BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32790_g1_i1 len=912 path=[1:0-911]

Length=912
                                                                      Score     E

emb|CDP00357.1|  unnamed protein product                                219   6e-67   
ref|XP_009602468.1|  PREDICTED: casparian strip membrane protein ...    211   1e-63   
ref|XP_009789554.1|  PREDICTED: casparian strip membrane protein ...    209   5e-63   
ref|XP_006344265.1|  PREDICTED: CASP-like protein SDM1_58t00016-like    203   1e-60   
ref|XP_004237043.1|  PREDICTED: casparian strip membrane protein ...    202   3e-60   
ref|XP_009606201.1|  PREDICTED: casparian strip membrane protein 2      195   1e-57   
ref|XP_009760874.1|  PREDICTED: casparian strip membrane protein 2      191   3e-56   
ref|XP_004238811.1|  PREDICTED: casparian strip membrane protein 2      189   2e-55   
ref|XP_006355125.1|  PREDICTED: CASP-like protein SDM1_58t00016-like    187   9e-55   
sp|Q5NRN4.1|CASP2_SOLDE  RecName: Full=Casparian strip membrane p...    187   1e-54   Solanum demissum
gb|EYU28778.1|  hypothetical protein MIMGU_mgv1a014587mg                186   5e-54   
ref|XP_011075520.1|  PREDICTED: casparian strip membrane protein ...    186   5e-54   
sp|Q60D27.1|CASP1_SOLDE  RecName: Full=Casparian strip membrane p...    184   1e-53   Solanum demissum
gb|KDO72617.1|  hypothetical protein CISIN_1g045471mg                   184   2e-53   
ref|XP_006482625.1|  PREDICTED: casparian strip membrane protein ...    184   2e-53   
ref|XP_004141446.1|  PREDICTED: casparian strip membrane protein ...    183   5e-53   
ref|XP_008459331.1|  PREDICTED: CASP-like protein 1                     183   1e-52   
sp|P0DI35.1|CASP1_LACSI  RecName: Full=Casparian strip membrane p...    181   4e-52   
ref|XP_002436759.1|  hypothetical protein SORBIDRAFT_10g008220          178   4e-51   Sorghum bicolor [broomcorn]
sp|P0DI33.1|CASP1_PANVG  RecName: Full=Casparian strip membrane p...    177   7e-51   
ref|XP_004965049.1|  PREDICTED: casparian strip membrane protein ...    177   8e-51   
ref|XP_010088133.1|  hypothetical protein L484_013577                   177   9e-51   
ref|XP_010683143.1|  PREDICTED: casparian strip membrane protein 3      177   1e-50   
ref|XP_006431199.1|  hypothetical protein CICLE_v10013539mg             176   3e-50   
ref|XP_009763947.1|  PREDICTED: casparian strip membrane protein 1      175   4e-50   
gb|AFW85233.1|  membrane protein 2                                      175   6e-50   
gb|KHN12189.1|  CASP-like protein 1                                     175   6e-50   
ref|NP_001174676.1|  Os06g0231050                                       175   8e-50   
ref|NP_001148957.1|  casparian strip membrane protein 1                 174   1e-49   Zea mays [maize]
ref|XP_009610092.1|  PREDICTED: casparian strip membrane protein 1      174   2e-49   
ref|XP_010029309.1|  PREDICTED: casparian strip membrane protein 1      174   2e-49   
ref|XP_006655941.1|  PREDICTED: casparian strip membrane protein ...    174   2e-49   
sp|P0DI44.1|CASP1_SOLTU  RecName: Full=Casparian strip membrane p...    174   2e-49   
ref|XP_006363407.1|  PREDICTED: casparian strip membrane protein ...    174   2e-49   
ref|NP_001236648.1|  CASP-like protein 7                                172   5e-49   
ref|XP_004304287.1|  PREDICTED: CASP-like protein 1-like                172   6e-49   
ref|XP_006438724.1|  hypothetical protein CICLE_v10033634mg             172   6e-49   
ref|XP_004955209.1|  PREDICTED: casparian strip membrane protein ...    172   2e-48   
gb|KDO82981.1|  hypothetical protein CISIN_1g044764mg                   171   2e-48   
gb|KHN01253.1|  CASP-like protein 1                                     171   3e-48   
ref|XP_006827304.1|  hypothetical protein AMTR_s00010p00265970          170   4e-48   
ref|XP_004233369.1|  PREDICTED: casparian strip membrane protein 1      170   5e-48   
gb|KDP27167.1|  hypothetical protein JCGZ_19866                         170   6e-48   
ref|XP_007153553.1|  hypothetical protein PHAVU_003G045200g             170   7e-48   
ref|XP_004297290.1|  PREDICTED: CASP-like protein 2-like                170   7e-48   
ref|XP_010258295.1|  PREDICTED: casparian strip membrane protein 3      169   1e-47   
ref|XP_010550038.1|  PREDICTED: casparian strip membrane protein ...    168   3e-47   
ref|XP_010066899.1|  PREDICTED: casparian strip membrane protein ...    167   6e-47   
ref|XP_007032593.1|  Casparian strip membrane protein 5, putative       167   7e-47   
ref|XP_008379370.1|  PREDICTED: CASP-like protein 1                     167   1e-46   
ref|XP_009376287.1|  PREDICTED: CASP-like protein 1                     167   1e-46   
ref|XP_010042237.1|  PREDICTED: casparian strip membrane protein ...    166   1e-46   
gb|AFK37802.1|  unknown                                                 166   2e-46   
ref|XP_004975856.1|  PREDICTED: casparian strip membrane protein ...    166   2e-46   
ref|XP_003564046.1|  PREDICTED: casparian strip membrane protein 3      166   2e-46   
ref|XP_002278569.1|  PREDICTED: casparian strip membrane protein 3      166   2e-46   Vitis vinifera
ref|XP_011098775.1|  PREDICTED: casparian strip membrane protein ...    166   3e-46   
ref|XP_010420188.1|  PREDICTED: casparian strip membrane protein ...    165   3e-46   
ref|XP_007046042.1|  Casparian strip membrane protein 5, putative...    166   3e-46   
ref|XP_010453663.1|  PREDICTED: casparian strip membrane protein 5      165   4e-46   
ref|XP_007046043.1|  Casparian strip membrane protein 5, putative...    166   4e-46   
sp|P0DI54.1|CASP1_MALDO  RecName: Full=Casparian strip membrane p...    164   5e-46   
gb|EYU34055.1|  hypothetical protein MIMGU_mgv1a020210mg                164   6e-46   
ref|XP_006338436.1|  PREDICTED: casparian strip membrane protein ...    164   7e-46   
ref|XP_009360608.1|  PREDICTED: CASP-like protein 1                     164   1e-45   
sp|P0DI34.1|CASP2_PANVG  RecName: Full=Casparian strip membrane p...    164   2e-45   
ref|XP_010551838.1|  PREDICTED: casparian strip membrane protein ...    163   2e-45   
emb|CDP02250.1|  unnamed protein product                                163   2e-45   
ref|XP_010492362.1|  PREDICTED: casparian strip membrane protein ...    163   2e-45   
ref|XP_007225906.1|  hypothetical protein PRUPE_ppa011955mg             163   3e-45   
ref|XP_004233676.1|  PREDICTED: casparian strip membrane protein ...    162   3e-45   
ref|NP_001052990.2|  Os04g0460400                                       163   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006665081.1|  PREDICTED: casparian strip membrane protein ...    163   3e-45   
ref|XP_002318369.1|  integral membrane family protein                   162   5e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008230985.1|  PREDICTED: CASP-like protein 1                     162   6e-45   
ref|XP_002533115.1|  conserved hypothetical protein                     161   1e-44   Ricinus communis
ref|XP_003607732.1|  hypothetical protein MTR_4g081880                  162   1e-44   
gb|AFK45120.1|  unknown                                                 161   1e-44   
ref|NP_197033.1|  casparian strip membrane protein 5                    161   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221595.1|  PREDICTED: CASP-like protein 1                     161   1e-44   
sp|P0DI62.1|CASP1_CYNCS  RecName: Full=Casparian strip membrane p...    162   1e-44   
ref|XP_011001927.1|  PREDICTED: casparian strip membrane protein 6      160   2e-44   
sp|Q6Z2U5.2|CASP4_ORYSJ  RecName: Full=Casparian strip membrane p...    160   3e-44   Oryza sativa Japonica Group [Japonica rice]
sp|P0DI58.1|CSPL2_LOTJA  RecName: Full=CASP-like protein 2; Short...    160   5e-44   
ref|XP_008669320.1|  PREDICTED: casparian strip membrane protein ...    159   7e-44   
ref|XP_008341761.1|  PREDICTED: CASP-like protein 1                     159   1e-43   
ref|XP_003621263.1|  hypothetical protein MTR_7g011090                  158   2e-43   
ref|XP_010265175.1|  PREDICTED: casparian strip membrane protein ...    159   2e-43   
gb|KHN25032.1|  CASP-like protein 2                                     158   2e-43   
ref|XP_004490091.1|  PREDICTED: CASP-like protein MTR_5g041900-like     158   2e-43   
ref|NP_001235823.1|  CASP-like protein 6                                158   2e-43   
ref|XP_009609035.1|  PREDICTED: casparian strip membrane protein ...    158   2e-43   
ref|XP_009794323.1|  PREDICTED: casparian strip membrane protein ...    157   3e-43   
ref|XP_003556790.1|  PREDICTED: CASP-like protein 2-like                157   4e-43   
emb|CDX69534.1|  BnaA10g18830D                                          157   4e-43   
ref|XP_008339880.1|  PREDICTED: CASP-like protein 1                     157   6e-43   
ref|XP_006400049.1|  hypothetical protein EUTSA_v10015485mg             156   1e-42   
ref|XP_009121585.1|  PREDICTED: casparian strip membrane protein ...    156   1e-42   
ref|XP_002446616.1|  hypothetical protein SORBIDRAFT_06g018970          155   2e-42   Sorghum bicolor [broomcorn]
ref|XP_011085855.1|  PREDICTED: casparian strip membrane protein ...    155   3e-42   
ref|XP_008663281.1|  PREDICTED: casparian strip membrane protein 2      155   3e-42   
ref|XP_008646251.1|  PREDICTED: casparian strip membrane protein ...    155   4e-42   
sp|P0DI59.1|CASP1_LACSA  RecName: Full=Casparian strip membrane p...    152   3e-41   
sp|P0DI42.1|CASP2_WHEAT  RecName: Full=Casparian strip membrane p...    152   3e-41   
ref|XP_011016793.1|  PREDICTED: casparian strip membrane protein ...    152   5e-41   
ref|XP_010245909.1|  PREDICTED: casparian strip membrane protein ...    153   5e-41   
ref|XP_006289591.1|  hypothetical protein CARUB_v10003142mg             151   8e-41   
ref|XP_010271592.1|  PREDICTED: casparian strip membrane protein ...    152   9e-41   
ref|XP_003613862.1|  hypothetical protein MTR_5g041900                  151   1e-40   
ref|XP_006648782.1|  PREDICTED: CASP-like protein Os02g0578333-like     150   2e-40   
ref|XP_011043416.1|  PREDICTED: casparian strip membrane protein ...    151   2e-40   
ref|XP_010476448.1|  PREDICTED: casparian strip membrane protein ...    151   2e-40   
sp|B9S8Z3.2|CASP4_RICCO  RecName: Full=Casparian strip membrane p...    150   2e-40   Ricinus communis
sp|P0DI32.1|CASP1_TARKO  RecName: Full=Casparian strip membrane p...    150   3e-40   
ref|XP_010458896.1|  PREDICTED: casparian strip membrane protein 6      150   3e-40   
ref|XP_010495793.1|  PREDICTED: casparian strip membrane protein ...    150   4e-40   
sp|D7M7B3.2|CASP5_ARALL  RecName: Full=Casparian strip membrane p...    149   4e-40   
ref|XP_002892791.1|  integral membrane family protein                   150   4e-40   
ref|XP_006339139.1|  PREDICTED: casparian strip membrane protein ...    150   5e-40   
ref|XP_002530531.1|  conserved hypothetical protein                     149   6e-40   Ricinus communis
ref|XP_011004684.1|  PREDICTED: casparian strip membrane protein ...    149   7e-40   
ref|XP_011004682.1|  PREDICTED: casparian strip membrane protein 2      149   7e-40   
ref|XP_011043429.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    149   7e-40   
ref|XP_009117933.1|  PREDICTED: CASP-like protein ARALYDRAFT_888790     149   8e-40   
ref|XP_008446384.1|  PREDICTED: casparian strip membrane protein ...    149   9e-40   
emb|CDX78624.1|  BnaA03g05360D                                          149   9e-40   
sp|Q6EP58.1|CASP7_ORYSJ  RecName: Full=Casparian strip membrane p...    149   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131457.1|  PREDICTED: casparian strip membrane protein ...    148   1e-39   
ref|XP_006417050.1|  hypothetical protein EUTSA_v10008800mg             149   1e-39   
ref|NP_172868.1|  uncharacterized protein                               149   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871659.1|  integral membrane family protein                   147   2e-39   
sp|P0DKC2.1|CASP1_LOTJA  RecName: Full=Casparian strip membrane p...    147   2e-39   
ref|XP_011017493.1|  PREDICTED: casparian strip membrane protein 5      147   3e-39   
ref|XP_007015764.1|  Casparian strip membrane protein 3, putative       148   3e-39   
sp|P0DI40.1|CASP1_VIGUN  RecName: Full=Casparian strip membrane p...    147   4e-39   
ref|XP_010523465.1|  PREDICTED: CASP-like protein 1A1 isoform X2        148   5e-39   
ref|XP_010108691.1|  hypothetical protein L484_015678                   146   6e-39   
ref|XP_002311310.2|  hypothetical protein POPTR_0008s08820g             146   7e-39   Populus trichocarpa [western balsam poplar]
dbj|BAD16116.1|  integral membrane family protein-like                  146   3e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDX70605.1|  BnaC03g06890D                                          144   4e-38   
ref|XP_004135448.1|  PREDICTED: CASP-like protein RCOM_0837390-like     144   4e-38   
ref|XP_004249431.1|  PREDICTED: casparian strip membrane protein 1      145   5e-38   
ref|XP_009801668.1|  PREDICTED: casparian strip membrane protein ...    144   6e-38   
ref|XP_006306344.1|  hypothetical protein CARUB_v10012228mg             144   8e-38   
ref|XP_002523839.1|  conserved hypothetical protein                     144   1e-37   Ricinus communis
gb|EEC73471.1|  hypothetical protein OsI_07795                          147   1e-37   Oryza sativa Indica Group [Indian rice]
gb|EEE57248.1|  hypothetical protein OsJ_07255                          147   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004516297.1|  PREDICTED: casparian strip membrane protein ...    143   1e-37   
ref|XP_006341077.1|  PREDICTED: casparian strip membrane protein ...    144   1e-37   
ref|XP_010059483.1|  PREDICTED: casparian strip membrane protein ...    142   3e-37   
ref|XP_009591857.1|  PREDICTED: casparian strip membrane protein ...    142   3e-37   
sp|B9HQ42.2|CASP4_POPTR  RecName: Full=Casparian strip membrane p...    143   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002313609.1|  hypothetical protein POPTR_0009s16160g             142   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004246481.1|  PREDICTED: casparian strip membrane protein ...    142   4e-37   
gb|KDP41223.1|  hypothetical protein JCGZ_15630                         141   4e-37   
ref|XP_002522462.1|  conserved hypothetical protein                     140   5e-37   Ricinus communis
ref|XP_011098776.1|  PREDICTED: casparian strip membrane protein ...    141   6e-37   
ref|XP_008387040.1|  PREDICTED: casparian strip membrane protein ...    141   1e-36   
gb|KGN51938.1|  hypothetical protein Csa_5G606300                       140   2e-36   
ref|XP_009601005.1|  PREDICTED: casparian strip membrane protein 1      140   3e-36   
ref|NP_001242085.1|  casparian strip membrane protein 4                 140   4e-36   
gb|KDP39843.1|  hypothetical protein JCGZ_04188                         139   5e-36   
ref|XP_009767267.1|  PREDICTED: casparian strip membrane protein 1      139   6e-36   
gb|KEH41980.1|  casparian strip membrane protein                        139   6e-36   
ref|XP_006361147.1|  PREDICTED: casparian strip membrane protein ...    139   7e-36   
gb|EYU34054.1|  hypothetical protein MIMGU_mgv1a026542mg                137   1e-35   
ref|XP_004487484.1|  PREDICTED: casparian strip membrane protein ...    138   2e-35   
ref|XP_002530532.1|  nitrate, fromate, iron dehydrogenase, putative     137   4e-35   Ricinus communis
ref|XP_006430137.1|  hypothetical protein CICLE_v10013511mg             136   5e-35   
sp|Q1W3A5.1|CASP1_STRAF  RecName: Full=Casparian strip membrane p...    136   6e-35   Striga asiatica [witchweed]
emb|CDP06886.1|  unnamed protein product                                136   8e-35   
ref|XP_006481869.1|  PREDICTED: casparian strip membrane protein ...    136   8e-35   
gb|KDP36189.1|  hypothetical protein JCGZ_08833                         135   1e-34   
ref|XP_003519133.1|  PREDICTED: casparian strip membrane protein ...    135   1e-34   
ref|NP_001236338.1|  casparian strip membrane protein 5                 136   1e-34   
gb|EEE57797.1|  hypothetical protein OsJ_08354                          135   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001237259.1|  casparian strip membrane protein 3                 135   2e-34   
gb|KEH41982.1|  casparian strip membrane protein                        135   2e-34   
ref|XP_011004683.1|  PREDICTED: casparian strip membrane protein 3      135   2e-34   
gb|KHN02602.1|  Casparian strip membrane protein 4                      134   3e-34   
ref|XP_004149191.1|  PREDICTED: casparian strip membrane protein ...    134   3e-34   
ref|XP_004143331.1|  PREDICTED: casparian strip membrane protein ...    134   5e-34   
ref|XP_007206803.1|  hypothetical protein PRUPE_ppa025691mg             134   6e-34   
emb|CDP10637.1|  unnamed protein product                                134   6e-34   
ref|XP_004168080.1|  PREDICTED: casparian strip membrane protein ...    134   7e-34   
ref|XP_006299322.1|  hypothetical protein CARUB_v10015479mg             134   7e-34   
sp|P0DI57.1|CASP5_LOTJA  RecName: Full=Casparian strip membrane p...    133   7e-34   
ref|XP_008361038.1|  PREDICTED: casparian strip membrane protein ...    134   7e-34   
ref|XP_007203160.1|  hypothetical protein PRUPE_ppa024449mg             133   8e-34   
gb|KFK28903.1|  hypothetical protein AALP_AA7G063100                    134   8e-34   
gb|KEH41983.1|  casparian strip membrane protein                        133   8e-34   
ref|XP_004303525.1|  PREDICTED: casparian strip membrane protein ...    133   9e-34   
sp|P0DI31.1|CASP1_TRIPD  RecName: Full=Casparian strip membrane p...    133   1e-33   
ref|XP_010104281.1|  hypothetical protein L484_005384                   133   1e-33   
ref|XP_004516298.1|  PREDICTED: casparian strip membrane protein ...    133   1e-33   
gb|KFK25022.1|  hypothetical protein AALP_AA8G056700                    133   1e-33   
ref|XP_011077838.1|  PREDICTED: casparian strip membrane protein 1      133   1e-33   
ref|XP_008243654.1|  PREDICTED: casparian strip membrane protein ...    133   1e-33   
gb|EYU34645.1|  hypothetical protein MIMGU_mgv1a015926mg                130   1e-33   
ref|XP_007144398.1|  hypothetical protein PHAVU_007G152900g             132   2e-33   
ref|XP_009372531.1|  PREDICTED: casparian strip membrane protein ...    132   2e-33   
ref|XP_003555157.1|  PREDICTED: casparian strip membrane protein ...    132   3e-33   
ref|XP_008462597.1|  PREDICTED: casparian strip membrane protein 1      132   4e-33   
ref|XP_008442871.1|  PREDICTED: casparian strip membrane protein ...    131   6e-33   
ref|XP_008229074.1|  PREDICTED: casparian strip membrane protein ...    131   7e-33   
ref|XP_004300108.1|  PREDICTED: casparian strip membrane protein ...    131   9e-33   
ref|XP_002323410.1|  integral membrane family protein                   130   9e-33   Populus trichocarpa [western balsam poplar]
sp|P0DI60.1|CASP1_HELAN  RecName: Full=Casparian strip membrane p...    130   1e-32   
sp|P0DI63.1|CASP1_STRHE  RecName: Full=Casparian strip membrane p...    130   1e-32   
ref|XP_006487914.1|  PREDICTED: casparian strip membrane protein ...    130   1e-32   
ref|XP_009372532.1|  PREDICTED: casparian strip membrane protein ...    130   1e-32   
ref|XP_009377816.1|  PREDICTED: casparian strip membrane protein ...    130   1e-32   
ref|XP_003519136.1|  PREDICTED: casparian strip membrane protein ...    130   1e-32   
ref|XP_006424191.1|  hypothetical protein CICLE_v10030236mg             130   2e-32   
gb|KHN02600.1|  Casparian strip membrane protein 1                      129   2e-32   
ref|XP_010093771.1|  hypothetical protein L484_019174                   129   2e-32   
ref|XP_010516820.1|  PREDICTED: casparian strip membrane protein ...    130   2e-32   
sp|P0DI52.1|CASP1_ERYGU  RecName: Full=Casparian strip membrane p...    129   3e-32   
ref|XP_006408711.1|  hypothetical protein EUTSA_v10002094mg             129   3e-32   
ref|XP_010683665.1|  PREDICTED: casparian strip membrane protein 2      129   4e-32   
gb|KFK36497.1|  hypothetical protein AALP_AA4G132200                    129   5e-32   
gb|EEC73995.1|  hypothetical protein OsI_08910                          129   5e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010037287.1|  PREDICTED: casparian strip membrane protein ...    129   5e-32   
ref|XP_010505142.1|  PREDICTED: casparian strip membrane protein 1      129   5e-32   
ref|XP_003535780.1|  PREDICTED: casparian strip membrane protein ...    128   5e-32   
ref|XP_004515966.1|  PREDICTED: casparian strip membrane protein ...    128   6e-32   
ref|NP_001237549.1|  casparian strip membrane protein 1                 128   6e-32   
sp|A2YQB8.1|CASP2_ORYSI  RecName: Full=Casparian strip membrane p...    129   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_002881427.1|  hypothetical protein ARALYDRAFT_482586             127   1e-31   
gb|AEJ82293.1|  casparian strip protein 1                               128   1e-31   
sp|P0DH80.1|CASP1_PINTA  RecName: Full=Casparian strip membrane p...    127   1e-31   
ref|NP_181154.1|  casparian strip membrane protein 1                    127   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882736.1|  integral membrane family protein                   127   1e-31   
ref|XP_009393394.1|  PREDICTED: casparian strip membrane protein ...    128   1e-31   
sp|Q6Z1Y7.1|CASP2_ORYSJ  RecName: Full=Casparian strip membrane p...    128   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001242417.1|  casparian strip membrane protein 2                 127   1e-31   
ref|XP_008359498.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    127   2e-31   
ref|XP_004242111.1|  PREDICTED: casparian strip membrane protein ...    127   2e-31   
emb|CDP02251.1|  unnamed protein product                                127   2e-31   
ref|NP_180305.1|  uncharacterized protein                               127   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391938.1|  PREDICTED: casparian strip membrane protein ...    127   3e-31   
ref|XP_006295518.1|  hypothetical protein CARUB_v10024622mg             127   3e-31   
gb|AEJ82303.1|  casparian strip protein 3                               127   3e-31   
sp|P0DI39.1|CASP2_VIGUN  RecName: Full=Casparian strip membrane p...    126   3e-31   
ref|XP_006410782.1|  hypothetical protein EUTSA_v10017241mg             127   3e-31   
ref|XP_010509510.1|  PREDICTED: casparian strip membrane protein ...    126   3e-31   
ref|XP_007144399.1|  hypothetical protein PHAVU_007G153000g             126   3e-31   
ref|XP_002880911.1|  integral membrane family protein                   127   3e-31   
ref|XP_010510780.1|  PREDICTED: casparian strip membrane protein ...    127   4e-31   
ref|XP_006410783.1|  hypothetical protein EUTSA_v10017240mg             126   4e-31   
ref|XP_010672773.1|  PREDICTED: casparian strip membrane protein ...    125   6e-31   
gb|KHN23088.1|  Casparian strip membrane protein 3                      125   6e-31   
ref|XP_009609007.1|  PREDICTED: casparian strip membrane protein ...    125   7e-31   
ref|XP_004292551.1|  PREDICTED: casparian strip membrane protein ...    126   7e-31   
ref|XP_010417897.1|  PREDICTED: casparian strip membrane protein 3      126   7e-31   
ref|XP_010557426.1|  PREDICTED: casparian strip membrane protein 3      125   9e-31   
ref|XP_010497100.1|  PREDICTED: casparian strip membrane protein ...    125   1e-30   
gb|KFK38524.1|  hypothetical protein AALP_AA3G125100                    125   1e-30   
ref|XP_009411946.1|  PREDICTED: casparian strip membrane protein ...    124   2e-30   
ref|XP_010473135.1|  PREDICTED: casparian strip membrane protein ...    125   2e-30   
ref|XP_007027844.1|  Casparian strip membrane protein RCOM_1259260      124   2e-30   
sp|P0DI43.1|CASP1_THECC  RecName: Full=Casparian strip membrane p...    124   2e-30   
gb|AEX12490.1|  hypothetical protein 2_4221_02                          122   2e-30   
ref|XP_006289845.1|  hypothetical protein CARUB_v10003455mg             124   3e-30   
emb|CDX84159.1|  BnaC04g09210D                                          124   3e-30   
ref|XP_009140798.1|  PREDICTED: casparian strip membrane protein ...    124   4e-30   
ref|XP_002309415.1|  integral membrane family protein                   123   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003596846.1|  hypothetical protein MTR_2g086740                  124   4e-30   
ref|XP_009133899.1|  PREDICTED: casparian strip membrane protein ...    124   4e-30   
sp|P0DI53.1|CASP3_ERYGU  RecName: Full=Casparian strip membrane p...    123   5e-30   
ref|XP_009789373.1|  PREDICTED: casparian strip membrane protein ...    124   5e-30   
emb|CDY31172.1|  BnaC03g47190D                                          124   5e-30   
ref|XP_006295716.1|  hypothetical protein CARUB_v10024835mg             124   5e-30   
ref|XP_003535799.1|  PREDICTED: casparian strip membrane protein 3      123   6e-30   
gb|ACU14340.1|  unknown                                                 123   6e-30   Glycine max [soybeans]
emb|CDY43748.1|  BnaAnng07630D                                          123   6e-30   
sp|P0DI30.1|CASP2_TRIPD  RecName: Full=Casparian strip membrane p...    123   7e-30   
ref|NP_187762.1|  uncharacterized protein                               123   7e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84158.1|  BnaC04g09200D                                          122   1e-29   
gb|AEJ82299.1|  casparian strip protein 2                               122   1e-29   
ref|XP_009141561.1|  PREDICTED: casparian strip membrane protein ...    122   1e-29   
emb|CDX75070.1|  BnaA05g08160D                                          122   1e-29   
emb|CDX84579.1|  BnaA03g16510D                                          122   2e-29   
emb|CDX79653.1|  BnaC03g19890D                                          122   2e-29   
ref|XP_009133064.1|  PREDICTED: casparian strip membrane protein 1      122   2e-29   
emb|CDX77114.1|  BnaC04g39090D                                          122   2e-29   
ref|XP_009143616.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    121   2e-29   
ref|XP_011004187.1|  PREDICTED: casparian strip membrane protein 1      121   2e-29   
sp|P0DI49.1|CASP1_RAPRA  RecName: Full=Casparian strip membrane p...    121   3e-29   
ref|NP_196238.1|  uncharacterized protein                               120   4e-29   
ref|XP_010464871.1|  PREDICTED: casparian strip membrane protein ...    120   4e-29   
ref|XP_010486824.1|  PREDICTED: casparian strip membrane protein 2      120   5e-29   
ref|XP_010452535.1|  PREDICTED: casparian strip membrane protein ...    120   6e-29   
sp|P0DI56.1|CASP3_LOTJA  RecName: Full=Casparian strip membrane p...    120   6e-29   
ref|XP_002871203.1|  predicted protein                                  120   6e-29   
ref|XP_003580136.1|  PREDICTED: casparian strip membrane protein 1      121   7e-29   
gb|AEJ82297.1|  casparian strip protein 4                               120   7e-29   
ref|XP_011089204.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    120   8e-29   
gb|KHN36486.1|  Casparian strip membrane protein 5                      120   8e-29   
ref|XP_002273638.1|  PREDICTED: casparian strip membrane protein 2      120   8e-29   
ref|XP_004972397.1|  PREDICTED: CASP-like protein Sb07g000300-like      120   1e-28   
ref|XP_004293125.1|  PREDICTED: casparian strip membrane protein ...    120   1e-28   
ref|XP_003571287.1|  PREDICTED: casparian strip membrane protein 2      120   1e-28   
gb|EYU35527.1|  hypothetical protein MIMGU_mgv1a014031mg                119   2e-28   
emb|CDY62471.1|  BnaC01g44860D                                          119   2e-28   
ref|XP_007201619.1|  hypothetical protein PRUPE_ppa019901mg             119   2e-28   
ref|XP_010423379.1|  PREDICTED: casparian strip membrane protein 4      119   2e-28   
ref|XP_006407435.1|  hypothetical protein EUTSA_v10021542mg             119   2e-28   
ref|XP_010491169.1|  PREDICTED: casparian strip membrane protein ...    119   3e-28   
ref|XP_009373039.1|  PREDICTED: casparian strip membrane protein ...    118   3e-28   
ref|XP_008237717.1|  PREDICTED: casparian strip membrane protein ...    118   4e-28   
gb|KDP36190.1|  hypothetical protein JCGZ_08834                         118   4e-28   
emb|CDX73869.1|  BnaA03g31780D                                          117   6e-28   
sp|P0DI48.1|CASP4_RAPSA  RecName: Full=Casparian strip membrane p...    117   7e-28   
ref|XP_011046927.1|  PREDICTED: casparian strip membrane protein ...    117   1e-27   
gb|EYU26727.1|  hypothetical protein MIMGU_mgv1a013858mg                117   1e-27   
ref|XP_006659729.1|  PREDICTED: CASP-like protein OsI_27482-like        117   1e-27   
ref|XP_009349510.1|  PREDICTED: casparian strip membrane protein ...    116   2e-27   
ref|XP_010534401.1|  PREDICTED: casparian strip membrane protein ...    116   3e-27   
ref|XP_009135174.1|  PREDICTED: casparian strip membrane protein ...    116   3e-27   
gb|EMT03852.1|  hypothetical protein F775_25649                         116   3e-27   
ref|XP_009124886.1|  PREDICTED: casparian strip membrane protein ...    115   4e-27   
gb|AFK35638.1|  unknown                                                 114   8e-27   
emb|CDY08514.1|  BnaA05g27500D                                          114   2e-26   
sp|P0DI51.1|CASP2_ERYGU  RecName: Full=Casparian strip membrane p...    114   2e-26   
emb|CDY01034.1|  BnaC05g41660D                                          114   2e-26   
ref|XP_009146708.1|  PREDICTED: casparian strip membrane protein 2      114   2e-26   
gb|ACU20464.1|  unknown                                                 114   2e-26   
ref|XP_011094537.1|  PREDICTED: casparian strip membrane protein ...    113   3e-26   
sp|P0DI46.1|CASP2_RAPSA  RecName: Full=Casparian strip membrane p...    112   5e-26   
ref|XP_002276085.1|  PREDICTED: casparian strip membrane protein 1      112   8e-26   
sp|E6Y2A0.1|CASP1_WHEAT  RecName: Full=Casparian strip membrane p...    112   1e-25   
ref|XP_002323409.1|  hypothetical protein POPTR_0016s07610g             110   2e-25   
ref|XP_002443685.1|  hypothetical protein SORBIDRAFT_07g000300          111   2e-25   
tpg|DAA37454.1|  TPA: hypothetical protein ZEAMMB73_440640              108   2e-25   
sp|P0DI55.1|CASP4_LOTJA  RecName: Full=Casparian strip membrane p...    110   2e-25   
gb|AFK48217.1|  unknown                                                 109   2e-25   
sp|Q7XPU9.1|CASP1_ORYSJ  RecName: Full=Casparian strip membrane p...    111   2e-25   
ref|XP_010520695.1|  PREDICTED: casparian strip membrane protein ...    110   4e-25   
sp|P0DI47.1|CASP3_RAPSA  RecName: Full=Casparian strip membrane p...    110   4e-25   
ref|XP_006399087.1|  hypothetical protein EUTSA_v10015967mg             108   8e-25   
emb|CDX75071.1|  BnaA05g08170D                                          109   1e-24   
gb|KCW87345.1|  hypothetical protein EUGRSUZ_B03828                     107   2e-24   
sp|P0DH81.1|CASP1_PICGL  RecName: Full=Casparian strip membrane p...    107   2e-24   
ref|XP_010046723.1|  PREDICTED: casparian strip membrane protein ...    107   3e-24   
sp|P0DI45.1|CASP1_RAPSA  RecName: Full=Casparian strip membrane p...    107   5e-24   
gb|KHN01909.1|  Casparian strip membrane protein 5                      105   5e-24   
ref|XP_006851480.1|  hypothetical protein AMTR_s00040p00135930          107   6e-24   
ref|XP_010534404.1|  PREDICTED: casparian strip membrane protein 2      105   1e-23   
ref|NP_001151404.1|  casparian strip membrane protein 2                 104   9e-23   
ref|XP_010102014.1|  hypothetical protein L484_016304                   102   2e-22   
ref|XP_009360780.1|  PREDICTED: casparian strip membrane protein ...    102   3e-22   
gb|AFK48530.1|  unknown                                                 100   3e-22   
ref|XP_009360778.1|  PREDICTED: casparian strip membrane protein ...    102   3e-22   
ref|XP_002447351.1|  hypothetical protein SORBIDRAFT_06g033470        99.0    7e-21   
tpg|DAA35281.1|  TPA: putative protein kinase superfamily protein       103   9e-21   
ref|XP_008806111.1|  PREDICTED: casparian strip membrane protein ...  97.4    2e-20   
sp|P0DI41.1|CASP3_VIGUN  RecName: Full=Casparian strip membrane p...  97.1    3e-20   
ref|XP_007150053.1|  hypothetical protein PHAVU_005G122200g           95.9    7e-20   
ref|XP_008381732.1|  PREDICTED: casparian strip membrane protein ...  92.4    1e-19   
ref|XP_008679497.1|  PREDICTED: CASP-like protein Sb07g000300         94.4    3e-19   
gb|KDO70521.1|  hypothetical protein CISIN_1g045229mg                 91.3    3e-19   
gb|AFK48532.1|  unknown                                               92.4    7e-19   
ref|XP_010943808.1|  PREDICTED: casparian strip membrane protein ...  92.8    9e-19   
ref|XP_010554941.1|  PREDICTED: casparian strip membrane protein ...  92.0    2e-18   
ref|XP_010523464.1|  PREDICTED: casparian strip membrane protein ...  84.7    1e-16   
sp|P0DI29.1|CSPL1_TRIPD  RecName: Full=CASP-like protein 1            83.6    6e-16   
emb|CDY69259.1|  BnaCnng62670D                                        80.1    1e-15   
emb|CDY11718.1|  BnaC06g13260D                                        80.5    2e-15   
emb|CAJ86161.1|  H0913C04.2                                           80.9    3e-15   
emb|CDY43749.1|  BnaAnng07640D                                        81.6    3e-15   
emb|CDY00740.1|  BnaC03g37240D                                        78.6    3e-14   
gb|KEH38986.1|  plant integral membrane protein                       77.0    8e-14   
ref|XP_010943799.1|  PREDICTED: casparian strip membrane protein ...  75.1    2e-13   
gb|EYU38661.1|  hypothetical protein MIMGU_mgv1a007267mg              77.4    1e-12   
ref|XP_011090486.1|  PREDICTED: casparian strip membrane protein ...  70.5    3e-11   
ref|XP_010686498.1|  PREDICTED: CASP-like protein 1C1                 70.1    3e-11   
ref|XP_006342777.1|  PREDICTED: CASP-like protein 5-like              70.1    5e-11   
ref|NP_001239666.1|  CASP-like protein 1E1                            69.7    6e-11   
sp|A9P0A6.1|CSPL5_PICSI  RecName: Full=CASP-like protein 1U1; Sho...  68.6    2e-10   
ref|XP_008386322.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430   68.2    2e-10   
ref|XP_009630064.1|  PREDICTED: CASP-like protein 1E2 isoform X1      68.2    2e-10   
ref|XP_010026145.1|  PREDICTED: CASP-like protein 1E1                 67.0    2e-10   
ref|XP_006467803.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  67.4    3e-10   
ref|XP_008229156.1|  PREDICTED: CASP-like protein RCOM_1174750        67.4    3e-10   
gb|KDO75960.1|  hypothetical protein CISIN_1g047574mg                 67.4    3e-10   
ref|XP_006836401.1|  hypothetical protein AMTR_s00092p00142720        67.8    3e-10   
ref|XP_007198888.1|  hypothetical protein PRUPE_ppa020481mg           66.6    5e-10   
ref|XP_006844552.1|  hypothetical protein AMTR_s00016p00178190        67.0    5e-10   
ref|XP_009803956.1|  PREDICTED: CASP-like protein 1E1                 67.0    6e-10   
ref|XP_003625864.1|  hypothetical protein MTR_7g108130                67.0    6e-10   
ref|XP_008808838.1|  PREDICTED: casparian strip membrane protein ...  66.6    7e-10   
gb|AFK37260.1|  unknown                                               66.6    8e-10   
ref|XP_009337529.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430   66.2    9e-10   
ref|XP_006855416.1|  hypothetical protein AMTR_s00057p00159510        66.2    9e-10   
ref|XP_002280714.1|  PREDICTED: CASP-like protein 1F1                 66.2    1e-09   
ref|XP_007154230.1|  hypothetical protein PHAVU_003G101200g           66.2    1e-09   
ref|XP_004229217.1|  PREDICTED: CASP-like protein 1E2                 66.2    1e-09   
sp|A7PHN8.2|CSPL4_VITVI  RecName: Full=CASP-like protein 1F1; Sho...  66.2    1e-09   
ref|XP_007159387.1|  hypothetical protein PHAVU_002G234000g           65.5    2e-09   
ref|XP_006857311.1|  hypothetical protein AMTR_s00067p00068460        65.9    2e-09   
ref|XP_007025630.1|  CASP-like protein POPTRDRAFT_758901              65.5    2e-09   
gb|EMT10061.1|  hypothetical protein F775_25764                       63.9    3e-09   
ref|XP_009341975.1|  PREDICTED: CASP-like protein RCOM_1174750        64.3    4e-09   
gb|EMS49591.1|  hypothetical protein TRIUR3_24580                     63.9    4e-09   
ref|XP_003609584.1|  hypothetical protein MTR_4g118810                64.3    5e-09   
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                 64.3    6e-09   
ref|XP_002517919.1|  conserved hypothetical protein                   63.5    8e-09   
gb|KHN33122.1|  CASP-like protein 6                                   63.9    9e-09   
gb|KHG12313.1|  CASP-like protein                                     63.5    9e-09   
ref|XP_006664182.1|  PREDICTED: CASP-like protein Os12g0610800-like   63.5    1e-08   
ref|XP_002884576.1|  integral membrane family protein                 63.5    1e-08   
emb|CDO98909.1|  unnamed protein product                              63.5    1e-08   
ref|XP_007147871.1|  hypothetical protein PHAVU_006G161900g           64.7    1e-08   
ref|XP_009357855.1|  PREDICTED: CASP-like protein RCOM_1174750        62.8    1e-08   
ref|XP_010326606.1|  PREDICTED: CASP-like protein 1E1                 63.2    1e-08   
ref|XP_003546096.2|  PREDICTED: CASP-like protein 6-like              63.2    1e-08   
gb|EYU45581.1|  hypothetical protein MIMGU_mgv1a023532mg              63.2    2e-08   
ref|XP_003531310.1|  PREDICTED: CASP-like protein 9-like              63.2    2e-08   
ref|XP_008353784.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  62.4    2e-08   
ref|XP_002511115.1|  conserved hypothetical protein                   62.4    2e-08   
ref|XP_007043593.1|  CASP-like protein POPTRDRAFT_270504              62.0    2e-08   
gb|KDP24131.1|  hypothetical protein JCGZ_25788                       62.0    2e-08   
emb|CDY22743.1|  BnaA08g05730D                                        62.4    3e-08   
ref|XP_009107849.1|  PREDICTED: CASP-like protein At4g15630           62.4    3e-08   
ref|XP_002305799.1|  hypothetical protein POPTR_0004s04330g           61.6    3e-08   
ref|NP_187290.1|  uncharacterized protein                             62.0    3e-08   
ref|XP_003624429.1|  hypothetical protein MTR_7g083120                62.0    4e-08   
emb|CAN69352.1|  hypothetical protein VITISV_023954                   62.0    4e-08   
ref|XP_008368681.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  61.6    4e-08   
ref|XP_002268702.1|  PREDICTED: CASP-like protein 1E1                 62.0    4e-08   
ref|XP_009402195.1|  PREDICTED: CASP-like protein VIT_17s0000g00560   62.8    4e-08   
gb|KFK38097.1|  hypothetical protein AALP_AA3G069100                  61.6    5e-08   
ref|XP_011086074.1|  PREDICTED: CASP-like protein 1C1 isoform X1      60.8    6e-08   
ref|XP_008451440.1|  PREDICTED: CASP-like protein VIT_07s0104g01350   61.6    6e-08   
emb|CDY18177.1|  BnaC05g02000D                                        60.8    7e-08   
ref|XP_010474998.1|  PREDICTED: CASP-like protein 1C2                 60.8    7e-08   
ref|XP_009385516.1|  PREDICTED: CASP-like protein VIT_17s0000g00560   60.8    7e-08   
ref|XP_010245394.1|  PREDICTED: CASP-like protein 1E1                 60.8    7e-08   
gb|KEH17619.1|  CASP POPTRDRAFT-like protein                          60.5    8e-08   
ref|XP_002516873.1|  conserved hypothetical protein                   60.8    8e-08   
ref|XP_009791544.1|  PREDICTED: CASP-like protein 1E2                 61.2    9e-08   
ref|XP_006306319.1|  hypothetical protein CARUB_v10012189mg           60.5    9e-08   
ref|XP_010482422.1|  PREDICTED: CASP-like protein 1C2                 60.5    9e-08   
ref|XP_006418212.1|  hypothetical protein EUTSA_v10009824mg           60.5    1e-07   
gb|KFK42715.1|  hypothetical protein AALP_AA1G030500                  60.1    1e-07   
ref|XP_004136057.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  60.8    1e-07   
ref|NP_193297.1|  uncharacterized protein                             60.5    1e-07   
ref|NP_563689.1|  uncharacterized protein                             60.1    1e-07   
ref|XP_007163061.1|  hypothetical protein PHAVU_001G202900g           60.5    1e-07   
emb|CDY09075.1|  BnaC08g10290D                                        60.1    1e-07   
gb|KHN48115.1|  CASP-like protein 9                                   60.1    1e-07   
ref|XP_004494327.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  60.1    2e-07   
ref|XP_009629411.1|  PREDICTED: CASP-like protein 1E2 isoform X2      60.5    2e-07   
ref|XP_002312974.2|  hypothetical protein POPTR_0009s13390g           57.8    2e-07   
ref|XP_009352216.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   59.7    2e-07   
ref|XP_007050797.1|  CASP protein GSVIVT01010992001, putative         59.3    3e-07   
ref|XP_011037328.1|  PREDICTED: CASP-like protein 1C3                 59.3    3e-07   
emb|CDY09749.1|  BnaC07g33120D                                        59.3    3e-07   
ref|XP_003630011.1|  hypothetical protein MTR_8g089300                59.3    3e-07   
ref|XP_008458485.1|  PREDICTED: CASP-like protein 6 isoform X1        59.3    3e-07   
ref|XP_009336197.1|  PREDICTED: CASP-like protein RCOM_1174750        58.5    3e-07   
ref|XP_010105029.1|  hypothetical protein L484_008470                 58.9    4e-07   
ref|XP_010105028.1|  hypothetical protein L484_008469                 59.3    4e-07   
ref|XP_007038092.1|  CASP-like protein GSVIVT01008618001              58.9    4e-07   
ref|XP_003521533.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  58.9    4e-07   
ref|XP_006407952.1|  hypothetical protein EUTSA_v10021548mg           59.3    4e-07   
ref|XP_009101697.1|  PREDICTED: CASP-like protein At5g44550           58.9    4e-07   
ref|XP_009629410.1|  PREDICTED: CASP-like protein 1E2 isoform X1      60.1    4e-07   
ref|XP_006398066.1|  hypothetical protein EUTSA_v10001033mg           58.9    4e-07   
ref|XP_010457381.1|  PREDICTED: CASP-like protein 1C2                 58.5    4e-07   
ref|XP_010272470.1|  PREDICTED: CASP-like protein 1C1                 58.5    4e-07   
ref|XP_003568713.1|  PREDICTED: CASP-like protein 1C1                 58.2    5e-07   
emb|CDY49020.1|  BnaAnng10140D                                        58.9    5e-07   
gb|KDP40019.1|  hypothetical protein JCGZ_02017                       58.5    5e-07   
emb|CDY49491.1|  BnaC07g18080D                                        58.5    5e-07   
ref|XP_009136705.1|  PREDICTED: CASP-like protein At4g15630           58.5    6e-07   
emb|CDX90578.1|  BnaA03g42030D                                        58.5    6e-07   
ref|XP_004232873.1|  PREDICTED: CASP-like protein 1C1                 57.8    6e-07   
ref|XP_010542892.1|  PREDICTED: CASP-like protein 1C1                 57.8    6e-07   
ref|XP_006419661.1|  hypothetical protein CICLE_v10005986mg           58.2    7e-07   
ref|XP_006468217.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  58.2    7e-07   
ref|XP_006489150.1|  PREDICTED: CASP-like protein RCOM_0679870-like   58.2    7e-07   
sp|A7PJ32.1|CSPL2_VITVI  RecName: Full=CASP-like protein 1C2; Sho...  57.8    7e-07   
ref|XP_002272783.1|  PREDICTED: CASP-like protein 1C2                 57.8    7e-07   
ref|XP_009369107.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   58.2    7e-07   
ref|XP_010494485.1|  PREDICTED: CASP-like protein 1B1                 58.2    8e-07   
ref|XP_009108468.1|  PREDICTED: CASP-like protein ARALYDRAFT_492822   58.2    8e-07   
ref|XP_011043373.1|  PREDICTED: CASP-like protein 1C2                 57.4    9e-07   
ref|XP_003528452.1|  PREDICTED: CASP-like protein POPTRDRAFT_7589...  57.4    9e-07   
ref|XP_010941794.1|  PREDICTED: CASP-like protein 1E2                 58.2    9e-07   
ref|XP_004150813.1|  PREDICTED: CASP-like protein 6-like              57.8    9e-07   
ref|XP_010434940.1|  PREDICTED: CASP-like protein 1E2                 57.8    1e-06   
gb|EYU27969.1|  hypothetical protein MIMGU_mgv1a015260mg              57.4    1e-06   
ref|XP_002870225.1|  integral membrane family protein                 57.8    1e-06   
emb|CDX76458.1|  BnaA08g09420D                                        57.8    1e-06   
ref|XP_006376496.1|  integral membrane family protein                 57.4    1e-06   
gb|KCW58540.1|  hypothetical protein EUGRSUZ_H01205                   57.8    1e-06   
emb|CDY05260.1|  BnaC05g45430D                                        57.8    1e-06   
ref|XP_004295628.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  57.0    1e-06   



>emb|CDP00357.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI DLILR+VAIVG+LGSA+AMGTT +TLPF  Q  +F+AQYDDF TF LFVIV+AIVC
Sbjct  24   VSIFDLILRIVAIVGTLGSAIAMGTTSETLPFFSQFVQFQAQYDDFTTFTLFVIVNAIVC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALSLPLSI+HI+R+RA KSR+LLIFLDT M+ LLTAGAS+AAGIVYLAHNGNSSANW
Sbjct  84   GYLALSLPLSIYHIIRSRAAKSRVLLIFLDTTMLALLTAGASAAAGIVYLAHNGNSSANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ FQDFC+R S SLIGSF
Sbjct  144  FAICQQFQDFCQRASGSLIGSF  165



>ref|XP_009602468.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DLILR+VAIVG+L  AVAMGT +QTLPF+ Q  +F AQYDDFDTFKLFVIV+AI+C
Sbjct  26   LSVFDLILRIVAIVGTLAGAVAMGTAEQTLPFVTQLVQFSAQYDDFDTFKLFVIVNAIIC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALSLP SIFHI+R+RA KSRILLIFLD +M+ LLT+GAS+AA IVYLAHNGNSSANW
Sbjct  86   AYLALSLPFSIFHIIRSRAGKSRILLIFLDAIMLALLTSGASAAAAIVYLAHNGNSSANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  146  FSICQQYTDFCQRSAGSLIGSF  167



>ref|XP_009789554.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana 
sylvestris]
Length=186

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DLILR+VAIVG+L  AVAMGT +QTLPF+ Q  +F AQYDDFDTFKLFVIV+AI+C
Sbjct  25   LSVFDLILRIVAIVGTLAGAVAMGTAEQTLPFVTQLVQFSAQYDDFDTFKLFVIVNAIIC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALSLP SI+HI+R+RA KSRILLIFLD +M+ LLT+GAS+AA IVYLAHNGNSSANW
Sbjct  85   AYLALSLPFSIYHIMRSRAGKSRILLIFLDAIMLVLLTSGASAAAAIVYLAHNGNSSANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  145  FSICQQYTDFCQRSAGSLIGSF  166



>ref|XP_006344265.1| PREDICTED: CASP-like protein SDM1_58t00016-like [Solanum tuberosum]
Length=185

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DL+LR+VAIVG+L  AVAMGT +QTLPF  Q  +F AQYDDFD+FKLFVIV+AIVC
Sbjct  24   LSVFDLVLRIVAIVGTLAGAVAMGTAEQTLPFATQLVQFSAQYDDFDSFKLFVIVNAIVC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALSLP SIFHI+R+RA KSRILLIFLD +M+ LLT+GAS+AA IVYLAH GN+SANW
Sbjct  84   AYLALSLPFSIFHIMRSRAGKSRILLIFLDAIMLVLLTSGASAAAAIVYLAHTGNTSANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             ++CQ + DFC+R++ SLIGSF
Sbjct  144  FSVCQQYTDFCQRSAGSLIGSF  165



>ref|XP_004237043.1| PREDICTED: casparian strip membrane protein 2-like [Solanum lycopersicum]
Length=185

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DL+LR+VAIVG+L  AVAMGT +QTLPF  Q  +F AQYDDFD+FKLFVIV+AIVC
Sbjct  24   LSVFDLVLRIVAIVGTLAGAVAMGTAEQTLPFATQLVQFSAQYDDFDSFKLFVIVNAIVC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLAL+LP SIFHI+R+RA KSRILLIFLD +M+ LLT+GAS+AA IVYLAH GN+SANW
Sbjct  84   AYLALTLPFSIFHIMRSRAGKSRILLIFLDAIMLVLLTSGASAAAAIVYLAHTGNTSANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             ++CQ + DFC+R++ SLIGSF
Sbjct  144  FSVCQQYTDFCQRSAGSLIGSF  165



>ref|XP_009606201.1| PREDICTED: casparian strip membrane protein 2 [Nicotiana tomentosiformis]
Length=184

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ DL+LR+ A+VG+L SAVAMGT DQ L F  Q   FEAQYDD D FK FVIV+AI C
Sbjct  23   ISVFDLVLRIAALVGTLASAVAMGTADQALSFSTQIVNFEAQYDDIDAFKFFVIVNAIAC  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALS+P+SIFHI+R RA KSR+LLIFLD +M+  +T+GAS+AA IVYLAHNGN+S NW
Sbjct  83   GYLALSIPISIFHIIRKRAGKSRVLLIFLDAIMLVFITSGASAAAAIVYLAHNGNTSTNW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  143  FSICQQYTDFCQRSAGSLIGSF  164



>ref|XP_009760874.1| PREDICTED: casparian strip membrane protein 2 [Nicotiana sylvestris]
Length=184

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ DLILR+ A+VG+LGSAVAMGT DQ L F  Q   +EAQYDD D FK FV V+AI C
Sbjct  23   ISVFDLILRIAALVGTLGSAVAMGTADQALSFSTQIVNYEAQYDDIDAFKFFVTVNAIAC  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALS+ +SIFHI+R RA KSR+LLIFLD +M+  +T+GAS+AA IVYLAHNGN+S NW
Sbjct  83   GYLALSISVSIFHIIRRRAGKSRVLLIFLDAIMLVFITSGASAAAAIVYLAHNGNTSTNW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  143  FSICQQYTDFCQRSAGSLIGSF  164



>ref|XP_004238811.1| PREDICTED: casparian strip membrane protein 2 [Solanum lycopersicum]
Length=185

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ DL+LR+VA+VG+L SAVAMGT DQ LPF  Q   FEAQYDD D+FK FV+ ++IVC
Sbjct  24   ISVFDLVLRIVALVGTLASAVAMGTADQALPFSTQIVNFEAQYDDIDSFKFFVVSNSIVC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALS+ +SIFHI+R+RA KSR+LLI LD +M+  LT+GAS+AA IVYLAHNGN+S NW
Sbjct  84   VYLALSITISIFHIIRSRAGKSRVLLIVLDAIMLVFLTSGASAAAAIVYLAHNGNTSTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  144  FSICQQYTDFCQRSAGSLIGSF  165



>ref|XP_006355125.1| PREDICTED: CASP-like protein SDM1_58t00016-like [Solanum tuberosum]
Length=185

 Score =   187 bits (476),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ DLILR+VA+VG+L SAVAMGT DQ L F  Q   FEAQYDD D FK FV+ ++I C
Sbjct  24   ISVFDLILRIVALVGTLASAVAMGTADQALSFSTQIVNFEAQYDDIDAFKFFVVSNSITC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALS+P+SIFHI+R+RA KSR+LLI LD +M+  LT+GAS+AA IVYLAHNGN+S NW
Sbjct  84   VYLALSIPISIFHIIRSRAGKSRVLLIVLDAIMLVFLTSGASAAAAIVYLAHNGNTSTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  144  FSICQQYTDFCQRSAGSLIGSF  165



>sp|Q5NRN4.1|CASP2_SOLDE RecName: Full=Casparian strip membrane protein 2; Short=SdCASP2 
[Solanum demissum]
 gb|AAW28571.1| plant integral membrane protein TIGR01569 containing protein 
[Solanum demissum]
Length=185

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ DL+LR+VA+VG+L SAVAMGT DQ L F  Q   FEAQYDD D FK FV+ ++I C
Sbjct  24   ISVFDLVLRIVALVGTLASAVAMGTADQALSFSTQIVNFEAQYDDIDAFKFFVVSNSITC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALS+P+SIFHI+R+RA KSR+LLI LD +M+  LT+GAS+AA IVYLAHNGN+S NW
Sbjct  84   VYLALSIPISIFHIIRSRAGKSRVLLIVLDAIMLVFLTSGASAAAAIVYLAHNGNTSTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  144  FSICQQYTDFCQRSAGSLIGSF  165



>gb|EYU28778.1| hypothetical protein MIMGU_mgv1a014587mg [Erythranthe guttata]
Length=185

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+DLILR++AI G+LGSAVAMGTTD+TLPF  QS  F+AQYDD  TF+ FVI + I C
Sbjct  22   ISILDLILRILAIFGTLGSAVAMGTTDETLPFSTQSVIFQAQYDDIPTFRFFVIANGIAC  81

Query  406  GYLAL-SLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSAN  582
            GYLA+ SLPL+I+HI+R  + KSR LLIFLDT+M+ +LTAGAS+AA IVY+AH GNSSAN
Sbjct  82   GYLAIISLPLAIYHIIRATSAKSRALLIFLDTIMVTVLTAGASAAAAIVYIAHKGNSSAN  141

Query  583  WPAICQPFQDFCRRTSASLIGSF  651
            W AICQ +Q FC R + SLIGSF
Sbjct  142  WAAICQQYQTFCVRITGSLIGSF  164



>ref|XP_011075520.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum]
Length=188

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  IIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCGY  411
            I++L+LRVVAI+G+L SAVAMGTTDQTLPF  Q+  F+AQYDD  TF+ FVI +A+V GY
Sbjct  22   ILELVLRVVAILGTLASAVAMGTTDQTLPFSTQTVLFQAQYDDIPTFRFFVITNALVSGY  81

Query  412  LALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWPA  591
            LA+SLP++++H++RT A KSR LLIFLD  M+ +LTAGAS+AA IVYLAH GN+SANW A
Sbjct  82   LAISLPMAVYHVIRTGAAKSRALLIFLDATMLSVLTAGASAAAAIVYLAHKGNASANWLA  141

Query  592  ICQPFQDFCRRTSASLIGSF  651
            ICQ +Q FC R + SLIGSF
Sbjct  142  ICQQYQKFCERITGSLIGSF  161



>sp|Q60D27.1|CASP1_SOLDE RecName: Full=Casparian strip membrane protein 1; Short=SdCASP1 
[Solanum demissum]
 gb|AAU90311.1| plant integral membrane protein TIGR01569 containing protein 
[Solanum demissum]
Length=185

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ DL+LR+VA+VG+L SAVAMGT  Q L F  Q   FEAQYDD D FK FV+ ++I C
Sbjct  24   ISVFDLVLRIVALVGTLASAVAMGTAGQALSFSTQIVNFEAQYDDIDAFKFFVVSNSITC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALS+P+SIFHI+R+RA KSR+LLI LD +M+  LT+GAS+AA IVYLAHNGN+S NW
Sbjct  84   VYLALSIPISIFHIIRSRAGKSRVLLIVLDAIMLVFLTSGASAAAAIVYLAHNGNTSTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ + DFC+R++ SLIGSF
Sbjct  144  FSICQQYTDFCQRSAGSLIGSF  165



>gb|KDO72617.1| hypothetical protein CISIN_1g045471mg [Citrus sinensis]
Length=185

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+D +LR++A  G+LGSA+AMGTT++TLPF  Q  RF A+YDD  +F  FV  +A+V 
Sbjct  24   ISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIRFRAEYDDLPSFTFFVAANAVVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LSIFHI+R+RA+KSRILL+F DT M+ LLT  AS+AA IVYLAH GN+ ANW
Sbjct  84   GYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLTGSASAAAAIVYLAHKGNAKANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC+R S SLIGSF
Sbjct  144  FAICQQFNSFCQRISGSLIGSF  165



>ref|XP_006482625.1| PREDICTED: casparian strip membrane protein VIT_14s0108g01050-like 
[Citrus sinensis]
Length=185

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+D +LR++A  G+LGSA+AMGTT++TLPF  Q  RF A+YDD  +F  FV  +A+V 
Sbjct  24   ISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIRFRAEYDDLPSFTFFVAANAVVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LSIFHI+R+RA+KSRILL+F DT M+ LLT  AS+AA IVYLAH GN+ ANW
Sbjct  84   GYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLTGSASAAAAIVYLAHKGNAKANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC+R S SLIGSF
Sbjct  144  FAICQQFNSFCQRISGSLIGSF  165



>ref|XP_004141446.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
 ref|XP_004170803.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
 gb|KGN52473.1| hypothetical protein Csa_5G636650 [Cucumis sativus]
Length=186

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D ILR+ AIVG+LGSA+AMGTT QTLPF  Q  +F A+Y+D   F  FV+  AIV 
Sbjct  24   LSIFDFILRLAAIVGALGSAIAMGTTTQTLPFATQFIQFRAEYNDLPMFTFFVVACAIVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSIFHILR+RA  +R++L+FLD  MM LLT+GAS+AA IVYLAH GN   NW
Sbjct  84   GYLVLSLPLSIFHILRSRARATRVVLVFLDAGMMALLTSGASAAAAIVYLAHKGNGKTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC RTS SLIGSF
Sbjct  144  LAICQQFNSFCERTSGSLIGSF  165



>ref|XP_008459331.1| PREDICTED: CASP-like protein 1 [Cucumis melo]
Length=213

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D ILR+ AIVG+LGSA+AMGTT QTLPF  Q  +F A+Y+D   F  FV+  AIV 
Sbjct  51   LSIFDFILRLAAIVGALGSAIAMGTTTQTLPFATQFIQFRAEYNDLPMFTFFVVACAIVS  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSIFHILR+RA  +R++L+FLD  MM LLT+GAS+AA IVYLAH GN   NW
Sbjct  111  GYLVLSLPLSIFHILRSRARATRVVLVFLDAGMMALLTSGASAAAAIVYLAHKGNGKTNW  170

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC RTS SLIGSF
Sbjct  171  LAICQQFNSFCERTSGSLIGSF  192



>sp|P0DI35.1|CASP1_LACSI RecName: Full=Casparian strip membrane protein 1; Short=LsCASP1 
[Lactuca saligna]
Length=192

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DL+LR+V I G+LG+A+AMGT +QTLPF  +   F A+YDDF +F+LFVIV+AIVC
Sbjct  25   VSVMDLVLRLVGIAGTLGAAIAMGTNEQTLPFFTRFVVFNAEYDDFRSFRLFVIVNAIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             Y  L+LPLSI HI+R+ A  SRILLI +DT+M+ LLTAGAS+AA IVYLAHNGN+S NW
Sbjct  85   AYFVLTLPLSIVHIMRSAARGSRILLIIMDTVMLALLTAGASAAASIVYLAHNGNTSTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ + DFC+  S SLIGSF
Sbjct  145  LPVCQQYGDFCQGASGSLIGSF  166



>ref|XP_002436759.1| hypothetical protein SORBIDRAFT_10g008220 [Sorghum bicolor]
 sp|C5Z7E3.1|CASP3_SORBI RecName: Full=Casparian strip membrane protein 3; Short=SbCASP3 
[Sorghum bicolor]
 gb|EER88126.1| hypothetical protein SORBIDRAFT_10g008220 [Sorghum bicolor]
Length=186

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DLILR +AI+G+L SA+AMGTT++TLPF  Q  RF+AQY D  T   FV+ ++IVC
Sbjct  25   VSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDLPTLTFFVVANSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI HI+R+RA+ SR+LLIFLD  M+ L+TAGAS+AA IVYLAH GN  ANW
Sbjct  85   AYLILSLPLSIVHIIRSRAKYSRLLLIFLDAAMLALVTAGASAAAAIVYLAHKGNVRANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  LAICQQFDSFCERISGSLIGSF  166



>sp|P0DI33.1|CASP1_PANVG RecName: Full=Casparian strip membrane protein 1; Short=PvCASP1 
[Panicum virgatum]
Length=184

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DLILR +AI+G+L SA+AMGTT++TLPF  Q  RF+AQY D  T   FV+ ++IVC
Sbjct  23   LSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDLPTLTFFVVANSIVC  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI HI+R+RA+ SR+LLIFLD +M+ L+TAGAS+AA IVYLAH GN  ANW
Sbjct  83   AYLILSLPLSIVHIIRSRAKFSRLLLIFLDAVMLALVTAGASAAAAIVYLAHKGNVRANW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  143  LAICQQFDSFCERISGSLIGSF  164



>ref|XP_004965049.1| PREDICTED: casparian strip membrane protein 1-like [Setaria italica]
Length=184

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DLILR +AI+G+L SA+AMGTT++TLPF  Q  RF+AQY D  T   FVI ++IVC
Sbjct  23   LSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDLPTLTFFVIANSIVC  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI HI+R+RA+ SR+LLIFLD  M+ L+TAGAS+AA IVYLAH GN  ANW
Sbjct  83   AYLILSLPLSIVHIIRSRAKFSRLLLIFLDAAMLALVTAGASAAAAIVYLAHKGNVRANW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  143  LAICQQFDSFCERISGSLIGSF  164



>ref|XP_010088133.1| hypothetical protein L484_013577 [Morus notabilis]
 gb|EXB31945.1| hypothetical protein L484_013577 [Morus notabilis]
Length=187

 Score =   177 bits (449),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D +LR++AIVG+L SAVAMGTT++TLPF  +  RF A+YDD  TF  FV+ +AIV 
Sbjct  26   LSILDFVLRLIAIVGTLASAVAMGTTNETLPFFTRFTRFRAEYDDLPTFTFFVVANAIVS  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS FHI+R+ A+ SR+LLI  D  M+GLLTAGAS++A IVYLAHNGN++ NW
Sbjct  86   GYLVLSLVLSFFHIVRSNAQNSRVLLIIFDAAMLGLLTAGASASAAIVYLAHNGNTNTNW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC+ F  FC R S SLIGSF
Sbjct  146  FAICRQFNSFCERISGSLIGSF  167



>ref|XP_010683143.1| PREDICTED: casparian strip membrane protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=184

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+D + R+VA   +LGSA+AMGTT+QTLPF  Q  RF AQYDD  TF  FV+ +AI+ 
Sbjct  22   ISILDFVFRIVAGASTLGSAIAMGTTNQTLPFFTQFIRFSAQYDDLPTFMFFVVANAIIT  81

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LSIFHI+R+ A+ +RILL  LDT  +GLLT+ AS+AA IVYLAH GN+SANW
Sbjct  82   GYLVLSLTLSIFHIVRSGAKGTRILLTILDTAALGLLTSAASAAAAIVYLAHKGNTSANW  141

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  142  FAICQQFDSFCERISGSLIGSF  163



>ref|XP_006431199.1| hypothetical protein CICLE_v10013539mg [Citrus clementina]
 gb|ESR44439.1| hypothetical protein CICLE_v10013539mg [Citrus clementina]
Length=185

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+D +LR++A  G+LGSA+AMGTT++TLPF  Q  RF A+YDD  +   FV  +A+V 
Sbjct  24   ISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIRFRAEYDDLPSLTFFVAANAVVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSIFHI+R+RA+KSRILL+F DT M+ LLT  AS+AA IVYLAH GN+ A W
Sbjct  84   RYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLTGSASAAAAIVYLAHKGNAKAKW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC+R S SLIGSF
Sbjct  144  FAICQQFNSFCQRISGSLIGSF  165



>ref|XP_009763947.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana sylvestris]
Length=184

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+DL LR++AI+ +LGSA+AMGTT++TLPF  Q  RF A+Y D  TF  FV+ +AIV 
Sbjct  23   MSILDLFLRIIAIIATLGSAIAMGTTNETLPFFTQFVRFRAKYSDLPTFTFFVVANAIVS  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL +SIFHI+R+RA+ SRI LIF D  MM LLTAGAS++A IVYLAH GN+  NW
Sbjct  83   AYLVLSLGMSIFHIMRSRAQASRIALIFFDAAMMALLTAGASASAAIVYLAHKGNTKTNW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ +  FC RTS SL+GSF
Sbjct  143  FPICQQYDSFCHRTSGSLVGSF  164



>gb|AFW85233.1| membrane protein 2 [Zea mays]
Length=186

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DLILR +AI+G+L SA+AMGTT++TLPF  Q  RF+AQY D  T   FV+ ++IVC
Sbjct  25   VSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDLPTLTFFVVANSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI HI+R+RA+ SR+LL+ LD  M+ L+TAGAS+AA IVYLAH GN  ANW
Sbjct  85   AYLTLSLPLSIVHIIRSRAKYSRLLLVVLDAAMLALVTAGASAAAAIVYLAHKGNVRANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SL+GSF
Sbjct  145  LAICQQFDSFCERISGSLVGSF  166



>gb|KHN12189.1| CASP-like protein 1 [Glycine soja]
Length=186

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++A V +LGSA+AMGTT++TLPF  Q  +F A++DD  +   FV+ +A+VC
Sbjct  25   LSIMDFILRIIAAVATLGSALAMGTTNETLPFATQFIKFRAEFDDLPSLVFFVMANAVVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL +S+FHILR+ A KSRILL+ LDT+M+ L+TA AS+A  IVY+AHNGN+ ANW
Sbjct  85   GYLVLSLMISVFHILRSTAVKSRILLVALDTVMLSLVTASASAATSIVYIAHNGNTGANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ + +FC R S SLIGS+
Sbjct  145  FAICQQYNNFCERISGSLIGSY  166



>ref|NP_001174676.1| Os06g0231050 [Oryza sativa Japonica Group]
 sp|Q67X40.1|CASP3_ORYSJ RecName: Full=Casparian strip membrane protein 3; Short=OsCASP3 
[Oryza sativa Japonica Group]
 sp|A2YAZ1.1|CASP3_ORYSI RecName: Full=Casparian strip membrane protein 3; Short=OsCASP3 
[Oryza sativa Indica Group]
 dbj|BAD37279.1| integral membrane family protein-like [Oryza sativa Japonica 
Group]
 gb|EAZ00252.1| hypothetical protein OsI_22263 [Oryza sativa Indica Group]
 gb|EAZ36366.1| hypothetical protein OsJ_20694 [Oryza sativa Japonica Group]
 dbj|BAH93404.1| Os06g0231050 [Oryza sativa Japonica Group]
Length=184

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D+ILR VAI+G+L SA+AMGTT+QTLPF  Q  RF+AQY D  T   FV+ ++IV 
Sbjct  23   VSILDVILRFVAIIGTLASAIAMGTTNQTLPFFTQFIRFKAQYSDLPTLTFFVVANSIVS  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI H++R+RA+ SR++LIF D  M+ L+TAGAS+AA IVYLAH GN+ ANW
Sbjct  83   AYLILSLPLSIVHVIRSRAKYSRLILIFFDAAMLALVTAGASAAAAIVYLAHKGNARANW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  143  LAICQQFDSFCERISGSLIGSF  164



>ref|NP_001148957.1| casparian strip membrane protein 1 [Zea mays]
 sp|B6T959.1|CASP1_MAIZE RecName: Full=Casparian strip membrane protein 1; Short=ZmCASP1 
[Zea mays]
 gb|ACG33642.1| plant integral membrane protein TIGR01569 containing protein 
[Zea mays]
Length=187

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DLILR +AI+G+L SA+AMGTT++TLPF  Q  RF+AQY D  T   FV+ ++IVC
Sbjct  26   VSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDLPTLTFFVVANSIVC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI HI+R+RA+ SR+LL+ LD  M+ L+T GAS+AA IVYLAH GN  ANW
Sbjct  86   AYLTLSLPLSIVHIIRSRAKYSRLLLVVLDAAMLALVTPGASAAAAIVYLAHKGNVRANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S  LIGSF
Sbjct  146  LAICQQFDSFCERISGCLIGSF  167



>ref|XP_009610092.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana tomentosiformis]
Length=188

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+DL LR++AI+ +LGSA+AMGTT++TLPF  Q  RF A+Y D  TF  FV+ +AIV 
Sbjct  27   MSILDLFLRIIAIIATLGSAIAMGTTNETLPFFTQFIRFRAKYSDLPTFTFFVVANAIVS  86

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL +SIFHI+R+RA+ SRI LIF D  M+ LLTAGAS++A IVYLAH GN+ ANW
Sbjct  87   AYLVLSLGMSIFHIMRSRAQASRIALIFFDAAMLALLTAGASASAAIVYLAHKGNTKANW  146

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ +  FC RTS SL+GS
Sbjct  147  FPICQQYDSFCHRTSGSLVGS  167



>ref|XP_010029309.1| PREDICTED: casparian strip membrane protein 1 [Eucalyptus grandis]
 gb|KCW56206.1| hypothetical protein EUGRSUZ_I01956 [Eucalyptus grandis]
Length=186

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D ILR++A V +LGSA+AMGTT++TLPF  Q  RF A+YDD  TF  FV+ +++V 
Sbjct  25   VAVLDFILRILAFVCTLGSAIAMGTTNETLPFFTQFIRFRARYDDLPTFTFFVVANSVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLS+FHI+R+ A+ SRI+L+  DT M+ LLTAGAS++A IVYLAH GN+ ANW
Sbjct  85   AYLVLSLPLSVFHIMRSAAQNSRIVLVIFDTAMLALLTAGASASAAIVYLAHKGNTKANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ F  FC R S SLIGSF
Sbjct  145  FSICQQFNSFCERISGSLIGSF  166



>ref|XP_006655941.1| PREDICTED: casparian strip membrane protein Os06g0231050-like 
[Oryza brachyantha]
Length=184

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D+ILR VAI+G+L SA+AMGTT+QTLPF  Q  RF+AQY D  T   FV+ ++IVC
Sbjct  23   VSILDVILRFVAIIGTLASAIAMGTTNQTLPFFTQFIRFKAQYSDLPTLTFFVVANSIVC  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI H++R+RA+ SR++LIF D +M+ L+ AGAS+AA IVYLAH GN+ ANW
Sbjct  83   AYLILSLPLSIVHVIRSRAKYSRLILIFFDAVMLALVAAGASAAAAIVYLAHKGNARANW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  143  LAICQQFDSFCERISGSLIGSF  164



>sp|P0DI44.1|CASP1_SOLTU RecName: Full=Casparian strip membrane protein 1; Short=StCASP1 
[Solanum tuberosum]
Length=188

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+DL +R++AI+ +LGSA+AMGTT++TLPF  Q  RF+A+Y D  TF  FV+ +AIV 
Sbjct  23   MSILDLFIRIIAIIATLGSAIAMGTTNETLPFFTQFVRFKAKYSDLPTFTFFVVANAIVS  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSI+HI+R+RA+ +RI LIF D  M+GLLT GAS++A IVYLAH GN   NW
Sbjct  83   AYLVLSLGLSIYHIMRSRAQATRIALIFFDAAMLGLLTGGASASAAIVYLAHKGNRKTNW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ +  FC RTS SL+GSF
Sbjct  143  FPICQQYDSFCHRTSGSLVGSF  164



>ref|XP_006363407.1| PREDICTED: casparian strip membrane protein 1-like isoform X1 
[Solanum tuberosum]
 ref|XP_006363408.1| PREDICTED: casparian strip membrane protein 1-like isoform X2 
[Solanum tuberosum]
Length=188

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+DL +R++AI+ +LGSA+AMGTT++TLPF  Q  RF+A+Y D  TF  FV+ +AIV 
Sbjct  23   MSILDLFIRIIAIIATLGSAIAMGTTNETLPFFTQFVRFKAKYSDLPTFTFFVVANAIVS  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSI+HI+R+RA+ +RI LIF D  M+GLLT GAS++A IVYLAH GN   NW
Sbjct  83   AYLVLSLGLSIYHIMRSRAQATRIALIFFDAAMLGLLTGGASASAAIVYLAHKGNRKTNW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ +  FC RTS SL+GSF
Sbjct  143  FPICQQYDSFCHRTSGSLVGSF  164



>ref|NP_001236648.1| CASP-like protein 7 [Glycine max]
 sp|C6T1G0.1|CASP7_SOYBN RecName: Full=CASP-like protein 7; Short=GmCASP7 [Glycine max]
 gb|ACU15399.1| unknown [Glycine max]
Length=186

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++A V +LGSA+AMGTT++TLPF  Q  +F A++DD  +   FV+ +A+VC
Sbjct  25   LSIMDFILRIIAAVATLGSALAMGTTNETLPFATQFIKFRAEFDDLPSLVFFVMANAVVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL +S+FHILR+   KSRILL+ LDT+M+ L+TA AS+A  IVY+AHNGN+ ANW
Sbjct  85   GYLVLSLMISVFHILRSTPVKSRILLVALDTVMLSLVTASASAATSIVYIAHNGNTGANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ + +FC R S SLIGS+
Sbjct  145  FAICQQYNNFCERISGSLIGSY  166



>ref|XP_004304287.1| PREDICTED: CASP-like protein 1-like [Fragaria vesca subsp. vesca]
Length=187

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I+D ILR++A +G+L SA+AMGTT + LPF  Q  +F A+YDD  TF  FV+ ++IVC 
Sbjct  27   AILDFILRIIAFLGTLASAIAMGTTRERLPFFTQFLQFRAEYDDLPTFTFFVVANSIVCV  86

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL  SL LSIFHILR+ A+ SRI+LIF DT M+ LLT+GAS+A  IVYLAH GN+ ANW 
Sbjct  87   YLMFSLALSIFHILRSHAKNSRIILIFFDTGMLALLTSGASAATAIVYLAHKGNAKANWF  146

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S SLIGSF
Sbjct  147  AICQQFNSFCERISGSLIGSF  167



>ref|XP_006438724.1| hypothetical protein CICLE_v10033634mg [Citrus clementina]
 gb|ESR51964.1| hypothetical protein CICLE_v10033634mg [Citrus clementina]
Length=189

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+DLILR +A  G+ GSA+AM TT++TL    Q  +  A+YDD  +FK FVI ++IVC
Sbjct  28   ISILDLILRTIAAAGTFGSAIAMATTNETLTVFPQFTQVRAEYDDHPSFKFFVIANSIVC  87

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALS+PLSIFHI+RT A+KSRILL+  D +M+ L+TAGASSA  IVYLAH GN+SANW
Sbjct  88   GYLALSVPLSIFHIIRTAAKKSRILLLVFDLVMLTLVTAGASSATAIVYLAHKGNTSANW  147

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A CQ F  FC R S SLIGSF
Sbjct  148  FAFCQLFDSFCERISGSLIGSF  169



>ref|XP_004955209.1| PREDICTED: casparian strip membrane protein Os06g0231050-like 
[Setaria italica]
Length=198

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++DLILR VA++ ++GSA+AMGTT+QTLPF  Q  RF+AQYDD  T   FV+ ++IV 
Sbjct  37   LAVLDLILRFVAVIATVGSAIAMGTTNQTLPFFTQFLRFKAQYDDLPTLTFFVVANSIVA  96

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI H +R+RA+ SR++L+F D  M+ L+T+ AS+AA IVYLAH GN+ ANW
Sbjct  97   AYLVLSIPLSIVHTIRSRAKYSRLVLVFFDAAMLALVTSAASAAAAIVYLAHKGNARANW  156

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S +LIGSF
Sbjct  157  FAICQQFDAFCERISGTLIGSF  178



>gb|KDO82981.1| hypothetical protein CISIN_1g044764mg [Citrus sinensis]
Length=186

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+DLILR +A  G+ GSA+AM TT++TL    Q  +  A+YDD  +FK FVI ++IVC
Sbjct  25   ISILDLILRTIAAAGTFGSAIAMATTNETLTVFPQFTQVRAEYDDHPSFKFFVIANSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLA+S+PLSIFHI+RT A+KSRILL+  D +M+ L+TAGASSA  IVYLAH GN+SANW
Sbjct  85   GYLAISVPLSIFHIIRTAAKKSRILLLVFDLVMLTLVTAGASSATAIVYLAHKGNTSANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A CQ F  FC R S SLIGSF
Sbjct  145  FAFCQLFDSFCERISGSLIGSF  166



>gb|KHN01253.1| CASP-like protein 1 [Glycine soja]
Length=186

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++  V +LGSA+AMGTT++TLPF  Q  +F A++DD  +   FV+ +A+VC
Sbjct  25   LSIMDFILRIITAVATLGSALAMGTTNETLPFATQFIKFRAEFDDLPSLVFFVMGNAVVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL +S+FHI+R+ A KSRILL+ LDT+M+GL+TA AS+A  IVY+AHNGN+ ANW
Sbjct  85   GYLVLSLIISVFHIVRSAAVKSRILLVALDTVMLGLVTASASAATSIVYIAHNGNTGANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  + +FC R S SLIGS+
Sbjct  145  FAICLQYNNFCERISGSLIGSY  166



>ref|XP_006827304.1| hypothetical protein AMTR_s00010p00265970 [Amborella trichopoda]
 gb|ERM94541.1| hypothetical protein AMTR_s00010p00265970 [Amborella trichopoda]
Length=179

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS+ D +LR++  +G+L  A+AMGTTD+TLPF  Q  RF A+Y D  TF  FV+ +AIV 
Sbjct  18   ISVFDFVLRLMGFMGTLAGAIAMGTTDETLPFFTQFIRFRARYSDLPTFTFFVVANAIVS  77

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSIFHI+R++A+ SR++LIF DT M+GL+TAGAS+AA IVYLAH GN  ANW
Sbjct  78   VYLLLSLPLSIFHIVRSKAKGSRMILIFFDTGMLGLITAGASAAAAIVYLAHKGNVRANW  137

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S +LIGSF
Sbjct  138  LAICQQFNSFCERISGALIGSF  159



>ref|XP_004233369.1| PREDICTED: casparian strip membrane protein 1 [Solanum lycopersicum]
Length=176

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++DL +R++AI+ +LGSA+AMGTT +TLPF  Q  RF+A+++D  TF  FV+ +AIV 
Sbjct  11   MSVLDLFIRIIAIIATLGSAIAMGTTYETLPFFTQFVRFKAKFNDLPTFTFFVVANAIVS  70

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSI+HI+R+RA+ SRI LIF D  M+ LLTAGAS++A IVYLAH GN+  NW
Sbjct  71   AYLVLSLGLSIYHIMRSRAQASRIALIFFDAAMLELLTAGASASAAIVYLAHKGNTKTNW  130

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ F  FC RTS SL+GSF
Sbjct  131  FPICQQFDSFCHRTSGSLVGSF  152



>gb|KDP27167.1| hypothetical protein JCGZ_19866 [Jatropha curcas]
Length=185

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D  LR++A +G+L S + MGTT +TLPF  Q FRF A++DD  TF  FV+ + +VC
Sbjct  25   VSILDSFLRIIAFIGTLASGILMGTTKETLPFSTQFFRFRAEFDDLPTFTFFVVANVVVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSIF+I+R+ A+ SRI+ I  DT+M+ LLT GA++AA IVYLAH GN+ ANW
Sbjct  85   GYLLLSLPLSIFNIVRSNAKNSRIIFIIFDTVMVTLLTGGAAAAAAIVYLAHKGNTRANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  FAICQQFNSFCERISGSLIGSF  166



>ref|XP_007153553.1| hypothetical protein PHAVU_003G045200g [Phaseolus vulgaris]
 gb|ESW25547.1| hypothetical protein PHAVU_003G045200g [Phaseolus vulgaris]
Length=187

 Score =   170 bits (430),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D +LR++A VG+LG+A+AMGTT++TLPF  Q  +F A++DD  +   FV+ ++IV 
Sbjct  26   LSVMDFVLRILAAVGTLGAALAMGTTNETLPFTTQFIKFRAEFDDLPSLVFFVMGNSIVS  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS+FH+LR+ A KSRILL+  DT+MMGL+TA AS+A  IVY+AH GN+ ANW
Sbjct  86   GYLVLSLVLSVFHMLRSTAVKSRILLVAFDTVMMGLITASASAATSIVYIAHKGNAGANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ + +FC R S SLIGS+
Sbjct  146  FAICQQYNNFCERISGSLIGSY  167



>ref|XP_004297290.1| PREDICTED: CASP-like protein 2-like [Fragaria vesca subsp. vesca]
Length=190

 Score =   170 bits (430),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D ILRVVA +G+L SA+AMGT+ QTLPF+ Q  RF+A Y D  TF  FVIV++IVC
Sbjct  29   LSVLDFILRVVAALGTLASAIAMGTSRQTLPFVSQFARFKANYKDLPTFTFFVIVNSIVC  88

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP+SI HI+ T A KSRI+L+  DT MMGLLTAGASSA  IV+LAH G+SSANW
Sbjct  89   VYLVLSLPVSIVHIIWTGAVKSRIMLVIFDTAMMGLLTAGASSATAIVFLAHYGSSSANW  148

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               C+ F +FC R S SLIGSF
Sbjct  149  FPFCRQFNNFCERISGSLIGSF  170



>ref|XP_010258295.1| PREDICTED: casparian strip membrane protein 3 [Nelumbo nucifera]
Length=188

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+DL+LR+VA+ G+LGSA+AMGTT++TLPF  Q  RF+AQY D  +F  FVI +A+V 
Sbjct  27   ISILDLVLRLVAVAGTLGSAIAMGTTNETLPFFTQFIRFKAQYSDLPSFTFFVIANAVVS  86

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI+HI R+ A  SRI+L FLD  M+ LLTAGAS+AA IVYLAH GN+ ANW
Sbjct  87   AYLILSLPLSIYHIARSSARGSRIVLTFLDAAMLALLTAGASAAAAIVYLAHKGNARANW  146

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ F  FC R S SLIGSF
Sbjct  147  FSICQQFNSFCERISGSLIGSF  168



>ref|XP_010550038.1| PREDICTED: casparian strip membrane protein 5-like [Tarenaya 
hassleriana]
Length=187

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D ILR++A + ++GSA+ MGTT++TLPF  Q  RF A+Y+D  T   FV+ +A+V 
Sbjct  25   IAIFDFILRIIAFLNTIGSAIIMGTTNETLPFFTQFIRFRAEYNDLPTLTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL +SL  S FHI++++A+ SRILLIFLD  M+GLLT+GAS+AA IVYLAH GN+  NW
Sbjct  85   GYLIVSLGFSFFHIVKSKAQNSRILLIFLDAGMLGLLTSGASAAAAIVYLAHKGNNRTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  FAICQQFNSFCERISGSLIGSF  166



>ref|XP_010066899.1| PREDICTED: casparian strip membrane protein 3-like [Eucalyptus 
grandis]
 gb|KCW64942.1| hypothetical protein EUGRSUZ_G02489 [Eucalyptus grandis]
Length=186

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D  LR+VA +G+LGSA+AM TT+QTLPF  Q  +F AQY+D  +F  FVI + +VC
Sbjct  25   MSMVDFALRIVAAIGTLGSAIAMATTNQTLPFFTQFLQFRAQYNDLPSFMFFVIANGMVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+PLSIFHI R     +RI+LI  DT MM LLTAG S+AA IVYLAHNGNSSANW
Sbjct  85   GYLVLSIPLSIFHIKRPELTITRIILIIFDTAMMALLTAGGSAAAAIVYLAHNGNSSANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R + SLIGSF
Sbjct  145  FAICQQFGSFCERITGSLIGSF  166



>ref|XP_007032593.1| Casparian strip membrane protein 5, putative [Theobroma cacao]
 gb|EOY03519.1| Casparian strip membrane protein 5, putative [Theobroma cacao]
Length=187

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D I R++A +G+LGSA+AM TT++TLPF  + F+F A+YDD  TF  FV+ +AIV 
Sbjct  25   VSVLDFIFRILAFIGTLGSAIAMVTTNETLPFFTRFFQFRAEYDDLPTFTFFVVANAIVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SIFHI+R+ A+++R++LIF D +M+ LLTAGAS+AA IVYLAH GN+  NW
Sbjct  85   GYLLLSLPFSIFHIVRSSAQRTRMILIFFDMVMLALLTAGASAAAAIVYLAHKGNARVNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC+RTS SLIGSF
Sbjct  145  LAICQQFNSFCQRTSGSLIGSF  166



>ref|XP_008379370.1| PREDICTED: CASP-like protein 1 [Malus domestica]
 ref|XP_008348077.1| PREDICTED: CASP-like protein 1 [Malus domestica]
Length=193

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            SI+D ILR+VA +G+L SAV MGTT + LPF  Q  +F A+YDD  TF  FV+ ++IVC 
Sbjct  33   SILDFILRIVAFLGTLVSAVTMGTTRERLPFFTQFLQFRAEYDDLPTFTFFVVANSIVCA  92

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL  SL LS+FHILR+ A+KSRI+LIF DT M+ LLTAGAS+AA IVYLAH GN+ ANW 
Sbjct  93   YLVFSLALSVFHILRSNAKKSRIILIFFDTAMLALLTAGASAAAAIVYLAHKGNAKANWF  152

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S SLIGSF
Sbjct  153  AICQQFNSFCERISGSLIGSF  173



>ref|XP_009376287.1| PREDICTED: CASP-like protein 1 [Pyrus x bretschneideri]
Length=193

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            SI+D ILR+VA +G+L SA+AMGTT + LPF  Q  +F A+YDD  TF  FV+ ++IVC 
Sbjct  33   SILDFILRIVAFLGTLVSAIAMGTTRERLPFFTQFLQFRAEYDDLPTFTFFVVANSIVCA  92

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL  SL LS+FHI+R+ A+KSRI+LIF DT M+ LLTAGAS+AA IVYLAH GN+ ANW 
Sbjct  93   YLVFSLALSVFHIIRSNAKKSRIILIFFDTAMLALLTAGASAAAAIVYLAHKGNAKANWF  152

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S SLIGSF
Sbjct  153  AICQQFNSFCERISGSLIGSF  173



>ref|XP_010042237.1| PREDICTED: casparian strip membrane protein 3-like [Eucalyptus 
grandis]
Length=186

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D  LR++A +G+LGSA+AM TT+QTLPF  Q  +F AQY+D  +F  FVI + +VC
Sbjct  25   MSMVDFALRIIAAIGTLGSAIAMATTNQTLPFFTQFLQFRAQYNDLPSFMFFVIANGMVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+PLSIFHI R     +RI+LI  DT MM LLTAG S+AA IVYLAHNGNSSANW
Sbjct  85   GYLVLSIPLSIFHIKRPELTITRIILIIFDTAMMALLTAGGSAAAAIVYLAHNGNSSANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R + SLIGSF
Sbjct  145  FAICQQFGSFCERITGSLIGSF  166



>gb|AFK37802.1| unknown [Lotus japonicus]
Length=186

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+VA   +LG AV MGT +++LPF+    +F A+YDD  +F  FV+ +++VC
Sbjct  25   LSIMDFILRIVAAAATLGGAVGMGTAEESLPFVTNFMQFRAEYDDLPSFVFFVLANSLVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS+FHI+R+ A KSR+LLI  DT+M+GLL AGAS+AA IVYLAHNGNS ANW
Sbjct  85   GYLVLSLILSVFHIVRSSAVKSRVLLIVFDTVMLGLLIAGASAAAAIVYLAHNGNSKANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ F ++C++ S S++GS+
Sbjct  145  FPICQQFNNYCQQASGSVVGSY  166



>ref|XP_004975856.1| PREDICTED: casparian strip membrane protein 2-like [Setaria italica]
Length=189

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S  D+ LR +AI+G++GSA++MGTT++TLPF  Q  +FEA+Y D  +F  FV  +A+VC
Sbjct  27   VSFADIFLRFLAIIGTIGSAISMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVC  86

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI HI+R RA  SR++LIFLD  M+ LLTAGAS+AA IVYLAH GN  ANW
Sbjct  87   TYLVLSIPLSIVHIIRPRARYSRLILIFLDASMLTLLTAGASAAAAIVYLAHKGNVRANW  146

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ F  FC R S SLIGSF
Sbjct  147  FSICQQFDSFCERISGSLIGSF  168



>ref|XP_003564046.1| PREDICTED: casparian strip membrane protein 3 [Brachypodium distachyon]
 sp|P0DI36.1|CASP3_BRADI RecName: Full=Casparian strip membrane protein 3; Short=BdCASP3 
[Brachypodium distachyon]
Length=184

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  IIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCGY  411
            I+DLI RV+A++G+L SA+AMGTT+QT+PF  Q  +F+ +Y D  T   FV+ ++I   Y
Sbjct  25   ILDLIFRVIAVIGTLASAIAMGTTNQTMPFFTQFVQFKERYSDLPTLTFFVVANSIASAY  84

Query  412  LALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWPA  591
            L +SLPLSI HI+R+RA+ SR++LIF D  M+ L+TA AS+ A IVYLAHNGN SANW A
Sbjct  85   LIISLPLSIVHIIRSRAKYSRLILIFFDVAMLALVTAAASAGAAIVYLAHNGNVSANWFA  144

Query  592  ICQPFQDFCRRTSASLIGSF  651
            ICQ F  FC R S SLIGSF
Sbjct  145  ICQQFDSFCERISGSLIGSF  164



>ref|XP_002278569.1| PREDICTED: casparian strip membrane protein 3 [Vitis vinifera]
 sp|A7PMY7.1|CASP3_VITVI RecName: Full=Casparian strip membrane protein 3; Short=VvCASP3 
[Vitis vinifera]
 emb|CBI22242.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI+D ILR++ I+G+LGSA+AMGTT++TLPF  Q  +F A+YDD  TF  FVI ++IV 
Sbjct  25   ISILDFILRLITIIGTLGSAIAMGTTNETLPFFTQFTQFRAEYDDLPTFTFFVIANSIVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+SI HI+R+ A  SRI+LIF DT M+ LLTA AS+A+ IVYLAH GN+ ANW
Sbjct  85   GYLVLSLPMSILHIVRSGARASRIVLIFFDTAMLALLTAAASAASAIVYLAHKGNAQANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F+ FC R S SLIGSF
Sbjct  145  FAICQQFKSFCERISGSLIGSF  166



>ref|XP_011098775.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum]
Length=189

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+V IV +L SA+AM TT+++LPF  Q  RF A+Y+D  TF  FV  +++VC
Sbjct  27   VAILDFILRLVGIVATLASAIAMATTNESLPFFTQFIRFRAKYNDLPTFTFFVAANSVVC  86

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSIFHI+R+ A+ SR++LIF DT M+GLL+AGAS++A IVYLAH GN+ ANW
Sbjct  87   AYLVLSLALSIFHIVRSSAQNSRVVLIFFDTGMLGLLSAGASASAAIVYLAHKGNTRANW  146

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC+RTS SLIGSF
Sbjct  147  FAICQQFNSFCQRTSGSLIGSF  168



>ref|XP_010420188.1| PREDICTED: casparian strip membrane protein 5-like [Camelina 
sativa]
Length=187

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA   ++GSA+ MGTT +TLPF  Q  RF+A+Y+D      FV+ +A+V 
Sbjct  25   IAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQFIRFQAEYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL L+  HI++++ + SRILLI LD +M+GLLTAGASSAA IVYLAHNGN+  NW
Sbjct  85   GYLILSLTLAFVHIVKSKTQNSRILLIVLDVVMLGLLTAGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  NAICQQFNSFCERISGSLIGSF  166



>ref|XP_007046042.1| Casparian strip membrane protein 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01874.1| Casparian strip membrane protein 5, putative isoform 1 [Theobroma 
cacao]
Length=212

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D +LR++A  G+LGSA+AMGTT++T+P   QS    A+Y D   F  FVI +++ C
Sbjct  51   VAVLDFMLRILAAAGTLGSAMAMGTTEETVPLFPQSILLNAEYSDLPMFTFFVIANSVAC  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLS +HI+RT A+ SRI+L+  DT+M+ L+TAGAS+AA IVYLAH GN++ANW
Sbjct  111  AYLVLSLPLSFYHIIRTAAKSSRIILVMFDTVMLALVTAGASTAAAIVYLAHKGNANANW  170

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC  TS SLIGSF
Sbjct  171  FAICQQFNSFCEHTSGSLIGSF  192



>ref|XP_010453663.1| PREDICTED: casparian strip membrane protein 5 [Camelina sativa]
Length=187

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA   ++GSA+ MGTT +TLPF  Q  RF+A+Y+D      FV+ +A+V 
Sbjct  25   IAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQFIRFQAEYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL L+  HI++++ + SRILLI LD +M+GLLTAGASSAA IVYLAHNGN+  NW
Sbjct  85   GYLILSLTLAFVHIVKSKTQNSRILLIVLDVVMLGLLTAGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  NAICQQFNSFCERISGSLIGSF  166



>ref|XP_007046043.1| Casparian strip membrane protein 5, putative isoform 2 [Theobroma 
cacao]
 gb|EOY01875.1| Casparian strip membrane protein 5, putative isoform 2 [Theobroma 
cacao]
Length=234

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D +LR++A  G+LGSA+AMGTT++T+P   QS    A+Y D   F  FVI +++ C
Sbjct  73   VAVLDFMLRILAAAGTLGSAMAMGTTEETVPLFPQSILLNAEYSDLPMFTFFVIANSVAC  132

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLS +HI+RT A+ SRI+L+  DT+M+ L+TAGAS+AA IVYLAH GN++ANW
Sbjct  133  AYLVLSLPLSFYHIIRTAAKSSRIILVMFDTVMLALVTAGASTAAAIVYLAHKGNANANW  192

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC  TS SLIGSF
Sbjct  193  FAICQQFNSFCEHTSGSLIGSF  214



>sp|P0DI54.1|CASP1_MALDO RecName: Full=Casparian strip membrane protein 1; Short=MdCASP1 
[Malus domestica]
Length=175

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            SI+D ILR+VA +G+L SAV MGTT + LPF  Q  +F A+YDD  TF  FV+ ++IVC 
Sbjct  15   SILDFILRIVAFLGTLVSAVTMGTTRERLPFFTQFLQFRAEYDDLPTFTFFVVANSIVCA  74

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL  SL LS+FHI+R+ A+KSRI+LIF DT M+ LLTAGAS+AA IVYL+H GN+ ANW 
Sbjct  75   YLVFSLALSVFHIIRSNAKKSRIILIFFDTAMLALLTAGASAAAAIVYLSHKGNAKANWF  134

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S SLIGSF
Sbjct  135  AICQQFNSFCERISGSLIGSF  155



>gb|EYU34055.1| hypothetical protein MIMGU_mgv1a020210mg [Erythranthe guttata]
Length=182

 Score =   164 bits (416),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D  LR+VAI+ +L SA++MGTTD++LPF  Q  RF A+Y+D  TF  FV+ ++IV 
Sbjct  20   VAVVDFFLRIVAIIATLASAISMGTTDESLPFFTQFIRFRAKYNDLPTFTFFVVANSIVS  79

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSI HI+R+ +  SR++LI  DT M+ LLT+GAS+AA IVYLAH GN+  NW
Sbjct  80   AYLVLSLALSISHIIRSGSRNSRVVLIIFDTAMLALLTSGASAAAAIVYLAHKGNTKTNW  139

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC RTS SLIGSF
Sbjct  140  FAICQQYNSFCERTSGSLIGSF  161



>ref|XP_006338436.1| PREDICTED: casparian strip membrane protein VIT_14s0108g01050-like 
[Solanum tuberosum]
Length=179

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +D I+R+VAI+G+LGSA+AMGTT++TLP   Q  RF+A+Y +  TF  FV+ + IV 
Sbjct  18   ISFLDFIMRIVAILGTLGSAIAMGTTNETLPSFEQFIRFKAEYKNLPTFTFFVVANGIVS  77

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLA+SL LSI HI+ + A  +R++LIF DT+MM  LT+GAS+AA IVYLAH GN+SANW
Sbjct  78   AYLAVSLVLSILHIVMSGARITRVVLIFFDTVMMAFLTSGASAAAAIVYLAHKGNASANW  137

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC R S SL+GSF
Sbjct  138  IAICQQYNSFCDRASGSLVGSF  159



>ref|XP_009360608.1| PREDICTED: CASP-like protein 1 [Pyrus x bretschneideri]
Length=193

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            SI+D ILR+VA +G+L SA+AMGTT + LPF  Q  +F  +YDD  TF  FV+ ++IVC 
Sbjct  33   SILDFILRIVAFLGTLVSAIAMGTTRERLPFFTQFLQFRPEYDDLPTFTFFVVANSIVCA  92

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL  SL LS+FHI+R+ A+KSRI+LIF DT M+ LL AGAS+AA IVYLAH GN+ ANW 
Sbjct  93   YLVFSLALSVFHIIRSNAKKSRIILIFFDTAMLALLMAGASAAAAIVYLAHKGNAKANWF  152

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S SLIGSF
Sbjct  153  AICQQFNAFCERISGSLIGSF  173



>sp|P0DI34.1|CASP2_PANVG RecName: Full=Casparian strip membrane protein 2; Short=PvCASP2 
[Panicum virgatum]
Length=192

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            S+ D+ LR +AIVG++ SA++MGTT++TLPF  Q  +FEA+Y D  +F  FV  +A+VC 
Sbjct  31   SVADVFLRFLAIVGTIASAISMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVCT  90

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LS+PLSI HI+R RA  SR++L+F D  M+ LLTAGAS+AA IVYLAH GN  ANW 
Sbjct  91   YLVLSIPLSIVHIVRPRARYSRLVLVFFDAAMLTLLTAGASAAAAIVYLAHKGNVRANWF  150

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S SLIGSF
Sbjct  151  AICQQFDSFCERISGSLIGSF  171



>ref|XP_010551838.1| PREDICTED: casparian strip membrane protein 5-like [Tarenaya 
hassleriana]
Length=184

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D ILR++A + ++GSA+ MGTT++TLPF  Q  RF A+Y+D      FV+ +A+V 
Sbjct  22   IAIFDFILRIIAFLNTIGSAIIMGTTNETLPFFTQFIRFRAEYNDLPALTFFVVANAVVS  81

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS F+IL+  A+ SR+LLIFLD   +GLLTAGASSAA IVYLAH GN+  NW
Sbjct  82   GYLILSLALSFFNILKNNAQNSRVLLIFLDVASLGLLTAGASSAAAIVYLAHEGNNRTNW  141

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  142  FAICQQFNSFCERISGSLIGSF  163



>emb|CDP02250.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +++D  LRVVAI+ +LGSA+AMGTT++TLPF  Q  RF A+Y D   F  FV+ +++V  
Sbjct  26   AVVDFFLRVVAIIATLGSAIAMGTTNETLPFFTQFIRFRAKYTDLPMFTFFVVANSVVSA  85

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSL LSIFHI+R+RA  SR++LIF D  M+ LLTAGAS+AA IVYLAH GNS ANW 
Sbjct  86   YLVLSLALSIFHIMRSRAHASRVVLIFFDAGMLALLTAGASAAAAIVYLAHKGNSRANWI  145

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AICQ F  FC R S S+IGSF
Sbjct  146  AICQQFNSFCERISGSMIGSF  166



>ref|XP_010492362.1| PREDICTED: casparian strip membrane protein 5-like [Camelina 
sativa]
Length=187

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA+  ++GSA+ MGTT +TLPF  +  RF+A+Y D      FV+ +A+V 
Sbjct  25   IAILEFILRIVALFNTIGSAILMGTTHETLPFFTRFIRFQAEYSDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL L+  HI++++ + SRILLI LD +M+GLLTAGASSAA IVYLAHNGN+  NW
Sbjct  85   GYLILSLTLAFVHIVKSKTQNSRILLIVLDVVMLGLLTAGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  NAICQQFNSFCERISGSLIGSF  166



>ref|XP_007225906.1| hypothetical protein PRUPE_ppa011955mg [Prunus persica]
 gb|EMJ27105.1| hypothetical protein PRUPE_ppa011955mg [Prunus persica]
Length=190

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D  LRVVA +G+L SA+AMGT+ +TLPF  Q  RF A+Y D  T   FVI ++IVC
Sbjct  29   LSVLDFTLRVVAALGTLASAIAMGTSRETLPFTAQFVRFRARYKDLPTLTFFVIANSIVC  88

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLS  HI+ T A+ SRI+LI  DT+MMGLLTAGAS+AA IVYLAH GNSS NW
Sbjct  89   VYLVLSLPLSFVHIIWTAAKNSRIVLIISDTVMMGLLTAGASAAAAIVYLAHYGNSSTNW  148

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C+ F  FC R S SLIGSF
Sbjct  149  FAFCRQFNSFCERISGSLIGSF  170



>ref|XP_004233676.1| PREDICTED: casparian strip membrane protein 3-like [Solanum lycopersicum]
Length=182

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +D I+R+VAI+G+LGSA+AMGTT++TLP   Q  RF+A+Y D  TF  FV+ + IV 
Sbjct  21   ISFLDFIMRIVAILGTLGSAIAMGTTNETLPSFEQFIRFKAEYKDLPTFTFFVVANGIVS  80

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLA+SL LSI HI+ + A  +R++LIF DT+MM  LT+GAS+AA IVYLAH GN+ ANW
Sbjct  81   AYLAVSLVLSILHIVMSGARITRVVLIFFDTVMMAFLTSGASAAAAIVYLAHKGNARANW  140

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC R S SL+GSF
Sbjct  141  IAICQHYNSFCDRASGSLVGSF  162



>ref|NP_001052990.2| Os04g0460400 [Oryza sativa Japonica Group]
 sp|Q7XUV7.2|CASP5_ORYSJ RecName: Full=Casparian strip membrane protein 5; Short=OsCASP5 
[Oryza sativa Japonica Group]
 sp|A2XU91.1|CASP6_ORYSI RecName: Full=Casparian strip membrane protein 6; Short=OsCASP6 
[Oryza sativa Indica Group]
 sp|F2QA93.1|CASP1_ORYRU RecName: Full=Casparian strip membrane protein 1; Short=OrCASP1 
[Oryza rufipogon]
 emb|CAD40983.2| OSJNBa0072F16.8 [Oryza sativa Japonica Group]
 emb|CAH67083.1| OSIGBa0097P08.13 [Oryza sativa Indica Group]
 emb|CAH67451.1| H0219H12.8 [Oryza sativa Indica Group]
 gb|EAY94401.1| hypothetical protein OsI_16169 [Oryza sativa Indica Group]
 gb|EAZ30975.1| hypothetical protein OsJ_15056 [Oryza sativa Japonica Group]
 dbj|BAF14904.2| Os04g0460400 [Oryza sativa Japonica Group]
 emb|CBW45788.1| ORW1943Ba0077G13.16 [Oryza rufipogon]
Length=186

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D  LR +AI+G++GSA+AMGTT++TLPF  Q  +FEA+Y D  +F  FV  +A+VC
Sbjct  24   VAVVDTFLRFIAIIGTIGSAIAMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVC  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI HILR RA  SR+ L+F DT M+ LLTAGAS+AA IVYLAH GN  ANW
Sbjct  84   TYLVLSIPLSIVHILRPRARYSRLFLVFFDTAMLALLTAGASAAAAIVYLAHKGNVRANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ F  FC R S SLIGSF
Sbjct  144  FSICQQFDSFCERISGSLIGSF  165



>ref|XP_006665081.1| PREDICTED: casparian strip membrane protein ORW1943Ba0077G13.16-like 
[Oryza brachyantha]
Length=189

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D+ LR +AI+G++GSA+AMGTT++TLPF  Q  +FEA+Y D  +F  FV  +A+VC
Sbjct  27   VAVVDIFLRFIAIIGTVGSAIAMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVC  86

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI HI+R RA  SR+ L+F DT M+ LLTAGAS+AA IVYLAH GN  ANW
Sbjct  87   TYLVLSIPLSIVHIIRPRARYSRLFLVFFDTAMLALLTAGASAAAAIVYLAHKGNVRANW  146

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ F  FC R S SLIGSF
Sbjct  147  FSICQQFDSFCERISGSLIGSF  168



>ref|XP_002318369.1| integral membrane family protein [Populus trichocarpa]
 sp|B9I534.1|CASP6_POPTR RecName: Full=Casparian strip membrane protein 6; Short=PtCASP6 
[Populus trichocarpa]
 gb|EEE96589.1| integral membrane family protein [Populus trichocarpa]
Length=186

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR++A +G+LGSA++M TT++TLPF  Q  RF A+YDD  TF  FV+ + +V 
Sbjct  24   VAILDFILRILAFIGTLGSAISMATTNETLPFFTQFIRFRAEYDDLPTFTFFVVANGVVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL  SLP SIF+I+R++A+ SRILLI LDT M+GLL+AGAS+AA IVYLAH GN   NW
Sbjct  84   AYLLFSLPFSIFNIVRSKAQNSRILLIILDTAMLGLLSAGASAAAAIVYLAHQGNVRTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  144  SAICQQFNSFCERISGSLIGSF  165



>ref|XP_008230985.1| PREDICTED: CASP-like protein 1 [Prunus mume]
Length=189

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++A +G+L SA+AMGTT + LPF  Q  +F A+YDD  TF  FV+ +++VC
Sbjct  28   VSILDFILRIIAFLGTLVSAIAMGTTRERLPFFTQFLQFRAEYDDLPTFTFFVVANSVVC  87

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL  SL LSIFHI+R+ A++SRI+ IF DT M+ LLTAGAS+AA IVYLAH GN+ ANW
Sbjct  88   AYLVCSLALSIFHIIRSNAKRSRIISIFFDTAMLALLTAGASAAAAIVYLAHKGNAKANW  147

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  148  FAICQQFNSFCERISGSLIGSF  169



>ref|XP_002533115.1| conserved hypothetical protein [Ricinus communis]
 sp|B9T4E6.1|CASP5_RICCO RecName: Full=Casparian strip membrane protein 5; Short=RcCASP5 
[Ricinus communis]
 gb|EEF29260.1| conserved hypothetical protein [Ricinus communis]
Length=186

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+VA+VG+L SA+ MGTT++TLPF  Q  RF A+YDD  TF  FV+ + +V 
Sbjct  24   VSILDFILRLVALVGTLASAILMGTTNETLPFATQFIRFRAEYDDLPTFTFFVVANIVVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSI +I+R+ A+  RI+LI  DT M+ LLTAGAS+AA IVYLAH GN+ ANW
Sbjct  84   GYLLLSLPLSIVNIVRSTAKNRRIILIIFDTAMLALLTAGASAAAAIVYLAHKGNTRANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  144  FAICQQFNSFCERISGSLIGSF  165



>ref|XP_003607732.1| hypothetical protein MTR_4g081880 [Medicago truncatula]
 sp|G7JG80.1|CASP2_MEDTR RecName: Full=Casparian strip membrane protein 2; Short=MtCASP2 
[Medicago truncatula]
 gb|AES89929.1| casparian strip membrane protein [Medicago truncatula]
Length=189

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+ A + +LGSA++MGT  QT+PF  +  RF+  + D  TF  FV  ++IVC
Sbjct  26   LSIMDFILRIFAAMSTLGSALSMGTAKQTMPFATRFVRFKVSFHDLPTFLFFVTANSIVC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALSL LS FHI+RT + KSRILL+FLDT+M GLLT+GAS+AA IVY+AH GN SANW
Sbjct  86   GYLALSLVLSFFHIVRTISVKSRILLVFLDTVMFGLLTSGASAAAAIVYVAHYGNPSANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               CQ +  FC R S SL+GSF
Sbjct  146  FPFCQQYNSFCGRISGSLVGSF  167



>gb|AFK45120.1| unknown [Medicago truncatula]
Length=189

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+ A + +LGSA++MGT  QT+PF+ +  RF+  + D  TF  FV  ++I C
Sbjct  26   LSIMDFILRIFAAMSTLGSALSMGTAKQTMPFVTRFVRFKVSFHDLPTFLFFVTANSIAC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALSL LS FHI+RT + KSRILL+FLDT+M GLLT+GAS+AA IVY+AH GN SANW
Sbjct  86   GYLALSLVLSFFHIVRTISVKSRILLVFLDTVMFGLLTSGASAAAAIVYVAHYGNPSANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               CQ +  FC R S SL+GSF
Sbjct  146  FPFCQQYNSFCGRISGSLVGSF  167



>ref|NP_197033.1| casparian strip membrane protein 5 [Arabidopsis thaliana]
 sp|Q9LXF3.1|CASP5_ARATH RecName: Full=Casparian strip membrane protein 5; Short=AtCASP5 
[Arabidopsis thaliana]
 emb|CAB89339.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42012.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39953.1| At5g15290 [Arabidopsis thaliana]
 gb|AED92144.1| casparian strip membrane protein 5 [Arabidopsis thaliana]
 gb|AEJ82275.1| casparian strip protein 5 [Cloning vector pCASP5::CASP5:GFP]
 gb|AEJ82285.1| casparian strip protein 5 [Cloning vector p35S::CASP5:GFP]
Length=187

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA   ++GSA+ MGTT +TLPF  Q  RF+A+Y+D      FV+ +A+V 
Sbjct  25   IAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQFIRFQAEYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL L+  HI++ + + +RILLI LD  M+GLLT+GASSAA IVYLAHNGN+  NW
Sbjct  85   GYLILSLTLAFVHIVKRKTQNTRILLIILDVAMLGLLTSGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  FAICQQFNSFCERISGSLIGSF  166



>ref|XP_008221595.1| PREDICTED: CASP-like protein 1 [Prunus mume]
Length=190

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D  LRV+A +G+L SA+AMGT+ +TLPF  Q  RF A+Y D  T   FVI ++IVC
Sbjct  29   LSVLDFTLRVIAALGTLASAIAMGTSRETLPFTAQFVRFRARYKDLPTLTFFVIANSIVC  88

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLS  HI+ T A+ SRI+LI  DT+MMGL+TAGAS+AA IVYLAH GNSS NW
Sbjct  89   VYLVLSLPLSFVHIIWTAAKNSRIVLIISDTVMMGLVTAGASAAAAIVYLAHYGNSSTNW  148

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C+ F  FC R S SLIGSF
Sbjct  149  FAFCRQFNSFCERISGSLIGSF  170



>sp|P0DI62.1|CASP1_CYNCS RecName: Full=Casparian strip membrane protein 1; Short=CsCASP1 
[Cynara cardunculus var. scolymus]
Length=207

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +++ D++LR+  I  +LG+A+AMG+TDQTLPF  Q F+F+A++DD   F  FVI +AI  
Sbjct  49   LAVFDVVLRLAGIATALGAAIAMGSTDQTLPFFTQFFQFKAEFDDLPAFTFFVIANAITA  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLAL++P+SI  I+R      R+LLIFLDT+M+ L TA A   A IVYLAHNGNS ANW
Sbjct  109  AYLALTIPISIVCIIRPHLVAPRVLLIFLDTVMVALTTAAAGGTASIVYLAHNGNSDANW  168

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            PAICQ F D C++ S +++ SF
Sbjct  169  PAICQQFNDXCQKVSGAVVASF  190



>ref|XP_011001927.1| PREDICTED: casparian strip membrane protein 6 [Populus euphratica]
Length=186

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR++A +G+LGSA++M TT++TLPF  +  RF A+YDD  TF  FV+ + +V 
Sbjct  24   VAILDFILRILAFIGTLGSAISMATTNETLPFFTRFIRFRAEYDDLPTFTFFVVANGVVS  83

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL  SLPLSIF+I+R++A+ SRILLI LDT M+GLL+AGAS+AA IVYLAH GN   NW
Sbjct  84   AYLLFSLPLSIFNIVRSKAQNSRILLIILDTAMLGLLSAGASAAAAIVYLAHRGNVRTNW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  144  FAICQQFNSFCERISGSLIGSF  165



>sp|Q6Z2U5.2|CASP4_ORYSJ RecName: Full=Casparian strip membrane protein 4; Short=OsCASP4 
[Oryza sativa Japonica Group]
Length=201

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DLILRVVA+V  + SA+AMGTT+QTLPF  Q  RF+AQY D  T  LFV+ ++ V 
Sbjct  40   LSVADLILRVVAVVAIVDSAIAMGTTNQTLPFFTQFLRFKAQYSDLPTLTLFVVANSAVT  99

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLS+ HI+R+RA  SR++LIFLD++M+ L+ A AS++A IVYLAH GN  ANW
Sbjct  100  AYLVLSIPLSVVHIIRSRASYSRLVLIFLDSVMLALVAAVASASAAIVYLAHKGNVRANW  159

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A+CQ F  FC R S  LIGSF
Sbjct  160  FAVCQQFDSFCERISGPLIGSF  181



>sp|P0DI58.1|CSPL2_LOTJA RecName: Full=CASP-like protein 2; Short=LjCASP2 [Lotus japonicus]
Length=187

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+VA +G+LGSA++ GTT +TLPF  Q  +F A +DD  TF  FV  ++IVC
Sbjct  25   LSIMDFILRIVAAIGTLGSALSTGTTRETLPFTTQFVKFRAVFDDLPTFVFFVTSNSIVC  84

Query  406  GYLALSLPLSIFHIL-RTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSAN  582
            GYL LSL LS FHI+ R+ A KSRILL+FLDT+M GLLT GA++A  IVY++H GN +AN
Sbjct  85   GYLVLSLALSFFHIIRRSSAAKSRILLVFLDTVMFGLLTTGAAAAGTIVYVSHYGNVNAN  144

Query  583  WPAICQPFQDFCRRTSASLIGSF  651
            W   C  +  FC R S SLIGSF
Sbjct  145  WFPFCGQYNHFCERISGSLIGSF  167



>ref|XP_008669320.1| PREDICTED: casparian strip membrane protein Sb06g018970-like 
[Zea mays]
Length=193

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D+ LR +AIV ++GSAV+MGTT++TLPF  Q  +FEA+Y D  +F  FV  +A+VC
Sbjct  31   VSIADVFLRFLAIVATIGSAVSMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVC  90

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI HI+R RA  SR++L+F D  M+ LLTAGAS+AA IVYLAH GN  ANW
Sbjct  91   TYLVLSIPLSIVHIVRPRAHYSRLILVFFDAAMLALLTAGASAAAAIVYLAHKGNVRANW  150

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  151  FAICQQFDSFCERISGSLIGSF  172



>ref|XP_008341761.1| PREDICTED: CASP-like protein 1 [Malus domestica]
Length=194

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            SI+D ILR+VA +G+L SA+AMGTT + LPF  Q  +F A+YDD  TF  FV+ ++IVC 
Sbjct  33   SILDFILRIVAFLGTLVSAIAMGTTQERLPFFTQFLQFRAEYDDLPTFTFFVVXNSIVCT  92

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDT-MMMGLLTagassaagIVYLAHNGNSSANW  585
            YL  SL LS+FHI+R+ A+KSRI+LIF DT M+  L    +++AA IVYLAH GN+ ANW
Sbjct  93   YLVFSLALSVFHIIRSNAKKSRIILIFFDTAMLALLTAGASAAAAAIVYLAHKGNAKANW  152

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC   S SLIGSF
Sbjct  153  FAICQQFNAFCEHISGSLIGSF  174



>ref|XP_003621263.1| hypothetical protein MTR_7g011090 [Medicago truncatula]
 sp|G7L218.1|CASP3_MEDTR RecName: Full=Casparian strip membrane protein 3; Short=MtCASP3 
[Medicago truncatula]
 gb|AES77481.1| casparian strip membrane protein [Medicago truncatula]
Length=186

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++AIV +L SA+AMGTTD++LPF  Q  RF A YDD  T + FV+ SAIV 
Sbjct  25   VSILDFILRLIAIVATLASAIAMGTTDESLPFFTQFVRFRANYDDLPTLRFFVVASAIVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSI HI+R+ A  +R++ I LDT+M+GLLTAG+S+AA IVYLAH GN  ANW
Sbjct  85   GYLILSLPLSILHIIRSSAGMTRVIFIILDTVMLGLLTAGSSAAASIVYLAHKGNRKANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A CQ +  FC R S SLIGSF
Sbjct  145  FAFCQQYNSFCERISGSLIGSF  166



>ref|XP_010265175.1| PREDICTED: casparian strip membrane protein 1-like [Nelumbo nucifera]
Length=194

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS++D +LR+VA+  ++GSAVAMGTT++TLPF  Q  +F+AQY+D  +F  FVI +A+V 
Sbjct  30   ISVLDFVLRLVAVAATIGSAVAMGTTNETLPFFTQFIQFKAQYNDLPSFTFFVIANAVVS  89

Query  406  GYLALSLPLSIFHILRT--RAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSA  579
             YL LSLPLSI+HI+RT   A  SRI+LIFLD  MM LLTAGAS+AA +VYLAH GN+ A
Sbjct  90   AYLILSLPLSIYHIVRTTSSARGSRIILIFLDAAMMALLTAGASAAAAVVYLAHKGNARA  149

Query  580  NWPAICQPFQDFCRRTSASLIGSF  651
            NW AICQ F  FC RTSASLIGSF
Sbjct  150  NWFAICQQFNSFCERTSASLIGSF  173



>gb|KHN25032.1| CASP-like protein 2 [Glycine soja]
Length=186

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+VA + +LGSA+ MGTT QTLPF  Q  +F A + D  TF  FV  ++IVC
Sbjct  25   LSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFVKFRAVFSDLPTFVFFVTSNSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS FHI+R+ A KSR+L +FLDT+M GLLT GAS+A  IVY AH GNS+ NW
Sbjct  85   GYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGLLTTGASAATAIVYEAHYGNSNTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               C+ +  FC++ S SLIGSF
Sbjct  145  FPFCRQYNRFCKQISGSLIGSF  166



>ref|XP_004490091.1| PREDICTED: CASP-like protein MTR_5g041900-like [Cicer arietinum]
Length=187

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++  V +L SAV+M TTD+ LPF     +F A+YDD  +F  FV+ +++VC
Sbjct  26   LSIMDFILRIIGGVATLASAVSMATTDERLPFATAFIQFRAEYDDLPSFVFFVMANSVVC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LSIFHI+R+ A KSRI LI LD  MM LLTA AS+AA IVY+AH GNS ANW
Sbjct  86   GYLVLSLILSIFHIVRSTAVKSRIFLIVLDMAMMSLLTAAASAAAAIVYIAHYGNSQANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ +  FC R S SLIGS+
Sbjct  146  FPICQQYNSFCERISGSLIGSY  167



>ref|NP_001235823.1| CASP-like protein 6 [Glycine max]
 sp|C6T4A0.1|CASP6_SOYBN RecName: Full=CASP-like protein 6; Short=GmCASP6 [Glycine max]
 gb|ACU16510.1| unknown [Glycine max]
 gb|KHN25031.1| CASP-like protein 2 [Glycine soja]
Length=186

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+VA + +LGSA+ MGTT QTLPF  Q  +F A + D  TF  FV  ++IVC
Sbjct  25   LSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFVKFRAVFSDVPTFVFFVTSNSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS FHI+R+ A KSR+L +FLDT+M GLLT GAS+A  IVY AH GNS+ NW
Sbjct  85   GYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGLLTTGASAATAIVYEAHYGNSNTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               C+ +  FC++ S SLIGSF
Sbjct  145  FPFCRQYNHFCKQISGSLIGSF  166



>ref|XP_009609035.1| PREDICTED: casparian strip membrane protein 3-like [Nicotiana 
tomentosiformis]
Length=186

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +D I+R+ AI+G+LGSA+AMG T++TLP   +  RF+A+Y D  TF  FV+ + IV 
Sbjct  25   ISFLDFIMRIFAIIGTLGSAIAMGKTNETLPSFTEFIRFKAEYKDLPTFTFFVVANGIVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLA+SL LSI HI+   A  +R++L+F DT+MM  LT+GAS+AA IVYLAH GN  ANW
Sbjct  85   AYLAVSLVLSILHIVMAGARITRVVLVFFDTVMMSFLTSGASAAAAIVYLAHKGNERANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC R S SL+GSF
Sbjct  145  IAICQQYNSFCDRASGSLVGSF  166



>ref|XP_009794323.1| PREDICTED: casparian strip membrane protein 3-like [Nicotiana 
sylvestris]
Length=184

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +D I+R+ AIVG+LGSA+AMG T+ TLP   +  +F+A+Y D  TF  FV+ + IV 
Sbjct  23   ISFLDFIMRIFAIVGTLGSAIAMGKTNDTLPSFTEFIKFKAEYKDLPTFTFFVVANGIVS  82

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLA+SL LSI HI+ + A  +R++LIF DT+MM  LT+GAS+AA IVYLAH GN  ANW
Sbjct  83   AYLAVSLVLSILHIVMSGARITRVVLIFFDTVMMAFLTSGASAAAAIVYLAHKGNERANW  142

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC R S SL+GSF
Sbjct  143  IAICQQYNSFCDRASGSLVGSF  164



>ref|XP_003556790.1| PREDICTED: CASP-like protein 2-like [Glycine max]
Length=186

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR+VA + +LGSA+ MGTT QTLPF  Q  +F A + D  TF  FV  ++IVC
Sbjct  25   LSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFVKFRAVFSDLPTFVFFVTSNSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LS FHI+R+ A KS++L +FLDT+M GLLT GAS+A  IVY AH GNS+ NW
Sbjct  85   GYLVLSLVLSFFHIVRSAAVKSKVLQVFLDTVMYGLLTTGASAATAIVYEAHYGNSNTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               C+ +  FC++ S SLIGSF
Sbjct  145  FPFCRQYNRFCKQISGSLIGSF  166



>emb|CDX69534.1| BnaA10g18830D [Brassica napus]
Length=187

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I++ ILR+VA   ++ SA+ M TT++TLPF  Q  RF A+Y D      FVI +A+V G
Sbjct  26   AILEFILRIVAFFNTITSAILMATTNETLPFFTQFIRFHAEYSDLSALTFFVIANAVVSG  85

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLPL+  HI++++ + SR+LLI LD  M+GLLTAGASSAA IVYLAH GN++ NW 
Sbjct  86   YLILSLPLTFVHIVKSKTQNSRVLLIILDVAMLGLLTAGASSAAAIVYLAHKGNNNTNWF  145

Query  589  AICQPFQDFCRRTSASLIGSF  651
            +ICQ F  FC R S SLIGSF
Sbjct  146  SICQQFNSFCERISGSLIGSF  166



>ref|XP_008339880.1| PREDICTED: CASP-like protein 1 [Malus domestica]
 ref|XP_008352978.1| PREDICTED: CASP-like protein 1 [Malus domestica]
Length=188

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D  LRVVA++G+L SA+AMGT+ +TLPF  +  RF A+Y D  T   FV+ ++IVC
Sbjct  27   LAVLDFTLRVVAVLGTLASAIAMGTSRETLPFATRFIRFRARYKDLPTLTFFVMTNSIVC  86

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL +SI HI+ T A  SRI+LI  DT+MMGL+TAGAS+A  IVYLAH GN S NW
Sbjct  87   AYLVLSLXVSIVHIIWTAAVNSRIILIISDTVMMGLVTAGASAATAIVYLAHYGNPSTNW  146

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A CQ F  FC R S SLIGSF
Sbjct  147  FAFCQQFNSFCGRISGSLIGSF  168



>ref|XP_006400049.1| hypothetical protein EUTSA_v10015485mg [Eutrema salsugineum]
 gb|ESQ41502.1| hypothetical protein EUTSA_v10015485mg [Eutrema salsugineum]
Length=187

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA   ++ SA+ M TT++TLPF  Q  RF A+Y+D      FV+ +A+V 
Sbjct  25   IAILEFILRIVAFFNTISSAILMATTNETLPFFTQFIRFHAEYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL ++  HI++++ + SRILLI LD  M+GLLTAGASSAA IVYLAHNGN+  NW
Sbjct  85   GYLILSLAVAFVHIVKSKTQNSRILLIVLDVAMLGLLTAGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             +ICQ F  FC R S SLIGSF
Sbjct  145  FSICQQFNSFCERISGSLIGSF  166



>ref|XP_009121585.1| PREDICTED: casparian strip membrane protein ARALYDRAFT_488377 
[Brassica rapa]
Length=187

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I++ ILR+VA   ++ SA+ M TT++TLPF  Q  RF A+Y D      FVI +A+V G
Sbjct  26   AILEFILRIVAFFNTITSAILMATTNETLPFFAQFIRFHAEYSDLPALTFFVIANAVVSG  85

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLPL+  HI++++ + SR+LLI LD  M+GLLTAGASSAA IVYLAH GN++ NW 
Sbjct  86   YLILSLPLAFVHIVKSKTQNSRVLLIILDVAMLGLLTAGASSAAAIVYLAHKGNNNTNWF  145

Query  589  AICQPFQDFCRRTSASLIGSF  651
            +ICQ F  FC R S SLIGSF
Sbjct  146  SICQQFNSFCERISGSLIGSF  166



>ref|XP_002446616.1| hypothetical protein SORBIDRAFT_06g018970 [Sorghum bicolor]
 sp|C5Y9U6.1|CASP4_SORBI RecName: Full=Casparian strip membrane protein 4; Short=SbCASP4 
[Sorghum bicolor]
 gb|EES10944.1| hypothetical protein SORBIDRAFT_06g018970 [Sorghum bicolor]
Length=192

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D+ LR ++IV ++ SA++MGTT++TLPF  Q  +FEA+Y D  +F  FV  +A+VC
Sbjct  30   VSIADVFLRFLSIVATIASAISMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVC  89

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI HI+R RA  SR++L+F D +M+ LLTAGAS+AA IVYLAH GN  ANW
Sbjct  90   TYLVLSIPLSIVHIIRPRARYSRLILVFFDAVMLALLTAGASAAAAIVYLAHKGNVRANW  149

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  150  FAICQQFDSFCERISGSLIGSF  171



>ref|XP_011085855.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum]
Length=186

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D ILR+VAIV +L SA+AMGTT+++LPF  Q  RF A+Y+D  TF  FV+ ++IV 
Sbjct  24   VAVLDFILRLVAIVATLASAIAMGTTNESLPFFTQFIRFRAKYNDLPTFTFFVVANSIVS  83

Query  406  GYLALSLPLSIFHILRT-RAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSAN  582
             YL LSL  SIFHI+R+   +KSR++LIF DT M+ LLTAGAS+AA IVYLAH GN+  N
Sbjct  84   AYLVLSLAFSIFHIIRSGGGQKSRVVLIFFDTGMLALLTAGASAAAAIVYLAHKGNTRTN  143

Query  583  WPAICQPFQDFCRRTSASLIGSF  651
            W AICQ +  FC R S SLIGSF
Sbjct  144  WFAICQQYNSFCERISGSLIGSF  166



>ref|XP_008663281.1| PREDICTED: casparian strip membrane protein 2 [Zea mays]
 gb|AFW58489.1| hypothetical protein ZEAMMB73_640463 [Zea mays]
Length=192

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ D+ LR +AIV ++GSAV+MGTT+QTLPF  Q  +FEA+Y D  +F  FV  +A+ C
Sbjct  30   VSVADVFLRFLAIVATIGSAVSMGTTNQTLPFFTQFIQFEAKYSDLPSFTFFVAANAVAC  89

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLSI H++R  A  SR++L+F D  M+ LLTAGAS+AA IVYLAH GN  ANW
Sbjct  90   TYLVLSIPLSIVHVVRPSARYSRLVLVFFDAAMLALLTAGASAAAAIVYLAHKGNVRANW  149

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  150  FAICQQFDSFCERISGSLIGSF  171



>ref|XP_008646251.1| PREDICTED: casparian strip membrane protein Os06g0231050-like 
[Zea mays]
 gb|AFW73388.1| hypothetical protein ZEAMMB73_811725 [Zea mays]
Length=202

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++DLILR VA+V ++GSA+AMGTT+QTLPF  Q  RF+AQY D  T   FV+V++IV 
Sbjct  40   LAVVDLILRSVAVVATVGSAIAMGTTNQTLPFFTQFLRFKAQYSDLPTLTFFVVVNSIVA  99

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLD-TMMMGLLTagassaagIVYLAHNGNSSAN  582
             YL LS+PLSI HI+ + A+ SR++L+F D  M++ L+TA AS+AA IVYLAH GN+ AN
Sbjct  100  AYLVLSIPLSIVHIMASSAKYSRLVLVFFDAAMLLALVTAAASAAAAIVYLAHKGNARAN  159

Query  583  WPAICQPFQDFCRRTSASLIGSF  651
            W AICQ F  FC R S SLIGSF
Sbjct  160  WLAICQQFDSFCERISGSLIGSF  182



>sp|P0DI59.1|CASP1_LACSA RecName: Full=Casparian strip membrane protein 1; Short=LsCASP1 
[Lactuca sativa]
Length=179

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D  LR +AIVG+L SA+AM TT+QTLPF  Q  RF A+++D  +F  FV+ S+IV 
Sbjct  18   IAILDFFLRPIAIVGTLASAIAMATTNQTLPFFSQFIRFRAKFNDLPSFTFFVVASSIVS  77

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL  SI HI ++    SR+LL+ LDT  MGLL AG+++A  IV LAH GN+  NW
Sbjct  78   AYLILSLGFSILHIAKSNLVNSRVLLLLLDTAAMGLLMAGSAAATAIVQLAHKGNNKVNW  137

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC+R S SLIGS+
Sbjct  138  FAICQQYNSFCKRVSGSLIGSY  159



>sp|P0DI42.1|CASP2_WHEAT RecName: Full=Casparian strip membrane protein 2; Short=TaCASP2 
[Triticum aestivum]
 gb|EMT15400.1| hypothetical protein F775_31947 [Aegilops tauschii]
Length=183

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+DLILRV+A++ +L SA+AMGTT++TLP      +F+A+Y D      FV+ ++IV 
Sbjct  22   VSILDLILRVIAVISTLASAIAMGTTNETLPLFTPFIQFKARYSDLPALTFFVVANSIVS  81

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLSI HI+R+ A+ SR++LI  D  M+ L+TA +S+A  IVYLAH GN  ANW
Sbjct  82   AYLILSLPLSIAHIIRSGAKYSRLVLIIFDAAMLALVTAASSAATAIVYLAHKGNVRANW  141

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ    FC RTS SL+GSF
Sbjct  142  LAICQQLDSFCERTSGSLVGSF  163



>ref|XP_011016793.1| PREDICTED: casparian strip membrane protein 4-like [Populus euphratica]
Length=180

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+DL+LR+ AIV    +   M TTD+TLPF  Q  +F AQY+D  TF  F+I +AI  
Sbjct  18   VAIVDLVLRLSAIVAGFAATSLMATTDETLPFFTQFLQFHAQYNDLPTFSFFLIANAITS  77

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL L+LP SI  I+R RA   R+LLI LD++MMGL T+ AS++A IVYLAHNGNSS+NW
Sbjct  78   GYLVLTLPFSIVCIVRPRAAGPRLLLIILDSVMMGLTTSAASASAAIVYLAHNGNSSSNW  137

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C  F +FC++ S++++ SF
Sbjct  138  NAFCLQFNNFCQQVSSAVVASF  159



>ref|XP_010245909.1| PREDICTED: casparian strip membrane protein 2-like [Nelumbo nucifera]
Length=222

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ILR++AI  +LG+A++MGTTDQTLP   Q F+F+A Y D   F  FVI +AI  
Sbjct  60   LAIFDFILRILAIGATLGAAISMGTTDQTLPIFTQFFQFQASYSDLPAFTFFVIANAIAA  119

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I+R     +R+LL+  DT+M+ L  AGA SAA IVYLAH GNSSANW
Sbjct  120  GYLVLSIPFSIVGIVRPNIVGARLLLLIFDTVMVALTAAGAGSAAAIVYLAHTGNSSANW  179

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++ S +++GSF
Sbjct  180  VAICQQFDDFCQQVSGAVVGSF  201



>ref|XP_006289591.1| hypothetical protein CARUB_v10003142mg [Capsella rubella]
 gb|EOA22489.1| hypothetical protein CARUB_v10003142mg [Capsella rubella]
Length=187

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA   ++GSA+ MGTT +TLPF  Q  RF+A+Y D      FV+ +A+V 
Sbjct  25   IAILEFILRIVACFNTMGSAILMGTTHETLPFFTQFIRFQAEYSDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL L+  HI++++ + SRILLI LD +M+GLL AGASSAA IVYLAHNGN+  NW
Sbjct  85   GYLILSLTLAFVHIVKSKTQNSRILLIVLDVVMLGLLAAGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  FAICQQFNSFCERISGSLIGSF  166



>ref|XP_010271592.1| PREDICTED: casparian strip membrane protein 2-like [Nelumbo nucifera]
Length=216

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ILR++AI  +LG+++AMGTTDQ LP   Q+F+FEA Y D      FVI +AI  
Sbjct  55   LAIFDFILRLLAIGATLGASIAMGTTDQILPIFTQAFQFEASYSDLPALLFFVIANAIAA  114

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            G+L LSLP SI  I+R  AE  ++LL+ LDT+M+ L  AGASSAA IVYLAH GNS+ANW
Sbjct  115  GFLVLSLPFSIVGIVRPHAEGPKLLLLILDTVMVSLTAAGASSAAAIVYLAHTGNSNANW  174

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC+++S +L+GSF
Sbjct  175  VAICQQFDSFCQQSSGALVGSF  196



>ref|XP_003613862.1| hypothetical protein MTR_5g041900 [Medicago truncatula]
 sp|G7KGQ4.1|CASP1_MEDTR RecName: Full=Casparian strip membrane protein 1; Short=MtCASP1 
[Medicago truncatula]
 gb|AES96820.1| casparian strip membrane protein [Medicago truncatula]
Length=186

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ILR++A V +L SAVAMGTTD+ LPF     +F A+YDD  +F  FV+ ++IVC
Sbjct  25   LSIMDFILRIIAGVATLASAVAMGTTDERLPFATSFVQFRAEYDDLPSFVFFVLANSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALSL LSI HI+R+ A KSRILLI LD +MMGLL A AS+AA IVY+AH GN+ ANW
Sbjct  85   GYLALSLILSILHIVRSTAVKSRILLIVLDMVMMGLLAAAASAAASIVYIAHYGNTQANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ +  FC R S SLIGS+
Sbjct  145  FPICQQYNSFCERISGSLIGSY  166



>ref|XP_006648782.1| PREDICTED: CASP-like protein Os02g0578333-like [Oryza brachyantha]
Length=183

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DL+LR VAI G+ GSA+AM TT +TLPF     +  A+Y D  TF  FV+ S++VC
Sbjct  20   LSVADLVLRFVAIGGTAGSAIAMATTSETLPFATPFVQLRAEYSDLPTFMFFVVASSVVC  79

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSS-AN  582
            GYL LSLP S+ H++R  A  SR +L  LD +M+ +LTAGAS+AA IVYLAH G+++ AN
Sbjct  80   GYLVLSLPASVLHVVRPTARCSRAVLALLDAVMLAVLTAGASAAAAIVYLAHRGSTARAN  139

Query  583  WPAICQPFQDFCRRTSASLIGS  648
            W AICQ F  FC RT+ASL+GS
Sbjct  140  WFAICQQFTSFCERTTASLVGS  161



>ref|XP_011043416.1| PREDICTED: casparian strip membrane protein 4-like [Populus euphratica]
Length=214

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+DL+LR+ AIV    +   M TTD+TLPF  Q  +F AQY+D  TF  F+I +AI  
Sbjct  52   VAIVDLVLRLSAIVAGFAATSLMATTDETLPFFTQFLQFHAQYNDLPTFSFFLIANAITS  111

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL L+LP SI  I+R RA   R+LLI LD++MMGL T+ AS++A IVYLAHNGNSS+NW
Sbjct  112  GYLVLTLPFSIVCIVRPRAAGPRLLLIILDSVMMGLTTSAASASAAIVYLAHNGNSSSNW  171

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C  F +FC++ S++++ SF
Sbjct  172  NAFCLQFNNFCQQVSSAVVASF  193



>ref|XP_010476448.1| PREDICTED: casparian strip membrane protein 6-like [Camelina 
sativa]
 ref|XP_010476449.1| PREDICTED: casparian strip membrane protein 6-like [Camelina 
sativa]
 ref|XP_010476451.1| PREDICTED: casparian strip membrane protein 6-like [Camelina 
sativa]
Length=218

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS++  +LR+ A+ G++GSA+AMGTT++++  + Q    +A+Y D  T   FV+ +AI  
Sbjct  57   ISVLGFVLRLFAVFGTIGSALAMGTTNESVVSLSQLVLLKAKYSDLPTLMFFVVANAIAG  116

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+ IFHI  T+A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW
Sbjct  117  GYLVLSLPVCIFHIFSTKAKTSRIILLVIDTVMLALVSSGASAATATVYLAHEGNTTANW  176

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC R S SLIGSF
Sbjct  177  PPICQQFDKFCERISGSLIGSF  198



>sp|B9S8Z3.2|CASP4_RICCO RecName: Full=Casparian strip membrane protein 4; Short=RcCASP4 
[Ricinus communis]
Length=191

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I I+DL+LRV   + +LGSAVAMGTT QTLP   Q FRF A+Y+D   F  F I ++IVC
Sbjct  28   ILILDLVLRVFGAICTLGSAVAMGTTSQTLPSSSQFFRFRAKYNDLPMFMFFAIANSIVC  87

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSIFHI+R+    +RI+L+  D +M+ LLT GAS+A  IVYLAH GN+SANW
Sbjct  88   AYLVLSLRLSIFHIIRSAGIITRIILVTFDMVMLVLLTCGASAATSIVYLAHKGNASANW  147

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               C  F  FC R S SLIGSF
Sbjct  148  LPFCVRFSHFCNRISGSLIGSF  169



>sp|P0DI32.1|CASP1_TARKO RecName: Full=Casparian strip membrane protein 1; Short=TkCASP1 
[Taraxacum kok-saghyz]
Length=207

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +++ D++LR+  I  +LG+ +AMG+TDQTLPF  Q F+F+A++DD   F  FVI +AI  
Sbjct  49   LAVFDVVLRIAGIAAALGAVIAMGSTDQTLPFFTQFFQFKAEFDDLPVFTFFVIANAITA  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALS+P+SI  I+R      R+LL FLDT+M+GL TA A  AA IVYLAHNGNS ANW
Sbjct  109  AYLALSIPISIVCIIRPHLVGPRVLLTFLDTVMVGLTTAAAGGAASIVYLAHNGNSDANW  168

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            PAICQ F DFC+  S +++ SF
Sbjct  169  PAICQQFNDFCQEVSGAVVASF  190



>ref|XP_010458896.1| PREDICTED: casparian strip membrane protein 6 [Camelina sativa]
Length=217

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS++  ILR+ A+ G++GSA+AMGTT +++  + Q    +A+Y D  T   FV+ +AI  
Sbjct  56   ISVLGFILRLFAVFGTIGSALAMGTTHESVVSLSQLVLLKAKYSDLPTLMFFVVANAIAG  115

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+ IFHI  T+A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW
Sbjct  116  GYLVLSLPVCIFHIFSTKAKTSRIILLVIDTVMLALVSSGASAATATVYLAHEGNTTANW  175

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC R S SLIGSF
Sbjct  176  PPICQQFDKFCERISGSLIGSF  197



>ref|XP_010495793.1| PREDICTED: casparian strip membrane protein 6-like [Camelina 
sativa]
Length=218

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS++  ILR+ A+ G++GSA+AMGTT +++  + Q    +A+Y D  T   FV+ +AI  
Sbjct  57   ISVLGFILRLFAVFGTIGSALAMGTTHESVVSLSQLVLLKAKYSDLPTLMFFVVANAIAG  116

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+ IFHI  T+A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW
Sbjct  117  GYLVLSLPVCIFHIFSTKAKTSRIILLVIDTVMLALVSSGASAATATVYLAHEGNTTANW  176

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC R S SLIGSF
Sbjct  177  PPICQQFDKFCERISGSLIGSF  198



>sp|D7M7B3.2|CASP5_ARALL RecName: Full=Casparian strip membrane protein 5; Short=AlCASP5 
[Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I++ ILR+VA   ++GSA+ MGTT +TLPF  Q  RF+A+Y+D      FV+ +A+V 
Sbjct  25   IAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQFIRFQAEYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL +SL L+  HI++ + + +RILLI LD  M+GLL+AGASSAA IVYLAHNGN+  NW
Sbjct  85   GYLIMSLTLAFVHIVKRKTQNTRILLIVLDVAMLGLLSAGASSAAAIVYLAHNGNNKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F  FC R S SLIGSF
Sbjct  145  FAICQQFNSFCERISGSLIGSF  166



>ref|XP_002892791.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7KBH3.1|CASP6_ARALL RecName: Full=Casparian strip membrane protein 6; Short=AlCASP6 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH69050.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=217

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS++  +LR+ A+ G++GSA+AMGTT +++  + Q    + +Y D  T   FV+ +AI  
Sbjct  56   ISVLGFVLRLFAVFGTIGSALAMGTTHESVVSLSQLVLLKVKYSDLPTLMFFVVANAIAG  115

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+SIFHI  T+A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW
Sbjct  116  GYLVLSLPVSIFHIFSTKAKTSRIILLVIDTVMLALVSSGASAATATVYLAHEGNTTANW  175

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC R S SLIGSF
Sbjct  176  PPICQQFDGFCERISGSLIGSF  197



>ref|XP_006339139.1| PREDICTED: casparian strip membrane protein 1-like [Solanum tuberosum]
Length=212

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ A   +LG+ VAM TT++TLPF  Q F+FEA YDD   F  FV+   IV 
Sbjct  51   IAIFDLILRIAAFASALGATVAMATTEETLPFFTQFFQFEASYDDLPAFTFFVVGMGIVV  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I+R  A   R+LLI  DT+++ L T  A S+  IVYLAHNGN  ANW
Sbjct  111  AYLVLSVPFSIVCIVRPHAVVPRLLLIIFDTVIIALATGAAGSSTAIVYLAHNGNQDANW  170

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC+R S +++ SF
Sbjct  171  LAICQQFGDFCQRASGAVVASF  192



>ref|XP_002530531.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SX12.1|CASP1_RICCO RecName: Full=Casparian strip membrane protein 1; Short=RcCASP1 
[Ricinus communis]
 gb|EEF31863.1| conserved hypothetical protein [Ricinus communis]
Length=200

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D ILR+ A++ +L +A  MGT+D+TLPF  Q F+FEA YDDF TF+ FVI    V 
Sbjct  39   IAIFDFILRLGAVISALSAAATMGTSDETLPFFTQFFQFEAGYDDFPTFQFFVIAMGFVG  98

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S+  I+R  A   R+LL+ LDT+ + L TA A++AA IVYLAHNGN SANW
Sbjct  99   GYLVLSLPFSVVAIIRPHAVGIRLLLLILDTVALTLNTAAAAAAAAIVYLAHNGNQSANW  158

Query  586  PAICQPFQDFCRRTSASLI  642
             A+CQ F DFC++ S  ++
Sbjct  159  LAVCQQFGDFCQKVSGGVV  177



>ref|XP_011004684.1| PREDICTED: casparian strip membrane protein 2-like [Populus euphratica]
Length=198

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ AIV +L +A +MGT+D+TLPF  QSF+F+A YDD  TF+ FVI  AIV 
Sbjct  37   IAIFDLILRLAAIVTALAAAASMGTSDETLPFFTQSFQFQASYDDLPTFQFFVIAMAIVG  96

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LLI LDT+ + L TA  ++AA IVYLAHNGNSS NW
Sbjct  97   GYLVLSLPFSIVAIVRPHAAGPRLLLIILDTVALSLNTAAGAAAAAIVYLAHNGNSSTNW  156

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  + DFCR+ S +++ SF
Sbjct  157  LAICLQYGDFCRKNSGAVVASF  178



>ref|XP_011004682.1| PREDICTED: casparian strip membrane protein 2 [Populus euphratica]
Length=199

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ AIV +L +A +MGT+D+TLPF  QSF+F+A YDD  TF+ FVI  AIV 
Sbjct  38   IAIFDLILRLAAIVTALAAAASMGTSDETLPFFTQSFQFQASYDDLPTFQFFVIAMAIVG  97

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LLI LDT+ + L TA  ++AA IVYLAHNGNSS NW
Sbjct  98   GYLVLSLPFSIVAIVRPHAAGPRLLLIILDTVALSLNTAAGAAAAAIVYLAHNGNSSTNW  157

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  + DFCR+ S +++ SF
Sbjct  158  LAICLQYGDFCRKNSGAVVASF  179



>ref|XP_011043429.1| PREDICTED: LOW QUALITY PROTEIN: casparian strip membrane protein 
4-like [Populus euphratica]
Length=214

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I DL+LR+ AIV    +   M TTD+TLPF  Q  +F AQY+D  TF  F+I +AI  
Sbjct  52   VAIFDLVLRLSAIVAGFAATSLMATTDETLPFFTQFLQFHAQYNDLPTFSFFLIANAITS  111

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL L+LP SI  I+R RA   R+LLI LD++MMGL T+ AS++A IVYLAHNGNSS+NW
Sbjct  112  GYLVLTLPFSIVCIVRPRAAGPRLLLIILDSVMMGLTTSAASASAAIVYLAHNGNSSSNW  171

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C  F +FC++ S++++ SF
Sbjct  172  NAFCLQFNNFCQQVSSAVVASF  193



>ref|XP_009117933.1| PREDICTED: CASP-like protein ARALYDRAFT_888790 [Brassica rapa]
 emb|CDY33770.1| BnaA09g45760D [Brassica napus]
Length=195

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +  + R+ A+ G++GSA+AMGTT +++  + Q    +A+Y D  T   FV+ +A+  
Sbjct  34   ISTLGFVFRLFAVFGTIGSALAMGTTQESVVSLTQLVLLKAKYSDLPTLMFFVVANAVAG  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+SIFHI+ T+A+ SRI+L+ +DT+M+ L++ GAS+A   VYLAH GN++ANW
Sbjct  94   GYLVLSLPVSIFHIISTKAKTSRIILLAIDTVMLALVSCGASAATSTVYLAHEGNTTANW  153

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC R S SLIGSF
Sbjct  154  PPICQQFDGFCERISGSLIGSF  175



>ref|XP_008446384.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis melo]
Length=193

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+DL++RV+A + +L SA+ MGT +QTLPF  QS +F+A Y D   F  FV+ +AIVC
Sbjct  30   LAIVDLVVRVMATMATLSSAIVMGTANQTLPFSTQSSQFKANYKDLPMFMFFVVANAIVC  89

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSIFH++   +   R++L+  DTM M L TAGAS+AA  VYLA+ GN +ANW
Sbjct  90   GYLFLSLPLSIFHVMEVASVTPRLILLIFDTMAMVLATAGASTAASAVYLAYRGNVAANW  149

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             + C  F  FCRR S SLIGSF
Sbjct  150  VSFCTQFDSFCRRISGSLIGSF  171



>emb|CDX78624.1| BnaA03g05360D [Brassica napus]
Length=187

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I + ILR++A   ++ SA+ M TT++TLPF  Q  RF A Y+D      FV+ +A+V 
Sbjct  25   IAIFEFILRIIAFFNTISSAILMATTNETLPFFTQFIRFHADYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL L+LPL+  HI++ + E SRILLI LD  M+GLL +GA+SAA IVYLAHNGN++ NW
Sbjct  85   GYLILTLPLAFVHIVKNKTENSRILLIVLDVAMVGLLASGAASAAAIVYLAHNGNNNTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A+CQ F  FC R S SLIGSF
Sbjct  145  FAVCQQFNSFCERISGSLIGSF  166



>sp|Q6EP58.1|CASP7_ORYSJ RecName: Full=Casparian strip membrane protein 7; Short=OsCASP7 
[Oryza sativa Japonica Group]
 sp|B8AEC9.2|CASP5_ORYSI RecName: Full=Casparian strip membrane protein 5; Short=OsCASP5 
[Oryza sativa Indica Group]
 dbj|BAD29562.1| integral membrane-like protein [Oryza sativa Japonica Group]
 dbj|BAD34267.1| integral membrane-like protein [Oryza sativa Japonica Group]
Length=201

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DL+LR VAI G+ GSA+AM TT +TLPF     RF A+Y D  T   FV+ S++VC
Sbjct  39   LSVADLVLRFVAIGGTAGSAIAMATTSETLPFAAPFVRFRAEYSDLPTLMFFVVASSVVC  98

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP S+ H++R  A  SR +L FLDT+M+ LLTA AS+AA IVYLAH G++ ANW
Sbjct  99   AYLVLSLPASVVHVVRPGARSSRAILAFLDTVMLALLTASASAAAAIVYLAHRGSARANW  158

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F  FC+R +ASL+GS
Sbjct  159  LGICQQFTSFCQRITASLVGS  179



>ref|XP_009131457.1| PREDICTED: casparian strip membrane protein 5-like [Brassica 
rapa]
Length=187

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I + ILR++A   ++ SA+ M TT++TLPF  Q  RF A Y+D      FV+ +A+V 
Sbjct  25   IAIFEFILRIIAFFNTISSAILMATTNETLPFFTQFIRFHADYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL L+LPL+  HI++ + E SRILLI LD  M+GLL +GA+SAA IVYLAHNGN++ NW
Sbjct  85   GYLILTLPLAFVHIVKNKTENSRILLIILDVAMVGLLASGAASAADIVYLAHNGNNNTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A+CQ F  FC R S SLIGSF
Sbjct  145  FAVCQQFNSFCERISGSLIGSF  166



>ref|XP_006417050.1| hypothetical protein EUTSA_v10008800mg [Eutrema salsugineum]
 gb|ESQ35403.1| hypothetical protein EUTSA_v10008800mg [Eutrema salsugineum]
Length=203

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS I   LR+ A+ G++GSA+AMGTT +++    Q    +A+Y D  T   FV+ +A+  
Sbjct  42   ISTIGFFLRLFAVFGTIGSALAMGTTHESVVSFTQLILLKAKYSDLPTLMFFVVANAVAG  101

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+SIFHI+ ++A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW
Sbjct  102  GYLILSLPVSIFHIISSKAKTSRIILLVIDTVMVALVSSGASAATATVYLAHEGNTTANW  161

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC+R S SLIGSF
Sbjct  162  PPICQQFDGFCKRISGSLIGSF  183



>ref|NP_172868.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9XI72.1|CSPL2_ARATH RecName: Full=CASP-like protein 1A1; Short=AtCASPL1A1 [Arabidopsis 
thaliana]
 gb|AAD39301.1|AC007576_24 Hypothetical protein [Arabidopsis thaliana]
 dbj|BAC41974.1| unknown protein [Arabidopsis thaliana]
 gb|AAP12860.1| At1g14160 [Arabidopsis thaliana]
 gb|AEE29113.1| uncharacterized protein AT1G14160 [Arabidopsis thaliana]
Length=209

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS++  +LR+ A+ G++GSA+AMGTT +++  + Q    + +Y D  T   FV+ +AI  
Sbjct  48   ISVLGFVLRLFAVFGTIGSALAMGTTHESVVSLSQLVLLKVKYSDLPTLMFFVVANAISG  107

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+SIFHI  T+A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW
Sbjct  108  GYLVLSLPVSIFHIFSTQAKTSRIILLVVDTVMLALVSSGASAATATVYLAHEGNTTANW  167

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P ICQ F  FC R S SLIGSF
Sbjct  168  PPICQQFDGFCERISGSLIGSF  189



>ref|XP_002871659.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47918.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 107/144 (74%), Gaps = 2/144 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFD--TFKLFVIVSAI  399
            I+I++ ILR+VA   ++GSA+ MGTT +TLPF  Q  RF+A+Y+D    T+ +FV+ +A+
Sbjct  25   IAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQFIRFQAEYNDLPALTYVIFVVANAV  84

Query  400  VCGYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSA  579
            V GYL +SL L+  HI++ + + +RILLI LD  M+GLL+AGASSAA IVYLAHNGN+  
Sbjct  85   VSGYLIMSLTLAFVHIVKRKTQNTRILLIVLDVAMLGLLSAGASSAAAIVYLAHNGNNKT  144

Query  580  NWPAICQPFQDFCRRTSASLIGSF  651
            NW AICQ F  FC R S SLIGSF
Sbjct  145  NWFAICQQFNSFCERISGSLIGSF  168



>sp|P0DKC2.1|CASP1_LOTJA RecName: Full=Casparian strip membrane protein 1; Short=LjCASP1 
[Lotus japonicus]
Length=186

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D ILR++A+V +L SA+AMGTTD++LPF  Q  RF A+YDD  T +LFV+ SA   
Sbjct  25   VSVLDFILRLIAVVATLASAIAMGTTDESLPFFTQFIRFRAEYDDLPTLRLFVVASAFAS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSI HI R+ A ++R++LI LD +M+  LTA +S+AA IVYLAH GN+ ANW
Sbjct  85   GYLILSLPLSILHITRSSARRTRVILIILDMVMLTSLTAASSAAAAIVYLAHKGNAKANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A CQ +  FC R S SLIGSF
Sbjct  145  FAFCQQYDSFCERISGSLIGSF  166



>ref|XP_011017493.1| PREDICTED: casparian strip membrane protein 5 [Populus euphratica]
 ref|XP_011017501.1| PREDICTED: casparian strip membrane protein 5 [Populus euphratica]
Length=188

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI DLILRVVA +G+  SA+AMGTT +TL    Q     A+Y+D  +   FVI ++IVC
Sbjct  26   ISIADLILRVVAAIGTFASALAMGTTTETLTIFTQPIIIRAKYNDLPSLTFFVIANSIVC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS PLSI H +R  A  +RI+L+  DT M+ LLTAGAS+A  +VYLAH GN++ANW
Sbjct  86   GYLVLSFPLSISHFIRREARITRIILVIFDTAMVELLTAGASAATVVVYLAHKGNANANW  145

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F +FC R S SLIGSF
Sbjct  146  LAICQQFNNFCERISGSLIGSF  167



>ref|XP_007015764.1| Casparian strip membrane protein 3, putative [Theobroma cacao]
 gb|EOY33383.1| Casparian strip membrane protein 3, putative [Theobroma cacao]
Length=207

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D +LR+ AI  +LG+   MGTT +TLPF  Q  +F+AQY+D   F+ FVI +AIV 
Sbjct  46   IAICDFLLRLCAIGAALGATATMGTTAETLPFFTQFLQFQAQYNDIPAFQFFVIANAIVA  105

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LL+  DT+M GL  A AS++A IVYLAH GN + NW
Sbjct  106  GYLLLSLPFSIICIIRPYATAPRLLLVIFDTVMAGLTIASASASASIVYLAHYGNPNTNW  165

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFCR  S +++GSF
Sbjct  166  LAICQQFGDFCRSVSGAVVGSF  187



>sp|P0DI40.1|CASP1_VIGUN RecName: Full=Casparian strip membrane protein 1; Short=VuCASP1 
[Vigna unguiculata]
Length=192

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+  I  SLG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  31   LAIMDFILRLGGIAASLGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVA  90

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S+  I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  91   GYLVLSLPFSVVAIIRPHAPGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNW  150

Query  586  PAICQPFQDFCRRTSA  633
             AIC  F DFC +TS 
Sbjct  151  LAICNQFGDFCAQTSG  166



>ref|XP_010523465.1| PREDICTED: CASP-like protein 1A1 isoform X2 [Tarenaya hassleriana]
Length=232

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI++  LR +A+ G++GSA+AMGTT +++P + Q    +A+Y D  T   FV+ ++I  
Sbjct  71   ISILEFGLRFIAVFGTIGSALAMGTTQESVPSLAQFVLLKAKYTDLPTLTFFVVANSIAG  130

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP+SI+HI+RT+++ SR +L+  DT MMGL++AGAS+A   VYLAH GN SANW
Sbjct  131  AYLVLSLPVSIYHIIRTKSKTSRFILLVFDTGMMGLVSAGASAATATVYLAHEGNKSANW  190

Query  586  PAICQPFQDFCRRTSASLIGSF  651
            P IC  F  FC+R S SLIGSF
Sbjct  191  PPICPQFNAFCQRISGSLIGSF  212



>ref|XP_010108691.1| hypothetical protein L484_015678 [Morus notabilis]
 gb|EXC20002.1| hypothetical protein L484_015678 [Morus notabilis]
Length=186

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S++D ILR++A +G+L SA+AMGT+ QTL F+ +  RF A Y D  TF  FVI ++IVC
Sbjct  25   LSLLDFILRIIAALGTLASAIAMGTSRQTLSFVTRFTRFRAVYKDLPTFTFFVIANSIVC  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL +SL LS  HI+++ A KSRI L+  DT+MMGLLTAGAS+AA IV +AHNG++ ANW
Sbjct  85   VYLVVSLCLSFIHIIKSAAVKSRIFLVIFDTVMMGLLTAGASAAAAIVAMAHNGSTGANW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
               CQ F+ FC R S SLIGSF
Sbjct  145  VPFCQQFRSFCDRISGSLIGSF  166



>ref|XP_002311310.2| hypothetical protein POPTR_0008s08820g [Populus trichocarpa]
 sp|B9HI87.2|CASP5_POPTR RecName: Full=Casparian strip membrane protein 5; Short=PtCASP5 
[Populus trichocarpa]
 gb|EEE88677.2| hypothetical protein POPTR_0008s08820g [Populus trichocarpa]
Length=185

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 2/142 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI DLILR VA +G+  SA+ MGTT +TL    Q     A+Y+D  +   FVI ++IVC
Sbjct  26   ISIADLILRGVAAIGTFASALTMGTTSETLTIFTQPIMIRAKYNDLPSLTFFVIANSIVC  85

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+PLSI H +R  A  +RI+L+  DT M+ LLTAGAS+A  +VYLAH  N  ANW
Sbjct  86   GYLVLSIPLSISHFIRREARITRIILVIFDTAMVELLTAGASAATVVVYLAHKRN--ANW  143

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F +FC R S SLIGSF
Sbjct  144  LAICQQFNNFCERISGSLIGSF  165



>dbj|BAD16116.1| integral membrane family protein-like [Oryza sativa Japonica 
Group]
Length=230

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 107/171 (63%), Gaps = 29/171 (17%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTF-----------  372
            +S+ DLILRVVA+V  + SA+AMGTT+QTLPF  Q  RF+AQY D  T            
Sbjct  40   LSVADLILRVVAVVAIVDSAIAMGTTNQTLPFFTQFLRFKAQYSDLPTLTCDHSCLLATI  99

Query  373  ------------------KLFVIVSAIVCGYLALSLPLSIFHILRTRAEKSRILLIFLDT  498
                              +LFV+ ++ V  YL LS+PLS+ HI+R+RA  SR++LIFLD+
Sbjct  100  VNLHYFRLQARLFLPVVTRLFVVANSAVTAYLVLSIPLSVVHIIRSRASYSRLVLIFLDS  159

Query  499  MMMGLLTagassaagIVYLAHNGNSSANWPAICQPFQDFCRRTSASLIGSF  651
            +M+ L+ A AS++A IVYLAH GN  ANW A+CQ F  FC R S  LIGSF
Sbjct  160  VMLALVAAVASASAAIVYLAHKGNVRANWFAVCQQFDSFCERISGPLIGSF  210



>emb|CDX70605.1| BnaC03g06890D [Brassica napus]
Length=187

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I + ILR++A   ++ SA+ M TT++TLPF  Q  RF A Y+D      FV+ +A+V 
Sbjct  25   IAIFEFILRIIAFFNTISSAILMATTNETLPFFTQFIRFHADYNDLPALTFFVVANAVVS  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL L+LPL+  HI++ + E SRILLI LD  M+GLL +GA+SAA IVYLAH GN++ NW
Sbjct  85   GYLILTLPLAFVHIVKKKTENSRILLIILDVAMVGLLASGAASAAAIVYLAHKGNNNTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F  FC R S SLIGSF
Sbjct  145  FPVCQQFNSFCERISGSLIGSF  166



>ref|XP_004135448.1| PREDICTED: CASP-like protein RCOM_0837390-like [Cucumis sativus]
 ref|XP_004155381.1| PREDICTED: CASP-like protein RCOM_0837390-like [Cucumis sativus]
Length=193

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+DL++RV+A + +L SA+ MGT +QTLPF  Q+ +F+A Y D   F  FV+ ++IVC
Sbjct  30   LAIVDLVVRVMATMATLSSAIVMGTANQTLPFSTQTSQFKANYKDLPMFMFFVLANSIVC  89

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSIFHI+   +   R++L+  D M M L TAGAS+AA  VYLA+ GN +ANW
Sbjct  90   GYLFLSLPLSIFHIMEVASVTPRLILLIFDMMAMVLATAGASTAASAVYLAYRGNVAANW  149

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             + C  F  FCRR S SLIGSF
Sbjct  150  VSFCTQFDSFCRRISGSLIGSF  171



>ref|XP_004249431.1| PREDICTED: casparian strip membrane protein 1 [Solanum lycopersicum]
Length=212

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 93/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ A   +LG+ VAM TT++TLPF  Q F+FEA YDD  TF  FV+   IV 
Sbjct  51   IAIFDLILRIAAFASALGATVAMATTEETLPFFTQFFQFEASYDDLPTFSFFVVGMGIVV  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I+R+ A   R+LLI  DT+++ L T  A S+A IVYLAHNGN  ANW
Sbjct  111  AYLVLSVPFSIVCIVRSHAVVPRLLLIIFDTVIIALATGAAGSSAAIVYLAHNGNQDANW  170

Query  586  PAICQPFQDFCRRTSA  633
             AICQ F DFC+R S 
Sbjct  171  LAICQQFGDFCQRASG  186



>ref|XP_009801668.1| PREDICTED: casparian strip membrane protein 1-like [Nicotiana 
sylvestris]
Length=211

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+DLILR+ A+  S+G+AV MGT  +TLPF  Q F+FEA YDD  TF  FV+  +IV 
Sbjct  50   IAIVDLILRIAAVATSIGAAVGMGTAGETLPFFTQFFQFEAGYDDLPTFTFFVVAMSIVV  109

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I R+ A   R+LLI  DT  + L TA A ++A IVYLAHNGN  ANW
Sbjct  110  GYLVLSIPFSIVCIARSHAVVPRLLLIIFDTAFVTLTTAAAGASAAIVYLAHNGNQDANW  169

Query  586  PAICQPFQDFCRRTSA  633
             A C  F DFC+ TS 
Sbjct  170  LAFCNQFGDFCQTTSG  185



>ref|XP_006306344.1| hypothetical protein CARUB_v10012228mg [Capsella rubella]
 gb|EOA39242.1| hypothetical protein CARUB_v10012228mg [Capsella rubella]
Length=217

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = +1

Query  235  IDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCGYL  414
            +  +LR+ A+ G++GSA+AMGTT +++  + Q    +A Y D  T   FV+ +AI  GYL
Sbjct  59   LGFVLRLFAVFGTIGSALAMGTTHESVVSLTQLILLKANYSDLPTLMFFVVANAIAGGYL  118

Query  415  ALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWPAI  594
             LSLP+SIFHI  T+A+ SRI+L+ +DT+M+ L+++GAS+A   VYLAH GN++ANW  I
Sbjct  119  VLSLPVSIFHIFGTKAKTSRIILLVIDTVMLALVSSGASAATATVYLAHEGNTTANWQPI  178

Query  595  CQPFQDFCRRTSASLIGSF  651
            CQ F  FC R S SLIGSF
Sbjct  179  CQQFDKFCERISGSLIGSF  197



>ref|XP_002523839.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SCX0.1|CASP3_RICCO RecName: Full=Casparian strip membrane protein 3; Short=RcCASP3 
[Ricinus communis]
 gb|EEF38565.1| conserved hypothetical protein [Ricinus communis]
Length=215

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ++R+ AI   L +   MGTT+QTLPF  Q F+F A+Y+D  TF  FV  + I  
Sbjct  54   VAIFDFVVRLCAIATGLAATGIMGTTEQTLPFFTQFFQFHAEYNDLPTFMFFVFANGIAS  113

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LLI  DT++M L  A AS+AA IVYLAHNGNS+ANW
Sbjct  114  GYLILSLPFSIVCIVRPLAIVPRLLLIIFDTVVMALTIAAASAAAAIVYLAHNGNSNANW  173

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++TS +++ SF
Sbjct  174  NAICQQFNDFCQQTSTAVVASF  195



>gb|EEC73471.1| hypothetical protein OsI_07795 [Oryza sativa Indica Group]
Length=357

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DL+LR VAI G+ GSA+AM TT +TLPF     RF A+Y D  T   FV+ S++VC
Sbjct  195  LSVADLVLRFVAIGGTAGSAIAMATTSETLPFAAPFVRFRAEYSDLPTLMFFVVASSVVC  254

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP S+ H++R  A  SR +L FLDT+M+ LLTA AS+AA IVYLAH G++ ANW
Sbjct  255  AYLVLSLPASVVHVVRPGARSSRAILAFLDTVMLALLTASASAAAAIVYLAHRGSARANW  314

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F  FC+R +ASL+GS
Sbjct  315  LGICQQFTSFCQRITASLVGS  335



>gb|EEE57248.1| hypothetical protein OsJ_07255 [Oryza sativa Japonica Group]
Length=365

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DL+LR VAI G+ GSA+AM TT +TLPF     RF A+Y D  T   FV+ S++VC
Sbjct  203  LSVADLVLRFVAIGGTAGSAIAMATTSETLPFAAPFVRFRAEYSDLPTLMFFVVASSVVC  262

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP S+ H++R  A  SR +L FLDT+M+ LLTA AS+AA IVYLAH G++ ANW
Sbjct  263  AYLVLSLPASVVHVVRPGARSSRAILAFLDTVMLALLTASASAAAAIVYLAHRGSARANW  322

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F  FC+R +ASL+GS
Sbjct  323  LGICQQFTSFCQRITASLVGS  343



>ref|XP_004516297.1| PREDICTED: casparian strip membrane protein 1-like [Cicer arietinum]
Length=195

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A +MGT+DQTLPF  Q F+FEA YD F TF+ FVI  AIV 
Sbjct  34   MAIMDFILRLGAIAAALGAAASMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVISMAIVG  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A+  R+ LI LDT+ + L T+  +SAA IVYLAHNGN   NW
Sbjct  94   GYLVLSLPFSIVAIIRPHAKGPRLFLIILDTVFLTLATSCGASAASIVYLAHNGNQDTNW  153

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC +TS +++ SF
Sbjct  154  LAICNQFGDFCAQTSGAVVSSF  175



>ref|XP_006341077.1| PREDICTED: casparian strip membrane protein 1-like [Solanum tuberosum]
Length=215

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 93/142 (65%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI DLILR+ ++  S+G+AV M T  +TLPF  Q F+FEA YDD  TF  FVI  +IV 
Sbjct  54   ISIFDLILRIASVATSIGAAVGMATAGETLPFFTQFFQFEAGYDDLPTFTFFVIAMSIVV  113

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I R+     R+LLI  DT ++ L T+ A ++  IVYLAHNGN  ANW
Sbjct  114  AYLVLSIPFSIVCIARSHVVAPRLLLIIFDTAIITLTTSAAGASTAIVYLAHNGNQDANW  173

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C  F DFC+ TS +++ +F
Sbjct  174  LAFCNQFGDFCQTTSGAVVAAF  195



>ref|XP_010059483.1| PREDICTED: casparian strip membrane protein 1-like [Eucalyptus 
grandis]
 gb|KCW90515.1| hypothetical protein EUGRSUZ_A02631 [Eucalyptus grandis]
Length=202

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+DLILR+ A+V +L S  AMGT+++TLPF  Q F+F+A YDD  T + FVI  A+V 
Sbjct  41   IAILDLILRICAVVATLASTAAMGTSEETLPFFTQFFQFQASYDDLPTLQFFVIAMALVG  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I+R RA   R LL+ LDT+ + L T+  ++AA IVYLAHNGN + NW
Sbjct  101  GYLVLSIPFSIVTIIRPRAVGPRFLLLILDTVALTLATSAGAAAAAIVYLAHNGNLNTNW  160

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++ S S++GSF
Sbjct  161  LAICQQFGDFCQKVSGSVVGSF  182



>ref|XP_009591857.1| PREDICTED: casparian strip membrane protein 1-like [Nicotiana 
tomentosiformis]
Length=211

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ A+  S+G+AV MGT  +TLPF  Q F+FEA YDD  TF  FV+  +IV 
Sbjct  50   IAIFDLILRIAAVATSIGAAVGMGTAGETLPFFTQFFQFEAGYDDLPTFTFFVVAMSIVV  109

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I R+ A   R+LLI  DT  + L TA A ++A IVYLAHNGN  ANW
Sbjct  110  GYLVLSIPFSIVCIARSHAVVPRLLLIIFDTAFVTLTTAAAGASAAIVYLAHNGNQDANW  169

Query  586  PAICQPFQDFCRRTSA  633
             A C  F DFC+ TS 
Sbjct  170  LAFCNQFGDFCQTTSG  185



>sp|B9HQ42.2|CASP4_POPTR RecName: Full=Casparian strip membrane protein 4; Short=PtCASP4 
[Populus trichocarpa]
Length=243

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I DL LR+ AI     +   M TTDQTLPF  Q F+F AQY D  TF  F+IV+AI  G
Sbjct  82   AIFDLTLRLSAIAAGFAATSLMATTDQTLPFFTQFFQFHAQYTDLPTFLSFMIVNAITSG  141

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLP SI  I+R RA   R+LLI LD++MM L T+ AS++A IVYLAHNGNSS+NW 
Sbjct  142  YLVLSLPFSIVCIVRARAAGPRLLLIILDSVMMALTTSAASASAAIVYLAHNGNSSSNWN  201

Query  589  AICQPFQDFCRRTSASL  639
            A CQ F ++C++ S ++
Sbjct  202  AFCQQFNNYCQQVSNAV  218



>ref|XP_002313609.1| hypothetical protein POPTR_0009s16160g [Populus trichocarpa]
 gb|EEE87564.1| hypothetical protein POPTR_0009s16160g [Populus trichocarpa]
Length=198

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I DL LR+ AI     +   M TTDQTLPF  Q F+F AQY D  TF  F+IV+AI  G
Sbjct  54   AIFDLTLRLSAIAAGFAATSLMATTDQTLPFFTQFFQFHAQYTDLPTFLSFMIVNAITSG  113

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLP SI  I+R RA   R+LLI LD++MM L T+ AS++A IVYLAHNGNSS+NW 
Sbjct  114  YLVLSLPFSIVCIVRARAAGPRLLLIILDSVMMALTTSAASASAAIVYLAHNGNSSSNWN  173

Query  589  AICQPFQDFCRR  624
            A CQ F ++C++
Sbjct  174  AFCQQFNNYCQQ  185



>ref|XP_004246481.1| PREDICTED: casparian strip membrane protein 1-like [Solanum lycopersicum]
Length=215

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ISI DLILR+ ++  S+G+AV M T  +TLPF  Q F+FEA YDD  TF  FVI  +IV 
Sbjct  54   ISIFDLILRIASVATSIGAAVGMATAGETLPFFTQFFQFEAGYDDLPTFTFFVIAMSIVV  113

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I R+     R+LLI  DT M+ L T+ A ++A IVYLAHNGN  ANW
Sbjct  114  AYLVLSIPFSIVCIARSYVVVPRLLLIIFDTAMITLTTSAAGASAAIVYLAHNGNEDANW  173

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A C  F DFC+ TSA+++ +F
Sbjct  174  LAFCNQFGDFCQTTSAAVVAAF  195



>gb|KDP41223.1| hypothetical protein JCGZ_15630 [Jatropha curcas]
Length=164

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI DL+LRV A + +L SA+AM TT QTLPF IQSF F A Y DF  FK F I ++IVC
Sbjct  1    MSIADLMLRVFAAIATLASAIAMTTTKQTLPFSIQSFLFRADYKDFPVFKFFAIANSIVC  60

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLPLS+F ++R + +  RI+L+  D +M+ +L++GA+ A  IV LA  GNS ANW
Sbjct  61   AYLLLSLPLSVFLMIRIKMKIIRIILVVFDMVMLVILSSGAAGATSIVQLAEKGNSRANW  120

Query  586  PAICQP--FQDFCRRTSASLIGSF  651
             AICQP  F+ FC R S SL+GSF
Sbjct  121  VAICQPFRFRSFCHRLSGSLVGSF  144



>ref|XP_002522462.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39954.1| conserved hypothetical protein [Ricinus communis]
Length=171

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I I+DL+LRV   + +LGSAVAMGTT QTLP   Q FRF A+Y+D   F  F I ++IVC
Sbjct  28   ILILDLVLRVFGAICTLGSAVAMGTTSQTLPSSSQFFRFRAKYNDLPMFMFFAIANSIVC  87

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSIFHI+R+    +RI+L+  D +M+ LLT GAS+A  IVYLAH GN+SANW
Sbjct  88   AYLVLSLRLSIFHIIRSAGIITRIILVTFDMVMLVLLTCGASAATSIVYLAHKGNASANW  147

Query  586  PAICQPFQDFCRRTSA  633
               C  F  FC R SA
Sbjct  148  LPFCVRFSHFCNRISA  163



>ref|XP_011098776.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum]
Length=195

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +D ++R+VA +  +GSA+A+GT + TL F  Q  RF+ QY D  TF  FV+ + I  
Sbjct  35   ISKLDFVMRIVAAISIMGSAIAVGTANHTLSFFNQFIRFKTQYQDLPTFTFFVVSNVIAT  94

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LS+FH+L++ A+ +R +LI LD +++ LLTAGAS+AA I +LAH GN  ANW
Sbjct  95   AYLILSLALSVFHMLKSGAKVTRTVLIILDMIILSLLTAGASAAAAITHLAHKGNVQANW  154

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC R S SL+GSF
Sbjct  155  SAICQQYNSFCERVSGSLVGSF  176



>ref|XP_008387040.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_576556-like 
[Malus domestica]
Length=205

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR  AIV +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  ++V 
Sbjct  43   MAIIDLVLRSGAIVSALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVA  102

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P +I  I+R  A   R+LL+ LD + + L T+ A +A  IVYLAHNGN+S+NW
Sbjct  103  GYLVLSIPFAIVSIVRPHASGPRLLLLILDVVALTLATSAAGAATSIVYLAHNGNASSNW  162

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFCR  S +++ SF
Sbjct  163  LAICNQFGDFCRNVSGAVVASF  184



>gb|KGN51938.1| hypothetical protein Csa_5G606300 [Cucumis sativus]
Length=191

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+DL++RV+A + +L SA+ MGT +QTLPF  Q+ +F+A Y D   F  FV+ ++IVC
Sbjct  30   LAIVDLVVRVMATMATLSSAIVMGTANQTLPFSTQTSQFKANYKDLPMF--FVLANSIVC  87

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSIFHI+   +   R++L+  D M M L TAGAS+AA  VYLA+ GN +ANW
Sbjct  88   GYLFLSLPLSIFHIMEVASVTPRLILLIFDMMAMVLATAGASTAASAVYLAYRGNVAANW  147

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             + C  F  FCRR S SLIGSF
Sbjct  148  VSFCTQFDSFCRRISGSLIGSF  169



>ref|XP_009601005.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana tomentosiformis]
Length=210

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ A   +LG+AVAMGTT++TLPF  Q F+FEA YDD  TF  FV   AIV 
Sbjct  48   IAIFDLILRIAAFASALGAAVAMGTTEETLPFFTQFFQFEASYDDLPTFTFFVAAMAIVV  107

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I+R  A   R+LLI  DT+++ L T  A S+A IVYLAHNGN  ANW
Sbjct  108  AYLVLSVPFSIVCIVRPHAVVPRLLLIIFDTVIIALTTGAAGSSAAIVYLAHNGNQDANW  167

Query  586  PAICQPFQDFCRRTSA  633
             AICQ F DFC+R S 
Sbjct  168  LAICQQFGDFCQRVSG  183



>ref|NP_001242085.1| casparian strip membrane protein 4 [Glycine max]
 sp|C6TH93.1|CASP4_SOYBN RecName: Full=Casparian strip membrane protein 4; Short=GmCASP4 
[Glycine max]
 gb|ACU21195.1| unknown [Glycine max]
Length=210

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  M T+D+TLPF  Q F+FEA YD F TF+ FVI  A V 
Sbjct  49   VAILDFILRLGAITSALGAAATMATSDETLPFFTQFFQFEASYDSFSTFQFFVIAMAFVG  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L T+ A++A  IVYLAHNGN  +NW
Sbjct  109  GYLVLSLPFSIVTIIRPHAAGPRLFLIILDTVFLTLATSSAAAATAIVYLAHNGNQDSNW  168

Query  586  PAICQPFQDFCRRTSA  633
             AIC  F DFC+  S 
Sbjct  169  LAICNQFGDFCQEISG  184



>gb|KDP39843.1| hypothetical protein JCGZ_04188 [Jatropha curcas]
Length=213

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I D +LR+ AI   L +   MGTT+Q+LPF  Q F+F A+YDD +TF+ F   + I  G
Sbjct  53   AIFDFVLRLCAITAGLAATSIMGTTEQSLPFFTQFFQFHAEYDDIETFRFFTFANGIASG  112

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLP SI  I+R  A   R+ LI  D++ M L+ A AS+A  I YLAHNGNS ANW 
Sbjct  113  YLVLSLPFSIVCIVRPYATGPRLFLIIFDSVAMALIVAAASAATAIAYLAHNGNSDANWN  172

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AIC  F DFC+ +S++++ SF
Sbjct  173  AICNQFTDFCQSSSSAIVASF  193



>ref|XP_009767267.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana sylvestris]
 sp|P0DI50.1|CASP1_TOBAC RecName: Full=Casparian strip membrane protein 1; Short=NtCASP1 
[Nicotiana tabacum]
Length=209

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILR+ A   +LG+AVAM TT++TLPF  Q F+FEA YDD  TF  FV+  AIV 
Sbjct  47   IAIFDLILRIAAFASALGAAVAMATTEETLPFFTQFFQFEASYDDLPTFTFFVVAMAIVV  106

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I+R  A   R+LLI  DT+++ L T  A S+A IVYLAHNGN  ANW
Sbjct  107  AYLVLSVPFSIVCIVRPHAVVPRLLLIIFDTVIIALTTGAAGSSAAIVYLAHNGNQDANW  166

Query  586  PAICQPFQDFCRRTSA  633
             AICQ F DFC+R S 
Sbjct  167  LAICQQFGDFCQRVSG  182



>gb|KEH41980.1| casparian strip membrane protein [Medicago truncatula]
Length=196

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D +LR+ AI  SL + + M T+DQ LPF  Q  +FEA YD F TF+ FVI  A V 
Sbjct  35   IAIMDFVLRLGAIAASLAATITMATSDQILPFFTQFLQFEASYDSFSTFQFFVIAMAFVG  94

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L TA  +SAA +V LAHNGN  +NW
Sbjct  95   GYLVLSLPFSIVTIIRPHAPGPRLFLIILDTVFLTLATASGASAAAMVSLAHNGNQDSNW  154

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC +TS +++ SF
Sbjct  155  LAICNQFGDFCAQTSGAVVASF  176



>ref|XP_006361147.1| PREDICTED: casparian strip membrane protein 3-like [Solanum tuberosum]
Length=211

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D ILR+ A+V +L +A  MGTT++TLP   Q F+F+A YDD   F  FV+ +AI  
Sbjct  49   VSIFDFILRLCALVTTLAAATTMGTTEETLPLFTQFFQFQASYDDLPAFSYFVVANAIAS  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             Y+ LSLP SI  I+R     ++++L+ LDT+M+   TA AS+AA IVYLAHNGNS+  W
Sbjct  109  AYVVLSLPFSIVCIVRPHLVGAKLVLLILDTVMVAFTTAAASAAAAIVYLAHNGNSTTQW  168

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC+R S +++ SF
Sbjct  169  VAICQQFGDFCQRVSGAVVASF  190



>gb|EYU34054.1| hypothetical protein MIMGU_mgv1a026542mg, partial [Erythranthe 
guttata]
Length=172

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI+D ++R+VA + +LGS +A+GTT+QTLP   Q  RF+A+Y D  TF  FV+ + I  
Sbjct  11   LSIVDFVMRIVAAIATLGSTIAVGTTNQTLPMFTQFIRFKARYQDLPTFTFFVVTNGIAT  70

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSL LSI HI  T A+ +R +LI LD +++ LLTAGASSAA IV+LAH GN  ANW
Sbjct  71   VYLVLSLVLSILHIFMTGAKVTRTVLIILDMIILALLTAGASSAAAIVHLAHTGNVEANW  130

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ +  FC R S SL+GSF
Sbjct  131  SAICQQYNSFCERVSGSLVGSF  152



>ref|XP_004487484.1| PREDICTED: casparian strip membrane protein MTR_2g086740-like 
[Cicer arietinum]
Length=224

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D ILR+ AI  +LG+AV MGT +Q LPF  Q  +F AQ+DDF  F+ FV  +A   
Sbjct  63   IAILDFILRLSAIGSALGAAVLMGTNEQILPFFTQFLQFHAQWDDFPMFRFFVGANATAS  122

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            G L LSLP SI  I+R  A   R LL+ +D ++MGL+ A ASSAA IVYLAHNG+  ANW
Sbjct  123  GILILSLPFSIVCIVRPLAVGPRFLLVIIDLVLMGLVVAAASSAAAIVYLAHNGSQDANW  182

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC+ +S ++I SF
Sbjct  183  NAICQQFTDFCQGSSLAVIASF  204



>ref|XP_002530532.1| nitrate, fromate, iron dehydrogenase, putative [Ricinus communis]
 sp|B9SX13.1|CASP2_RICCO RecName: Full=Casparian strip membrane protein 2; Short=RcCASP2 
[Ricinus communis]
 gb|EEF31864.1| nitrate, fromate, iron dehydrogenase, putative [Ricinus communis]
Length=200

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ILR+ AI  +LG+A  MGT+D+TLPF  Q F+F A YDDF TF+ FVI  A+V 
Sbjct  39   LAIFDFILRLGAIAAALGAASTMGTSDETLPFFTQFFQFNAGYDDFPTFQFFVIAMAMVA  98

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I R  A   RILL  LDT+ + L  A  ++AA IVYLAHNGN + NW
Sbjct  99   GYLVLSLPFSIVSICRPHAAGPRILLFILDTVALTLNAAAGAAAADIVYLAHNGNQTTNW  158

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFCR  S S++ SF
Sbjct  159  LAICLQFGDFCREVSGSVVASF  180



>ref|XP_006430137.1| hypothetical protein CICLE_v10013511mg [Citrus clementina]
 gb|ESR43377.1| hypothetical protein CICLE_v10013511mg [Citrus clementina]
Length=198

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D ILR+ A+V +L +A AMGT+D+TLPF  Q F+F+A YDD  TF+ FVI  A+V 
Sbjct  37   IAIFDFILRIGALVCTLAAATAMGTSDETLPFFTQFFQFQASYDDLPTFQYFVIAMALVG  96

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+SI  I+R  A   R+LL+ LDT+ +   TA A++AA IVYLAHNGN + NW
Sbjct  97   GYLVLSLPISIVTIVRPHAVGPRLLLLILDTVTLTFATAAAAAAAAIVYLAHNGNQNTNW  156

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++ S +++ SF
Sbjct  157  FAICQQFGDFCQKVSGAVVASF  178



>sp|Q1W3A5.1|CASP1_STRAF RecName: Full=Casparian strip membrane protein 1; Short=SaCASP1, 
partial [Striga asiatica]
 gb|ABD98039.1| unknown [Striga asiatica]
Length=189

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI DLILR+ A   +L + + MGTT+QTLPF  Q F+F AQYDD  TF  FV+  AIV 
Sbjct  41   VSIFDLILRISAATAALAATIVMGTTEQTLPFFTQFFQFRAQYDDLPTFTFFVVGMAIVT  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+PLSI  I R  A   R LLI  DT+   L T+ A S+A IVYLAHNGNS ANW
Sbjct  101  GYLILSVPLSIVCIARPVAIGPRFLLIVCDTVTAVLATSAAGSSAAIVYLAHNGNSDANW  160

Query  586  PAICQPFQDFCRRTSA  633
             AICQ F DFC+R S 
Sbjct  161  LAICQQFNDFCQRVSG  176



>emb|CDP06886.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ILR+ A++ +L + + MGTTDQTLPF  Q F+F+A YDD   F  FV+ +AI  
Sbjct  51   VAIFDFILRLCALIATLTATITMGTTDQTLPFFTQFFQFQASYDDLPAFSYFVVANAIAS  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A  +R+ L+  DTM++   TA A+SAA IVYLAHNGN +ANW
Sbjct  111  GYLVLSLPFSIVCIVRPHAAGARLALLIFDTMLLAFTTAAAASAAAIVYLAHNGNQNANW  170

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ + DFC+R S +++ SF
Sbjct  171  LAICQQYTDFCQRVSGAVVASF  192



>ref|XP_006481869.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Citrus sinensis]
Length=198

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D ILR+ A+V +L +A AMGT+D+TLPF  Q F+F+A YDD  TF+ FVI  A+V 
Sbjct  37   IAIFDFILRIGALVCTLAAATAMGTSDETLPFFTQFFQFQASYDDLPTFQYFVIAMALVG  96

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LL+ LDT+ +   TA A++AA IVYLAHNGN + NW
Sbjct  97   GYLVLSLPFSIVTIVRPHAVGPRLLLLILDTVTLTFATAAAAAAAAIVYLAHNGNQNTNW  156

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++ S +++ SF
Sbjct  157  FAICQQFGDFCQKVSGAVVASF  178



>gb|KDP36189.1| hypothetical protein JCGZ_08833 [Jatropha curcas]
Length=203

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D +LR+ AIV +L +A  MG + +TLPF  Q F+FEA YDD    + FV+  A+V 
Sbjct  41   IAILDFLLRIGAIVTALSAAGTMGASGETLPFFTQFFQFEAGYDDLPALQFFVVAMAVVG  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LL+  DT+ + L T+ A++A  IVYLAHNGN  ANW
Sbjct  101  GYLVLSLPFSIVTIIRPHAVGPRLLLLIFDTVALTLNTSAAAAATAIVYLAHNGNEDANW  160

Query  586  PAICQPFQDFCRRTSASLI  642
             AIC  F DFC++ S ++I
Sbjct  161  LAICVQFGDFCQQISGAVI  179



>ref|XP_003519133.1| PREDICTED: casparian strip membrane protein 4-like [Glycine max]
 gb|KHN23087.1| Casparian strip membrane protein 4 [Glycine soja]
Length=194

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  33   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVA  92

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  93   GYLVLSLPFSIVAIIRPHAVGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNW  152

Query  586  PAICQPFQDFCRRTSAS  636
             AIC  F DFC +TS +
Sbjct  153  LAICNQFGDFCAQTSGA  169



>ref|NP_001236338.1| casparian strip membrane protein 5 [Glycine max]
 sp|C6T4E0.1|CASP5_SOYBN RecName: Full=Casparian strip membrane protein 5; Short=GmCASP5 
[Glycine max]
 gb|ACU16550.1| unknown [Glycine max]
 gb|KHN32862.1| Casparian strip membrane protein 5 [Glycine soja]
Length=218

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D I+R+ AI  +LG+A  MG ++Q LPF  Q F+F AQ+DDF  F+ FV  +    
Sbjct  57   VAILDFIIRLGAIGSALGAAAIMGNSEQILPFFTQFFQFHAQWDDFPMFQFFVFANGAAG  116

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            G+L LSLP SI  I+R      R+LL+ LD +MM L+ A ASSAA +VYLAHNG+  ANW
Sbjct  117  GFLILSLPFSIVCIVRPYTVGPRLLLVILDILMMALVMAAASSAAAVVYLAHNGSQDANW  176

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC+ TS +++ SF
Sbjct  177  IAICQQFTDFCQVTSEAVVASF  198



>gb|EEE57797.1| hypothetical protein OsJ_08354 [Oryza sativa Japonica Group]
Length=195

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 6/142 (4%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +S+ DLILRVVA+V  + SA+AMG T+QTLPF  Q    +         +LFV+ ++ V 
Sbjct  40   LSVADLILRVVAVVAIVDSAIAMGHTNQTLPFFTQFLPVQG------AVQLFVVANSAVT  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+PLS+ HI+R+RA  SR++LIFLD++M+ L+ A AS++A IVYLAH GN  ANW
Sbjct  94   AYLVLSIPLSVVHIIRSRASYSRLVLIFLDSVMLALVAAVASASAAIVYLAHKGNVRANW  153

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A+CQ F  FC R S  LIGSF
Sbjct  154  FAVCQQFDSFCERISGPLIGSF  175



>ref|NP_001237259.1| casparian strip membrane protein 3 [Glycine max]
 sp|C6T1K6.1|CASP3_SOYBN RecName: Full=Casparian strip membrane protein 3; Short=GmCASP3 
[Glycine max]
 gb|ACU15456.1| unknown [Glycine max]
Length=195

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  + G+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  34   VAIMDFILRLGAIAAAPGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVA  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  94   GYLVLSLPFSIVVIIRPHAVGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNW  153

Query  586  PAICQPFQDFCRRTSAS  636
             AIC  F DFC +TS +
Sbjct  154  LAICNQFGDFCAQTSGA  170



>gb|KEH41982.1| casparian strip membrane protein [Medicago truncatula]
Length=195

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D ILR+ AI  +L +A +MGT+DQ+LPF  Q F+FEA YD F  F+ F+I  AIV 
Sbjct  34   IAIMDFILRLGAIAAALAAAASMGTSDQSLPFFTQFFQFEASYDSFPAFQFFLIAMAIVA  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L TA A+SAA IVYLAHNGN   NW
Sbjct  94   GYLVLSLPFSIVAIIRPHATGPRLFLIILDTVFLTLATASAASAASIVYLAHNGNQDTNW  153

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC +TS +++ SF
Sbjct  154  LAICNQFGDFCAQTSGAVVASF  175



>ref|XP_011004683.1| PREDICTED: casparian strip membrane protein 3 [Populus euphratica]
Length=197

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I DL+LR+ A+V +L +A AMGT++QTLPF  Q F+F+A YDD  TF+  VI  AIV 
Sbjct  36   LAIFDLVLRLGAVVTALAAAAAMGTSEQTLPFFTQFFQFQASYDDLPTFQFHVIAMAIVS  95

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LLI LDT+ + L TA A++AA IVYLAHNGNSSANW
Sbjct  96   GYLVLSLPFSIVAIVRPHATGPRLLLIILDTVALTLNTAAAAAAAAIVYLAHNGNSSANW  155

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFCR+ S +++ SF
Sbjct  156  LAICQQFGDFCRKASGAVVASF  177



>gb|KHN02602.1| Casparian strip membrane protein 4 [Glycine soja]
Length=195

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  34   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVA  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  94   GYLVLSLPFSIVVIIRPHAVGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNW  153

Query  586  PAICQPFQDFCRRTSAS  636
             AIC  F DFC +TS +
Sbjct  154  LAICNQFGDFCAQTSGA  170



>ref|XP_004149191.1| PREDICTED: casparian strip membrane protein RCOM_1259250-like 
[Cucumis sativus]
 ref|XP_004161216.1| PREDICTED: casparian strip membrane protein RCOM_1259250-like 
[Cucumis sativus]
 gb|KGN59158.1| hypothetical protein Csa_3G777660 [Cucumis sativus]
Length=203

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D +LR+ A+  +LG+A AMGT+D+TLPF  Q F+FEA YDD  TF+ F+I   IV 
Sbjct  41   LSIFDFVLRLGALGAALGAAAAMGTSDETLPFFTQFFQFEASYDDLPTFQFFLIAMGIVA  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALSLP SI  I+R RA   R+LL+ LDT+++ L T+ A++AA IVYLAH+GN+S NW
Sbjct  101  GYLALSLPFSIVCIVRPRAVGLRLLLLILDTVVLTLATSAAAAAAAIVYLAHDGNTSTNW  160

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC++ S ++IG+F
Sbjct  161  LAICDQFDDFCQKVSGAVIGAF  182



>ref|XP_004143331.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
 gb|KGN48281.1| hypothetical protein Csa_6G453800 [Cucumis sativus]
Length=211

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D +LR+  +  +L +A  MGT+DQTLPF  Q F+FEA YDD  TF+ FV+  A+V 
Sbjct  49   LSIFDFVLRIGVLASALAAAATMGTSDQTLPFFTQFFQFEASYDDLPTFQFFVVAMAVVA  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+ LS+P SI  I+R  A   R+LL+ LD++ + L TA A +AA +V LAH+GNSS NW
Sbjct  109  GYVVLSIPFSIVCIIRPHAAGPRVLLLILDSVALTLNTAAAGAAAAVVSLAHSGNSSTNW  168

Query  586  PAICQPFQDFCRRTSASLIGS  648
             A+C  F DFC++ S +++GS
Sbjct  169  LAVCNQFGDFCQQASGAVVGS  189



>ref|XP_007206803.1| hypothetical protein PRUPE_ppa025691mg [Prunus persica]
 gb|EMJ08002.1| hypothetical protein PRUPE_ppa025691mg [Prunus persica]
Length=206

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IID++LR+ A   +L +A   G T+Q LPF  Q F+F AQY+D  TF  FV  +A+  
Sbjct  45   LAIIDIVLRLGAGSAALAAAYIAGNTEQILPFFTQFFQFHAQYNDLPTFTFFVAANAVAV  104

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+A SLP SI  I+R  A   R+LL+FLDT+M+ L+ + A +++ IVYLAHNGN ++NW
Sbjct  105  GYIAFSLPFSIVCIVRPHAIGPRLLLVFLDTVMVALVMSAAGASSAIVYLAHNGNLNSNW  164

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  + DFC+  S +L+ SF
Sbjct  165  LAICMQYNDFCQALSGALVASF  186



>emb|CDP10637.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I DLILRV A   +LG+ V+MGT +QTLPF  Q F+F+A YDD  TF  FVI  AIVC
Sbjct  44   IAIFDLILRVSAAAAALGATVSMGTAEQTLPFFTQFFQFQASYDDLPTFSFFVIGMAIVC  103

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YLALS+P SI  I R  A   R+LLI  DT+ + L T+ +++AA +VYLAH GNS+ANW
Sbjct  104  AYLALSIPFSIVCIARPHAVAPRLLLIIFDTLALTLATSASAAAAAMVYLAHQGNSNANW  163

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++TS S+I  F
Sbjct  164  LAICQQFTDFCQKTSGSVIAGF  185



>ref|XP_004168080.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
Length=230

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D +LR+  +  +L +A  MGT+DQTLPF  Q F+FEA YDD  TF+ FV+  A+V 
Sbjct  49   LSIFDFVLRIGVLASALAAAATMGTSDQTLPFFTQFFQFEASYDDLPTFQFFVVAMAVVA  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+ LS+P SI  I+R  A   R+LL+ LD++ + L TA A +AA +V LAH+GNSS NW
Sbjct  109  GYVVLSIPFSIVCIIRPHAAGPRVLLLILDSVALTLNTAAAGAAAAVVSLAHSGNSSTNW  168

Query  586  PAICQPFQDFCRRTSASLIGS  648
             A+C  F DFC++ S +++GS
Sbjct  169  LAVCNQFGDFCQQASGAVVGS  189



>ref|XP_006299322.1| hypothetical protein CARUB_v10015479mg [Capsella rubella]
 gb|EOA32220.1| hypothetical protein CARUB_v10015479mg [Capsella rubella]
Length=204

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AIV +L +A  MGT+D+TLPF  Q  +FEA YDD  TF+ FVI  A+V 
Sbjct  43   LAIFDFLLRLAAIVAALVAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVG  102

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP+S+  ILR  A   R+LL+ LDT ++GL  A ASSAA I YLAHNGN + NW
Sbjct  103  GYLVLSLPISVVTILRPLATAPRLLLLVLDTGILGLNMAAASSAAAISYLAHNGNQNTNW  162

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              ICQ F DFC+++S +++ +F
Sbjct  163  LPICQQFGDFCQKSSGAVVSAF  184



>sp|P0DI57.1|CASP5_LOTJA RecName: Full=Casparian strip membrane protein 5; Short=LjCASP5 
[Lotus japonicus]
 gb|AFK37522.1| unknown [Lotus japonicus]
Length=197

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MG +DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  35   VAIMDFILRLGAIAAALGAAATMGLSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVA  94

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSI  ++R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN   NW
Sbjct  95   GYLVLSLPLSIVAVVRPHAAGPRLFLIILDTVFLTLATASGASAASIVYLAHNGNQDTNW  154

Query  586  PAICQPFQDFCRRTSA  633
             AIC  F DFC +TS 
Sbjct  155  IAICNQFGDFCAQTSG  170



>ref|XP_008361038.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840-like 
[Malus domestica]
Length=217

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IID++LR+ A   ++ +A   G T+Q LPF  Q F+F AQY+D  TF  FV+ +A+  
Sbjct  56   LAIIDIVLRLGAGSAAVAAAYTAGNTEQILPFFTQFFQFHAQYNDLPTFTFFVVANAVAV  115

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+  SLP SI  ++R  A   R+LL+ LDT+M+ L+ A   +++ IVYLAHNGN +ANW
Sbjct  116  GYIGFSLPFSIICVIRPHAXGPRLLLVILDTVMVALIIAADGASSAIVYLAHNGNVNANW  175

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC+ + DFC+  S +L+ SF
Sbjct  176  LAICRQYNDFCQALSGALVSSF  197



>ref|XP_007203160.1| hypothetical protein PRUPE_ppa024449mg [Prunus persica]
 gb|EMJ04359.1| hypothetical protein PRUPE_ppa024449mg [Prunus persica]
Length=205

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR+ AIV +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  ++V 
Sbjct  44   MAIIDLVLRIGAIVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVA  103

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I+R  A   R+LL+ LD + + L T+ A +A  IVYLAHNGNSS+NW
Sbjct  104  GYLVLSVPFSIVSIVRPHASGIRLLLLILDVVALTLATSAAGAATAIVYLAHNGNSSSNW  163

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC+  S +++ SF
Sbjct  164  LAICNQFGDFCQTVSGAVVASF  185



>gb|KFK28903.1| hypothetical protein AALP_AA7G063100 [Arabis alpina]
Length=221

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ILR++A + ++ +A  M TT++TLPF  Q  +F+A Y D  TF  FVIV++IV 
Sbjct  59   VAIFDFILRLIAAITAMSAAAKMATTEETLPFFTQFLQFQADYTDLPTFSSFVIVNSIVG  118

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  ILR      R+ LI  DT MMGL    AS++A IVY+AHNGNSS+NW
Sbjct  119  GYLTLSLPFSIVCILRPLVLPPRLFLILCDTAMMGLTMVAASASAAIVYVAHNGNSSSNW  178

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F DFC  TS +++ SF
Sbjct  179  LPVCQQFGDFCEGTSGAVVASF  200



>gb|KEH41983.1| casparian strip membrane protein [Medicago truncatula]
Length=194

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I+D ILR+ AI  ++ +A +MGT+DQTLPF  Q F+FEA YD F TF+ FVI  AI   
Sbjct  34   AIMDFILRLGAIAAAIAAAASMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVISMAIAAS  93

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLP SI  I+R  A   R+ LI LDT+ + L T+ A++AA IVYLAHNGN   NW 
Sbjct  94   YLVLSLPFSIVAIIRPHAPGPRLFLIILDTVFLTLATSSAAAAASIVYLAHNGNQDTNWL  153

Query  589  AICQPFQDFCRRTSASLIGSF  651
            AIC  F DFC +TS +++ SF
Sbjct  154  AICNQFGDFCAQTSGAVVASF  174



>ref|XP_004303525.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Fragaria vesca subsp. vesca]
Length=200

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDLI+R+ A+V +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  +IV 
Sbjct  39   LAIIDLIIRIGAMVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFEFFLIAMSIVA  98

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LL+ +D   + L T+ A++A  IVYLAHNGNS++NW
Sbjct  99   GYLVLSLPFSIVAIVRPHAGGPRLLLLIVDIAALTLATSAAAAATSIVYLAHNGNSNSNW  158

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC++ S +++ SF
Sbjct  159  LAICNQFGDFCQKVSGAVVASF  180



>sp|P0DI31.1|CASP1_TRIPD RecName: Full=Casparian strip membrane protein 1; Short=TpCASP1 
[Triphysaria pusilla]
Length=202

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I DLILR+ A   +L + + MGTT+QTLPF  Q F+F A YDD  TF  FVI  AIV 
Sbjct  41   VAIFDLILRISAATAALAATIVMGTTEQTLPFFTQFFQFRASYDDLPTFTFFVIAMAIVT  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I R      RILLI  DT+ + L T+ A ++A IVYLAHNG S ANW
Sbjct  101  GYLILSVPFSIVCIARPVVAAPRILLILCDTLTVTLATSAAGASAAIVYLAHNGXSDANW  160

Query  586  PAICQPFQDFCRRTSA  633
             AICQ F DFC+R S 
Sbjct  161  LAICQQFNDFCQRVSG  176



>ref|XP_010104281.1| hypothetical protein L484_005384 [Morus notabilis]
 gb|EXB99566.1| hypothetical protein L484_005384 [Morus notabilis]
Length=202

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 93/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D +LR+ AI  +L +A  MGT D+TLPF  Q F+FEA YDD  TF  FVI  AIV 
Sbjct  41   IAITDFVLRLGAIAAALSAAATMGTADETLPFFTQFFQFEASYDDLPTFMFFVIAMAIVG  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLPLSI  I+R  A   R+ L+ LDT+ + L T+ A++A  IVYLAHNGNSSANW
Sbjct  101  GYLVLSLPLSIVTIIRPHAAAPRLALLILDTVALTLATSCAAAATSIVYLAHNGNSSANW  160

Query  586  PAICQPFQDFCRRTSA  633
             A+CQ F  FC+  S 
Sbjct  161  MAVCQQFTGFCQGASG  176



>ref|XP_004516298.1| PREDICTED: casparian strip membrane protein 1-like [Cicer arietinum]
Length=195

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D ILR+ AI  +LG+A +MGT+DQTLPF  Q F+FEA YD F TF+ FVI  AIV 
Sbjct  34   IAIMDFILRLGAIAAALGAAASMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMAIVA  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LD++ + L TA A+SAA IVYLAHNGN   NW
Sbjct  94   GYLVLSLPFSIVAIIRPHAPGPRLFLIILDSVFLTLATASAASAASIVYLAHNGNQDTNW  153

Query  586  PAICQPFQDFCRRTSA  633
             AIC  F DFC +TS 
Sbjct  154  LAICNQFGDFCAQTSG  169



>gb|KFK25022.1| hypothetical protein AALP_AA8G056700 [Arabis alpina]
Length=202

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +1

Query  292  MGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCGYLALSLPLSIFHILRTRAEKS  471
            MGT+D+TLPF  Q  +FEA YDD  TF+ FVI  A+V GYL LSLP S+  I+R  A   
Sbjct  63   MGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAVALVAGYLVLSLPFSVITIIRPLAVAP  122

Query  472  RILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWPAICQPFQDFCRRTSASLIGSF  651
            R+LL+ LDT  + L+TA AS+AA IVYLAHNGN + NW  ICQ F DFC++TS S++ +F
Sbjct  123  RLLLLVLDTAALVLITAAASAAAAIVYLAHNGNQNTNWLPICQQFGDFCQKTSGSVVSAF  182



>ref|XP_011077838.1| PREDICTED: casparian strip membrane protein 1 [Sesamum indicum]
Length=205

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I DLILR+ A   +LG+ +AMGT +QTLPF  Q F+F+A YDD  TF  FVI  AIV 
Sbjct  44   VAIFDLILRISAAAAALGATIAMGTAEQTLPFFTQFFQFQASYDDLPTFSFFVIAMAIVT  103

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I+R  A   R+LLI  DT+ + L T+   +AA IVYLAHNGNS ANW
Sbjct  104  AYLVLSVPFSIVCIVRPVAAAPRLLLILCDTLAVTLATSAGGAAAAIVYLAHNGNSDANW  163

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC+R S +++GSF
Sbjct  164  LAICQQFTDFCQRVSGAVVGSF  185



>ref|XP_008243654.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Prunus mume]
Length=211

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR+ A+V +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  ++V 
Sbjct  50   MAIIDLVLRIGAVVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVA  109

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I+R  A   R+LL+ LD + + L T+ A +A  IVYLAHNGNSS+NW
Sbjct  110  GYLVLSVPFSIVSIVRPHASGIRLLLLILDVVALTLATSAAGAATAIVYLAHNGNSSSNW  169

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFC+  S +++ SF
Sbjct  170  LAICNQFGDFCQTVSGAVVASF  191



>gb|EYU34645.1| hypothetical protein MIMGU_mgv1a015926mg [Erythranthe guttata]
Length=140

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  292  MGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCGYLALSLPLSIFHILRTRAEKS  471
            MGTT+++LPF  Q  RF A+Y D  TF  FV+ ++IV  YL LSL LSI HI+   A+KS
Sbjct  1    MGTTNESLPFFTQFIRFRAKYSDLPTFTFFVVANSIVSAYLVLSLALSISHIVNGGAKKS  60

Query  472  RILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWPAICQPFQDFCRRTSASLIGSF  651
            R++LIF DT M+ LLTAGAS+AA IVYLAH GN+  NW AICQ F  FC R S SLIGSF
Sbjct  61   RVVLIFFDTGMLALLTAGASAAAAIVYLAHKGNTRTNWFAICQQFNSFCERISGSLIGSF  120



>ref|XP_007144398.1| hypothetical protein PHAVU_007G152900g [Phaseolus vulgaris]
 gb|ESW16392.1| hypothetical protein PHAVU_007G152900g [Phaseolus vulgaris]
Length=195

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +I+D ILR+ A+  SLG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V G
Sbjct  35   AIMDFILRLGAVAASLGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAG  94

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLP SI  I+R      R+ LI LDT+ + L TA  +SAA IVYLAHNGN  ANW 
Sbjct  95   YLVLSLPFSIVAIIRLHVAGPRLFLITLDTVFLTLATASGASAAAIVYLAHNGNQDANWL  154

Query  589  AICQPFQDFCRRTSA  633
            AIC  F DFC +TS 
Sbjct  155  AICNQFGDFCAQTSG  169



>ref|XP_009372531.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Pyrus x bretschneideri]
Length=203

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR+ AIV +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  +IV 
Sbjct  41   MAIIDLVLRIGAIVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSIVA  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LL+ LD + + L+T+ A +A  IVYLAHNGN+S+NW
Sbjct  101  GYLVLSLPFSIVSIVRPHASGPRLLLLILDLVALTLVTSAAGAATSIVYLAHNGNASSNW  160

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFCR  S +++ SF
Sbjct  161  LAICNQFGDFCRNVSGAVVASF  182



>ref|XP_003555157.1| PREDICTED: casparian strip membrane protein 5-like [Glycine max]
Length=212

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I++ D +LR+ AI  ++GSAV MGT ++ LPF  Q  +F AQ+ DF  F+ FV  + ++ 
Sbjct  51   IAVTDFVLRLGAIGAAMGSAVTMGTNEEQLPFFTQFLQFHAQWSDFPVFQFFVFANGVIS  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY  LSLP S   I++  A + R+LL+  DT+MMGL++  A+ AA IVY+ HNG+  ANW
Sbjct  111  GYAILSLPFSYVCIVQPHAVRPRLLLMTFDTVMMGLISVAAAGAAAIVYVGHNGSQDANW  170

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             A CQ F +FC+  S +++ SF
Sbjct  171  MAFCQGFTNFCQAASEAVVLSF  192



>ref|XP_008462597.1| PREDICTED: casparian strip membrane protein 1 [Cucumis melo]
 sp|P0DI61.1|CASP1_CUCME RecName: Full=Casparian strip membrane protein 1; Short=CmCASP1 
[Cucumis melo]
Length=209

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+  +  +L +A AMGT++QTLPF  Q F+FEA YDD  TF+ FV+  A+V 
Sbjct  47   LAIFDFVLRIGVLASALAAAAAMGTSEQTLPFFTQFFQFEASYDDLPTFQFFVVAMAVVA  106

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+ LS+P SI  I+R  A   R+LL+ LD++ + L TA A +AA +V LAH+GNSS NW
Sbjct  107  GYVVLSIPFSIVCIIRPHAAGPRVLLLILDSVALTLNTAAAGAAAAVVSLAHSGNSSTNW  166

Query  586  PAICQPFQDFCRRTSASLIGS  648
             AIC  F DFC++ S +++GS
Sbjct  167  LAICNQFGDFCQQASGAVVGS  187



>ref|XP_008442871.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_576556-like 
[Cucumis melo]
Length=204

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D ++R+ A+  +LG+A AMGT+D+TLPF  Q F+FEA YDD  TF+ F+I   IV 
Sbjct  42   LSIFDFVIRLGALGAALGAAAAMGTSDETLPFFTQFFQFEASYDDLPTFQFFLIAMGIVA  101

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYLALSLP SI  I+R  A   R+LL+ LDT+++ L T+ A++AA IVYLAH+GNSS NW
Sbjct  102  GYLALSLPFSIVCIVRPGAVGLRLLLLILDTVVLTLATSAAAAAAAIVYLAHDGNSSTNW  161

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F+DFC+  S ++IG+F
Sbjct  162  LAICDQFEDFCQNISGAVIGAF  183



>ref|XP_008229074.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840 
[Prunus mume]
Length=216

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IID++LR+ A   +L +A   G T+Q LPF  Q F+F AQY+D  TF  FV  +A+  
Sbjct  55   LAIIDIVLRLGAGSAALAAAYISGNTEQILPFFTQFFQFHAQYNDLPTFTFFVAANAVAS  114

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+A+SLP SI  I+R  A   R+LL+FLDT+M+ L+ + A +++ IVYLAHNGN ++NW
Sbjct  115  GYIAISLPFSIVCIVRPHAIGPRLLLVFLDTVMVALVMSAAGASSAIVYLAHNGNLNSNW  174

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  + DFC+  + +L+ SF
Sbjct  175  LAICMQYTDFCQALTGALVASF  196



>ref|XP_004300108.1| PREDICTED: casparian strip membrane protein RCOM_1259250-like 
[Fragaria vesca subsp. vesca]
Length=215

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++++D ILR+ A   +LG+ V M +++QTLPF  Q F+F A YDD  TF  FVI  AIV 
Sbjct  54   VAVLDFILRLGATAAALGATVTMASSEQTLPFFTQFFQFSAGYDDMPTFTFFVIAMAIVS  113

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R +    R+LL+  DT+ + L T+ A++AA IVYLAHNG+S ANW
Sbjct  114  GYLVLSLPFSIVSIVRPKLVAPRLLLLIFDTVALTLNTSAAAAAAAIVYLAHNGSSDANW  173

Query  586  PAICQPFQDFCRRTSA  633
             AICQ F DFC++TS 
Sbjct  174  LAICQQFTDFCQQTSG  189



>ref|XP_002323410.1| integral membrane family protein [Populus trichocarpa]
 sp|B9IIR5.1|CASP2_POPTR RecName: Full=Casparian strip membrane protein 2; Short=PtCASP2 
[Populus trichocarpa]
 gb|EEF05171.1| integral membrane family protein [Populus trichocarpa]
Length=199

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I D ILR+ AI  +L +A +MGT+D+TLPF  Q F+F+A YDD  TF+ FVI  AIV 
Sbjct  38   IAIFDFILRLAAIATALAAAASMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAMAIVA  97

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LLI LDT+ + L TA  ++AA IVYLAHNGNSS NW
Sbjct  98   GYLVLSLPFSIVAIVRPHAAGPRLLLIILDTVALTLNTAAGAAAAAIVYLAHNGNSSTNW  157

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++ S +++ SF
Sbjct  158  LAICQQFGDFCQKNSGAVVASF  179



>sp|P0DI60.1|CASP1_HELAN RecName: Full=Casparian strip membrane protein 1; Short=HaCASP1 
[Helianthus annuus]
Length=212

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            + IID ILR+ AI  +L +A AMGTT Q LPF  Q F+F+A Y+D   F  FVI +A+  
Sbjct  51   LGIIDFILRICAIAAALAAATAMGTTSQQLPFFTQFFQFKADYNDLPAFTFFVIANAMAG  110

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R     +R++L+  DT+ + L+TA AS+AA IVYLAHNGNS ANW
Sbjct  111  AYLVLSLPFSILCIVRPHILGARLMLLVFDTVAVPLVTAAASAAASIVYLAHNGNSDANW  170

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC+ F DFC+R S +++ SF
Sbjct  171  VAICRQFNDFCQRVSGAVVASF  192



>sp|P0DI63.1|CASP1_STRHE RecName: Full=Casparian strip membrane protein 1; Short=ShCASP1 
[Striga hermonthica]
Length=202

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI DL LR+ A   +L + + MGTT+QTLPF  Q F+F AQYDD  TF  FV+  AIV 
Sbjct  41   VSIFDLFLRISAATAALAATIVMGTTEQTLPFFTQFFQFRAQYDDLPTFTFFVVGMAIVT  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I R  A   R LLI  DT+   L T+ A S+A IVYLAHNGNS ANW
Sbjct  101  GYLILSVPFSIVCIARPVAIGPRFLLIVGDTLKAVLATSAAGSSAAIVYLAHNGNSDANW  160

Query  586  PAICQPFQDFCRRTSA  633
              ICQ F DFC+R S 
Sbjct  161  LDICQQFNDFCQRVSG  176



>ref|XP_006487914.1| PREDICTED: casparian strip membrane protein 5-like [Citrus sinensis]
Length=203

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  +LG+   MGT D+ LPF  Q F+FEAQYDDF+ F  FVI + +V 
Sbjct  41   VAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVIANGLVS  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R+LL+  DT+MM L    A++AA +VYLAH+GN +ANW
Sbjct  101  AYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSGNPNANW  160

Query  586  PAICQPFQDFCRRTSASL  639
              ICQ F DFC+ TS+++
Sbjct  161  LPICQQFGDFCQSTSSAV  178



>ref|XP_009372532.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_576556-like 
[Pyrus x bretschneideri]
Length=205

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR  AIV +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  ++V 
Sbjct  43   MAIIDLVLRSGAIVSALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVA  102

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I+R  A   R+LL+ LD + + L T+ A +A  IVYLAHNGN+S+NW
Sbjct  103  GYLVLSVPFSIVSIVRPHASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNASSNW  162

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFCR  S +++ SF
Sbjct  163  LAICNQFGDFCRNVSGAVVASF  184



>ref|XP_009377816.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840-like 
[Pyrus x bretschneideri]
Length=218

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IID++LR+ A   ++ +A   G T+Q LPF  Q F+F AQY+D  T   F++ +A+  
Sbjct  57   LAIIDIVLRLGAGSAAVAAAYTAGNTEQILPFFTQFFQFHAQYNDLPTITFFIVANAVAV  116

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+  SLP SI  I+R  A   R+LL+ LDT+M+ L+ A   +++ IVYLAHNGN +ANW
Sbjct  117  GYIGFSLPFSIICIIRPHAIGPRLLLVILDTVMVALIIAADGASSAIVYLAHNGNMNANW  176

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC+ + DFC+  S +L+ SF
Sbjct  177  LAICRQYNDFCQALSGALVSSF  198



>ref|XP_003519136.1| PREDICTED: casparian strip membrane protein 1-like [Glycine max]
 gb|KHN42577.1| Casparian strip membrane protein 1 [Glycine soja]
Length=194

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F +F+ FVI  A+V 
Sbjct  33   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTSFQFFVITMALVG  92

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S   I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  93   GYLVLSLPFSFVAIIRPHAAGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNW  152

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  153  LAICNQFGDFCAQT  166



>ref|XP_006424191.1| hypothetical protein CICLE_v10030236mg [Citrus clementina]
 gb|ESR37431.1| hypothetical protein CICLE_v10030236mg [Citrus clementina]
 gb|KDO39724.1| hypothetical protein CISIN_1g042128mg [Citrus sinensis]
Length=211

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  +LG+   MGT D+ LPF  Q F+FEAQYDDF+ F  FVI + +V 
Sbjct  49   VAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVIANGLVS  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R+LL+  DT+MM L    A++AA +VYLAH+GN +ANW
Sbjct  109  AYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSGNPNANW  168

Query  586  PAICQPFQDFCRRTSASL  639
              ICQ F DFC+ TS+++
Sbjct  169  LPICQQFGDFCQSTSSAV  186



>gb|KHN02600.1| Casparian strip membrane protein 1 [Glycine soja]
Length=194

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F +F+ FVI  A+V 
Sbjct  33   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTSFQFFVITMALVG  92

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S   I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  93   GYLVLSLPFSFVAIIRPHAAGPRLFLIILDTVFLTLTTASGASAAAIVYLAHNGNQDSNW  152

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  153  LAICNQFGDFCAQT  166



>ref|XP_010093771.1| hypothetical protein L484_019174 [Morus notabilis]
 gb|EXB54604.1| hypothetical protein L484_019174 [Morus notabilis]
Length=194

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = +1

Query  229  SIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCG  408
            +IID +LR+ AI  +L +A  MGT+D++LPF  Q F+FEA YDD  TF+ F+I  A V G
Sbjct  34   AIIDFVLRLGAIASALAAAATMGTSDESLPFFTQFFQFEASYDDMPTFQFFLIGMAFVSG  93

Query  409  YLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWP  588
            YL LSLP SI  I+R  A   R+ LI +DT+ + L T+  ++AA IVYLAHNGNSS+NW 
Sbjct  94   YLVLSLPFSIVAIVRPHAVGIRLFLIIMDTVALTLATSAGAAAAAIVYLAHNGNSSSNWL  153

Query  589  AICQPFQDFCRRTSA  633
            AIC  F DFC++ S 
Sbjct  154  AICNQFTDFCQKVSG  168



>ref|XP_010516820.1| PREDICTED: casparian strip membrane protein 1-like [Camelina 
sativa]
Length=207

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  S+G+A  M T ++TLPF  Q  +F+A YDD   F+ FVI  AIV 
Sbjct  46   LAIFDFLLRLGAIAVSIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVA  105

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A++AA IVYLAHNGN S NW
Sbjct  106  SYLVLSLPFSIIAIIRPLAVAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNW  165

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S +++ +
Sbjct  166  LPICQQFGDFCQNVSTAVVAA  186



>sp|P0DI52.1|CASP1_ERYGU RecName: Full=Casparian strip membrane protein 1; Short=MgCASP1 
[Erythranthe guttata]
 gb|EYU38660.1| hypothetical protein MIMGU_mgv1a013782mg [Erythranthe guttata]
Length=210

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I DLILR+ A   +L + + MGTT+QTLPF  Q F+F+A YDD  TF  FVI  +IV 
Sbjct  49   VAIFDLILRISAATAALAATITMGTTEQTLPFFTQFFQFQASYDDLPTFTFFVIAMSIVT  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LS+P SI  I R  A   R+LLI  DT+ + L T+ A ++A IVYLAHNGNS ANW
Sbjct  109  GYLVLSVPFSIVCIARPVAAAPRLLLILCDTLAVTLNTSAAGASAAIVYLAHNGNSDANW  168

Query  586  PAICQPFQDFCRRTS  630
             AICQ F DFC+RTS
Sbjct  169  LAICQQFNDFCQRTS  183



>ref|XP_006408711.1| hypothetical protein EUTSA_v10002094mg [Eutrema salsugineum]
 gb|ESQ50164.1| hypothetical protein EUTSA_v10002094mg [Eutrema salsugineum]
Length=221

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR++A + ++ +A  M TT++TLPF  Q  +F+A+Y D  TF  FVIV++IV 
Sbjct  59   VAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQAEYTDLPTFSSFVIVNSIVG  118

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  ILR  A   R+ LI  DT MMGL    AS++A IVYLAHNGNSS+NW
Sbjct  119  GYLTLSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNW  178

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F DFC+ TS +++ SF
Sbjct  179  LPVCQQFGDFCQGTSGAVVASF  200



>ref|XP_010683665.1| PREDICTED: casparian strip membrane protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            + +ID ++R++A+  +L + V MGTTDQTLPF  Q F+F A+Y D  TF  FVI +AIV 
Sbjct  55   VGVIDFVVRLIALATALAATVVMGTTDQTLPFFTQFFQFRARYYDLPTFTYFVIANAIVA  114

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LS+P SI  I+R  A   R++L+  DT+ + L  + A++ A IV LAH GN++ NW
Sbjct  115  AYLVLSMPFSIVTIVRPLAAGPRLILVIFDTIALTLTISAAAAGAAIVSLAHKGNTNTNW  174

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F +FC+R+S +++ SF
Sbjct  175  IAICQQFDNFCQRSSGAVVASF  196



>gb|KFK36497.1| hypothetical protein AALP_AA4G132200 [Arabis alpina]
Length=205

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  +L +++ M + ++TLPF  Q  +F+A YDD  TF+ FVI  AIV 
Sbjct  44   LAIFDFLLRLAAISATLAASIVMFSAEETLPFFTQFLQFQASYDDLPTFQFFVIAVAIVA  103

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L TA A+S+A IVYLAHNGN + NW
Sbjct  104  SYLVLSLPFSIVTIVRPLAVAPRLVLLIFDTLVVTLNTAAAASSAAIVYLAHNGNQNTNW  163

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S++++ +
Sbjct  164  LPICQQFGDFCQIVSSAVVAA  184



>gb|EEC73995.1| hypothetical protein OsI_08910 [Oryza sativa Indica Group]
Length=223

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 100/171 (58%), Gaps = 36/171 (21%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTF-----------  372
            +S+ DLILRVVA+V  + SA+AMGTT+QTLPF  Q  RF+AQY D  T            
Sbjct  40   LSVADLILRVVAVVAIVDSAIAMGTTNQTLPFFTQFLRFKAQYSDLPTLTCDHSCLLATI  99

Query  373  ------------------KLFVIVSAIVCGYLALSLPLSIFHILRTRAEKSRILLIFLDT  498
                              +LFV+ ++ V  YL LS+PLS+ HI+R+RA  SR++      
Sbjct  100  VNLHYFRLQARLFLPVVTRLFVVANSAVTAYLVLSIPLSVVHIIRSRASYSRLV------  153

Query  499  MMMGLLTagassaagIVYLAHNGNSSANWPAICQPFQDFCRRTSASLIGSF  651
             M+ L+ A AS++A IVYLAH GN  ANW A+CQ F  FC R S  LIGSF
Sbjct  154  -MLALVAAVASASAAIVYLAHKGNVRANWFAVCQQFDSFCERISGPLIGSF  203



>ref|XP_010037287.1| PREDICTED: casparian strip membrane protein 1-like [Eucalyptus 
grandis]
 gb|KCW48963.1| hypothetical protein EUGRSUZ_K02571 [Eucalyptus grandis]
Length=203

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D ILR+ AIV +L +A AMGT+D+TLPF  Q F+F+A YDD  TF+ FVI  AIV 
Sbjct  42   VAIFDFILRLCAIVTALAAAAAMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAMAIVG  101

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+RT A   R+LL+ LD M + L TA  ++AA IVYLAHNGN + NW
Sbjct  102  GYLVLSLPFSIVCIIRTHAAGLRMLLLVLDAMALTLTTAAGAAAAAIVYLAHNGNPNTNW  161

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC++ S +++ S 
Sbjct  162  LAICQQFGDFCQKVSGAVVASM  183



>ref|XP_010505142.1| PREDICTED: casparian strip membrane protein 1 [Camelina sativa]
Length=207

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++G+A  M T ++TLPF  Q  +F+A YDD   F+ FVI  AIV 
Sbjct  46   LAIFDFLLRLGAIAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVA  105

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A++AA IVYLAHNGN S NW
Sbjct  106  SYLVLSLPFSIIAIIRPLAVAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNW  165

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S +++ +
Sbjct  166  LPICQQFGDFCQNVSTAVVAA  186



>ref|XP_003535780.1| PREDICTED: casparian strip membrane protein 2-like [Glycine max]
 gb|KHN02601.1| Casparian strip membrane protein 2 [Glycine soja]
Length=196

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  35   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVG  94

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT+ + L TAG +SAA IVYLAHNG+   NW
Sbjct  95   GYLVLSLPFSIVAIVRPHAVGPRLSLIILDTVFLTLATAGGASAAAIVYLAHNGDQDTNW  154

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  155  LAICNQFGDFCAQT  168



>ref|XP_004515966.1| PREDICTED: casparian strip membrane protein 2-like [Cicer arietinum]
Length=192

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            I+I+D ILR+ AI  SL +A+ M T+DQ LPF  Q F+FEA YD F TF+ FVI  A V 
Sbjct  31   IAIMDFILRLGAIASSLAAAITMATSDQILPFFTQFFQFEASYDSFSTFQFFVITMAFVG  90

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LD + + L TA  +SAA IVYLAHNGN  +NW
Sbjct  91   GYLVLSLPFSIVTIIRPHAIGPRLFLIILDIVFLTLATASGASAAAIVYLAHNGNQDSNW  150

Query  586  PAICQPFQDFCRRTSA  633
             AIC  F+DFC +TS 
Sbjct  151  LAICNQFEDFCSQTSG  166



>ref|NP_001237549.1| casparian strip membrane protein 1 [Glycine max]
 sp|C6T2E7.1|CASP1_SOYBN RecName: Full=Casparian strip membrane protein 1; Short=GmCASP1 
[Glycine max]
 gb|ACU15802.1| unknown [Glycine max]
 gb|KHN42578.1| Casparian strip membrane protein 2 [Glycine soja]
Length=195

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  ++V 
Sbjct  34   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMSLVG  93

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+ LI LDT  + L TAG +SAA IVYLAHNG+   NW
Sbjct  94   GYLVLSLPFSIVAIVRPHAVGPRLFLIILDTAFLTLATAGGASAAAIVYLAHNGDQDTNW  153

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  154  LAICNQFGDFCAQT  167



>sp|A2YQB8.1|CASP2_ORYSI RecName: Full=Casparian strip membrane protein 2; Short=OsCASP2 
[Oryza sativa Indica Group]
 gb|EAZ05279.1| hypothetical protein OsI_27482 [Oryza sativa Indica Group]
Length=235

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            + +ID +LRV A   +L +A+++GT+D+ L      F+F A++DDF  F+ F++ +AI  
Sbjct  68   LGLIDFVLRVAAFGPTLAAAISIGTSDERLSVFTNYFQFRARFDDFPAFEFFIVANAIAA  127

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+ LSLP S   I+ ++A   ++LL+  DT+M+GLLTA AS+AA +VY+AH GN  ANW
Sbjct  128  GYMVLSLPFSAATIMSSKATGVKLLLLICDTIMVGLLTAAASAAAAMVYVAHEGNLRANW  187

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              IC  F  FC+RTS ++I SF
Sbjct  188  VPICLQFHGFCQRTSGAVIASF  209



>ref|XP_002881427.1| hypothetical protein ARALYDRAFT_482586 [Arabidopsis lyrata subsp. 
lyrata]
 sp|D7LIN7.1|CASP1_ARALL RecName: Full=Casparian strip membrane protein 1; Short=AlCASP1 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH57686.1| hypothetical protein ARALYDRAFT_482586 [Arabidopsis lyrata subsp. 
lyrata]
Length=203

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++G+A  M T  +TLPF  Q  +F+A YDD   F+ FVI  AIV 
Sbjct  42   LAIFDFLLRLAAIGVTIGAASVMYTAQETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVA  101

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A++AA IVYLAHNGN S NW
Sbjct  102  SYLVLSLPFSIVTIVRPLAVAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNW  161

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S +++ +
Sbjct  162  LPICQQFGDFCQNVSTAVVAA  182



>gb|AEJ82293.1| casparian strip protein 1 [Cloning vector pCASP1::CASP1:mTurquoise]
Length=207

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 92/140 (66%), Gaps = 0/140 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++G+A  M T ++TLPF  Q  +F+A YDD   F+ FVI  A+V 
Sbjct  45   LAIFDFLLRLAAIAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVA  104

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A++AA I YLAHNGN S NW
Sbjct  105  SYLVLSLPFSIVSIVRPHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNW  164

Query  586  PAICQPFQDFCRRTSASLIG  645
              ICQ F DFC+  S +++ 
Sbjct  165  LPICQQFGDFCQNVSTAVVA  184



>sp|P0DH80.1|CASP1_PINTA RecName: Full=Casparian strip membrane protein 1; Short=PtCASP1 
[Pinus taeda]
Length=190

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D +LR++AI  +L +A+AMGT ++TL F  Q F+F A++ +   F  FVI +A V 
Sbjct  25   LAILDFLLRLLAIGATLSAAIAMGTNNETLKFFTQFFQFNARFYNLSAFIYFVIANATVG  84

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SIF I+R RA   R+LLIF DT+M+ + T+GA++A  I+Y+A  GN+  NW
Sbjct  85   LYLLLSLPFSIFDIVRPRAAAFRVLLIFFDTVMVAVCTSGAAAATAIMYVARRGNTKTNW  144

Query  586  PAICQPFQDFCRRTSASLIGSFvaivmllllvllsaialHRSH  714
             +ICQ F  FC + + +L  SF A+V+L+LLVLLSA  LHR  
Sbjct  145  FSICQQFNSFCDQATGALGASFAAVVLLILLVLLSASTLHRQR  187



>ref|NP_181154.1| casparian strip membrane protein 1 [Arabidopsis thaliana]
 sp|Q9SIH4.1|CASP1_ARATH RecName: Full=Casparian strip membrane protein 1; Short=AtCASP1 
[Arabidopsis thaliana]
 gb|AAD26967.1| unknown protein [Arabidopsis thaliana]
 gb|AAO24545.1| At2g36100 [Arabidopsis thaliana]
 dbj|BAF00084.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09206.1| casparian strip membrane protein 1 [Arabidopsis thaliana]
 gb|AEJ82277.1| casparian strip protein 1 [Cloning vector pCASP1::CASP1:GFP]
 gb|AEJ82287.1| casparian strip protein 1 [Cloning vector p35S::CASP1:GFP]
Length=206

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 92/140 (66%), Gaps = 0/140 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++G+A  M T ++TLPF  Q  +F+A YDD   F+ FVI  A+V 
Sbjct  45   LAIFDFLLRLAAIAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVA  104

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A++AA I YLAHNGN S NW
Sbjct  105  SYLVLSLPFSIVSIVRPHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNW  164

Query  586  PAICQPFQDFCRRTSASLIG  645
              ICQ F DFC+  S +++ 
Sbjct  165  LPICQQFGDFCQNVSTAVVA  184



>ref|XP_002882736.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LAP2.1|CASP2_ARALL RecName: Full=Casparian strip membrane protein 2; Short=AlCASP2 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH58995.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +1

Query  292  MGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVCGYLALSLPLSIFHILRTRAEKS  471
            MGT+D+TLPF  Q  +FEA YDD  TF+ FVI  A+V GYL LSLP+S+  ILR  A   
Sbjct  65   MGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPLATAP  124

Query  472  RILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANWPAICQPFQDFCRRTSASLIGSF  651
            R+LL+ LDT ++ L TA ASSAA I YLAH+GN + NW  ICQ F DFC+++S +++ +F
Sbjct  125  RLLLLVLDTAVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAVVSAF  184



>ref|XP_009393394.1| PREDICTED: casparian strip membrane protein VIT_08s0007g02880-like 
[Musa acuminata subsp. malaccensis]
Length=226

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 93/142 (65%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++  D +LR+ AI  +L +A+ MGTTD+TLPF  Q F+F A + D      FV+ +AI  
Sbjct  65   VACFDFLLRLCAIAATLVAAIMMGTTDETLPFFTQFFQFHANFADLPALTFFVVGNAIAA  124

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S+  ++R +A   R+LL  LDT+MM L  A ASSA  IVYLAHNG+S ANW
Sbjct  125  GYLVLSLPFSLAAMIRPQAIGPRLLLFVLDTVMMELTIAAASSATAIVYLAHNGSSKANW  184

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F  FC+  S +++ SF
Sbjct  185  VAICLRFDGFCQSISGAVVASF  206



>sp|Q6Z1Y7.1|CASP2_ORYSJ RecName: Full=Casparian strip membrane protein 2; Short=OsCASP2 
[Oryza sativa Japonica Group]
 dbj|BAD03557.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD33153.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ41220.1| hypothetical protein OsJ_25725 [Oryza sativa Japonica Group]
Length=237

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            + +ID +LRV A   +L +A+++GT+D+ L      F+F A++DDF  F+ F++ +AI  
Sbjct  70   LGLIDFVLRVAAFGPTLAAAISIGTSDERLSVFTNYFQFRARFDDFPAFEFFIVANAIAA  129

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GY+ LSLP S   I+ ++A   ++LL+  DT+M+GLLTA AS+AA +VY+AH GN  ANW
Sbjct  130  GYMVLSLPFSAATIMSSKATGVKLLLLICDTIMVGLLTAAASAAAAMVYVAHEGNLRANW  189

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              IC  F  FC+RTS ++I SF
Sbjct  190  VPICLQFHGFCQRTSGAVIASF  211



>ref|NP_001242417.1| casparian strip membrane protein 2 [Glycine max]
 sp|C6TFL9.1|CASP2_SOYBN RecName: Full=Casparian strip membrane protein 2; Short=GmCASP2 
[Glycine max]
 gb|ACU20621.1| unknown [Glycine max]
Length=194

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q  +FEA YD F +F+ FVI  A+V 
Sbjct  33   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFLQFEASYDSFTSFQFFVITMALVG  92

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S   I+R  A   R+ LI LDT+ + L TA  +SAA IVYLAHNGN  +NW
Sbjct  93   GYLVLSLPFSFVAIIRPHAAGPRLFLIILDTVFLTLTTASGASAAAIVYLAHNGNQDSNW  152

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  153  LAICNQFGDFCAQT  166



>ref|XP_008359498.1| PREDICTED: LOW QUALITY PROTEIN: casparian strip membrane protein 
POPTRDRAFT_763057-like [Malus domestica]
Length=203

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR+ AIV +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  +IV 
Sbjct  41   MAIIDLVLRIGAIVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSIVA  100

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R  A   R+LL+ LD + + L T+ A +A  IVYLAHNGN+S+NW
Sbjct  101  GYLVLSLPFSIVSIVRPHASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNASSNW  160

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFCR  S  ++ SF
Sbjct  161  LAICNQFGDFCRNVSGXVVASF  182



>ref|XP_004242111.1| PREDICTED: casparian strip membrane protein 3-like [Solanum lycopersicum]
Length=210

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            +SI D ILR+ A+  +L +A AMGTT++TLP   Q F+F+A YDD   F  FV+ +AI  
Sbjct  49   LSIFDFILRLCALATTLAAATAMGTTEETLPLFTQFFQFQASYDDLPAFSYFVVANAIAS  108

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             Y+ LSLP SI  I+R      ++LL+ LDT+M+   TA A++AA IVYLA NGNS+  W
Sbjct  109  AYVVLSLPFSIVCIVRPHLVGVKLLLLILDTVMVAFTTAAAAAAAAIVYLAENGNSTTQW  168

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ F DFC+R S +++ SF
Sbjct  169  VAICQQFGDFCQRVSGAVVASF  190



>emb|CDP02251.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 99/142 (70%), Gaps = 4/142 (3%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            IS +DL +R+VA +G+LGSA+A+GT +   PF    FRF A YDD  TF   V+ +AIVC
Sbjct  32   ISKLDLAMRMVAAIGTLGSALAVGTANGAGPFFAGFFRFGAGYDDLPTFTFLVVTNAIVC  91

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSL LSIFHIL++ A  +R++LI LDT+M+  LT GASSAA +V+LAH GN     
Sbjct  92   GYLVLSLLLSIFHILKSSARVTRVILIILDTVMVAYLTGGASSAAAMVHLAHKGNGG---  148

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AICQ    FC R + +L+GSF
Sbjct  149  -AICQQHNSFCDRVAGALVGSF  169



>ref|NP_180305.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9ZQI2.1|CASP3_ARATH RecName: Full=Casparian strip membrane protein 3; Short=AtCASP3 
[Arabidopsis thaliana]
 gb|AAD41993.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15182.1| unknown protein [Arabidopsis thaliana]
 gb|AAO23628.1| At2g27370 [Arabidopsis thaliana]
 dbj|BAE99586.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07986.1| uncharacterized protein AT2G27370 [Arabidopsis thaliana]
 gb|AEJ82279.1| casparian strip protein 3 [Cloning vector pCASP3::CASP3:GFP]
 gb|AEJ82289.1| casparian strip protein 3 [Cloning vector p35S::CASP3:GFP]
Length=221

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR++A + ++ +A  M TT++TLPF  Q  +F+A Y D  T   FVIV++IV 
Sbjct  59   VAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVG  118

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  ILR  A   R+ LI  DT+MMGL    AS++A IVYLAHNGNSS+NW
Sbjct  119  GYLTLSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNW  178

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F DFC+ TS +++ SF
Sbjct  179  LPVCQQFGDFCQGTSGAVVASF  200



>ref|XP_008391938.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057 
[Malus domestica]
Length=205

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++IIDL+LR+ AIV +L +A  MGT+DQ LPF  Q F+FEA YDD  +F+ F+I  ++V 
Sbjct  43   MAIIDLVLRIGAIVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVA  102

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S+  I+R  A   R+LL+ LD + + L T+ A +A  IVYLAHNGNSS+NW
Sbjct  103  GYLVLSLPFSVVCIVRPHASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNSSSNW  162

Query  586  PAICQPFQDFCRRTSASLIGSF  651
             AIC  F DFCR  S +++ SF
Sbjct  163  LAICNQFGDFCRNVSGAVVASF  184



>ref|XP_006295518.1| hypothetical protein CARUB_v10024622mg [Capsella rubella]
 gb|EOA28416.1| hypothetical protein CARUB_v10024622mg [Capsella rubella]
Length=206

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++G+A  M T ++TLPF  Q  +F+A YDD   F+ FV+  AIV 
Sbjct  45   LAIFDFLLRLAAIAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVVAVAIVA  104

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A +AA I YLAHNGN S NW
Sbjct  105  SYLVLSLPFSIVAIVRPLAVAPRLILLICDTLVLTLNTSAAGAAASIDYLAHNGNQSTNW  164

Query  586  PAICQPFQDFCRRTSASLIG  645
              ICQ F DFC+  S +++ 
Sbjct  165  LPICQQFGDFCQNVSTAIVA  184



>gb|AEJ82303.1| casparian strip protein 3 [Cloning vector pScarecrow::CASP3:mCherry]
Length=229

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR++A + ++ +A  M TT++TLPF  Q  +F+A Y D  T   FVIV++IV 
Sbjct  59   VAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVG  118

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  ILR  A   R+ LI  DT+MMGL    AS++A IVYLAHNGNSS+NW
Sbjct  119  GYLTLSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNW  178

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F DFC+ TS +++ SF
Sbjct  179  LPVCQQFGDFCQGTSGAVVASF  200



>sp|P0DI39.1|CASP2_VIGUN RecName: Full=Casparian strip membrane protein 2; Short=VuCASP2 
[Vigna unguiculata]
Length=194

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  33   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVG  92

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S+  I+R  A   R+ LI LDT+ + L TA A+SAA +VYLAHNG+   NW
Sbjct  93   GYLVLSLPFSVVAIIRPHAVGPRLFLIILDTVFLTLATASAASAAAVVYLAHNGDQDTNW  152

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  153  LAICNQFGDFCAQT  166



>ref|XP_006410782.1| hypothetical protein EUTSA_v10017241mg [Eutrema salsugineum]
 gb|ESQ52235.1| hypothetical protein EUTSA_v10017241mg [Eutrema salsugineum]
Length=207

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++ ++  M T ++TLPF  Q  +F+A YDD  TF+ FVI +AIV 
Sbjct  46   LAIFDFLLRLAAIGITIAASSLMFTAEETLPFFTQFLQFQAGYDDDPTFQFFVIATAIVA  105

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R +A   R++L+  DT+++ L TA A++AA IVYLAHNGN++ NW
Sbjct  106  GYLLLSLPFSIVSIVRPQAVAPRLILLISDTVVVTLNTAAAAAAAAIVYLAHNGNANTNW  165

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S +++ +
Sbjct  166  LPICQQFGDFCQAVSTAVVAA  186



>ref|XP_010509510.1| PREDICTED: casparian strip membrane protein 1-like [Camelina 
sativa]
Length=207

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++G+A  M T ++TLPF  Q  +F+A YDD   F+ FVI  AIV 
Sbjct  46   LAIFDFLLRLGAIAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQFFVIAVAIVA  105

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
             YL LSLP SI  I+R  A   R++L+  DT+++ L T+ A++AA IVYLAHNGN + NW
Sbjct  106  SYLVLSLPFSIIAIIRPLAVAPRLVLLICDTLVVTLNTSAAAAAASIVYLAHNGNPNTNW  165

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S +++ +
Sbjct  166  LPICQQFGDFCQNVSTAVVAA  186



>ref|XP_007144399.1| hypothetical protein PHAVU_007G153000g [Phaseolus vulgaris]
 gb|ESW16393.1| hypothetical protein PHAVU_007G153000g [Phaseolus vulgaris]
Length=194

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D ILR+ AI  +LG+A  MGT+DQTLPF  Q F+FEA YD F TF+ FVI  A+V 
Sbjct  33   VAIMDFILRLGAIAAALGAAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVG  92

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP S+  I+R  A   R+ LI LDT+ + L TA A+SAA +VYLAHNG+   NW
Sbjct  93   GYLVLSLPFSVVAIVRPHAVGPRLFLIILDTVFLTLATASAASAAAVVYLAHNGDQDTNW  152

Query  586  PAICQPFQDFCRRT  627
             AIC  F DFC +T
Sbjct  153  LAICNQFGDFCAQT  166



>ref|XP_002880911.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LGW9.1|CASP3_ARALL RecName: Full=Casparian strip membrane protein 3; Short=AlCASP3 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH57170.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=221

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR++A + ++ +A  M TT++TLPF  Q  +F+A+Y D  T   FVIV++IV 
Sbjct  59   VAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQAEYTDLPTMSSFVIVNSIVG  118

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  ILR  A   R+ LI  DT MMGL    AS++A IVYLAHNGNSS+NW
Sbjct  119  GYLTLSLPFSIVCILRPLAVPPRLFLIICDTAMMGLTMMAASASAAIVYLAHNGNSSSNW  178

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F DFC+ TS +++ SF
Sbjct  179  LPVCQQFGDFCQGTSGAVVASF  200



>ref|XP_010510780.1| PREDICTED: casparian strip membrane protein 3-like [Camelina 
sativa]
Length=221

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I+D +LR++A + ++ +A  M TT++TLPF  Q  +F+A Y D  T   FVIV++IV 
Sbjct  59   VAILDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVG  118

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  ILR  A   R+ LI  DT MMGL    AS++A IVYLAHNGNSS+NW
Sbjct  119  GYLTLSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNW  178

Query  586  PAICQPFQDFCRRTSASLIGSF  651
              +CQ F DFC+ TS +++ SF
Sbjct  179  LPVCQQFGDFCQGTSGAVVASF  200



>ref|XP_006410783.1| hypothetical protein EUTSA_v10017240mg [Eutrema salsugineum]
 gb|ESQ52236.1| hypothetical protein EUTSA_v10017240mg [Eutrema salsugineum]
Length=207

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  226  ISIIDLILRVVAIVGSLGSAVAMGTTDQTLPFIIQSFRFEAQYDDFDTFKLFVIVSAIVC  405
            ++I D +LR+ AI  ++ ++  M T ++TLPF  Q  +F+A YDD  TF+ FVI +AIV 
Sbjct  46   LAIFDFLLRLAAIGITIAASSLMFTAEETLPFFTQFLQFQAGYDDDPTFQFFVIATAIVA  105

Query  406  GYLALSLPLSIFHILRTRAEKSRILLIFLDTMMMGLLTagassaagIVYLAHNGNSSANW  585
            GYL LSLP SI  I+R +A   R++L+  DT+++ L TA A++AA IVYLAHNGN++ NW
Sbjct  106  GYLLLSLPFSIVTIVRPQAVAPRLILLISDTVVVTLNTAAAAAAAAIVYLAHNGNANTNW  165

Query  586  PAICQPFQDFCRRTSASLIGS  648
              ICQ F DFC+  S +++ +
Sbjct  166  LPICQQFGDFCQAVSTAVVAA  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1899776125104