sbjct  292   EISRWWKDLDIANKLPYAKDRFVESYFWIIGLSVEPQYSRLRRMLTKVVNMNSIVDDTYD  351

Query  1074  VYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHV-SY  898
              YGT DEL   TNAI+R+D S  + +P Y++ IY  +L+I  E EEV+AKE K   V  Y
Sbjct  352   AYGTHDELVFLTNAIERWDISVMDSLPPYMRIIYQELLNIYDEAEEVLAKEGKSNSVIYY  411

Query  897   TIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDI-ITKEV  721
                E KK    Y +E  W    ++P  +EY+K +++++  M+  T  LVGM  + +TKE 
Sbjct  412   AKNEWKKLTAAYMKESDWLNAGYIPKCDEYMKNAVITATCMLYVTNSLVGMDKLYMTKEN  471

Query  720   LDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEK  541
             ++W+T+  L  ++  +ICR MDD+  HE  Q+RGHVAS V+CY+K Y VSK+EA+VEI K
Sbjct  472   IEWLTNGLLVARSAGAICRCMDDISDHEVNQQRGHVASIVDCYIKEYEVSKEEAHVEIRK  531

Query  540   LISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLV  361
             +++ AWKDIN+E L    VP  VL   LN A+ +   + D+D YT  + + K +++  LV
Sbjct  532   MVTNAWKDINKEFLFHKDVPFFVLELGLNFAQLVDTTFGDDDEYTSPKSETKKMLSLLLV  591

Query  360   QPVTI  346
             + + I
Sbjct  592   ESINI  596



>ref|XP_009355684.1| PREDICTED: (-)-alpha-pinene synthase-like [Pyrus x bretschneideri]
Length=560

 Score =   513 bits (1321),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 362/542 (67%), Gaps = 2/542 (0%)
 Frame = -2

Query  1968  GRRSVTYHPTVWGDYFLAYDSKLTEIDPSE-EREVQQLKEEVRKVLIAAPPASLEKLELV  1792
              R++  +HP+VWGD F+ YD     I  ++ +++V +LKE VR+    +      +L+L+
Sbjct  20    ARQTANFHPSVWGDQFINYDDSQDIITRAQSQQQVDELKEIVREGFTTSATDFSLQLKLI  79

Query  1791  DKIQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGV  1612
             D IQRLG+ YHFE EI  +++ +   +D+   G+++ +LY V+L FRLLRQ G+++SC +
Sbjct  80    DAIQRLGLAYHFEREIGEALERMHSTFDDD-HGNNDVDLYTVALCFRLLRQHGYNVSCAI  138

Query  1611  FEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNEL  1432
             F  F D+   FK+SL  D+ GMLS YEA++L VHGE  L+EAL FT +HLES    ++  
Sbjct  139   FNNFKDESSYFKESLIDDMSGMLSFYEATHLRVHGEDILEEALVFTTTHLESAATRVSNP  198

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
              A +++ AL+ P+R++L R+ A+ Y+ IY+++ +HN+ LL+ AKLDFNL+Q +H++EL  
Sbjct  199   LATQITQALERPLRKSLERLSARRYISIYQEEASHNESLLKLAKLDFNLVQPLHKKELQE  258

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             ITRWW+ L   + LPFAR R+ E YFWI+GVYFEPQY   R+I T++  + ++LDD+YD 
Sbjct  259   ITRWWRALDFERKLPFARDRMVELYFWIVGVYFEPQYSVGRKIMTKVSVLLTILDDIYDA  318

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             +GT +EL +FT AI R+D +  +E+P+Y++  Y A+L++  ++E  MAKE + + V Y I
Sbjct  319   FGTFEELVVFTEAIDRWDVNCIDELPEYMQTFYHALLNLYNDIEAEMAKEGRSYRVPYAI  378

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK Q R+Y  E  W +   VP  EEY++V+ VS  Y  + T  L+GMGD++TKE  +W
Sbjct  379   QAMKDQARSYCNEARWLHEGRVPSMEEYMRVATVSISYTFLTTISLLGMGDVVTKEAFEW  438

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             + ++P  V+A  +I RLMDD++  +FE+ERGH AS+V+CYMK Y VSKQE     +K I 
Sbjct  439   LFTDPKIVRAANTIFRLMDDIVSTDFEKERGHAASSVDCYMKQYGVSKQETVDVFQKQIM  498

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
               WKDIN+E L P  VPM +L+RVLNL R   L+YK  D +T      +  +T+  + PV
Sbjct  499   GLWKDINEEFLRPTSVPMPILMRVLNLTRVTDLLYKGEDGFTRVGKVTRDSVTSVCINPV  558

Query  351   TI  346
              +
Sbjct  559   PL  560



>gb|KHG05331.1| delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=554

 Score =   512 bits (1319),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 351/540 (65%), Gaps = 7/540 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R    + P++WGD FL    K   ID   E+  QQLKEEVRK+++A    S +KL  +D 
Sbjct  22    RPKADFQPSIWGDLFLNCPDK--NIDAETEKRHQQLKEEVRKMIVAPMANSTQKLAFIDS  79

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLGV YHF  EI+  +++I+ N       D EN+LY  SLRFRLLR+ G ++S  VF 
Sbjct  80    VQRLGVSYHFTKEIEDELENIYHN-----NNDAENDLYTTSLRFRLLREHGFNVSYDVFN  134

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPGLNELAA  1426
             KF D+ G FK S+T DV G+L LY+ASYL VHGE  LDEA++FT +HL   +  L+   +
Sbjct  135   KFKDEQGNFKSSMTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSLAVASLDYPLS  194

Query  1425  AKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSGIT  1246
              +VSHALK  IRR LPRV A+ Y+ +Y+  ++HNKVLL FAK+DFN++Q +H++ELS I+
Sbjct  195   EEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254

Query  1245  RWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDVYG  1066
             RWWKDL   + LP+AR R+ E YFWI GVYFEPQY   R++ T++I + S++DD YD Y 
Sbjct  255   RWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYA  314

Query  1065  TQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTIGE  886
             T +EL  +T AI+R+D    +E+P+Y+K  Y A+LD+  EME+++A+  + + V Y    
Sbjct  315   TYEELIPYTKAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGRQYRVEYAKNA  374

Query  885   MKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDWVT  706
             M +  ++Y  E  W    + P FEE+   +L +  Y M+A T  VGMGDI+T E   W  
Sbjct  375   MIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAA  434

Query  705   SEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLISKA  526
             ++P  ++A+  ICR MDD+  H+F+  R    SA+ECYM+ Y V+ QEAY    K +  A
Sbjct  435   NDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESA  494

Query  525   WKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPVTI  346
             WKD+NQE L P  +P +VL R LNLAR + ++Y++ D YT+     K  IT+ L++PV +
Sbjct  495   WKDVNQEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPVAL  554



>ref|XP_010247958.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score =   512 bits (1319),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 248/542 (46%), Positives = 358/542 (66%), Gaps = 4/542 (1%)
 Frame = -2

Query  1965  RRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIAAPPASLEKLELVDK  1786
             R + T+HP++WGD F+ Y     +++ S  ++V++LKEEVR +L  +    LE L L+D 
Sbjct  25    RHTTTFHPSIWGDRFITYTCDNMKLE-SYNQQVEELKEEVRSILRNSANKPLEMLSLIDG  83

Query  1785  IQRLGVDYHFENEIQASIQHIFDNYDNCIKGDDENNLYVVSLRFRLLRQEGHHISCGVFE  1606
             +QRLG+ Y FE EI   ++ IFD +      D ++NL  V+L FRLLRQ G++I C VF+
Sbjct  84    VQRLGLGYQFEREIDKMLEQIFDAH-IVYFNDMDDNLNAVALLFRLLRQHGYNIPCDVFK  142

Query  1605  KFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEALTFTASHLESILPG--LNEL  1432
             KF D+DGKF++SL +D++GMLSLYEA+YLG  GE  LDEAL FT +HL+S +     +  
Sbjct  143   KFRDEDGKFRESLARDIQGMLSLYEAAYLGKRGEEVLDEALAFTTAHLKSTVATDTTSPT  202

Query  1431  AAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQTHNKVLLRFAKLDFNLLQKVHQRELSG  1252
                +V HAL+ P+ R +P++ A+ Y+  YE+D++  +VLL+ AKLDFN  Q ++  ELS 
Sbjct  203   LVKQVKHALEQPLHRGIPKIEARHYISFYEEDKSRIQVLLKLAKLDFNRTQLLYLNELSQ  262

Query  1251  ITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSRRITTQIICIWSVLDDLYDV  1072
             ++RWWK++      P+AR RL ECYFW  GVY EPQY   R+I  +II I ++LDD YD 
Sbjct  263   VSRWWKNIDFTSKTPYARDRLVECYFWSAGVYPEPQYSLGRKILAKIIAITTILDDTYDA  322

Query  1071  YGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITTEMEEVMAKENKLFHVSYTI  892
             YGT +ELQL T+AI+R+D + ++++P+Y+K IY+ +L+I  E+EE M KE + F VSY  
Sbjct  323   YGTFEELQLLTDAIRRWDANETDKLPEYMKVIYVTLLNIYNEIEEEMRKEGRCFCVSYAK  382

Query  891   GEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMIATTCLVGMGDIITKEVLDW  712
               MK  I  Y  E  W    H+P FEE+ K+ L++S  +M+       MG++ TKEV DW
Sbjct  383   EAMKDLIEAYQIEATWLKEGHIPTFEEFSKLGLITSTCIMMTNVIFACMGEMATKEVFDW  442

Query  711   VTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECYMKGYNVSKQEAYVEIEKLIS  532
             ++  P AVK+TC I R +DD+  +EFEQERGHV S++ECYMK Y VS +EA  E+ KL++
Sbjct  443   LSKTPDAVKSTCIIGRFLDDIQTNEFEQERGHVCSSIECYMKQYGVSSEEAKNELRKLVT  502

Query  531   KAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDIYTFSQVKFKSLITTTLVQPV  352
              AWK +N+EC+ P   PM +L+ ++N  R   +IYK  D +T      K+ I   L+ P+
Sbjct  503   NAWKVLNEECITPTAAPMPLLMPLVNFTRLADVIYKHGDAFTNVITGLKTHIKLLLIDPI  562

Query  351   TI  346
             TI
Sbjct  563   TI  564



>gb|KDO74408.1| hypothetical protein CISIN_1g008427mg [Citrus sinensis]
Length=566

 Score =   512 bits (1319),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 261/562 (46%), Positives = 379/562 (67%), Gaps = 13/562 (2%)
 Frame = -2

Query  2007  KEITEMDVNVNSSGRRSVTYHPTVWGDYFLAYDSKLTEIDPSEEREVQQLKEEVRKVLIA  1828
             KE T+ D N     RRS  YHP++WGD+F+   S     +   E+  + LK EV K+L++
Sbjct  10    KESTKADEN-----RRSSNYHPSIWGDHFINVSSNDKYPNAEVEKRFETLKAEVEKLLMS  64

Query  1827  APPA--SLEKL-ELVDKIQRLGVDYHFENEIQASIQHIFDNY--DNC-IKGDDENNLYVV  1666
                A  ++E++  LVD++QRLGV YHFENEI+  +Q I++++   NC +  D  N+LY V
Sbjct  65    NNTAWKTIEEIVTLVDQLQRLGVAYHFENEIKEDLQSIYNSHVNSNCDVNYDHNNDLYTV  124

Query  1665  SLRFRLLRQEGHHISCGVFEKFLDKDGKFKDSLTKDVEGMLSLYEASYLGVHGETTLDEA  1486
             +LRFRLLRQ G+ +S  +F+KF D+ G+FK  LT D  G+L LYEASYL V GE  L+EA
Sbjct  125   ALRFRLLRQHGYKVSADIFKKFKDEKGEFKAMLTNDARGLLCLYEASYLRVQGENILEEA  184

Query  1485  LTFTASHLESILPGLNELAAAKVSHALKLPIRRTLPRVGAKEYMQIYEQDQ-THNKVLLR  1309
               F+  HL+S+LP ++   A +V H+L++P+ R +PR+ A++Y+ IYE D  T N+++L 
Sbjct  185   CEFSRKHLKSLLPHISTSLANQVEHSLEIPLHRGMPRLEARQYISIYEADNSTRNELILE  244

Query  1308  FAKLDFNLLQKVHQRELSGITRWWKDLGVPKMLPFARHRLAECYFWILGVYFEPQYHFSR  1129
              AKLDFNLLQ++H+RELS I+RWWKD+     LPFAR RL ECYFWILGVYFEP+Y  +R
Sbjct  245   LAKLDFNLLQELHRRELSEISRWWKDIDFATKLPFARDRLVECYFWILGVYFEPKYSITR  304

Query  1128  RITTQIICIWSVLDDLYDVYGTQDELQLFTNAIQRFDTSASNEVPQYLKKIYLAILDITT  949
             +  T+II I SV+DD+YDVYGT +EL+LFT+AI+R++ +A+NE+P+Y++  Y A+LD+  
Sbjct  305   KFMTKIIAIASVIDDIYDVYGTLEELKLFTHAIERWEVAAANELPKYMQVCYFALLDVVK  364

Query  948   EMEEVMAKENKLFHVSYTIGEMKKQIRTYYQEFMWFYTKHVPPFEEYLKVSLVSSCYMMI  769
             EME+    +     + Y    +K  +R Y+ E  WF  K+VP FEEY++ S +SS Y M+
Sbjct  365   EMEDKPVNKEPPGCMHYAKEAIKGLVRAYFVEAKWFNAKYVPTFEEYMENSTMSSGYPML  424

Query  768   ATTCLVGMGDI-ITKEVLDWVTSEPLAVKATCSICRLMDDMIGHEFEQERGHVASAVECY  592
             A   LVG+ D+ ITK+ LDW  S P  ++ +  I RL DD+  ++ EQERG   S+VECY
Sbjct  425   AVEALVGLEDMAITKQALDWAISVPKIIRYSSLIARLDDDVRTYKVEQERGDAPSSVECY  484

Query  591   MKGYNVSKQEAYVEIEKLISKAWKDINQECLHPLPVPMKVLLRVLNLARAIFLIYKDNDI  412
             M+ Y VS++EA  +I++++   W +IN+E   P   P++ LL  LNLAR + ++Y++ D 
Sbjct  485   MQQYGVSEEEACNKIKEMVEIEWMNINEEIQDPNHPPLQWLLPSLNLARMMVVLYQNGDG  544

Query  411   YTFSQVKFKSLITTTLVQPVTI  346
             YT S  K K  I + LV P+ +
Sbjct  545   YTNSSGKTKDRIASLLVDPLPM  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6091926715680