BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3274_g1_i1 len=152 path=[1:0-92 309:93-151]

Length=152
                                                                      Score     E

emb|CDP20318.1|  unnamed protein product                              66.6    5e-11   
emb|CDP04897.1|  unnamed protein product                              63.9    5e-11   
ref|XP_009598808.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    7e-11   
ref|XP_009598807.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    7e-11   
ref|XP_006343408.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
emb|CDP04889.1|  unnamed protein product                              65.1    1e-10   
emb|CDP22123.1|  unnamed protein product                              65.1    1e-10   
ref|XP_006383953.1|  hypothetical protein POPTR_0004s024002g          62.4    2e-10   
emb|CDP20316.1|  unnamed protein product                              64.7    2e-10   
ref|XP_006373158.1|  hypothetical protein POPTR_0017s09230g           62.4    2e-10   
emb|CDP04893.1|  unnamed protein product                              64.3    3e-10   
ref|XP_009762725.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  63.5    3e-10   
ref|XP_011011557.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
ref|XP_011011560.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.5    6e-10   
ref|XP_006373160.1|  hypothetical protein POPTR_0017s09230g           62.4    7e-10   
ref|XP_006373159.1|  hypothetical protein POPTR_0017s09230g           62.0    7e-10   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...  62.8    1e-09   
ref|XP_011010158.1|  PREDICTED: cysteine-rich receptor-like prote...  62.4    1e-09   
gb|KCW75401.1|  hypothetical protein EUGRSUZ_E04156                   62.0    1e-09   
ref|XP_004496789.1|  PREDICTED: cysteine-rich receptor-like prote...  62.4    1e-09   
ref|XP_004496788.1|  PREDICTED: cysteine-rich receptor-like prote...  62.4    1e-09   
ref|XP_003638035.1|  Cysteine-rich receptor-like protein kinase       62.4    2e-09   
ref|XP_003637976.1|  Cysteine-rich receptor-like protein kinase       62.4    2e-09   
ref|XP_011008149.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.0    2e-09   
ref|XP_002304944.2|  hypothetical protein POPTR_0004s02370g           61.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_002316681.2|  hypothetical protein POPTR_0011s03790g           62.0    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011008148.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.0    2e-09   
ref|XP_007025946.1|  Cysteine-rich protein, putative                  62.0    2e-09   
ref|XP_006603573.1|  PREDICTED: cysteine-rich receptor-like prote...  62.0    2e-09   
ref|XP_002304962.2|  S-locus lectin protein kinase                    62.0    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010644348.1|  PREDICTED: cysteine-rich receptor-like prote...  61.6    2e-09   
ref|XP_002304965.2|  hypothetical protein POPTR_0004s02700g           61.6    3e-09   Populus trichocarpa [western balsam poplar]
emb|CBI29180.3|  unnamed protein product                              61.2    3e-09   
gb|KDO75583.1|  hypothetical protein CISIN_1g010329mg                 61.2    3e-09   
emb|CDP04899.1|  unnamed protein product                              61.6    3e-09   
ref|XP_010059666.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...  61.6    3e-09   
gb|KDO37423.1|  hypothetical protein CISIN_1g005846mg                 61.2    3e-09   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_009357385.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
emb|CBI35672.3|  unnamed protein product                              61.2    3e-09   
ref|XP_009398950.1|  PREDICTED: uncharacterized protein LOC103983462  61.6    3e-09   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_009340921.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg           61.2    3e-09   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                 61.2    3e-09   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    3e-09   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg           61.2    3e-09   
ref|XP_007213903.1|  hypothetical protein PRUPE_ppa003904mg           61.2    3e-09   
ref|XP_006383956.1|  hypothetical protein POPTR_0004s02420g           59.3    4e-09   
emb|CBI39954.3|  unnamed protein product                              58.9    4e-09   
ref|XP_010059510.1|  PREDICTED: uncharacterized protein LOC104447479  61.2    4e-09   
ref|XP_010648190.1|  PREDICTED: cysteine-rich receptor-like prote...  60.8    4e-09   
ref|XP_010648189.1|  PREDICTED: cysteine-rich receptor-like prote...  60.8    4e-09   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057  61.2    4e-09   
ref|XP_010924012.1|  PREDICTED: putative receptor-like protein ki...  60.8    4e-09   
ref|XP_002518554.1|  ATP binding protein, putative                    60.8    5e-09   Ricinus communis
emb|CAN72253.1|  hypothetical protein VITISV_034184                   60.8    5e-09   Vitis vinifera
gb|KCW76231.1|  hypothetical protein EUGRSUZ_D00611                   60.5    6e-09   
ref|XP_006388606.1|  hypothetical protein POPTR_0138s00200g           60.1    6e-09   
gb|KHN02667.1|  Cysteine-rich receptor-like protein kinase 29         60.5    6e-09   
ref|XP_003535666.1|  PREDICTED: cysteine-rich receptor-like prote...  60.5    6e-09   
ref|XP_006449174.1|  hypothetical protein CICLE_v10014386mg           60.5    6e-09   
gb|EYU33571.1|  hypothetical protein MIMGU_mgv1a020014mg              60.5    7e-09   
ref|XP_006467933.1|  PREDICTED: G-type lectin S-receptor-like ser...  60.5    7e-09   
ref|XP_006467932.1|  PREDICTED: G-type lectin S-receptor-like ser...  60.5    7e-09   
gb|KCW75397.1|  hypothetical protein EUGRSUZ_E04151                   60.1    7e-09   
ref|XP_010052297.1|  PREDICTED: cysteine-rich receptor-like prote...  60.5    7e-09   
ref|XP_009338745.1|  PREDICTED: cysteine-rich receptor-like prote...  60.5    7e-09   
gb|KCW76230.1|  hypothetical protein EUGRSUZ_D00611                   60.5    7e-09   
ref|XP_009338737.1|  PREDICTED: cysteine-rich receptor-like prote...  60.5    7e-09   
ref|XP_009338731.1|  PREDICTED: cysteine-rich receptor-like prote...  60.5    7e-09   
ref|XP_011002058.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    7e-09   
gb|KDO37598.1|  hypothetical protein CISIN_1g008238mg                 60.1    7e-09   
ref|XP_011002057.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    8e-09   
ref|XP_003517662.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    8e-09   
ref|XP_002304949.2|  hypothetical protein POPTR_0004s02440g           59.3    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009364708.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    9e-09   
ref|XP_009364729.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    9e-09   
ref|XP_006387144.1|  hypothetical protein POPTR_1704s002002g          59.7    9e-09   
gb|KHN15821.1|  Cysteine-rich receptor-like protein kinase 25         59.7    1e-08   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg           60.1    1e-08   
emb|CAA18466.1|  serine/threonine kinase-like protein                 59.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...  59.7    1e-08   
gb|KHN04839.1|  Cysteine-rich receptor-like protein kinase 10         59.3    1e-08   
ref|XP_003556018.2|  PREDICTED: cysteine-rich receptor-like prote...  59.7    1e-08   
ref|XP_002304956.2|  hypothetical protein POPTR_0004s02490g           58.9    1e-08   Populus trichocarpa [western balsam poplar]
emb|CDX94167.1|  BnaC07g38010D                                        59.7    1e-08   
ref|NP_194050.2|  cysteine-rich receptor-like protein kinase 11       59.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA09731.1|  receptor-like protein kinase, RLK3                   59.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867727.1|  predicted protein                                59.7    1e-08   
ref|XP_006383960.1|  hypothetical protein POPTR_0004s02460g           58.9    1e-08   
gb|KHN15822.1|  Cysteine-rich receptor-like protein kinase 25         59.7    1e-08   
gb|KDO75662.1|  hypothetical protein CISIN_1g0030452mg                58.5    1e-08   
ref|XP_007213623.1|  hypothetical protein PRUPE_ppa002243mg           59.7    1e-08   
gb|KDP20812.1|  hypothetical protein JCGZ_21283                       59.7    1e-08   
gb|KHN40432.1|  Cysteine-rich receptor-like protein kinase 14         59.3    1e-08   
ref|XP_009357560.1|  PREDICTED: cysteine-rich receptor-like prote...  59.3    1e-08   
ref|XP_008224863.1|  PREDICTED: uncharacterized protein LOC103324571  60.1    1e-08   
ref|XP_006287218.1|  hypothetical protein CARUB_v10000395mg           59.3    1e-08   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...  59.3    1e-08   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...  59.3    1e-08   
gb|KFK30807.1|  hypothetical protein AALP_AA6G028400                  59.3    1e-08   
ref|XP_006282816.1|  hypothetical protein CARUB_v10006547mg           59.3    1e-08   
ref|XP_009340924.1|  PREDICTED: cysteine-rich receptor-like prote...  59.3    1e-08   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...  59.3    1e-08   
ref|XP_008224858.1|  PREDICTED: cysteine-rich receptor-like prote...  58.9    2e-08   
ref|XP_006652874.1|  PREDICTED: G-type lectin S-receptor-like ser...  59.3    2e-08   
gb|EYU27870.1|  hypothetical protein MIMGU_mgv1a002421mg              59.3    2e-08   
ref|XP_006383965.1|  hypothetical protein POPTR_0004s02530g           59.3    2e-08   
ref|XP_006383963.1|  hypothetical protein POPTR_0004s02510g           58.9    2e-08   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...  59.3    2e-08   
ref|XP_010907385.1|  PREDICTED: G-type lectin S-receptor-like ser...  59.3    2e-08   
gb|KFK23238.1|  hypothetical protein AALP_AAs43447U000100             58.9    2e-08   
gb|KHG26430.1|  Cysteine-rich receptor-like protein kinase 10         58.9    2e-08   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182  59.3    2e-08   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...  58.9    2e-08   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                   58.9    2e-08   
ref|XP_003556003.1|  PREDICTED: cysteine-rich receptor-like prote...  58.9    2e-08   
ref|XP_010907386.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.9    2e-08   
ref|XP_004957964.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.9    2e-08   
gb|KHN01550.1|  Cysteine-rich receptor-like protein kinase 29         58.5    2e-08   
ref|XP_009136929.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    2e-08   
emb|CDY41246.1|  BnaA01g12930D                                        58.5    2e-08   
ref|NP_001238492.1|  cysteine-rich protein precursor                  58.5    3e-08   
gb|KHN30448.1|  Cysteine-rich receptor-like protein kinase 10         58.5    3e-08   
ref|NP_001053994.1|  Os04g0633200                                     58.9    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008393358.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  57.4    3e-08   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    3e-08   
ref|XP_006285944.1|  hypothetical protein CARUB_v10007464mg           58.5    3e-08   
emb|CDP04752.1|  unnamed protein product                              58.5    3e-08   
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    3e-08   
ref|XP_008803876.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.9    3e-08   
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    3e-08   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25         58.5    3e-08   
ref|XP_010448753.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    3e-08   
ref|XP_003592435.1|  Cysteine-rich receptor-like protein kinase       58.2    3e-08   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    3e-08   
gb|EEC78082.1|  hypothetical protein OsI_17558                        58.5    3e-08   Oryza sativa Indica Group [Indian rice]
gb|EPS66267.1|  hypothetical protein M569_08510                       57.0    3e-08   
emb|CAE02985.2|  OSJNBa0043L09.4                                      58.5    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008803875.1|  PREDICTED: uncharacterized protein LOC103717326  58.5    3e-08   
ref|XP_003592436.1|  Cysteine-rich receptor-like protein kinase       58.2    3e-08   
gb|KHN15831.1|  Cysteine-rich receptor-like protein kinase 29         58.5    3e-08   
ref|XP_004153962.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    4e-08   
ref|XP_008439953.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    4e-08   
gb|KCW75003.1|  hypothetical protein EUGRSUZ_E03765                   58.2    4e-08   
ref|XP_003592434.1|  Cysteine-rich receptor-like protein kinase       58.2    4e-08   
emb|CBI23554.3|  unnamed protein product                              56.2    4e-08   
ref|XP_006383962.1|  hypothetical protein POPTR_0004s02500g           58.2    4e-08   
ref|XP_010089688.1|  Cysteine-rich receptor-like protein kinase 29    58.2    4e-08   
ref|XP_008778305.1|  PREDICTED: putative receptor-like protein ki...  58.2    4e-08   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    4e-08   
gb|AES98412.2|  cysteine-rich receptor-kinase-like protein            58.2    4e-08   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    4e-08   
gb|EMT12460.1|  Putative serine/threonine-protein kinase receptor     58.2    4e-08   
gb|KHN01542.1|  Cysteine-rich receptor-like protein kinase 10         58.2    4e-08   
ref|XP_010240482.1|  PREDICTED: receptor-like serine/threonine-pr...  58.2    4e-08   
ref|XP_010240481.1|  PREDICTED: receptor-like serine/threonine-pr...  58.2    4e-08   
gb|KHN07687.1|  G-type lectin S-receptor-like serine/threonine-pr...  58.2    4e-08   
ref|XP_003615454.1|  Cysteine-rich receptor-like protein kinase       58.2    4e-08   
ref|XP_003528424.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.2    4e-08   
gb|KHN01545.1|  Cysteine-rich receptor-like protein kinase 29         58.2    4e-08   
gb|KFK22120.1|  hypothetical protein AALP_AAs48628U000100             57.4    4e-08   
gb|KCW75002.1|  hypothetical protein EUGRSUZ_E03765                   58.2    4e-08   
emb|CDO99704.1|  unnamed protein product                              58.2    4e-08   
ref|XP_010540876.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    4e-08   
ref|XP_006283296.1|  hypothetical protein CARUB_v10004334mg           58.2    4e-08   
gb|KEH43936.1|  cysteine-rich receptor-kinase-like protein            58.2    4e-08   
ref|XP_006606017.1|  PREDICTED: cysteine-rich receptor-like prote...  58.2    4e-08   
ref|XP_003637984.1|  Cysteine-rich receptor-like protein kinase       58.2    4e-08   
ref|XP_010439210.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    4e-08   
ref|XP_010433941.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_010439209.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_006283252.1|  hypothetical protein CARUB_v10004288mg           57.8    5e-08   
ref|XP_007208684.1|  hypothetical protein PRUPE_ppa026449mg           57.8    5e-08   
gb|KEH43937.1|  cysteine-rich receptor-kinase-like protein            57.8    5e-08   
ref|XP_006467934.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.2    5e-08   
ref|XP_009108049.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
emb|CAH67721.1|  H0613A10.4                                           58.2    5e-08   Oryza sativa [red rice]
emb|CAE02986.2|  OSJNBa0043L09.5                                      58.2    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003637982.1|  Cysteine-rich receptor-like protein kinase       57.8    5e-08   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29         57.8    5e-08   
ref|NP_001053995.1|  Os04g0633300                                     58.2    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004145170.1|  PREDICTED: polygalacturonase-like                58.2    5e-08   
ref|XP_002447171.1|  hypothetical protein SORBIDRAFT_06g029740        58.2    5e-08   Sorghum bicolor [broomcorn]
ref|XP_010492474.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
gb|KCW75001.1|  hypothetical protein EUGRSUZ_E03762                   57.8    5e-08   
ref|XP_002316951.2|  hypothetical protein POPTR_0011s13290g           57.8    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009108048.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  57.8    5e-08   
ref|XP_009417402.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|NP_194054.2|  cysteine-rich receptor-like protein kinase 15       57.4    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006606019.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_004496787.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_007206688.1|  hypothetical protein PRUPE_ppa022095mg           57.8    5e-08   
ref|XP_004496786.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
gb|KDO37169.1|  hypothetical protein CISIN_1g041433mg                 57.4    5e-08   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  58.2    5e-08   
ref|XP_004504969.1|  PREDICTED: uncharacterized protein LOC101504189  58.2    5e-08   
ref|XP_010267803.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_004496785.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
ref|XP_010267802.1|  PREDICTED: putative receptor-like protein ki...  57.8    5e-08   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    5e-08   
tpg|DAA63062.1|  TPA: putative S-locus receptor-like protein kina...  57.8    5e-08   
ref|XP_008651857.1|  PREDICTED: kinase interacting kinase1 isofor...  57.8    5e-08   
ref|XP_006606016.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                   57.8    6e-08   
ref|XP_002869784.1|  hypothetical protein ARALYDRAFT_492546           57.8    6e-08   
ref|XP_010909793.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    6e-08   
gb|KCW75005.1|  hypothetical protein EUGRSUZ_E03767                   57.0    6e-08   
ref|XP_009108047.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
gb|EMT12145.1|  Cysteine-rich receptor-like protein kinase 10         57.8    6e-08   
gb|EEC78083.1|  hypothetical protein OsI_17559                        57.8    6e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006398146.1|  hypothetical protein EUTSA_v10000811mg           57.8    6e-08   
ref|XP_006606020.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    6e-08   
ref|XP_006413571.1|  hypothetical protein EUTSA_v10024630mg           57.8    6e-08   
ref|XP_006606018.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
gb|EEE61757.1|  hypothetical protein OsJ_16297                        57.8    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010529593.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_009417409.1|  PREDICTED: putative receptor-like protein ki...  57.8    6e-08   
ref|XP_010092052.1|  Cysteine-rich receptor-like protein kinase 29    57.4    6e-08   
gb|KFK30805.1|  hypothetical protein AALP_AA6G028200                  57.4    6e-08   
ref|XP_004511333.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_004511332.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_007159234.1|  hypothetical protein PHAVU_002G220500g           57.8    6e-08   
ref|XP_010057745.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_007212629.1|  hypothetical protein PRUPE_ppa016146mg           57.4    6e-08   
ref|XP_004496790.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_003637968.1|  Cysteine-rich receptor-like protein kinase       57.8    6e-08   
ref|XP_009417407.1|  PREDICTED: putative receptor-like protein ki...  57.8    6e-08   
gb|KCW75000.1|  hypothetical protein EUGRSUZ_E03762                   57.8    6e-08   
sp|Q8W4G6.2|CRK15_ARATH  RecName: Full=Cysteine-rich receptor-lik...  57.4    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976939.1|  PREDICTED: receptor-like serine/threonine-pr...  57.8    6e-08   
ref|XP_011096160.1|  PREDICTED: cysteine-rich receptor-like prote...  57.8    6e-08   
ref|XP_010529589.1|  PREDICTED: putative cysteine-rich receptor-l...  57.4    6e-08   
ref|XP_004976938.1|  PREDICTED: receptor-like serine/threonine-pr...  57.8    6e-08   
ref|XP_010320274.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    6e-08   
ref|XP_006356818.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    6e-08   
ref|XP_006464588.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    7e-08   
ref|XP_006356864.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    7e-08   
ref|NP_001105401.1|  kinase interacting kinase1 precursor             57.8    7e-08   Zea mays [maize]
ref|XP_007025949.1|  Cysteine-rich RLK 25                             57.4    7e-08   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...  57.4    7e-08   Vitis vinifera
ref|XP_009417400.1|  PREDICTED: putative receptor-like protein ki...  57.4    7e-08   
ref|XP_010412576.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  57.4    7e-08   
ref|XP_007217906.1|  hypothetical protein PRUPE_ppa017912mg           54.7    7e-08   
emb|CDP16212.1|  unnamed protein product                              57.0    7e-08   
ref|XP_003638028.1|  Cysteine-rich receptor-like protein kinase       57.0    7e-08   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                 57.4    7e-08   
dbj|BAJ88206.1|  predicted protein                                    57.4    7e-08   
ref|XP_010087722.1|  Cysteine-rich receptor-like protein kinase 25    57.4    7e-08   
ref|XP_006589611.1|  PREDICTED: cysteine-rich receptor-like prote...  57.4    7e-08   
ref|XP_010529376.1|  PREDICTED: cysteine-rich receptor-like prote...  57.4    8e-08   
gb|EMS52493.1|  Receptor-like serine/threonine-protein kinase SD1-8   57.4    8e-08   
ref|XP_010427119.1|  PREDICTED: cysteine-rich receptor-like prote...  57.4    8e-08   
gb|KHN02662.1|  Cysteine-rich receptor-like protein kinase 26         57.4    8e-08   
dbj|BAJ94342.1|  predicted protein                                    57.4    8e-08   
gb|KDP20807.1|  hypothetical protein JCGZ_21278                       57.4    8e-08   
ref|XP_010439215.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    8e-08   
ref|XP_008224905.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    8e-08   
ref|XP_002462992.1|  hypothetical protein SORBIDRAFT_02g035940        57.4    8e-08   Sorghum bicolor [broomcorn]
ref|XP_003635308.1|  PREDICTED: cysteine-rich receptor-like prote...  57.4    8e-08   
emb|CBI41018.3|  unnamed protein product                              57.4    8e-08   
gb|EYU27843.1|  hypothetical protein MIMGU_mgv11b018840mg             56.6    9e-08   
ref|XP_010529586.1|  PREDICTED: putative cysteine-rich receptor-l...  57.0    9e-08   
ref|XP_010529585.1|  PREDICTED: putative cysteine-rich receptor-l...  57.0    9e-08   
ref|XP_008349189.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    9e-08   
ref|XP_006283285.1|  hypothetical protein CARUB_v10004321mg           57.0    9e-08   
gb|KHN19788.1|  G-type lectin S-receptor-like serine/threonine-pr...  57.4    9e-08   
emb|CBI23406.3|  unnamed protein product                              57.0    9e-08   
ref|XP_010529590.1|  PREDICTED: putative cysteine-rich receptor-l...  57.0    9e-08   
gb|KDO59868.1|  hypothetical protein CISIN_1g037548mg                 57.0    9e-08   
ref|XP_009418899.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    9e-08   
ref|XP_010923981.1|  PREDICTED: putative receptor-like protein ki...  57.0    9e-08   
ref|XP_006582729.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    9e-08   
ref|XP_006373175.1|  hypothetical protein POPTR_0017s093603g          54.3    9e-08   
gb|KDO40377.1|  hypothetical protein CISIN_1g0034891mg                57.0    9e-08   
ref|XP_006427832.1|  hypothetical protein CICLE_v10027468mg           57.0    9e-08   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483  57.4    9e-08   
ref|XP_007143188.1|  hypothetical protein PHAVU_007G051000g           57.0    9e-08   
gb|KHN01543.1|  Cysteine-rich receptor-like protein kinase 29         57.0    9e-08   
ref|XP_006387003.1|  hypothetical protein POPTR_2259s00200g           54.3    9e-08   
ref|XP_004146620.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    9e-08   
ref|XP_008441094.1|  PREDICTED: uncharacterized protein LOC103485320  57.4    9e-08   
ref|XP_010529377.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    9e-08   
emb|CDY41273.1|  BnaA01g12660D                                        57.0    1e-07   
ref|XP_006595417.1|  PREDICTED: uncharacterized protein LOC100801910  57.4    1e-07   
ref|XP_010646643.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    1e-07   
ref|XP_010686954.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    1e-07   
ref|XP_010529592.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    1e-07   
dbj|BAJ89211.1|  predicted protein                                    55.5    1e-07   
ref|XP_010655951.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
gb|KFK22135.1|  hypothetical protein AALP_AAs39757U000400             57.0    1e-07   
ref|XP_010268928.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...  57.4    1e-07   
ref|XP_004164063.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
emb|CDY10926.1|  BnaA03g45850D                                        56.6    1e-07   
gb|KHN01559.1|  Cysteine-rich receptor-like protein kinase 26         57.0    1e-07   
gb|EMT27820.1|  Putative serine/threonine-protein kinase receptor     57.0    1e-07   
ref|XP_008439932.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
ref|XP_006388607.1|  hypothetical protein POPTR_0138s00210g           56.6    1e-07   
ref|XP_008234313.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  57.0    1e-07   
ref|XP_006606013.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    1e-07   
ref|XP_006449133.1|  hypothetical protein CICLE_v10014789mg           56.6    1e-07   
gb|KHN01558.1|  Cysteine-rich receptor-like protein kinase 26         57.0    1e-07   
ref|XP_008784491.1|  PREDICTED: putative receptor-like protein ki...  57.0    1e-07   
ref|XP_003571425.1|  PREDICTED: receptor-like serine/threonine-pr...  57.0    1e-07   
ref|XP_008441097.1|  PREDICTED: uncharacterized protein LOC103485324  57.0    1e-07   
ref|XP_008439931.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
ref|XP_007208249.1|  hypothetical protein PRUPE_ppa016784mg           56.6    1e-07   
gb|AES63664.2|  G-type lectin S-receptor-like Serine/Threonine-ki...  57.0    1e-07   
ref|XP_003593413.1|  Cysteine-rich receptor-like protein kinase       57.0    1e-07   
ref|XP_006655441.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_010646879.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
emb|CDY01595.1|  BnaC07g35850D                                        56.6    1e-07   
ref|XP_010655950.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_007148274.1|  hypothetical protein PHAVU_006G194500g           57.0    1e-07   
ref|XP_002518555.1|  ATP binding protein, putative                    56.6    1e-07   
ref|XP_008363254.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
gb|EYU27837.1|  hypothetical protein MIMGU_mgv1a002310mg              56.6    1e-07   
ref|XP_002316621.2|  hypothetical protein POPTR_0011s03270g           56.6    1e-07   
ref|XP_010999534.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
gb|KHN01544.1|  Cysteine-rich receptor-like protein kinase 8          56.6    1e-07   
emb|CAN70165.1|  hypothetical protein VITISV_024701                   57.0    1e-07   
ref|XP_010315042.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    1e-07   
ref|XP_006287210.1|  hypothetical protein CARUB_v10000385mg           56.6    1e-07   
ref|XP_004496784.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g           56.6    1e-07   
emb|CBI35335.3|  unnamed protein product                              56.6    1e-07   
gb|KCW75435.1|  hypothetical protein EUGRSUZ_E04197                   56.6    1e-07   
ref|NP_194059.1|  putative cysteine-rich receptor-like protein ki...  56.6    1e-07   
ref|XP_004496782.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_007025958.1|  Cysteine-rich RLK 29, putative                   56.6    1e-07   
sp|O65479.2|CRK20_ARATH  RecName: Full=Putative cysteine-rich rec...  56.6    1e-07   
ref|XP_004496783.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_008370581.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  56.2    1e-07   
gb|KCW74344.1|  hypothetical protein EUGRSUZ_E03020                   56.6    1e-07   
ref|NP_001059942.1|  Os07g0551300                                     56.6    1e-07   
emb|CAJ86027.1|  B0808H03.4                                           56.6    1e-07   
ref|XP_004295385.1|  PREDICTED: uncharacterized protein LOC101312912  57.0    1e-07   
gb|AAN15371.1|  serine/threonine kinase - like protein                56.2    1e-07   
ref|XP_010059142.1|  PREDICTED: putative cysteine-rich receptor-l...  56.6    1e-07   
emb|CDY53873.1|  BnaCnng25670D                                        56.6    1e-07   
ref|XP_010059683.1|  PREDICTED: putative cysteine-rich receptor-l...  56.6    1e-07   
gb|EEE61756.1|  hypothetical protein OsJ_16295                        56.6    1e-07   
gb|EEC78081.1|  hypothetical protein OsI_17557                        56.6    1e-07   
ref|XP_010059143.1|  PREDICTED: putative cysteine-rich receptor-l...  56.6    1e-07   
ref|XP_008363596.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    1e-07   
ref|XP_008355366.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    1e-07   
ref|XP_009137325.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_007157183.1|  hypothetical protein PHAVU_002G049400g           56.6    1e-07   
ref|XP_002524721.1|  S-locus-specific glycoprotein S6 precursor, ...  56.6    1e-07   
ref|XP_010913053.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
gb|KEH22682.1|  S-locus lectin kinase family protein                  56.6    1e-07   
ref|XP_010448759.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    1e-07   
ref|XP_002515717.1|  ATP binding protein, putative                    56.6    1e-07   
ref|XP_010059136.1|  PREDICTED: putative cysteine-rich receptor-l...  56.6    2e-07   
ref|XP_003596526.1|  Cysteine-rich receptor-like protein kinase       56.6    2e-07   
gb|KHN19086.1|  G-type lectin S-receptor-like serine/threonine-pr...  56.6    2e-07   
emb|CDP05828.1|  unnamed protein product                              56.6    2e-07   
gb|EEC78084.1|  hypothetical protein OsI_17562                        56.6    2e-07   
ref|XP_010451237.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_004514286.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    2e-07   
gb|EEE67374.1|  hypothetical protein OsJ_24675                        56.6    2e-07   
ref|XP_010913052.1|  PREDICTED: cysteine-rich receptor-like prote...  56.6    2e-07   
ref|XP_009108591.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
emb|CDX76348.1|  BnaA08g10520D                                        56.2    2e-07   
gb|KEH22681.1|  S-locus lectin kinase family protein                  56.6    2e-07   
ref|XP_010448745.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010448744.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
emb|CAN73041.1|  hypothetical protein VITISV_044351                   56.2    2e-07   
ref|XP_008345158.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    2e-07   
gb|KGN49169.1|  hypothetical protein Csa_6G516770                     56.2    2e-07   
ref|XP_010426013.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_003555319.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010529370.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_004513529.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  56.2    2e-07   
ref|XP_010448733.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010439199.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
gb|KHG01974.1|  Cysteine-rich receptor-like protein kinase 26         56.2    2e-07   
ref|XP_004295380.1|  PREDICTED: uncharacterized protein LOC101310880  56.6    2e-07   
ref|XP_008230156.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
sp|Q8H199.2|CRK14_ARATH  RecName: Full=Cysteine-rich receptor-lik...  56.2    2e-07   
ref|XP_002274577.2|  PREDICTED: putative receptor-like protein ki...  56.2    2e-07   
ref|XP_006856952.1|  hypothetical protein AMTR_s01216p00000700        56.2    2e-07   
ref|XP_003536563.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687  56.6    2e-07   
ref|XP_003638011.1|  Cysteine-rich receptor-like protein kinase       56.2    2e-07   
ref|XP_006286468.1|  hypothetical protein CARUB_v10000413mg           56.2    2e-07   
ref|XP_006658677.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_006283286.1|  hypothetical protein CARUB_v10004325mg           56.2    2e-07   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...  56.2    2e-07   
ref|XP_007143159.1|  hypothetical protein PHAVU_007G048800g           56.2    2e-07   
ref|NP_567680.4|  cysteine-rich receptor-like protein kinase 14       56.2    2e-07   
ref|XP_002867724.1|  kinase family protein                            56.2    2e-07   
ref|XP_006589610.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010448767.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010430440.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010448301.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_004134964.1|  PREDICTED: uncharacterized protein LOC101207147  56.6    2e-07   
gb|EEE61755.1|  hypothetical protein OsJ_16293                        56.2    2e-07   
ref|XP_010448732.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
gb|EEC78079.1|  hypothetical protein OsI_17555                        56.2    2e-07   
emb|CBI39957.3|  unnamed protein product                              55.8    2e-07   
ref|XP_006838093.1|  hypothetical protein AMTR_s00106p00032210        55.8    2e-07   
ref|XP_010448731.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010439198.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|NP_001053990.1|  Os04g0632500                                     56.2    2e-07   
gb|AAM90696.1|AF403128_1  S-locus receptor-like kinase RLK11          56.2    2e-07   
ref|XP_004169144.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_010240979.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
emb|CAA18469.1|  serine/threonine kinase-like protein                 56.2    2e-07   
ref|XP_002316624.2|  hypothetical protein POPTR_0011s03220g           56.2    2e-07   
gb|KHN37219.1|  G-type lectin S-receptor-like serine/threonine-pr...  56.2    2e-07   
ref|XP_010448766.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_010539037.1|  PREDICTED: putative cysteine-rich receptor-l...  56.2    2e-07   
ref|XP_010539046.1|  PREDICTED: putative cysteine-rich receptor-l...  56.2    2e-07   
gb|KEH43963.1|  cysteine-rich receptor-kinase-like protein            56.2    2e-07   
ref|XP_003637963.1|  Cysteine-rich receptor-like protein kinase       56.2    2e-07   
ref|XP_010686956.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
gb|EYU27838.1|  hypothetical protein MIMGU_mgv1a002249mg              56.2    2e-07   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g           56.2    2e-07   
emb|CBI39959.3|  unnamed protein product                              55.8    2e-07   
ref|XP_011002059.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_010240476.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    2e-07   
ref|XP_003541083.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_006291259.1|  hypothetical protein CARUB_v10017391mg           55.5    2e-07   
gb|KCW75396.1|  hypothetical protein EUGRSUZ_E04150                   55.8    2e-07   
gb|KEH43951.1|  cysteine-rich receptor-kinase-like protein            55.8    2e-07   
ref|XP_007025951.1|  Cysteine-rich RLK 25                             56.2    2e-07   
ref|XP_003580624.2|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
dbj|BAJ87407.1|  predicted protein                                    55.8    2e-07   
ref|XP_004496792.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
gb|EMT09591.1|  Putative serine/threonine-protein kinase receptor     56.2    2e-07   
ref|XP_010686945.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_003637940.1|  Cysteine-rich receptor-like protein kinase       55.8    2e-07   
ref|XP_007216507.1|  hypothetical protein PRUPE_ppa025419mg           55.8    2e-07   
ref|XP_006291260.1|  hypothetical protein CARUB_v10017391mg           55.5    2e-07   
ref|XP_004134968.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    2e-07   
ref|XP_008377957.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  55.8    2e-07   
ref|XP_009108593.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29         55.8    2e-07   
ref|XP_006606026.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_010540889.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_010646640.1|  PREDICTED: putative receptor-like protein ki...  55.8    2e-07   
gb|KCW74338.1|  hypothetical protein EUGRSUZ_E03010                   55.5    2e-07   
ref|XP_004973067.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
gb|KEH43956.1|  cysteine-rich receptor-kinase-like protein            55.8    2e-07   
emb|CDY46371.1|  BnaA09g19850D                                        55.8    2e-07   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_007021220.1|  S-locus lectin protein kinase family protein...  55.8    2e-07   
ref|XP_008371201.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_009377332.1|  PREDICTED: uncharacterized protein LOC103965953  56.2    2e-07   
ref|XP_008345852.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
gb|KHN15823.1|  Cysteine-rich receptor-like protein kinase 10         55.8    2e-07   
ref|XP_006606025.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_008377959.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
ref|XP_008355945.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
gb|EYU33574.1|  hypothetical protein MIMGU_mgv1a0256212mg             55.8    2e-07   
ref|XP_006396890.1|  hypothetical protein EUTSA_v10028491mg           55.8    2e-07   
ref|XP_010661208.1|  PREDICTED: putative receptor-like protein ki...  55.8    2e-07   
ref|XP_010436426.1|  PREDICTED: uncharacterized protein LOC104720171  56.2    2e-07   
ref|XP_008364117.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  55.8    2e-07   
ref|XP_010999536.1|  PREDICTED: putative receptor-like protein ki...  55.8    2e-07   
ref|XP_008371138.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    2e-07   
emb|CDX94168.1|  BnaC07g38020D                                        55.8    2e-07   
ref|XP_010661211.1|  PREDICTED: putative receptor-like protein ki...  55.8    2e-07   
ref|XP_010999535.1|  PREDICTED: putative receptor-like protein ki...  55.8    3e-07   
gb|KHN02669.1|  Cysteine-rich receptor-like protein kinase 29         55.8    3e-07   
ref|XP_002304960.2|  hypothetical protein POPTR_0004s02640g           55.8    3e-07   
ref|XP_009367024.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
gb|KHN45742.1|  G-type lectin S-receptor-like serine/threonine-pr...  55.8    3e-07   
gb|KHN02670.1|  Cysteine-rich receptor-like protein kinase 25         55.8    3e-07   
emb|CAI44641.1|  OSJNBb0015D13.18                                     56.2    3e-07   
emb|CAJ86025.1|  B0808H03.2                                           56.2    3e-07   
gb|KDP20811.1|  hypothetical protein JCGZ_21282                       56.2    3e-07   
gb|EYU33576.1|  hypothetical protein MIMGU_mgv1a003061mg              55.8    3e-07   
gb|EYU23766.1|  hypothetical protein MIMGU_mgv1a021757mg              55.5    3e-07   
ref|XP_009109107.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
ref|XP_009109099.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
ref|XP_009109092.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
ref|XP_010932139.1|  PREDICTED: cysteine-rich receptor-like prote...  55.1    3e-07   
emb|CDY39507.1|  BnaA01g24810D                                        55.8    3e-07   
gb|KFK22702.1|  hypothetical protein AALP_AAs67984U000400             55.5    3e-07   
ref|XP_006283340.1|  hypothetical protein CARUB_v10004380mg           55.8    3e-07   
ref|XP_006286770.1|  hypothetical protein CARUB_v10003321mg           55.8    3e-07   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g           55.8    3e-07   
ref|XP_006590217.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
emb|CAN62393.1|  hypothetical protein VITISV_021304                   55.5    3e-07   
ref|XP_009137321.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
ref|XP_008372181.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    3e-07   
ref|XP_004134966.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
ref|XP_008245043.1|  PREDICTED: cysteine-rich receptor-like prote...  55.5    3e-07   
ref|XP_010418086.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
ref|XP_010418085.1|  PREDICTED: cysteine-rich receptor-like prote...  55.8    3e-07   
gb|KCW74351.1|  hypothetical protein EUGRSUZ_E03027                   55.8    3e-07   
ref|XP_007025926.1|  Cysteine-rich RLK 29, putative isoform 2         55.5    3e-07   



>emb|CDP20318.1| unnamed protein product [Coffea canephora]
Length=678

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ++L+WSRR+KII GIARGLLYLHEDSRL
Sbjct  440  FDPEKQHMLDWSRRYKIIAGIARGLLYLHEDSRL  473



>emb|CDP04897.1| unnamed protein product [Coffea canephora]
Length=247

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +DP+KQ LL+WSRR+KII GIARGLLYLHEDSRL
Sbjct  6    VDPEKQPLLDWSRRYKIIGGIARGLLYLHEDSRL  39



>ref|XP_009598808.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Nicotiana tomentosiformis]
Length=540

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ+LL WSRR+KII GIARGLLYLHEDSRL
Sbjct  300  FDPEKQHLLNWSRRYKIIGGIARGLLYLHEDSRL  333



>ref|XP_009598807.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Nicotiana tomentosiformis]
Length=675

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ+LL WSRR+KII GIARGLLYLHEDSRL
Sbjct  435  FDPEKQHLLNWSRRYKIIGGIARGLLYLHEDSRL  468



>ref|XP_006343408.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=662

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WSRR+KII GIARGLLYLHEDSRL
Sbjct  424  FDPEKQQLLDWSRRYKIIGGIARGLLYLHEDSRL  457



>emb|CDP04889.1| unnamed protein product [Coffea canephora]
Length=495

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WSRR+KII GIARGLLYLHEDSRL
Sbjct  416  FDPEKQPLLDWSRRYKIIGGIARGLLYLHEDSRL  449



>emb|CDP22123.1| unnamed protein product, partial [Coffea canephora]
Length=541

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WSRR+KII GIARGLLYLHEDSRL
Sbjct  462  FDPEKQPLLDWSRRYKIIGGIARGLLYLHEDSRL  495



>ref|XP_006383953.1| hypothetical protein POPTR_0004s024002g, partial [Populus trichocarpa]
 gb|ERP61750.1| hypothetical protein POPTR_0004s024002g, partial [Populus trichocarpa]
Length=211

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            F  L ++DP++Q LL+WSRR+KII GIARG+LYLHEDSRL
Sbjct  107  FCFLDFIDPERQGLLDWSRRYKIIGGIARGILYLHEDSRL  146



>emb|CDP20316.1| unnamed protein product [Coffea canephora]
Length=670

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+R+KII GIARGLLYLHEDSRL
Sbjct  435  FDPEKQQLLDWSKRYKIITGIARGLLYLHEDSRL  468



>ref|XP_006373158.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
 gb|ERP50955.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
Length=257

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+R+KII GIARG+LYLHEDSRL
Sbjct  178  FDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRL  211



>emb|CDP04893.1| unnamed protein product [Coffea canephora]
Length=556

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WSRRFKII GIA+GLLYLHEDSRL
Sbjct  316  FDPEKQPLLDWSRRFKIIGGIAKGLLYLHEDSRL  349



>ref|XP_009762725.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10, partial [Nicotiana sylvestris]
Length=404

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL WSRR+KII GIARGLLYLHEDSRL
Sbjct  164  FDPEKQQLLNWSRRYKIIGGIARGLLYLHEDSRL  197



>ref|XP_011011557.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Populus euphratica]
Length=839

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ LL+WS+RF II GIARGLLYLH DSRL
Sbjct  618  FDPDKQALLDWSKRFAIIEGIARGLLYLHRDSRL  651



>ref|XP_011011560.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Populus euphratica]
Length=849

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ LL+WS+RF II GIARGLLYLH DSRL
Sbjct  618  FDPDKQALLDWSKRFAIIEGIARGLLYLHRDSRL  651



>ref|XP_006373160.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
 gb|ERP50957.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
Length=419

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+R+KII GIARG+LYLHEDSRL
Sbjct  178  FDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRL  211



>ref|XP_006373159.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
 gb|ERP50956.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
Length=334

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+R+KII GIARG+LYLHEDSRL
Sbjct  178  FDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRL  211



>ref|XP_009340926.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=705

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +  DP+KQ  L+WSRRFKII GIARG++YLHEDSRL
Sbjct  464  LLFDPEKQGQLDWSRRFKIISGIARGIMYLHEDSRL  499



>ref|XP_011010158.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+R+KII GIARG+LYLHEDSRL
Sbjct  434  FDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRL  467



>gb|KCW75401.1| hypothetical protein EUGRSUZ_E04156 [Eucalyptus grandis]
Length=429

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L WSRR+KII GIARG+LYLHEDSRL
Sbjct  286  FDPDKRRQLNWSRRYKIISGIARGMLYLHEDSRL  319



>ref|XP_004496789.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Cicer arietinum]
Length=670

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W+RR+KIIRGIARG+ YLHEDSRL
Sbjct  438  ILFDPEKQSGLDWTRRYKIIRGIARGIQYLHEDSRL  473



>ref|XP_004496788.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=675

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W+RR+KIIRGIARG+ YLHEDSRL
Sbjct  443  ILFDPEKQSGLDWTRRYKIIRGIARGIQYLHEDSRL  478



>ref|XP_003638035.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=657

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ LL+W+RR+KII GIARG+ YLHEDSRL
Sbjct  434  ILFDPEKQRLLDWTRRYKIIGGIARGIQYLHEDSRL  469



>ref|XP_003637976.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|KEH43946.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=661

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ LL+W+RR+KII GIARG+ YLHEDSRL
Sbjct  438  ILFDPEKQRLLDWTRRYKIIGGIARGIQYLHEDSRL  473



>ref|XP_011008149.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X2 [Populus euphratica]
Length=735

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LLEW++RF+II GIARGLLYLH DSRL
Sbjct  611  FDPEKQGLLEWNKRFEIIEGIARGLLYLHRDSRL  644



>ref|XP_002304944.2| hypothetical protein POPTR_0004s02370g [Populus trichocarpa]
 gb|EEE85455.2| hypothetical protein POPTR_0004s02370g [Populus trichocarpa]
Length=403

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q LL+WSRR+KII GIARG+LYLHEDSRL
Sbjct  161  FDPERQGLLDWSRRYKIIGGIARGILYLHEDSRL  194



>ref|XP_002316681.2| hypothetical protein POPTR_0011s03790g [Populus trichocarpa]
 gb|EEE97293.2| hypothetical protein POPTR_0011s03790g [Populus trichocarpa]
Length=805

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LLEW++RF+II GIARGLLYLH DSRL
Sbjct  574  FDPEKQGLLEWNKRFEIIEGIARGLLYLHRDSRL  607



>ref|XP_011008148.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Populus euphratica]
Length=850

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LLEW++RF+II GIARGLLYLH DSRL
Sbjct  611  FDPEKQGLLEWNKRFEIIEGIARGLLYLHRDSRL  644



>ref|XP_007025946.1| Cysteine-rich protein, putative [Theobroma cacao]
 gb|EOY28568.1| Cysteine-rich protein, putative [Theobroma cacao]
Length=664

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARGLLYLHEDSRL
Sbjct  423  FDPEKQGNLDWSRRYKIIGGIARGLLYLHEDSRL  456



>ref|XP_006603573.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=710

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KIIRGIARGLLYLHEDSRL
Sbjct  455  VPNKSLDYFIF---DPTKKARLDWDRRYKIIRGIARGLLYLHEDSRL  498



>ref|XP_002304962.2| S-locus lectin protein kinase [Populus trichocarpa]
 gb|EEE85473.2| S-locus lectin protein kinase [Populus trichocarpa]
Length=846

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+RF II GIARGLLYLH DSRL
Sbjct  615  FDPEKQALLDWSKRFAIIEGIARGLLYLHRDSRL  648



>ref|XP_010644348.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=507

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  420  FDPDKRGQLDWSRRYKIIGGIARGILYLHEDSRL  453



>ref|XP_002304965.2| hypothetical protein POPTR_0004s02700g [Populus trichocarpa]
 gb|EEE85476.2| hypothetical protein POPTR_0004s02700g [Populus trichocarpa]
Length=836

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WS+RF II GIARGLLYLH DSRL
Sbjct  615  FDPEKQALLDWSKRFAIIEGIARGLLYLHRDSRL  648



>emb|CBI29180.3| unnamed protein product [Vitis vinifera]
Length=523

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  283  FDPDKRGQLDWSRRYKIIGGIARGILYLHEDSRL  316



>gb|KDO75583.1| hypothetical protein CISIN_1g010329mg [Citrus sinensis]
Length=513

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  466



>emb|CDP04899.1| unnamed protein product [Coffea canephora]
Length=644

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ LL+WSRR KII GIARG+LYLHEDSRL
Sbjct  403  FDPEKQPLLDWSRRCKIIGGIARGVLYLHEDSRL  436



>ref|XP_010059666.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=451

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L WSRR+KII GIARG+LYLHEDSRL
Sbjct  242  FDPDKRRQLNWSRRYKIISGIARGMLYLHEDSRL  275



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  420  FDPDKRGQLDWSRRYKIIGGIARGILYLHEDSRL  453



>gb|KDO37423.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=571

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  466



>ref|XP_010646899.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=668

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ  L+WSRR+KII GIARG+LYLHEDS+L
Sbjct  429  FDPDKQGQLDWSRRYKIIGGIARGILYLHEDSQL  462



>ref|XP_008384459.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=658

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  419  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRL  452



>ref|XP_009357385.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=662

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  423  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRL  456



>emb|CBI35672.3| unnamed protein product [Vitis vinifera]
Length=699

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ  L+WSRR+KII GIARG+LYLHEDS+L
Sbjct  460  FDPDKQGQLDWSRRYKIIGGIARGILYLHEDSQL  493



>ref|XP_009398950.1| PREDICTED: uncharacterized protein LOC103983462 [Musa acuminata 
subsp. malaccensis]
Length=1341

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DP+++ LL+W+RR+KII GIARGLLYLHEDSRL
Sbjct  1099  FDPNRRGLLDWARRYKIIEGIARGLLYLHEDSRL  1132


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+++  L+W+RR+KII GIARGLLYLHEDSRL
Sbjct  430  FDPNRRGSLDWARRYKIIEGIARGLLYLHEDSRL  463



>ref|XP_008340068.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=668

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  429  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRL  462



>ref|XP_009340921.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=670

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  431  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRL  464



>ref|XP_008363779.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=678

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  439  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRL  472



>ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
 gb|ESR62360.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
Length=671

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  431  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  463



>gb|KDO37422.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=674

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  466



>ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=674

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  466



>ref|XP_006449119.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
 gb|ESR62359.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
Length=674

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  434  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  466



>ref|XP_007213903.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
 gb|EMJ15102.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
Length=541

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  302  FDPEKQGQLDWSRRYKIIAGIARGIMYLHEDSRL  335



>ref|XP_006383956.1| hypothetical protein POPTR_0004s02420g [Populus trichocarpa]
 gb|ERP61753.1| hypothetical protein POPTR_0004s02420g [Populus trichocarpa]
Length=249

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q LL+WSRR+KII GIARG+LYLHEDSRL
Sbjct  109  FDPERQGLLDWSRRYKIIGGIARGILYLHEDSRL  142



>emb|CBI39954.3| unnamed protein product [Vitis vinifera]
Length=249

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            ++ DPDKQ  L WSR++KII GIARG+L+LHEDSRL
Sbjct  168  LHQDPDKQGQLNWSRQYKIIGGIARGILFLHEDSRL  203



>ref|XP_010059510.1| PREDICTED: uncharacterized protein LOC104447479 [Eucalyptus grandis]
Length=1330

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DPDK+  L+WSRR+KII GIARG+LYLHEDSR 
Sbjct  1092  FDPDKRRQLDWSRRYKIISGIARGMLYLHEDSRF  1125


 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K   L+WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  427  FDPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRL  460



>ref|XP_010648190.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=681

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ  L+WSRR+ II GIARG+LYLHEDSRL
Sbjct  441  FDPDKQGQLDWSRRYNIIGGIARGVLYLHEDSRL  474



>ref|XP_010648189.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=682

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ  L+WSRR+ II GIARG+LYLHEDSRL
Sbjct  442  FDPDKQGQLDWSRRYNIIGGIARGVLYLHEDSRL  475



>ref|XP_006468228.1| PREDICTED: uncharacterized protein LOC102629057 [Citrus sinensis]
Length=1332

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99    DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  1092  DPEKQGQLDWSRRYKIIGGIARGILYLHEDSRL  1124



>ref|XP_010924012.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=663

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  QHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            QH+   +  ++ DP K  LL+W RR+KII+GIARGLLYLHEDS+L
Sbjct  417  QHNTSLDKFLF-DPMKNRLLDWGRRYKIIKGIARGLLYLHEDSKL  460



>ref|XP_002518554.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43941.1| ATP binding protein, putative [Ricinus communis]
Length=579

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  435  FDPEKQAQLDWSRRYKIIGGIARGIVYLHEDSRL  468



>emb|CAN72253.1| hypothetical protein VITISV_034184 [Vitis vinifera]
Length=655

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDKQ  L+WSRR+ II GIARG+LYLHEDSRL
Sbjct  415  FDPDKQGQLDWSRRYMIIGGIARGILYLHEDSRL  448



>gb|KCW76231.1| hypothetical protein EUGRSUZ_D00611 [Eucalyptus grandis]
Length=576

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +PDK+  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  444  FEPDKRGKLDWSRRYKIISGIARGMLYLHEDSRL  477



>ref|XP_006388606.1| hypothetical protein POPTR_0138s00200g [Populus trichocarpa]
 gb|ERP47520.1| hypothetical protein POPTR_0138s00200g [Populus trichocarpa]
Length=505

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL WS R+KII GIARGLLYLHEDSRL
Sbjct  265  FDPAKQGLLNWSSRYKIIGGIARGLLYLHEDSRL  298



>gb|KHN02667.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=696

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F I    DP+K+  L W RR+ IIRGIARGLLYLHEDSRL
Sbjct  438  VPNKSLDFFIF---DPNKRGNLNWERRYNIIRGIARGLLYLHEDSRL  481



>ref|XP_003535666.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Glycine max]
Length=696

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F I    DP+K+  L W RR+ IIRGIARGLLYLHEDSRL
Sbjct  438  VPNKSLDFFIF---DPNKRGNLNWERRYNIIRGIARGLLYLHEDSRL  481



>ref|XP_006449174.1| hypothetical protein CICLE_v10014386mg [Citrus clementina]
 gb|ESR62414.1| hypothetical protein CICLE_v10014386mg [Citrus clementina]
Length=748

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L   DP KQ LL+W++RF II GIARGLLYLH DSRL
Sbjct  514  LFIFDPAKQALLDWTKRFAIIEGIARGLLYLHRDSRL  550



>gb|EYU33571.1| hypothetical protein MIMGU_mgv1a020014mg [Erythranthe guttata]
Length=808

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            LI  DP K  LL+W RRF II GIARGL+YLH+DSRL
Sbjct  574  LILFDPRKTMLLDWPRRFNIINGIARGLMYLHQDSRL  610



>ref|XP_006467933.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X2 [Citrus sinensis]
Length=852

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L   DP KQ LL+W++RF II GIARGLLYLH DSRL
Sbjct  620  LFIFDPAKQALLDWTKRFAIIEGIARGLLYLHRDSRL  656



>ref|XP_006467932.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X1 [Citrus sinensis]
Length=854

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L   DP KQ LL+W++RF II GIARGLLYLH DSRL
Sbjct  620  LFIFDPAKQALLDWTKRFAIIEGIARGLLYLHRDSRL  656



>gb|KCW75397.1| hypothetical protein EUGRSUZ_E04151 [Eucalyptus grandis]
Length=461

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DPDK+  L+WSRR+KI+ G+ARG+LYLHEDSR 
Sbjct  271  DPDKRRQLDWSRRYKIVSGVARGMLYLHEDSRF  303



>ref|XP_010052297.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=662

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +PDK+  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  424  FEPDKRGKLDWSRRYKIISGIARGMLYLHEDSRL  457



>ref|XP_009338745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X3 [Pyrus x bretschneideri]
Length=649

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  426  FDPERQGQLDWSRRYKIISGIARGIMYLHEDSRL  459



>gb|KCW76230.1| hypothetical protein EUGRSUZ_D00611 [Eucalyptus grandis]
Length=682

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +PDK+  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  444  FEPDKRGKLDWSRRYKIISGIARGMLYLHEDSRL  477



>ref|XP_009338737.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=650

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  426  FDPERQGQLDWSRRYKIISGIARGIMYLHEDSRL  459



>ref|XP_009338731.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=665

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  426  FDPERQGQLDWSRRYKIISGIARGIMYLHEDSRL  459



>ref|XP_011002058.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Populus euphratica]
Length=588

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL WS R+KII GIARGLLYLHEDSRL
Sbjct  428  FDPAKQGLLNWSSRYKIIGGIARGLLYLHEDSRL  461



>gb|KDO37598.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=573

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P+KQ  L+WSRR+KII GIARG+LYLHEDSRL
Sbjct  435  EPEKQQQLDWSRRYKIIGGIARGILYLHEDSRL  467



>ref|XP_011002057.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Populus euphratica]
Length=668

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL WS R+KII GIARGLLYLHEDSRL
Sbjct  428  FDPAKQGLLNWSSRYKIIGGIARGLLYLHEDSRL  461



>ref|XP_003517662.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=674

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KII+GIARGLLYLHEDSRL
Sbjct  419  VPNKSLDYFIF---DPTKKARLDWDRRYKIIQGIARGLLYLHEDSRL  462



>ref|XP_002304949.2| hypothetical protein POPTR_0004s02440g [Populus trichocarpa]
 gb|EEE85460.2| hypothetical protein POPTR_0004s02440g [Populus trichocarpa]
Length=354

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q LL+WSRR+KII GIA G+LYLHEDSRL
Sbjct  146  FDPERQGLLDWSRRYKIIGGIALGILYLHEDSRL  179



>ref|XP_009364708.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=650

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR++II GIARG++YLHEDSRL
Sbjct  413  FDPEKQGQLDWSRRYQIISGIARGIMYLHEDSRL  446



>ref|XP_009364729.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=653

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR++II GIARG++YLHEDSRL
Sbjct  416  FDPEKQGQLDWSRRYQIISGIARGIMYLHEDSRL  449



>ref|XP_006387144.1| hypothetical protein POPTR_1704s002002g, partial [Populus trichocarpa]
 gb|ERP46058.1| hypothetical protein POPTR_1704s002002g, partial [Populus trichocarpa]
Length=524

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L+P KQ LL WS R+KII GIARGLLYLHEDSRL
Sbjct  390  LNPAKQGLLNWSSRYKIIGGIARGLLYLHEDSRL  423



>gb|KHN15821.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=592

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W+RR+KI+ GIARG+ YLHEDSRL
Sbjct  351  ILFDPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRL  386



>ref|XP_007211369.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
 gb|EMJ12568.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
Length=663

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG++YLHEDSRL
Sbjct  424  FDPEKQGQLDWARRYKIIAGIARGIMYLHEDSRL  457



>emb|CAA18466.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB79274.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
Length=570

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  424  FDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRL  457



>ref|XP_003556014.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 2 [Glycine max]
Length=666

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W+RR+KI+ GIARG+ YLHEDSRL
Sbjct  425  ILFDPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRL  460



>gb|KHN04839.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=457

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KII+GIARGLLYLHEDSRL
Sbjct  202  VPNKSLDYFIF---DPTKKARLDWDRRYKIIQGIARGLLYLHEDSRL  245



>ref|XP_003556018.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 1 [Glycine max]
Length=707

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W+RR+KI+ GIARG+ YLHEDSRL
Sbjct  466  ILFDPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRL  501



>ref|XP_002304956.2| hypothetical protein POPTR_0004s02490g [Populus trichocarpa]
 gb|EEE85467.2| hypothetical protein POPTR_0004s02490g [Populus trichocarpa]
Length=332

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q LL+WSRR+KII GIARG+LYLHEDSRL
Sbjct  90   FDPERQGLLDWSRRYKIIGGIARGILYLHEDSRL  123



>emb|CDX94167.1| BnaC07g38010D [Brassica napus]
Length=653

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP KQ  L+WSRR+KII GIARG+LYLH+DSRL
Sbjct  406  VPNESLDYFIF---DPVKQCQLDWSRRYKIISGIARGILYLHQDSRL  449



>ref|NP_194050.2| cysteine-rich receptor-like protein kinase 11 [Arabidopsis thaliana]
 sp|Q9ZP16.2|CRK11_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 11; 
Short=Cysteine-rich RLK11; AltName: Full=Receptor-like protein 
kinase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE84720.1| cysteine-rich receptor-like protein kinase 11 [Arabidopsis thaliana]
Length=667

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  436  FDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRL  469



>emb|CAA09731.1| receptor-like protein kinase, RLK3 [Arabidopsis thaliana]
Length=667

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  436  FDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRL  469



>ref|XP_002867727.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43986.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=674

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  440  FDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRL  473



>ref|XP_006383960.1| hypothetical protein POPTR_0004s02460g [Populus trichocarpa]
 gb|ERP61757.1| hypothetical protein POPTR_0004s02460g [Populus trichocarpa]
Length=332

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q LL+WSRR+KII GIARG+LYLHEDSRL
Sbjct  90   FDPERQGLLDWSRRYKIIGGIARGILYLHEDSRL  123



>gb|KHN15822.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=855

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W+RR+KI+ GIARG+ YLHEDSRL
Sbjct  438  ILFDPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRL  473



>gb|KDO75662.1| hypothetical protein CISIN_1g0030452mg, partial [Citrus sinensis]
Length=301

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L   DP KQ LL+W++RF II GIARGLLYLH DSRL
Sbjct  67   LFIFDPAKQALLDWTKRFAIIEGIARGLLYLHRDSRL  103



>ref|XP_007213623.1| hypothetical protein PRUPE_ppa002243mg [Prunus persica]
 gb|EMJ14822.1| hypothetical protein PRUPE_ppa002243mg [Prunus persica]
Length=697

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F      DP KQ LL+W RRF II GIARGLLYLH DSRL
Sbjct  454  MPNKSLDF---FLFDPSKQALLDWRRRFAIIEGIARGLLYLHRDSRL  497



>gb|KDP20812.1| hypothetical protein JCGZ_21283 [Jatropha curcas]
Length=673

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K+ +L+WSRR+KII GIARG+LYLH+DSRL
Sbjct  430  FDPEKRGVLDWSRRYKIIGGIARGILYLHQDSRL  463



>gb|KHN40432.1| Cysteine-rich receptor-like protein kinase 14 [Glycine soja]
Length=538

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KII+GIARGLLYLHEDSRL
Sbjct  283  VPNKSLDYFIF---DPTKKARLDWDRRYKIIQGIARGLLYLHEDSRL  326



>ref|XP_009357560.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=564

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDS+L
Sbjct  325  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQL  358



>ref|XP_008224863.1| PREDICTED: uncharacterized protein LOC103324571 [Prunus mume]
Length=1411

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG++YLHEDSRL
Sbjct  435  FDPEKQGQLDWARRYKIIAGIARGIMYLHEDSRL  468



>ref|XP_006287218.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
 gb|EOA20116.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
Length=669

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+WSRR+ II GIARG+LYLH+DSRL
Sbjct  431  FDPTKQPLLDWSRRYHIIGGIARGILYLHQDSRL  464



>ref|XP_008358736.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDS+L
Sbjct  425  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQL  458



>ref|XP_009357380.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=671

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDS+L
Sbjct  432  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQL  465



>gb|KFK30807.1| hypothetical protein AALP_AA6G028400 [Arabis alpina]
Length=663

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP KQ  L+W+RRFKII GIARG+LYLH+DSRL
Sbjct  427  DPAKQAQLDWTRRFKIIGGIARGILYLHQDSRL  459



>ref|XP_006282816.1| hypothetical protein CARUB_v10006547mg [Capsella rubella]
 gb|EOA15714.1| hypothetical protein CARUB_v10006547mg [Capsella rubella]
Length=669

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+W++R+ II+GI RG+LYLHEDSRL
Sbjct  428  FDPTKQVLLDWTKRYNIIKGITRGILYLHEDSRL  461



>ref|XP_009340924.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=693

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDS+L
Sbjct  455  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQL  488



>ref|XP_009340923.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=694

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDS+L
Sbjct  455  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQL  488



>ref|XP_008224858.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Prunus mume]
Length=424

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG++YLHEDSRL
Sbjct  185  FDPEKQGQLDWARRYKIIAGIARGIMYLHEDSRL  218



>ref|XP_006652874.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Oryza brachyantha]
Length=811

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP  +Y+L+W  RFKII+G+ARGL+YLHEDSRL
Sbjct  582  FDPASKYILDWPTRFKIIKGVARGLVYLHEDSRL  615



>gb|EYU27870.1| hypothetical protein MIMGU_mgv1a002421mg [Erythranthe guttata]
Length=677

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L+WS+RF II GIARGLLYLH DSRL
Sbjct  445  FDPDKKAQLDWSKRFNIIEGIARGLLYLHRDSRL  478



>ref|XP_006383965.1| hypothetical protein POPTR_0004s02530g [Populus trichocarpa]
 gb|ERP61762.1| hypothetical protein POPTR_0004s02530g [Populus trichocarpa]
Length=683

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL WS R+KII GIARGL+YLHEDSRL
Sbjct  428  FDPAKQGLLNWSSRYKIIGGIARGLIYLHEDSRL  461



>ref|XP_006383963.1| hypothetical protein POPTR_0004s02510g, partial [Populus trichocarpa]
 gb|ERP61760.1| hypothetical protein POPTR_0004s02510g, partial [Populus trichocarpa]
Length=505

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+WS R+KII GIARGLLYLH+DSRL
Sbjct  426  FDPGKQGLLDWSIRYKIIGGIARGLLYLHQDSRL  459



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG+LYLHEDS+L
Sbjct  424  FDPEKQGQLDWTRRYKIISGIARGILYLHEDSQL  457



>ref|XP_010907385.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Elaeis guineensis]
Length=846

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL+W +RF II+GIARGLLYLH+DSRL
Sbjct  614  FDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRL  647



>gb|KFK23238.1| hypothetical protein AALP_AAs43447U000100 [Arabis alpina]
Length=571

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+WSRR+KII GIARG+LYLH+DSRL
Sbjct  334  FDPAKQGQLDWSRRYKIIGGIARGILYLHQDSRL  367



>gb|KHG26430.1| Cysteine-rich receptor-like protein kinase 10 [Gossypium arboreum]
Length=661

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  421  FDPAKQGQLDWLRRYKIIEGIARGLLYLHEDSRL  454



>ref|XP_010247032.1| PREDICTED: uncharacterized protein LOC104590182 [Nelumbo nucifera]
Length=1289

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DP+++ LL+W +R+KII GIARGLLYLHEDSRL
Sbjct  1060  FDPERRALLDWEKRYKIIGGIARGLLYLHEDSRL  1093


 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP +  LL+W +R+KIIRGIARGLLYLHEDS L
Sbjct  412  FDPARCTLLDWEKRYKIIRGIARGLLYLHEDSPL  445



>ref|XP_010057978.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Eucalyptus 
grandis]
 gb|KCW75398.1| hypothetical protein EUGRSUZ_E04152 [Eucalyptus grandis]
Length=666

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K   L+WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  428  FDPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRL  461



>gb|KCW75004.1| hypothetical protein EUGRSUZ_E03766 [Eucalyptus grandis]
Length=666

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K   L+WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  428  FDPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRL  461



>ref|XP_003556003.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=672

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KII+GIARGLLYLHEDSRL
Sbjct  430  LPNRSLDYFIF---DPIKRLNLDWERRYKIIQGIARGLLYLHEDSRL  473



>ref|XP_010907386.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X2 [Elaeis guineensis]
Length=693

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL+W +RF II+GIARGLLYLH+DSRL
Sbjct  614  FDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRL  647



>ref|XP_004957964.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Setaria italica]
Length=864

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +P+KQ LL+WS+RF II GIARGLLYLH DSRL
Sbjct  633  FNPEKQELLDWSKRFDIIEGIARGLLYLHRDSRL  666



>gb|KHN01550.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=578

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KII+GIARGLLYLHEDSRL
Sbjct  336  LPNRSLDYFIF---DPIKRLNLDWERRYKIIQGIARGLLYLHEDSRL  379



>ref|XP_009136929.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brassica 
rapa]
Length=668

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+WSRR+KII G+ARG+LYLH+DSRL
Sbjct  429  FDPAKQAQLDWSRRYKIIGGVARGILYLHQDSRL  462



>emb|CDY41246.1| BnaA01g12930D [Brassica napus]
Length=668

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+WSRR+KII G+ARG+LYLH+DSRL
Sbjct  429  FDPAKQAQLDWSRRYKIIGGVARGILYLHQDSRL  462



>ref|NP_001238492.1| cysteine-rich protein precursor [Glycine max]
 gb|ACM89479.1| cysteine-rich protein [Glycine max]
Length=667

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W RR+KII GIARG+ YLHEDSRL
Sbjct  430  ILFDPEKQRELDWGRRYKIIGGIARGIQYLHEDSRL  465



>gb|KHN30448.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=669

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W RR+KII GIARG+ YLHEDSRL
Sbjct  432  ILFDPEKQRELDWGRRYKIIGGIARGIQYLHEDSRL  467



>ref|NP_001053994.1| Os04g0633200 [Oryza sativa Japonica Group]
 dbj|BAF15908.1| Os04g0633200 [Oryza sativa Japonica Group]
Length=887

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L+  DP  +Y L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  655  LVSEDPASKYALDWPTRFKIIKGVARGLLYLHQDSRL  691



>ref|XP_008393358.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10, partial [Malus domestica]
Length=276

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDSRL
Sbjct  41   FDPEKQRQLDWSRRYKIISGIARGIMYLHEDSRL  74



>ref|XP_008349286.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WSRR+KII GIARG++YLHEDS L
Sbjct  425  FDPEKQGQLDWSRRYKIISGIARGIMYLHEDSXL  458



>ref|XP_006285944.1| hypothetical protein CARUB_v10007464mg [Capsella rubella]
 gb|EOA18842.1| hypothetical protein CARUB_v10007464mg [Capsella rubella]
Length=666

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  429  FDPTKQAQLDWTRRYKIIGGIARGILYLHQDSRL  462



>emb|CDP04752.1| unnamed protein product [Coffea canephora]
Length=690

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D  KQ LL+W RR+KII GIARGLLYLHEDSRL
Sbjct  443  FDSKKQQLLDWLRRYKIIGGIARGLLYLHEDSRL  476



>ref|XP_009357379.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=669

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WS R+KII GIARG++YLHEDSRL
Sbjct  430  FDPEKQGQLDWSTRYKIISGIARGIMYLHEDSRL  463



>ref|XP_008803876.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120, partial [Phoenix dactylifera]
Length=1610

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL+W +RF II+GIARGLLYLH+DSRL
Sbjct  608  FDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRL  641


 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DP K+ LL+W +RF II+GIARGLLYLH+DSRL
Sbjct  1457  FDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRL  1490



>ref|XP_010247617.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=690

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L+W  R+KII GIARGLLYLHEDSRL
Sbjct  445  FDPDKRACLDWPTRYKIIGGIARGLLYLHEDSRL  478



>gb|KHG16271.1| Cysteine-rich receptor-like protein kinase 25 [Gossypium arboreum]
Length=662

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WS R+KII G+ARG+LYLHEDSRL
Sbjct  422  FDPEKQAQLDWSTRYKIIVGVARGILYLHEDSRL  455



>ref|XP_010448753.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=656

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  421  FDPEKQGQLDWTRRYKIIGGVARGILYLHQDSRL  454



>ref|XP_003592435.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES62686.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=562

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K + + W RR+KII GIARG+LYLHEDSRL
Sbjct  430  FDPEKAHQINWPRRYKIIEGIARGMLYLHEDSRL  463



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG++YLHEDS+L
Sbjct  437  FDPEKQGQLDWTRRYKIISGIARGIMYLHEDSQL  470



>gb|EEC78082.1| hypothetical protein OsI_17558 [Oryza sativa Indica Group]
Length=818

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+  E  I+ DP  +Y L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  599  LPNKSL--EAFIF-DPASKYALDWPTRFKIIKGVARGLLYLHQDSRL  642



>gb|EPS66267.1| hypothetical protein M569_08510, partial [Genlisea aurea]
Length=295

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K+ LL+W RR+KII+GIARGLLYLHEDSRL
Sbjct  176  FDPEKRSLLDWKRRWKIIQGIARGLLYLHEDSRL  209



>emb|CAE02985.2| OSJNBa0043L09.4 [Oryza sativa Japonica Group]
 gb|EAZ32101.1| hypothetical protein OsJ_16296 [Oryza sativa Japonica Group]
Length=838

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+  E  I+ DP  +Y L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  599  LPNKSL--EAFIF-DPASKYALDWPTRFKIIKGVARGLLYLHQDSRL  642



>ref|XP_008803875.1| PREDICTED: uncharacterized protein LOC103717326 [Phoenix dactylifera]
Length=2211

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DP K+ LL+W +RF II+GIARGLLYLH+DSRL
Sbjct  1868  FDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRL  1901


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D  K+ LL+W  R+ II GIARGLLYLH DSRL
Sbjct  607  FDSRKKGLLDWKTRYNIIEGIARGLLYLHRDSRL  640



>ref|XP_003592436.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES62687.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=673

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K + + W RR+KII GIARG+LYLHEDSRL
Sbjct  430  FDPEKAHQINWPRRYKIIEGIARGMLYLHEDSRL  463



>gb|KHN15831.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=1343

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DP K+  L+W RR+KII GI+RGLLYLHEDSRL
Sbjct  1109  FDPIKRLFLDWERRYKIIEGISRGLLYLHEDSRL  1142


 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSR  4
             DP K+  L+W  R+KII GIARGLLYLHEDS+
Sbjct  434  FDPIKRAHLDWKTRYKIIEGIARGLLYLHEDSQ  466



>ref|XP_004153962.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like, 
partial [Cucumis sativus]
Length=633

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            IP  S+ F      DP +Q  L+W +R+KII GIARG+LYLHEDSRL
Sbjct  387  IPNKSLNF---FLFDPKRQRELDWLKRYKIIHGIARGMLYLHEDSRL  430



>ref|XP_008439953.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis 
melo]
Length=722

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D +K+ LL+W RR+KII GIARGLLYLHEDSRL
Sbjct  486  FDFEKRILLDWGRRYKIINGIARGLLYLHEDSRL  519



>gb|KCW75003.1| hypothetical protein EUGRSUZ_E03765 [Eucalyptus grandis]
Length=570

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K   L WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  490  FDPEKSKQLNWSRRYKIVCGIARGMLYLHEDSRL  523



>ref|XP_003592434.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=801

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K + + W RR+KII GIARG+LYLHEDSRL
Sbjct  430  FDPEKAHQINWPRRYKIIEGIARGMLYLHEDSRL  463



>emb|CBI23554.3| unnamed protein product [Vitis vinifera]
Length=247

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  2    FDPIKRAQLDWDRRYKIIGGIARGLLYLHEDSRL  35



>ref|XP_006383962.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
 gb|ERP61759.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
Length=673

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+W  R+KII GIARGLLYLHEDSRL
Sbjct  433  FDPAKQGLLDWLSRYKIIGGIARGLLYLHEDSRL  466



>ref|XP_010089688.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB38211.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=679

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  433  FDPSKRANLDWERRYKIIGGIARGLLYLHEDSRL  466



>ref|XP_008778305.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=719

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  QHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            QH+   +  ++ DP K  LL+W RR+KII GIARGLLYLH+DS+L
Sbjct  459  QHNTSLDKFLF-DPMKNRLLDWGRRYKIIEGIARGLLYLHQDSQL  502



>ref|XP_003556004.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform 1 [Glycine max]
Length=687

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ +  L+W+ R+KIIRGIARGLLYLHEDSRL
Sbjct  431  VPNKSLDYFIF---DPNMKAQLDWNSRYKIIRGIARGLLYLHEDSRL  474



>gb|AES98412.2| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=553

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W +R+KII+GIARG+LYLHEDSRL
Sbjct  421  VPNKSLDYFIF---DPTKKAQLDWEKRYKIIKGIARGVLYLHEDSRL  464



>ref|XP_011007635.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D ++Q LL+WS+R+KII GIARG+LYLHEDSRL
Sbjct  433  FDSERQGLLDWSKRYKIIGGIARGILYLHEDSRL  466



>gb|EMT12460.1| Putative serine/threonine-protein kinase receptor [Aegilops tauschii]
Length=850

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  144  VIPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +  Q+ +    L++ D  ++ LL+WS RF II+G+ARGLLYLH+DSRL
Sbjct  606  ITSQNILFLTFLLFTDDSRKLLLDWSTRFNIIKGVARGLLYLHQDSRL  653



>gb|KHN01542.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=549

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ +  L+W  R+KIIRGIARGLLYLHEDSRL
Sbjct  322  VPNKSLDYFIF---DPNMKAQLDWKSRYKIIRGIARGLLYLHEDSRL  365



>ref|XP_010240482.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X2 [Brachypodium distachyon]
Length=788

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            LI  D  ++Y L+WS RFK+I+GIARGLLYLH+DSRL
Sbjct  555  LIMKDVARKYELDWSTRFKVIKGIARGLLYLHQDSRL  591



>ref|XP_010240481.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X1 [Brachypodium distachyon]
Length=789

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            LI  D  ++Y L+WS RFK+I+GIARGLLYLH+DSRL
Sbjct  556  LIMKDVARKYELDWSTRFKVIKGIARGLLYLHQDSRL  592



>gb|KHN07687.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Glycine soja]
Length=849

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RRF+II GIARGLLYLH+DSRL
Sbjct  619  FDPVKQTQLDWARRFEIIEGIARGLLYLHQDSRL  652



>ref|XP_003615454.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=585

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W +R+KII+GIARG+LYLHEDSRL
Sbjct  453  VPNKSLDYFIF---DPTKKAQLDWEKRYKIIKGIARGVLYLHEDSRL  496



>ref|XP_003528424.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Glycine max]
Length=849

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RRF+II GIARGLLYLH+DSRL
Sbjct  619  FDPVKQTQLDWARRFEIIEGIARGLLYLHQDSRL  652



>gb|KHN01545.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=612

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ +  L+W  R+KIIRGIARGLLYLHEDSRL
Sbjct  370  VPNKSLDYFIF---DPNMKAQLDWESRYKIIRGIARGLLYLHEDSRL  413



>gb|KFK22120.1| hypothetical protein AALP_AAs48628U000100, partial [Arabis alpina]
Length=392

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+WSRR+KII GIARG+LYLH+DSRL
Sbjct  155  FDPAKQGQLDWSRRYKIIGGIARGILYLHQDSRL  188



>gb|KCW75002.1| hypothetical protein EUGRSUZ_E03765 [Eucalyptus grandis]
Length=728

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+K   L WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  490  FDPEKSKQLNWSRRYKIVCGIARGMLYLHEDSRL  523



>emb|CDO99704.1| unnamed protein product [Coffea canephora]
Length=1313

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP++Q +L+WSRR+ II G+A+GLLYLHEDSRL
Sbjct  425  FDPERQPVLDWSRRYNIIGGLAKGLLYLHEDSRL  458


 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  93    DKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +KQ  L+WS R KII+GIARGLLYLHEDSRL
Sbjct  1084  EKQQTLDWSTRHKIIKGIARGLLYLHEDSRL  1114



>ref|XP_010540876.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Tarenaya 
hassleriana]
Length=649

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  408  FDPSKQGELDWTRRYKIIGGIARGILYLHQDSRL  441



>ref|XP_006283296.1| hypothetical protein CARUB_v10004334mg [Capsella rubella]
 gb|EOA16194.1| hypothetical protein CARUB_v10004334mg [Capsella rubella]
Length=649

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K  +L+WSRR+ II GIARG+LYLH+DSRL
Sbjct  420  FDPTKHEILDWSRRYNIIEGIARGILYLHQDSRL  453



>gb|KEH43936.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=653

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL WS+R KII+G+ARG+LYLHEDSRL
Sbjct  440  FDPQKRKLLSWSQRQKIIKGVARGILYLHEDSRL  473



>ref|XP_006606017.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=702

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+K+  L W  R+KIIRGIARGLLYLHEDSRL
Sbjct  443  VPNKSLDYFIF---DPNKRVNLNWEIRYKIIRGIARGLLYLHEDSRL  486



>ref|XP_003637984.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 ref|XP_003638027.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=657

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL WS+R KII+G+ARG+LYLHEDSRL
Sbjct  444  FDPQKRKLLSWSQRQKIIKGVARGILYLHEDSRL  477



>ref|XP_010439210.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Camelina sativa]
Length=620

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F      DP KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  373  VPNKSLDF---FLFDPAKQGQLDWTRRYKIIGGVARGILYLHQDSRL  416



>ref|XP_010433941.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=661

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F      DP KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  416  VPNKSLDF---FLFDPAKQGQLDWTRRYKIIGGVARGILYLHQDSRL  459



>ref|XP_010439209.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Camelina sativa]
Length=666

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F      DP KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  419  VPNKSLDF---FLFDPAKQGQLDWTRRYKIIGGVARGILYLHQDSRL  462



>ref|XP_006283252.1| hypothetical protein CARUB_v10004288mg [Capsella rubella]
 gb|EOA16150.1| hypothetical protein CARUB_v10004288mg [Capsella rubella]
Length=679

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+KII GIARG+LYLH+DSRL
Sbjct  442  FDPTKQGQLDWARRYKIIGGIARGILYLHQDSRL  475



>ref|XP_007208684.1| hypothetical protein PRUPE_ppa026449mg [Prunus persica]
 gb|EMJ09883.1| hypothetical protein PRUPE_ppa026449mg [Prunus persica]
Length=568

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K+  L+W RR+KI+ GIARGLLYLHEDSRL
Sbjct  355  IIFDPTKRAQLDWVRRYKIVVGIARGLLYLHEDSRL  390



>gb|KEH43937.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=620

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL WS+R KII+GIARG+LYLHEDSRL
Sbjct  386  FDPHKRKLLPWSQRQKIIKGIARGILYLHEDSRL  419



>ref|XP_006467934.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X3 [Citrus sinensis]
Length=847

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +E +   +P KQ LL+W++RF II GIARGLLYLH DSRL
Sbjct  610  YEYMPNKNPAKQALLDWTKRFAIIEGIARGLLYLHRDSRL  649



>ref|XP_009108049.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X3 [Brassica rapa]
Length=532

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +  DP+KQ  L+W+RR+ II G+ARG+LYLH+DSRL
Sbjct  427  VLFDPEKQVHLDWTRRYNIIGGVARGILYLHQDSRL  462



>emb|CAH67721.1| H0613A10.4 [Oryza sativa Indica Group]
Length=814

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP  +++L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  585  FDPASKFILDWPTRFKIIKGVARGLLYLHQDSRL  618



>emb|CAE02986.2| OSJNBa0043L09.5 [Oryza sativa Japonica Group]
Length=814

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP  +++L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  585  FDPASKFILDWPTRFKIIKGVARGLLYLHQDSRL  618



>ref|XP_003637982.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 ref|XP_003638025.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|KEH43938.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=667

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+ LL WS+R KII+GIARG+LYLHEDSRL
Sbjct  433  FDPHKRKLLPWSQRQKIIKGIARGILYLHEDSRL  466



>gb|KHN01547.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=672

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ +  L+W  R+KIIRGIARGLLYLHEDSRL
Sbjct  416  VPNKSLDYFIF---DPNMKAQLDWKSRYKIIRGIARGLLYLHEDSRL  459



>ref|NP_001053995.1| Os04g0633300 [Oryza sativa Japonica Group]
 dbj|BAF15909.1| Os04g0633300 [Oryza sativa Japonica Group]
Length=832

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP  +++L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  670  FDPASKFILDWPTRFKIIKGVARGLLYLHQDSRL  703



>ref|XP_004145170.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=1594

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            IP  S+ F      DP +Q  L+W +R+KII GIARG+LYLHEDSRL
Sbjct  409  IPNKSLNF---FLFDPKRQRELDWLKRYKIIHGIARGMLYLHEDSRL  452


 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = -3

Query  141   IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             IP  S+ F   +  D + Q  L W +R++II GIARG+LYLHEDSRL
Sbjct  1386  IPNKSLDF---LLFDEEGQKQLNWLKRYRIINGIARGILYLHEDSRL  1429



>ref|XP_002447171.1| hypothetical protein SORBIDRAFT_06g029740 [Sorghum bicolor]
 gb|EES11499.1| hypothetical protein SORBIDRAFT_06g029740 [Sorghum bicolor]
Length=837

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  D  ++YLL+W  RFKII+G++RGLLYLH+DSRL
Sbjct  606  IIFDAARKYLLDWPTRFKIIKGVSRGLLYLHQDSRL  641



>ref|XP_010492474.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Camelina 
sativa]
Length=657

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+K+I GIARG+LYLHEDSRL
Sbjct  429  FDPVKQGQLDWTRRYKVIGGIARGILYLHEDSRL  462



>gb|KCW75001.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=507

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K   L+WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  427  FDPKKSKELDWSRRYKIVCGIARGMLYLHEDSRL  460



>ref|XP_002316951.2| hypothetical protein POPTR_0011s13290g [Populus trichocarpa]
 gb|EEE97563.2| hypothetical protein POPTR_0011s13290g [Populus trichocarpa]
Length=674

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F I    D  K  LL+WSRRF II GIARGLLYLH+DSRL
Sbjct  585  MPNRSLDFFIF---DETKGRLLDWSRRFNIISGIARGLLYLHQDSRL  628



>ref|XP_009108048.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Brassica rapa]
Length=569

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +  DP+KQ  L+W+RR+ II G+ARG+LYLH+DSRL
Sbjct  427  VLFDPEKQVHLDWTRRYNIIGGVARGILYLHQDSRL  462



>ref|XP_008370580.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=661

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+WS R+KII GIARG++YLHEDSRL
Sbjct  422  FDPEKQGQLDWSIRYKIISGIARGIMYLHEDSRL  455



>ref|XP_009417402.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Musa 
acuminata subsp. malaccensis]
Length=547

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K   L W RR+KII GIARGLLYLHEDSRL
Sbjct  398  ILFDPTKCGQLNWERRYKIIEGIARGLLYLHEDSRL  433



>ref|NP_194054.2| cysteine-rich receptor-like protein kinase 15 [Arabidopsis thaliana]
 gb|AAL32647.1| putative protein [Arabidopsis thaliana]
 gb|AAM91196.1| putative protein [Arabidopsis thaliana]
 gb|AEE84726.1| cysteine-rich receptor-like protein kinase 15 [Arabidopsis thaliana]
Length=507

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+K+I GIARG+LYLH+DSRL
Sbjct  303  FDPAKQNQLDWTRRYKVIGGIARGILYLHQDSRL  336



>ref|XP_006606019.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
isoform X2 [Glycine max]
Length=592

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ +  L W RR+ IIRGIARGLLYLHEDSRL
Sbjct  430  VPNKSLDYFIF---DPNNRVNLNWERRYNIIRGIARGLLYLHEDSRL  473



>ref|XP_004496787.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X3 [Cicer arietinum]
Length=653

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L WS R+ II+GIARG+LYLHEDSRL
Sbjct  424  FDPQKQKQLTWSERYNIIKGIARGILYLHEDSRL  457



>ref|XP_007206688.1| hypothetical protein PRUPE_ppa022095mg [Prunus persica]
 gb|EMJ07887.1| hypothetical protein PRUPE_ppa022095mg [Prunus persica]
Length=705

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K+  L+W RR+KI+ GIARGLLYLHEDSRL
Sbjct  459  IIFDPTKRAQLDWVRRYKIVVGIARGLLYLHEDSRL  494



>ref|XP_004496786.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Cicer arietinum]
Length=656

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L WS R+ II+GIARG+LYLHEDSRL
Sbjct  424  FDPQKQKQLTWSERYNIIKGIARGILYLHEDSRL  457



>gb|KDO37169.1| hypothetical protein CISIN_1g041433mg, partial [Citrus sinensis]
Length=470

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP+KQ  L+WSRR+KII  IARG+LYLHEDSRL
Sbjct  349  DPEKQGQLDWSRRYKIIGLIARGILYLHEDSRL  381



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            IP  S+ F      DP +Q  L+W +R+KII GIARG+LYLHEDSRL
Sbjct  394  IPNKSLNF---FLFDPKRQRELDWLKRYKIIHGIARGMLYLHEDSRL  437


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  90    KQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             KQ LL+W +RF II GIARGLLYLH DSRL
Sbjct  2654  KQKLLDWRKRFNIINGIARGLLYLHRDSRL  2683



>ref|XP_004504969.1| PREDICTED: uncharacterized protein LOC101504189 [Cicer arietinum]
Length=1717

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F      DP KQ  L+W+RRF+II GIARGLLYLH DSRL
Sbjct  612  MPNKSLDF---FLFDPVKQTKLDWTRRFEIIEGIARGLLYLHRDSRL  655


 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  108   IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             I  +  K+ LL+W RRFKII GIARGLLYLH+DSR 
Sbjct  1482  ILFNKTKRALLDWQRRFKIICGIARGLLYLHQDSRF  1517



>ref|XP_010267803.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 isoform 
X2 [Nelumbo nucifera]
Length=671

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  433  FDPIKRVQLDWERRYKIIGGIARGLLYLHEDSRL  466



>ref|XP_004496785.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=671

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L WS R+ II+GIARG+LYLHEDSRL
Sbjct  424  FDPQKQKQLTWSERYNIIKGIARGILYLHEDSRL  457



>ref|XP_010267802.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=673

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  435  FDPIKRVQLDWERRYKIIGGIARGLLYLHEDSRL  468



>ref|XP_008224765.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP+KQ  L+W+RR+KII GIARG++YLHEDS+L
Sbjct  440  FDPEKQGHLDWARRYKIIAGIARGIMYLHEDSQL  473



>tpg|DAA63062.1| TPA: putative S-locus receptor-like protein kinase family protein 
[Zea mays]
Length=863

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +P+KQ LL+W +RF II GIARGLLYLH DSRL
Sbjct  631  FNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRL  664



>ref|XP_008651857.1| PREDICTED: kinase interacting kinase1 isoform X1 [Zea mays]
Length=864

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +P+KQ LL+W +RF II GIARGLLYLH DSRL
Sbjct  632  FNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRL  665



>ref|XP_006606016.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=667

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  412  VPNKSLDYFIF---DPIKKAQLDWQRRYKIIGGIARGLLYLHEDSRL  455



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K   L+W RR+KII GIARGLLYLHEDSRL
Sbjct  438  FDPVKHAYLDWERRYKIIGGIARGLLYLHEDSRL  471



>ref|XP_002869784.1| hypothetical protein ARALYDRAFT_492546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46043.1| hypothetical protein ARALYDRAFT_492546 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  427  FDPAKQSQLDWTRRYKIIGGVARGILYLHQDSRL  460



>ref|XP_010909793.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Elaeis guineensis]
Length=839

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K++LL+W RRF II+GIARGLLYLH+DSRL
Sbjct  607  FDPAKKHLLDWQRRFSIIKGIARGLLYLHQDSRL  640



>gb|KCW75005.1| hypothetical protein EUGRSUZ_E03767 [Eucalyptus grandis]
Length=363

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DPDK+  L+WSRR+KII GIARG+LYLHEDSR 
Sbjct  125  FDPDKRRQLDWSRRYKIISGIARGMLYLHEDSRF  158



>ref|XP_009108047.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Brassica rapa]
Length=654

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +  DP+KQ  L+W+RR+ II G+ARG+LYLH+DSRL
Sbjct  427  VLFDPEKQVHLDWTRRYNIIGGVARGILYLHQDSRL  462



>gb|EMT12145.1| Cysteine-rich receptor-like protein kinase 10 [Aegilops tauschii]
Length=694

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  ILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  + D  ++ LL WS RFKIIRG+ARGLLYLH+DSRL
Sbjct  464  IYAFRDGTRKLLLNWSTRFKIIRGVARGLLYLHQDSRL  501



>gb|EEC78083.1| hypothetical protein OsI_17559 [Oryza sativa Indica Group]
Length=815

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP  +++L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  588  DPASKFILDWPTRFKIIKGVARGLLYLHQDSRL  620



>ref|XP_006398146.1| hypothetical protein EUTSA_v10000811mg [Eutrema salsugineum]
 gb|ESQ39599.1| hypothetical protein EUTSA_v10000811mg [Eutrema salsugineum]
Length=657

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  420  FDPAKQAQLDWTRRYKIIGGVARGILYLHQDSRL  453



>ref|XP_006606020.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=413

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GI+RGLLYLHEDSRL
Sbjct  179  FDPIKRLFLDWERRYKIIEGISRGLLYLHEDSRL  212



>ref|XP_006413571.1| hypothetical protein EUTSA_v10024630mg [Eutrema salsugineum]
 gb|ESQ55024.1| hypothetical protein EUTSA_v10024630mg [Eutrema salsugineum]
Length=658

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+KII G+ARG+LYLH+DSRL
Sbjct  425  FDPAKQAQLDWTRRYKIIGGVARGILYLHQDSRL  458



>ref|XP_006606018.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
isoform X1 [Glycine max]
Length=687

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ +  L W RR+ IIRGIARGLLYLHEDSRL
Sbjct  430  VPNKSLDYFIF---DPNNRVNLNWERRYNIIRGIARGLLYLHEDSRL  473



>gb|EEE61757.1| hypothetical protein OsJ_16297 [Oryza sativa Japonica Group]
Length=854

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  99   DPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            DP  +++L+W  RFKII+G+ARGLLYLH+DSRL
Sbjct  630  DPASKFILDWPTRFKIIKGVARGLLYLHQDSRL  662



>ref|XP_010529593.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Tarenaya 
hassleriana]
Length=665

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+W+ R+KII GIARG+LYLH+DSRL
Sbjct  429  FDPAKQGLLDWTVRYKIIEGIARGILYLHQDSRL  462



>ref|XP_009417409.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K   L W RR+KII GIARGLLYLHEDSRL
Sbjct  398  ILFDPTKCGQLNWERRYKIIEGIARGLLYLHEDSRL  433



>ref|XP_010092052.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB49966.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=604

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  429  FDPSKRANLDWERRYKIIGGIARGLLYLHEDSRL  462



>gb|KFK30805.1| hypothetical protein AALP_AA6G028200 [Arabis alpina]
Length=522

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+W+RR+ II GIARG+LYLH+DSRL
Sbjct  291  FDPAKQGLLDWTRRYNIIGGIARGILYLHQDSRL  324



>ref|XP_004511333.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Cicer arietinum]
Length=683

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W RR K+I+GIARG+ YLHEDSRL
Sbjct  442  ILFDPEKQRELDWGRRNKVIKGIARGMQYLHEDSRL  477



>ref|XP_004511332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=684

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP+KQ  L+W RR K+I+GIARG+ YLHEDSRL
Sbjct  443  ILFDPEKQRELDWGRRNKVIKGIARGMQYLHEDSRL  478



>ref|XP_007159234.1| hypothetical protein PHAVU_002G220500g [Phaseolus vulgaris]
 gb|ESW31228.1| hypothetical protein PHAVU_002G220500g [Phaseolus vulgaris]
Length=838

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W++RF+II GIARGLLYLH+DSRL
Sbjct  607  FDPVKQTQLDWTKRFEIIEGIARGLLYLHQDSRL  640



>ref|XP_010057745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=644

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K   L+WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  406  FDPKKSKELDWSRRYKIVCGIARGMLYLHEDSRL  439



>ref|XP_007212629.1| hypothetical protein PRUPE_ppa016146mg [Prunus persica]
 gb|EMJ13828.1| hypothetical protein PRUPE_ppa016146mg [Prunus persica]
Length=565

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F I    D  +  LL+WS+RF IIRGIARGLLYLH+DSRL
Sbjct  318  LPNKSLDFYIF---DKTQGRLLDWSQRFHIIRGIARGLLYLHQDSRL  361



>ref|XP_004496790.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Cicer arietinum]
Length=662

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+WSRR+KII GIARG+LYLHEDS+L
Sbjct  421  FDPAKQRELDWSRRYKIIVGIARGILYLHEDSQL  454



>ref|XP_003637968.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|KEH43950.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=693

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K+  L W RRFKII+ IARGLLYLHEDSRL
Sbjct  447  IIFDPIKRANLNWERRFKIIKDIARGLLYLHEDSRL  482



>ref|XP_009417407.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=685

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K   L W RR+KII GIARGLLYLHEDSRL
Sbjct  438  ILFDPTKCGQLNWERRYKIIEGIARGLLYLHEDSRL  473



>gb|KCW75000.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=665

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K   L+WSRR+KI+ GIARG+LYLHEDSRL
Sbjct  427  FDPKKSKELDWSRRYKIVCGIARGMLYLHEDSRL  460



>sp|Q8W4G6.2|CRK15_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 15; 
Short=Cysteine-rich RLK15; Flags: Precursor [Arabidopsis thaliana]
Length=627

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ  L+W+RR+K+I GIARG+LYLH+DSRL
Sbjct  423  FDPAKQNQLDWTRRYKVIGGIARGILYLHQDSRL  456



>ref|XP_004976939.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
isoform X2 [Setaria italica]
Length=836

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F I    D   +YLL+W  RFKII+GI+RGLLYLH+DSRL
Sbjct  597  LPNKSLDFFIF---DAANKYLLDWPTRFKIIKGISRGLLYLHQDSRL  640



>ref|XP_011096160.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Sesamum 
indicum]
Length=1317

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            L   DP K+  L+W RR+KII GIARG+LYLHEDSRL
Sbjct  426  LFIFDPIKKSYLDWERRYKIIGGIARGILYLHEDSRL  462


 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  102   LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
              DP K   L+W RR+KII GIARG+LYLHEDSR+
Sbjct  1082  FDPIKCSRLDWERRYKIIEGIARGILYLHEDSRI  1115



>ref|XP_010529589.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Tarenaya hassleriana]
Length=665

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP KQ LL+W+ R+KII GIARG+LYLH+DSRL
Sbjct  429  FDPAKQGLLDWTVRYKIIEGIARGILYLHQDSRL  462



>ref|XP_004976938.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
isoform X1 [Setaria italica]
Length=860

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F I    D   +YLL+W  RFKII+GI+RGLLYLH+DSRL
Sbjct  621  LPNKSLDFFIF---DAANKYLLDWPTRFKIIKGISRGLLYLHQDSRL  664



>ref|XP_010320274.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=810

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D  K+ LL+WSRRF II GIARGLLYLH+DSRL
Sbjct  580  FDQTKKKLLDWSRRFDIINGIARGLLYLHQDSRL  613



>ref|XP_006356818.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=811

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D  K+ LL+WSRRF II GIARGLLYLH+DSRL
Sbjct  581  FDQTKKKLLDWSRRFDIINGIARGLLYLHQDSRL  614



>ref|XP_006464588.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330-like isoform X1 [Citrus sinensis]
Length=840

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP +Q LL+W +RF II+GI+RGLLYLH DSRL
Sbjct  607  FDPQRQSLLDWPKRFNIIKGISRGLLYLHRDSRL  640



>ref|XP_006356864.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=862

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ F   I  D DK  +L+W +RF II GIARGLLYLH+DSRL
Sbjct  624  MPNRSLDF---IIFDEDKSSILDWPKRFNIINGIARGLLYLHQDSRL  667



>ref|NP_001105401.1| kinase interacting kinase1 precursor [Zea mays]
 gb|AAB93834.1| KI domain interacting kinase 1 [Zea mays]
Length=848

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             +P+KQ LL+W +RF II GIARGLLYLH DSRL
Sbjct  616  FNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRL  649



>ref|XP_007025949.1| Cysteine-rich RLK 25 [Theobroma cacao]
 gb|EOY28571.1| Cysteine-rich RLK 25 [Theobroma cacao]
Length=558

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP+ Q  L+WS+R+KII+GIARGLLYLH DS L
Sbjct  310  VPNKSLDYFIF---DPENQRQLDWSKRYKIIKGIARGLLYLHSDSHL  353



>ref|XP_002271125.3| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=692

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             DP K+  L+W RR+KII GIARGLLYLHEDSRL
Sbjct  447  FDPIKRAQLDWDRRYKIIGGIARGLLYLHEDSRL  480



>ref|XP_009417400.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=685

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K   L W RR+KII GIARGLLYLHEDSRL
Sbjct  438  ILFDPTKCGQLNWERRYKIIEGIARGLLYLHEDSRL  473



>ref|XP_010412576.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 4 [Camelina sativa]
Length=661

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  141  IPQHSV*FEILIYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            +P  S+ + I    DP  Q  L+WSRR+KII GIARG+LYLH+DSRL
Sbjct  415  VPNKSLDYFIF---DPTMQNQLDWSRRYKIIGGIARGILYLHQDSRL  458



>ref|XP_007217906.1| hypothetical protein PRUPE_ppa017912mg, partial [Prunus persica]
 gb|EMJ19105.1| hypothetical protein PRUPE_ppa017912mg, partial [Prunus persica]
Length=142

 Score = 54.7 bits (130),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  IYLDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
            I  DP K+  L+W RR+KI+ GIARGLLYLHEDSRL
Sbjct  60   IIFDPTKRAQLDWVRRYKIVVGIARGLLYLHEDSRL  95



>emb|CDP16212.1| unnamed protein product [Coffea canephora]
Length=416

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  LDPDKQYLLEWSRRFKIIRGIARGLLYLHEDSRL  1
             D +K+  L WSRR+KII GIARGLLYLHEDSRL
Sbjct  176  FDSEKKRSLNWSRRYKIIGGIARGLLYLHEDSRL  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524054700018