BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32775_g1_i1 len=461 path=[439:0-460]

Length=461
                                                                      Score     E

gb|ADV02771.1|  cysteine protease inhibitor                           65.5    1e-10   
gb|ACK87021.1|  cysteine protease inhibitor                           48.5    8e-05   Gossypium hirsutum [American cotton]
gb|ABS52572.1|  cysteine proteinase inhibitor                         48.5    1e-04   Gossypium hirsutum [American cotton]
ref|XP_011084146.1|  PREDICTED: cysteine proteinase inhibitor B       48.5    1e-04   
gb|ACD85810.1|  cystcine proteinase inhibitor                         48.1    1e-04   Gossypium hirsutum [American cotton]
gb|EYU28504.1|  hypothetical protein MIMGU_mgv1a016168mg              47.4    3e-04   
sp|Q10993.1|CYTB_HELAN  RecName: Full=Cysteine proteinase inhibit...  47.0    3e-04   Helianthus annuus
gb|EYU24293.1|  hypothetical protein MIMGU_mgv1a016063mg              46.6    6e-04   
ref|XP_006421050.1|  hypothetical protein CICLE_v10006584mg           46.2    7e-04   



>gb|ADV02771.1| cysteine protease inhibitor [Ipomoea batatas]
Length=134

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPAAAA  304
            EKQVVAGEKY+LTI A   DG Q KT+E+E+ +KP   T  EML F+PAAAA
Sbjct  84   EKQVVAGEKYFLTIKATSEDG-QTKTYESEMWVKPGDETVHEMLNFAPAAAA  134



>gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum]
Length=119

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            EKQVVAG KYYL I A+   GG  KTFE+ +L+KP    +K++L FSP+
Sbjct  72   EKQVVAGIKYYLKIKAM--QGGVTKTFESVVLVKP-WVQSKDLLNFSPS  117



>gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            EKQVVAG KYYL I A+   GG  KTFE+ +L+KP    +K++L FSP+
Sbjct  78   EKQVVAGIKYYLKIKAM--QGGVTKTFESVVLVKP-WVQSKDLLNFSPS  123



>ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum]
Length=131

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            E QV++G KYYL I+AV  DG   +TF+A +++KP    +KE+L F+P+
Sbjct  77   ETQVISGIKYYLKISAVTRDGAPARTFDAVVVVKP-WLHSKELLNFAPS  124



>gb|ACD85810.1| cystcine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            EKQVVAG KYYL I A+   GG  KTFE+ +L+KP    +K++L FSP+
Sbjct  78   EKQVVAGIKYYLEIKAM--QGGVTKTFESVVLVKP-WVQSKDLLKFSPS  123



>gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata]
Length=132

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            E QVV+G KYYL I+A    GG  K+FEA +++KP    +KE++ F+P+
Sbjct  77   ETQVVSGIKYYLKISAATRGGGAAKSFEAVIVVKP-WIHSKELVNFAPS  124



>sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibitor B; AltName: Full=Cystatin-B; 
AltName: Full=SCB [Helianthus annuus]
Length=101

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            E QVVAG KYYL I A+ + GG+MK F+AE++++  +  +K++L F PA
Sbjct  51   ETQVVAGTKYYLKIEAI-TKGGKMKVFDAEVVVQSWK-HSKKLLGFKPA  97



>gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata]
Length=135

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            E QVV+G KYYL I+A    GG  K FEA +++KP    +KE++ F+P+
Sbjct  81   ETQVVSGIKYYLKISAATRGGGPAKNFEAVIVVKP-WIHSKELVNFAPS  128



>ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
 gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
Length=130

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  459  EKQVVAGEKYYLTINAVDSDGGQMKTFEAELLLKPVQTTAKEMLAFSPA  313
            +KQVV+G KYYLTI A   + G+++ F++ +++KP    +KE+L F+P+
Sbjct  82   QKQVVSGIKYYLTIEATTGENGEIQMFDSIVVIKP-WLHSKELLKFAPS  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 531634108022