BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32706_g1_i1 len=529 path=[1:0-528]

Length=529
                                                                      Score     E

ref|XP_002309560.2|  hypothetical protein POPTR_0006s25880g           88.6    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006476094.1|  PREDICTED: uncharacterized protein LOC102623437  86.3    2e-16   
ref|XP_006450629.1|  hypothetical protein CICLE_v10008167mg           85.5    3e-16   
ref|XP_002324818.2|  hypothetical protein POPTR_0018s00770g           83.6    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011019654.1|  PREDICTED: uncharacterized protein LOC105122312  84.7    7e-16   
ref|XP_008347683.1|  PREDICTED: uncharacterized protein LOC103410796  80.9    1e-15   
emb|CDP16156.1|  unnamed protein product                              83.6    1e-15   
ref|XP_007137180.1|  hypothetical protein PHAVU_009G106400g           82.8    3e-15   
ref|XP_009783706.1|  PREDICTED: uncharacterized protein LOC104232253  82.8    3e-15   
ref|XP_008220035.1|  PREDICTED: uncharacterized protein LOC103320179  82.4    4e-15   
ref|XP_011026589.1|  PREDICTED: uncharacterized protein LOC105127137  82.4    4e-15   
ref|XP_002516035.1|  conserved hypothetical protein                   82.4    4e-15   Ricinus communis
ref|XP_009396550.1|  PREDICTED: uncharacterized protein LOC103981523  82.0    5e-15   
ref|XP_006366208.1|  PREDICTED: uncharacterized protein LOC102587...  82.0    5e-15   
ref|XP_006366207.1|  PREDICTED: uncharacterized protein LOC102587...  82.0    5e-15   
ref|XP_009367912.1|  PREDICTED: uncharacterized protein LOC103957476  82.0    5e-15   
ref|XP_008393890.1|  PREDICTED: uncharacterized protein LOC103456039  82.0    6e-15   
ref|XP_010313606.1|  PREDICTED: uncharacterized protein LOC101255958  81.6    7e-15   
ref|XP_008347633.1|  PREDICTED: uncharacterized protein LOC103410...  81.6    7e-15   
ref|XP_009592783.1|  PREDICTED: uncharacterized protein LOC104089...  80.9    8e-15   
ref|XP_009788571.1|  PREDICTED: uncharacterized protein LOC104236361  81.3    1e-14   
ref|XP_009592782.1|  PREDICTED: uncharacterized protein LOC104089...  80.5    1e-14   
ref|XP_009592781.1|  PREDICTED: uncharacterized protein LOC104089...  80.5    2e-14   
gb|KDP34212.1|  hypothetical protein JCGZ_07783                       80.5    2e-14   
gb|EYU21882.1|  hypothetical protein MIMGU_mgv1a005504mg              80.9    2e-14   
ref|XP_007222835.1|  hypothetical protein PRUPE_ppa005114mg           80.5    2e-14   
ref|XP_009631525.1|  PREDICTED: uncharacterized protein LOC104121277  80.5    2e-14   
ref|XP_009791161.1|  PREDICTED: uncharacterized protein LOC104238494  80.5    2e-14   
gb|EYU21883.1|  hypothetical protein MIMGU_mgv1a005504mg              80.5    2e-14   
ref|XP_009611258.1|  PREDICTED: uncharacterized protein LOC104104...  79.7    2e-14   
ref|XP_009611256.1|  PREDICTED: uncharacterized protein LOC104104...  80.5    2e-14   
ref|XP_009623066.1|  PREDICTED: uncharacterized protein LOC104114346  80.5    2e-14   
emb|CAN61520.1|  hypothetical protein VITISV_033969                   79.7    2e-14   Vitis vinifera
ref|XP_011081835.1|  PREDICTED: uncharacterized protein LOC105164774  80.5    2e-14   
ref|XP_002516571.1|  conserved hypothetical protein                   80.5    2e-14   Ricinus communis
ref|XP_009611253.1|  PREDICTED: uncharacterized protein LOC104104...  80.5    2e-14   
ref|XP_009611257.1|  PREDICTED: uncharacterized protein LOC104104...  80.1    2e-14   
ref|XP_004501773.1|  PREDICTED: uncharacterized protein LOC101498079  80.1    2e-14   
ref|XP_010113488.1|  hypothetical protein L484_026823                 80.1    2e-14   
ref|XP_007202022.1|  hypothetical protein PRUPE_ppa004997mg           80.1    3e-14   
ref|XP_008241663.1|  PREDICTED: uncharacterized protein LOC103340075  80.1    3e-14   
ref|XP_004956625.1|  PREDICTED: uncharacterized protein LOC101768056  79.7    3e-14   
ref|XP_009777900.1|  PREDICTED: uncharacterized protein LOC104227...  79.7    3e-14   
ref|XP_009627765.1|  PREDICTED: uncharacterized protein LOC104118259  79.7    3e-14   
ref|XP_006340268.1|  PREDICTED: uncharacterized protein LOC102587334  79.7    3e-14   
ref|XP_002284175.1|  PREDICTED: uncharacterized protein LOC100267889  79.7    3e-14   Vitis vinifera
ref|XP_009777905.1|  PREDICTED: uncharacterized protein LOC104227...  79.0    3e-14   
ref|XP_011011435.1|  PREDICTED: uncharacterized protein LOC105116...  79.7    4e-14   
ref|XP_009777896.1|  PREDICTED: uncharacterized protein LOC104227...  79.7    4e-14   
ref|XP_002299704.2|  hypothetical protein POPTR_0001s18300g           79.7    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004291206.1|  PREDICTED: uncharacterized protein LOC101310663  79.7    4e-14   
ref|XP_004245262.1|  PREDICTED: uncharacterized protein LOC101258883  79.3    4e-14   
ref|XP_011011433.1|  PREDICTED: uncharacterized protein LOC105116...  79.7    4e-14   
ref|XP_009777901.1|  PREDICTED: uncharacterized protein LOC104227...  79.3    4e-14   
ref|XP_008799063.1|  PREDICTED: uncharacterized protein LOC103713782  79.3    5e-14   
ref|XP_010049082.1|  PREDICTED: uncharacterized protein LOC104437756  79.0    7e-14   
ref|XP_007046968.1|  DNA-directed RNA polymerase isoform 2            78.6    7e-14   
gb|ABR16391.1|  unknown                                               75.5    7e-14   Picea sitchensis
ref|XP_010048100.1|  PREDICTED: uncharacterized protein LOC104436943  78.6    7e-14   
ref|XP_007046967.1|  Sulfite exporter TauE/SafE family protein, p...  78.6    8e-14   
ref|XP_010526181.1|  PREDICTED: uncharacterized protein LOC104803...  78.6    9e-14   
ref|XP_010526182.1|  PREDICTED: uncharacterized protein LOC104803...  78.6    9e-14   
ref|XP_010249715.1|  PREDICTED: uncharacterized protein LOC104592187  78.2    1e-13   
ref|XP_006340601.1|  PREDICTED: uncharacterized protein LOC102601548  78.2    1e-13   
gb|KEH35984.1|  sulfite exporter TauE/SafE family protein             77.4    1e-13   
ref|XP_008795085.1|  PREDICTED: uncharacterized protein LOC103710932  77.4    1e-13   
ref|NP_001145740.1|  uncharacterized protein LOC100279247             75.9    1e-13   Zea mays [maize]
gb|ABR16333.1|  unknown                                               77.8    2e-13   Picea sitchensis
ref|XP_010649158.1|  PREDICTED: uncharacterized protein LOC100253061  77.8    2e-13   
ref|XP_006833308.1|  hypothetical protein AMTR_s00109p00049700        77.8    2e-13   
ref|XP_002324817.1|  hypothetical protein POPTR_0018s00760g           77.4    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006343068.1|  PREDICTED: uncharacterized protein LOC102587...  77.4    2e-13   
ref|XP_009800426.1|  PREDICTED: uncharacterized protein LOC104246...  77.4    2e-13   
ref|XP_002303288.2|  hypothetical protein POPTR_0003s05180g           77.4    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009800425.1|  PREDICTED: uncharacterized protein LOC104246...  77.4    2e-13   
gb|KEH35985.1|  sulfite exporter TauE/SafE family protein             77.4    2e-13   
gb|KHG02837.1|  ATP synthase subunit delta                            77.4    2e-13   
ref|XP_009356692.1|  PREDICTED: uncharacterized protein LOC103947...  77.4    2e-13   
ref|XP_003636475.1|  hypothetical protein MTR_042s0018                77.4    2e-13   
ref|XP_009356691.1|  PREDICTED: uncharacterized protein LOC103947...  77.4    2e-13   
ref|XP_003636476.1|  hypothetical protein MTR_042s0018                77.0    2e-13   
ref|XP_008363111.1|  PREDICTED: uncharacterized protein LOC103426...  77.0    2e-13   
ref|XP_008363110.1|  PREDICTED: uncharacterized protein LOC103426...  77.0    3e-13   
ref|XP_008338104.1|  PREDICTED: uncharacterized protein LOC103401...  77.0    3e-13   
gb|EMT22888.1|  hypothetical protein F775_28607                       76.6    3e-13   
ref|XP_008338105.1|  PREDICTED: uncharacterized protein LOC103401...  77.0    3e-13   
gb|KHG04871.1|  hypothetical protein F383_28778                       76.6    3e-13   
ref|XP_004232395.1|  PREDICTED: uncharacterized protein LOC101255155  77.0    3e-13   
ref|XP_007159528.1|  hypothetical protein PHAVU_002G2450000g          76.3    3e-13   
ref|XP_010915823.1|  PREDICTED: uncharacterized protein LOC105040818  76.6    3e-13   
dbj|BAK01650.1|  predicted protein                                    76.6    3e-13   
gb|KDP38300.1|  hypothetical protein JCGZ_05186                       76.6    3e-13   
gb|KDO79521.1|  hypothetical protein CISIN_1g011797mg                 76.6    3e-13   
ref|XP_006425693.1|  hypothetical protein CICLE_v10025446mg           76.6    4e-13   
ref|XP_002516570.1|  conserved hypothetical protein                   76.6    4e-13   Ricinus communis
ref|XP_007024174.1|  Sulfite exporter TauE/SafE family protein, p...  76.6    4e-13   
ref|XP_010048101.1|  PREDICTED: uncharacterized protein LOC104436...  76.6    4e-13   
emb|CDP02034.1|  unnamed protein product                              76.6    4e-13   
ref|XP_010048102.1|  PREDICTED: uncharacterized protein LOC104436...  76.3    4e-13   
ref|XP_011001598.1|  PREDICTED: uncharacterized protein LOC105108...  76.6    4e-13   
ref|XP_011001600.1|  PREDICTED: uncharacterized protein LOC105108...  76.6    4e-13   
gb|AEI98632.1|  hypothetical protein 111018.19                        76.3    5e-13   
ref|XP_007024175.1|  Sulfite exporter TauE/SafE family protein, p...  75.9    5e-13   
ref|XP_004287906.1|  PREDICTED: uncharacterized protein LOC101304510  76.3    5e-13   
ref|XP_008651296.1|  PREDICTED: uncharacterized protein LOC100279...  76.3    5e-13   
ref|XP_006585193.1|  PREDICTED: uncharacterized protein LOC100802321  76.3    5e-13   
ref|XP_010667904.1|  PREDICTED: uncharacterized protein LOC104884...  76.3    5e-13   
ref|XP_009784620.1|  PREDICTED: uncharacterized protein LOC104233...  76.3    5e-13   
ref|XP_010263696.1|  PREDICTED: uncharacterized protein LOC104601887  75.9    6e-13   
ref|XP_009388715.1|  PREDICTED: uncharacterized protein LOC103975470  75.9    6e-13   
gb|KCW58608.1|  hypothetical protein EUGRSUZ_H01268                   74.3    7e-13   
ref|XP_006580198.1|  PREDICTED: uncharacterized protein LOC100819316  75.9    7e-13   
ref|XP_006425694.1|  hypothetical protein CICLE_v10025446mg           75.9    7e-13   
gb|KHN48052.1|  hypothetical protein glysoja_015522                   75.5    8e-13   
ref|XP_007156932.1|  hypothetical protein PHAVU_002G029400g           75.5    9e-13   
ref|XP_002460084.1|  hypothetical protein SORBIDRAFT_02g022510        75.5    9e-13   Sorghum bicolor [broomcorn]
ref|XP_003578003.1|  PREDICTED: uncharacterized protein LOC100827421  75.5    1e-12   
gb|KHN06459.1|  hypothetical protein glysoja_010803                   75.5    1e-12   
ref|XP_010254104.1|  PREDICTED: uncharacterized protein LOC104595187  75.5    1e-12   
ref|XP_008792340.1|  PREDICTED: uncharacterized protein LOC103708984  75.1    1e-12   
gb|EEE69518.1|  hypothetical protein OsJ_28979                        75.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062933.1|  Os09g0344800                                     75.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84400.1|  hypothetical protein OsI_30977                        75.1    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010314281.1|  PREDICTED: uncharacterized protein LOC101268...  75.1    1e-12   
ref|XP_006359451.1|  PREDICTED: uncharacterized protein LOC102590...  75.1    1e-12   
ref|XP_009409060.1|  PREDICTED: uncharacterized protein LOC103991...  75.1    1e-12   
ref|XP_009409059.1|  PREDICTED: uncharacterized protein LOC103991...  75.1    1e-12   
ref|XP_010070053.1|  PREDICTED: uncharacterized protein LOC104456870  75.1    1e-12   
ref|XP_004168635.1|  PREDICTED: uncharacterized LOC101214783          74.7    1e-12   
ref|XP_004136295.1|  PREDICTED: uncharacterized protein LOC101214783  74.7    1e-12   
gb|KHN36120.1|  hypothetical protein glysoja_003243                   74.7    1e-12   
ref|XP_003629468.1|  hypothetical protein MTR_8g077830                74.7    2e-12   
ref|XP_010062471.1|  PREDICTED: uncharacterized protein LOC104449877  74.7    2e-12   
gb|AET03944.2|  sulfite exporter TauE/SafE family protein             74.7    2e-12   
ref|XP_009613204.1|  PREDICTED: uncharacterized protein LOC104106373  74.7    2e-12   
gb|AFK35007.1|  unknown                                               74.7    2e-12   
ref|XP_009777903.1|  PREDICTED: uncharacterized protein LOC104227...  74.3    2e-12   
ref|XP_010417351.1|  PREDICTED: uncharacterized protein LOC104703106  74.7    2e-12   
ref|XP_010098073.1|  hypothetical protein L484_026205                 74.7    2e-12   
ref|XP_003517231.1|  PREDICTED: uncharacterized protein LOC100801441  74.7    2e-12   
tpg|DAA39926.1|  TPA: hypothetical protein ZEAMMB73_327447            74.7    2e-12   
ref|XP_008466240.1|  PREDICTED: uncharacterized protein LOC103503714  74.7    2e-12   
ref|XP_007012055.1|  Sulfite exporter TauE/SafE family protein        74.7    2e-12   
ref|XP_007159577.1|  hypothetical protein PHAVU_002G249100g           74.3    2e-12   
ref|XP_010924740.1|  PREDICTED: uncharacterized protein LOC105047500  74.3    2e-12   
ref|XP_009371582.1|  PREDICTED: uncharacterized protein LOC103960...  74.3    2e-12   
ref|XP_002878880.1|  hypothetical protein ARALYDRAFT_481426           74.3    2e-12   
ref|XP_008228544.1|  PREDICTED: uncharacterized protein LOC103327946  74.3    2e-12   
ref|XP_009371583.1|  PREDICTED: uncharacterized protein LOC103960...  74.3    2e-12   
ref|XP_007159523.1|  hypothetical protein PHAVU_002G244700g           73.9    3e-12   
emb|CDO98032.1|  unnamed protein product                              73.9    3e-12   
ref|NP_850068.1|  Sulfite exporter TauE/SafE family protein           73.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369186.1|  hypothetical protein POPTR_0001s18380g           73.9    3e-12   
ref|XP_004509250.1|  PREDICTED: uncharacterized protein LOC101512581  73.9    3e-12   
ref|XP_008380922.1|  PREDICTED: uncharacterized protein LOC103443804  73.9    3e-12   
ref|XP_010691331.1|  PREDICTED: uncharacterized protein LOC104904681  73.6    4e-12   
ref|XP_010935066.1|  PREDICTED: uncharacterized protein LOC105055061  73.9    4e-12   
gb|KHN10230.1|  hypothetical protein glysoja_017834                   73.6    4e-12   
ref|XP_003523730.1|  PREDICTED: uncharacterized protein LOC100809318  73.6    4e-12   
ref|XP_011026588.1|  PREDICTED: uncharacterized protein LOC105127135  73.6    4e-12   
ref|XP_003611976.1|  Membrane protein-like protein                    73.6    4e-12   
ref|XP_010472594.1|  PREDICTED: uncharacterized protein LOC104752...  73.6    4e-12   
ref|XP_010472595.1|  PREDICTED: uncharacterized protein LOC104752...  73.6    4e-12   
ref|XP_007216479.1|  hypothetical protein PRUPE_ppa024737mg           73.6    4e-12   
ref|XP_010109461.1|  hypothetical protein L484_001800                 73.6    5e-12   
ref|XP_002284423.1|  PREDICTED: uncharacterized protein LOC100266912  73.2    5e-12   Vitis vinifera
ref|XP_010680799.1|  PREDICTED: uncharacterized protein LOC104895...  73.2    6e-12   
ref|XP_010680798.1|  PREDICTED: uncharacterized protein LOC104895...  73.2    6e-12   
ref|XP_010429580.1|  PREDICTED: uncharacterized protein LOC104714041  73.2    6e-12   
ref|XP_009381051.1|  PREDICTED: uncharacterized protein LOC103969282  72.8    8e-12   
ref|XP_007161546.1|  hypothetical protein PHAVU_001G078500g           72.0    8e-12   
ref|XP_008783526.1|  PREDICTED: uncharacterized protein LOC103702749  72.8    8e-12   
gb|KDO56896.1|  hypothetical protein CISIN_1g022146mg                 70.9    1e-11   
ref|XP_003546436.1|  PREDICTED: uncharacterized protein LOC100816528  72.4    1e-11   
gb|EYU21457.1|  hypothetical protein MIMGU_mgv1a005411mg              72.4    1e-11   
ref|XP_002516037.1|  conserved hypothetical protein                   72.4    1e-11   Ricinus communis
ref|XP_004235668.1|  PREDICTED: uncharacterized protein LOC101262796  72.4    1e-11   
gb|KHM98753.1|  hypothetical protein glysoja_030806                   72.4    1e-11   
ref|XP_009140696.1|  PREDICTED: uncharacterized protein LOC103864686  72.4    1e-11   
emb|CDX77007.1|  BnaC04g38020D                                        72.4    1e-11   
emb|CDY35338.1|  BnaA04g15090D                                        72.4    1e-11   
gb|ACU23197.1|  unknown                                               70.1    1e-11   Glycine max [soybeans]
ref|XP_009346009.1|  PREDICTED: uncharacterized protein LOC103937781  72.4    1e-11   
ref|XP_008342687.1|  PREDICTED: uncharacterized protein LOC103405461  72.0    1e-11   
ref|XP_006383214.1|  hypothetical protein POPTR_0005s12570g           72.0    1e-11   
ref|XP_006596174.1|  PREDICTED: uncharacterized protein LOC100781...  72.0    1e-11   
ref|XP_004498483.1|  PREDICTED: uncharacterized protein LOC101508...  72.0    1e-11   
ref|XP_006596173.1|  PREDICTED: uncharacterized protein LOC100781...  71.6    1e-11   
ref|XP_004498484.1|  PREDICTED: uncharacterized protein LOC101508...  72.0    1e-11   
ref|XP_007159524.1|  hypothetical protein PHAVU_002G244800g           72.0    1e-11   
ref|XP_006294138.1|  hypothetical protein CARUB_v10023132mg           72.0    2e-11   
ref|XP_003527825.1|  PREDICTED: uncharacterized protein LOC100810784  71.6    2e-11   
ref|XP_007161342.1|  hypothetical protein PHAVU_001G061000g           71.6    2e-11   
ref|XP_010249713.1|  PREDICTED: uncharacterized protein LOC104592186  71.6    2e-11   
ref|XP_006465610.1|  PREDICTED: uncharacterized protein LOC102613...  71.6    2e-11   
gb|KHN04837.1|  hypothetical protein glysoja_047520                   71.6    2e-11   
ref|XP_006426964.1|  hypothetical protein CICLE_v10025511mg           71.6    2e-11   
ref|XP_009353619.1|  PREDICTED: uncharacterized protein LOC103944866  71.6    2e-11   
gb|KDP37239.1|  hypothetical protein JCGZ_06295                       71.6    2e-11   
ref|XP_002310222.2|  hypothetical protein POPTR_0007s12700g           71.2    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003527721.1|  PREDICTED: uncharacterized protein LOC100789748  71.2    2e-11   
ref|XP_009403527.1|  PREDICTED: uncharacterized protein LOC103987...  71.2    3e-11   
gb|ABC47842.1|  membrane protein-like protein                         71.2    3e-11   Glycine max [soybeans]
ref|XP_009403528.1|  PREDICTED: uncharacterized protein LOC103987...  71.2    3e-11   
gb|EPS70855.1|  hypothetical protein M569_03905                       70.9    3e-11   
ref|XP_004959391.1|  PREDICTED: uncharacterized protein LOC101762929  70.9    3e-11   
ref|XP_003523605.1|  PREDICTED: uncharacterized protein LOC100816633  70.9    3e-11   
ref|XP_007216108.1|  hypothetical protein PRUPE_ppa018715mg           70.9    3e-11   
ref|XP_011072363.1|  PREDICTED: uncharacterized protein LOC105157640  70.9    3e-11   
ref|XP_004512029.1|  PREDICTED: uncharacterized protein LOC101496...  70.9    4e-11   
ref|XP_004512028.1|  PREDICTED: uncharacterized protein LOC101496...  70.9    4e-11   
ref|XP_004512031.1|  PREDICTED: uncharacterized protein LOC101496...  70.9    4e-11   
ref|XP_004512030.1|  PREDICTED: uncharacterized protein LOC101496...  70.9    4e-11   
ref|XP_007156036.1|  hypothetical protein PHAVU_003G253000g           70.9    4e-11   
ref|XP_008228542.1|  PREDICTED: uncharacterized protein LOC103327945  70.9    4e-11   
ref|XP_006405251.1|  hypothetical protein EUTSA_v10000151mg           70.5    4e-11   
emb|CDY70121.1|  BnaC03g72820D                                        70.5    5e-11   
ref|XP_011025767.1|  PREDICTED: uncharacterized protein LOC105126564  70.5    5e-11   
ref|XP_002516036.1|  conserved hypothetical protein                   70.1    6e-11   Ricinus communis
ref|XP_010254876.1|  PREDICTED: uncharacterized protein LOC104595...  70.1    6e-11   
ref|XP_006426963.1|  hypothetical protein CICLE_v10025503mg           70.1    6e-11   
ref|XP_006465615.1|  PREDICTED: uncharacterized protein LOC102614...  70.1    6e-11   
dbj|BAJ87419.1|  predicted protein                                    70.1    6e-11   
ref|XP_006465614.1|  PREDICTED: uncharacterized protein LOC102614...  70.1    7e-11   
emb|CDX83221.1|  BnaA03g22850D                                        69.7    7e-11   
gb|EPS70854.1|  hypothetical protein M569_03904                       69.7    8e-11   
ref|XP_004302906.1|  PREDICTED: uncharacterized protein LOC101294092  69.7    8e-11   
ref|XP_009133962.1|  PREDICTED: uncharacterized protein LOC103858367  69.7    8e-11   
gb|ACJ85296.1|  unknown                                               69.7    9e-11   Medicago truncatula
gb|KHN42580.1|  hypothetical protein glysoja_042801                   69.7    9e-11   
ref|XP_007159526.1|  hypothetical protein PHAVU_002G244900g           69.3    1e-10   
gb|KHN06457.1|  hypothetical protein glysoja_010801                   69.3    1e-10   
gb|KHN06458.1|  hypothetical protein glysoja_010802                   69.3    1e-10   
ref|XP_006580197.1|  PREDICTED: uncharacterized protein LOC100818778  69.3    1e-10   
ref|XP_007150626.1|  hypothetical protein PHAVU_005G168100g           69.3    1e-10   
ref|XP_007217721.1|  hypothetical protein PRUPE_ppa005105mg           69.3    1e-10   
ref|XP_002521607.1|  conserved hypothetical protein                   68.9    1e-10   Ricinus communis
ref|XP_006595132.1|  PREDICTED: uncharacterized protein LOC100789...  68.9    2e-10   
ref|XP_003532779.1|  PREDICTED: uncharacterized protein LOC100801788  68.9    2e-10   
gb|KDP37237.1|  hypothetical protein JCGZ_06293                       68.6    2e-10   
gb|KHN32619.1|  hypothetical protein glysoja_022301                   68.6    2e-10   
ref|XP_003542098.1|  PREDICTED: uncharacterized protein LOC100789...  68.6    2e-10   
gb|EPS67474.1|  hypothetical protein M569_07301                       66.2    2e-10   
ref|XP_010999980.1|  PREDICTED: uncharacterized protein LOC105107666  68.6    2e-10   
gb|KDO56903.1|  hypothetical protein CISIN_1g0454882mg                67.4    2e-10   
gb|KDO79522.1|  hypothetical protein CISIN_1g011797mg                 67.8    3e-10   
ref|XP_003629897.1|  hypothetical protein MTR_8g088080                67.8    4e-10   
gb|ACJ86264.1|  unknown                                               67.8    4e-10   Medicago truncatula
ref|NP_001061719.1|  Os08g0389700                                     67.8    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004504238.1|  PREDICTED: uncharacterized protein LOC101507523  67.4    4e-10   
ref|XP_002460083.1|  hypothetical protein SORBIDRAFT_02g022500        67.4    4e-10   Sorghum bicolor [broomcorn]
gb|EYU38596.1|  hypothetical protein MIMGU_mgv1a005752mg              67.4    5e-10   
gb|KEH40300.1|  sulfite exporter TauE/SafE family protein             67.0    6e-10   
gb|KEH40299.1|  sulfite exporter TauE/SafE family protein             67.0    6e-10   
gb|EEC83519.1|  hypothetical protein OsI_29108                        67.0    6e-10   Oryza sativa Indica Group [Indian rice]
gb|KHN48050.1|  hypothetical protein glysoja_015520                   67.0    7e-10   
gb|KDO56897.1|  hypothetical protein CISIN_1g0116822mg                63.5    7e-10   
gb|EMS67478.1|  hypothetical protein TRIUR3_25439                     64.3    9e-10   
ref|XP_006359480.1|  PREDICTED: uncharacterized protein LOC102600300  66.6    9e-10   
ref|XP_011094444.1|  PREDICTED: uncharacterized protein LOC105174142  66.6    9e-10   
gb|AAD20139.1|  unknown protein                                       65.1    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660551.1|  PREDICTED: uncharacterized protein LOC102715329  66.2    1e-09   
gb|EYU41559.1|  hypothetical protein MIMGU_mgv1a005977mg              66.2    1e-09   
ref|XP_004504239.1|  PREDICTED: uncharacterized protein LOC101507...  65.9    1e-09   
ref|XP_004504240.1|  PREDICTED: uncharacterized protein LOC101507...  65.9    1e-09   
ref|XP_006833307.1|  hypothetical protein AMTR_s00109p00047950        65.9    1e-09   
ref|XP_006660104.1|  PREDICTED: uncharacterized protein LOC102707608  65.9    1e-09   
ref|XP_009603782.1|  PREDICTED: uncharacterized protein LOC104098687  65.5    2e-09   
ref|XP_010509452.1|  PREDICTED: uncharacterized protein LOC104785865  65.5    2e-09   
ref|XP_008228546.1|  PREDICTED: uncharacterized protein LOC103327...  65.5    2e-09   
ref|NP_850267.1|  Sulfite exporter TauE/SafE family protein           65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228549.1|  PREDICTED: uncharacterized protein LOC103327...  65.5    2e-09   
ref|XP_010683928.1|  PREDICTED: uncharacterized protein LOC104898535  65.5    2e-09   
emb|CDP15335.1|  unnamed protein product                              65.5    2e-09   
ref|XP_010098870.1|  hypothetical protein L484_022637                 62.8    2e-09   
ref|XP_008228548.1|  PREDICTED: uncharacterized protein LOC103327...  65.1    2e-09   
ref|XP_004302905.1|  PREDICTED: uncharacterized protein LOC101293605  65.1    3e-09   
ref|XP_002298219.2|  hypothetical protein POPTR_0001s18390g           64.7    3e-09   Populus trichocarpa [western balsam poplar]
gb|KDP37236.1|  hypothetical protein JCGZ_06292                       64.7    3e-09   
ref|XP_009803774.1|  PREDICTED: uncharacterized protein LOC104249090  64.7    4e-09   
gb|EMT16950.1|  hypothetical protein F775_12779                       64.3    5e-09   
ref|XP_010314287.1|  PREDICTED: uncharacterized protein LOC101268...  63.9    5e-09   
ref|XP_008342674.1|  PREDICTED: uncharacterized protein LOC103405448  63.9    6e-09   
dbj|BAD05342.1|  unknown protein                                      60.8    7e-09   
ref|XP_009338074.1|  PREDICTED: uncharacterized protein LOC103930452  63.9    7e-09   
ref|XP_009338073.1|  PREDICTED: uncharacterized protein LOC103930451  63.9    7e-09   
ref|XP_010050180.1|  PREDICTED: uncharacterized protein LOC104438693  63.9    7e-09   
ref|XP_009615566.1|  PREDICTED: uncharacterized protein LOC104108278  63.5    8e-09   
ref|XP_002528632.1|  conserved hypothetical protein                   63.5    8e-09   
ref|XP_010505210.1|  PREDICTED: uncharacterized protein LOC104782082  63.5    9e-09   
gb|EMT12794.1|  hypothetical protein F775_19997                       63.5    9e-09   
ref|XP_008380919.1|  PREDICTED: uncharacterized protein LOC103443803  63.5    1e-08   
ref|XP_006294156.1|  hypothetical protein CARUB_v10023149mg           63.5    1e-08   
emb|CDY33170.1|  BnaC04g08690D                                        63.2    1e-08   
ref|XP_009143570.1|  PREDICTED: uncharacterized protein LOC103867...  63.2    1e-08   
emb|CDX75027.1|  BnaA05g07730D                                        63.2    1e-08   
ref|XP_009353615.1|  PREDICTED: uncharacterized protein LOC103944864  63.2    1e-08   
ref|XP_002881456.1|  hypothetical protein ARALYDRAFT_902780           62.8    1e-08   
ref|XP_011009831.1|  PREDICTED: uncharacterized protein LOC105114838  62.8    1e-08   
ref|XP_002283988.1|  PREDICTED: uncharacterized protein LOC100240792  62.8    2e-08   
gb|KHN02273.1|  60S ribosomal protein L24                             62.8    2e-08   
ref|XP_004305285.1|  PREDICTED: uncharacterized protein LOC101291554  62.4    2e-08   
ref|XP_003553577.1|  PREDICTED: uncharacterized protein LOC100807336  62.4    2e-08   
ref|XP_004246584.1|  PREDICTED: uncharacterized protein LOC101249675  62.4    2e-08   
ref|XP_006341192.1|  PREDICTED: uncharacterized protein LOC102602443  62.4    2e-08   
ref|XP_007012056.1|  Membrane protein-like, putative                  62.4    3e-08   
ref|XP_006410835.1|  hypothetical protein EUTSA_v10016620mg           62.0    3e-08   
ref|XP_009760234.1|  PREDICTED: uncharacterized protein LOC104212618  62.0    3e-08   
gb|KHG01219.1|  hypothetical protein F383_22307                       61.6    3e-08   
ref|XP_010516887.1|  PREDICTED: uncharacterized protein LOC104792440  61.6    4e-08   
tpg|DAA51123.1|  TPA: hypothetical protein ZEAMMB73_068409            59.3    5e-08   
tpg|DAA61110.1|  TPA: hypothetical protein ZEAMMB73_890925            60.8    5e-08   
ref|XP_003560372.1|  PREDICTED: uncharacterized protein LOC100844938  61.2    6e-08   
ref|XP_011011436.1|  PREDICTED: uncharacterized protein LOC105116...  60.8    6e-08   
ref|XP_004981916.1|  PREDICTED: uncharacterized protein LOC101758770  60.8    6e-08   
ref|NP_001061712.1|  Os08g0387200                                     60.8    7e-08   
ref|XP_006481932.1|  PREDICTED: uncharacterized protein LOC102623178  60.5    8e-08   
ref|XP_006430350.1|  hypothetical protein CICLE_v10011694mg           60.5    8e-08   
ref|XP_007216194.1|  hypothetical protein PRUPE_ppa015991mg           60.5    9e-08   
gb|KDO57298.1|  hypothetical protein CISIN_1g048232mg                 60.5    9e-08   
ref|XP_008387475.1|  PREDICTED: uncharacterized protein LOC103449926  60.5    9e-08   
ref|XP_006838739.1|  hypothetical protein AMTR_s00002p00254220        60.5    1e-07   
gb|EAZ06861.1|  hypothetical protein OsI_29096                        60.5    1e-07   
ref|XP_008241333.1|  PREDICTED: uncharacterized protein LOC103339...  60.1    1e-07   
gb|ACJ86237.1|  unknown                                               58.9    1e-07   
gb|AET04372.2|  sulfite exporter TauE/SafE family protein             60.1    1e-07   
gb|EMS50771.1|  hypothetical protein TRIUR3_13143                     59.7    1e-07   
ref|XP_007202039.1|  hypothetical protein PRUPE_ppa005330mg           60.1    1e-07   
ref|XP_008241334.1|  PREDICTED: uncharacterized protein LOC103339...  60.1    1e-07   
dbj|BAK00649.1|  predicted protein                                    60.1    1e-07   
ref|XP_009340971.1|  PREDICTED: uncharacterized protein LOC103933044  60.1    1e-07   
ref|XP_010243123.1|  PREDICTED: uncharacterized protein LOC104587275  60.1    1e-07   
ref|XP_010235080.1|  PREDICTED: uncharacterized protein LOC100846...  60.1    1e-07   
ref|XP_003629896.1|  hypothetical protein MTR_8g088070                59.7    1e-07   
ref|XP_003574412.1|  PREDICTED: uncharacterized protein LOC100846...  59.7    2e-07   
ref|XP_004303051.1|  PREDICTED: uncharacterized protein LOC101313325  59.7    2e-07   
gb|KHG12656.1|  putative tripeptidyl-peptidase SED4                   59.7    2e-07   
ref|XP_010278281.1|  PREDICTED: uncharacterized protein LOC104612536  59.7    2e-07   
ref|NP_001051136.1|  Os03g0726500                                     59.7    2e-07   
gb|EAY91726.1|  hypothetical protein OsI_13369                        59.7    2e-07   
ref|XP_008353719.1|  PREDICTED: uncharacterized protein LOC103417306  59.7    2e-07   
ref|XP_002463955.1|  hypothetical protein SORBIDRAFT_01g009520        59.3    2e-07   
gb|KDP29233.1|  hypothetical protein JCGZ_16622                       59.3    2e-07   
ref|XP_009394307.1|  PREDICTED: uncharacterized protein LOC103979817  59.3    3e-07   
ref|NP_001168709.1|  uncharacterized protein LOC100382501             58.9    3e-07   
ref|XP_006580862.1|  PREDICTED: uncharacterized protein LOC100818240  58.9    3e-07   
ref|XP_010558974.1|  PREDICTED: uncharacterized protein LOC104827497  58.9    3e-07   
ref|XP_011101500.1|  PREDICTED: uncharacterized protein LOC105179547  58.2    5e-07   
ref|XP_007027568.1|  Sulfite exporter TauE/SafE family protein is...  58.2    6e-07   
ref|XP_006659358.1|  PREDICTED: uncharacterized protein LOC102716712  57.8    7e-07   
ref|XP_007027567.1|  Sulfite exporter TauE/SafE family protein is...  57.8    7e-07   
ref|XP_010936219.1|  PREDICTED: uncharacterized protein LOC105055...  57.4    8e-07   
ref|XP_008228601.1|  PREDICTED: uncharacterized protein LOC103327990  57.4    8e-07   
ref|XP_010936218.1|  PREDICTED: uncharacterized protein LOC105055...  57.4    1e-06   
ref|XP_010050772.1|  PREDICTED: uncharacterized protein LOC104439396  57.0    1e-06   
ref|XP_011018859.1|  PREDICTED: uncharacterized protein LOC105121770  57.0    1e-06   
ref|XP_003574413.1|  PREDICTED: uncharacterized protein LOC100846...  56.6    2e-06   
ref|XP_006381336.1|  hypothetical protein POPTR_0006s11920g           56.6    2e-06   
gb|EAZ42610.1|  hypothetical protein OsJ_27176                        56.6    2e-06   
ref|XP_010527869.1|  PREDICTED: uncharacterized protein LOC104805133  56.6    2e-06   
ref|XP_003590403.1|  hypothetical protein MTR_1g061710                56.6    2e-06   
ref|XP_004498087.1|  PREDICTED: uncharacterized protein LOC101512728  56.6    2e-06   
gb|AES60654.2|  sulfite exporter TauE/SafE family protein             56.6    2e-06   
gb|KEH24088.1|  sulfite exporter TauE/SafE family protein             56.2    2e-06   
gb|KEH24090.1|  sulfite exporter TauE/SafE family protein             56.2    2e-06   
gb|KEH24089.1|  sulfite exporter TauE/SafE family protein             56.2    2e-06   
gb|KEH24085.1|  sulfite exporter TauE/SafE family protein             56.2    2e-06   
ref|XP_006585192.1|  PREDICTED: uncharacterized protein LOC100801244  55.8    3e-06   
ref|XP_008790425.1|  PREDICTED: uncharacterized protein LOC103707634  55.5    4e-06   
ref|XP_008462667.1|  PREDICTED: uncharacterized protein LOC103500970  55.1    5e-06   
ref|XP_004494124.1|  PREDICTED: uncharacterized protein LOC101492516  54.7    7e-06   
ref|XP_009388389.1|  PREDICTED: uncharacterized protein LOC103975...  54.3    1e-05   
ref|XP_009388390.1|  PREDICTED: uncharacterized protein LOC103975...  53.9    1e-05   
gb|KHN48208.1|  hypothetical protein glysoja_007877                   53.9    1e-05   
ref|XP_007145273.1|  hypothetical protein PHAVU_007G225100g           53.5    2e-05   
ref|XP_004143372.1|  PREDICTED: uncharacterized protein LOC101206149  53.5    2e-05   
ref|XP_002460081.1|  hypothetical protein SORBIDRAFT_02g022480        52.8    3e-05   
ref|XP_006588810.1|  PREDICTED: uncharacterized protein LOC100788770  52.4    5e-05   
gb|KHN45702.1|  hypothetical protein glysoja_036851                   52.4    5e-05   
ref|XP_006594178.1|  PREDICTED: uncharacterized protein LOC100804918  52.0    5e-05   
gb|EMS53169.1|  hypothetical protein TRIUR3_09961                     51.6    9e-05   
ref|XP_010526118.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.4    2e-04   
ref|XP_006651766.1|  PREDICTED: uncharacterized protein LOC102721538  49.3    4e-04   
gb|EMT30170.1|  hypothetical protein F775_26300                       48.5    9e-04   



>ref|XP_002309560.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
 gb|EEE93083.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
Length=479

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 8/133 (6%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            GGKWR +R+V+ +  +FLLA + +     E G LK+EA   S ++++  +S + + L + 
Sbjct  5    GGKWRGLRSVLMVLLNFLLAFVFV---SAERG-LKREAT--STRMNETGDSVSSYVLKAV  58

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + +    G++H  VWPE+KFGW+IV+GSIIGF GAAFGSVGGVGGGGIFVPML+L++ 
Sbjct  59   NFLWQPDHKGYQH--VWPEMKFGWQIVLGSIIGFFGAAFGSVGGVGGGGIFVPMLSLVIG  116

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  117  FDPKSATAISKCM  129



>ref|XP_006476094.1| PREDICTED: uncharacterized protein LOC102623437 [Citrus sinensis]
 gb|KDO79724.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=477

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 14/135 (10%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAAL--QSIKLSDANNSDAHHHLL  304
            G KW+ +R+VM I+ +F LA +           +K E  L  ++++ +     D+++ L 
Sbjct  5    GAKWKILRSVMMIFLNFALAFV----------CVKAERGLKIETLRFNGTERQDSNYLLK  54

Query  305  SKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLI  484
            +   + + + SG+ H  VWPELKFGW+IV+G+IIGF GAAFGSVGGVGGGGIFVPML+LI
Sbjct  55   AVNFLWQPEGSGYHH--VWPELKFGWEIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLI  112

Query  485  LRFDPKSATAISKCM  529
            + FDPKSATAISKCM
Sbjct  113  IGFDPKSATAISKCM  127



>ref|XP_006450629.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
 gb|ESR63869.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
Length=477

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 14/135 (10%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAAL--QSIKLSDANNSDAHHHLL  304
            G KW+ +R+VM I+ +F LA +           +K E  L  +++  +     D+++ L 
Sbjct  5    GAKWKILRSVMMIFLNFALAFV----------CVKAERGLKIETLSFNGTERQDSNYLLK  54

Query  305  SKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLI  484
            +   + + + SG+ H  VWPELKFGW+IV+G+IIGF GAAFGSVGGVGGGGIFVPML+LI
Sbjct  55   AVNFLWQPEGSGYHH--VWPELKFGWEIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLI  112

Query  485  LRFDPKSATAISKCM  529
            + FDPKSATAISKCM
Sbjct  113  IGFDPKSATAISKCM  127



>ref|XP_002324818.2| hypothetical protein POPTR_0018s00770g [Populus trichocarpa]
 gb|EEF03383.2| hypothetical protein POPTR_0018s00770g [Populus trichocarpa]
Length=294

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 8/133 (6%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            GGKWR +++V+ +  +FLLA + +     E G L +EA   S +  +  +S + + L + 
Sbjct  5    GGKWRGLKSVLMVLINFLLAFVFV---SAERG-LTREAT--SARTDETGDSVSSYVLKAV  58

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + +    G++H  VWPE+KFGW+IV+GSIIGFLGAAFGSVGGVGGGGIFVPML+LI+ 
Sbjct  59   SCLWQPDQRGYQH--VWPEMKFGWQIVLGSIIGFLGAAFGSVGGVGGGGIFVPMLSLIIG  116

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  117  FDPKSATAISKCM  129



>ref|XP_011019654.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
 ref|XP_011019655.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
Length=479

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 8/133 (6%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            GGKWR +R+V+      L   L  V    E G LK+EA   S ++++  +S + + L + 
Sbjct  5    GGKWRGLRSVLV---VLLNFLLAFVFVSAERG-LKREAT--STRMNETGDSVSSYVLKAV  58

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + +    G++H  VWPE+KFGW+IV+GSIIGF GAAFGSVGGVGGGGIFVPML+L++ 
Sbjct  59   NFLWQPDQKGYQH--VWPEMKFGWQIVLGSIIGFFGAAFGSVGGVGGGGIFVPMLSLVIG  116

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  117  FDPKSATAISKCM  129



>ref|XP_008347683.1| PREDICTED: uncharacterized protein LOC103410796 [Malus domestica]
Length=175

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 10/133 (8%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            G KW+ +R+V  + + F  A + +     E G L+ E +    + +    S++++ L + 
Sbjct  5    GAKWQGLRSVAMVMFHFAAAFVFV---SAERG-LRHEGS----RFNGTEGSESNYLLKAV  56

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + +++ SG+ H  VWPE+KFGW+I+VGSI+GF GAAFGSVGGVGGGGIFVPML+LI+ 
Sbjct  57   NFLWQSEKSGYHH--VWPEMKFGWQIIVGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIIG  114

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  115  FDPKSATAISKCM  127



>emb|CDP16156.1| unnamed protein product [Coffea canephora]
Length=482

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            S + EA+  S + S  N + A+   L  FL +  K SG++H  VWPE+KFGW+IVVG+II
Sbjct  34   SFRNEAS-ASAQNSTGNPASANFSKLLNFLWQADK-SGYQH--VWPEIKFGWQIVVGTII  89

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  90   GFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  130



>ref|XP_007137180.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
 gb|ESW09174.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
Length=468

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 9/97 (9%)
 Frame = +2

Query  257  IKLSDANNSDAHHHLLSKFLMR------ETKDSGHRHSHVWPELKFGWKIVVGSIIgflg  418
            +K+  A+ +   +H    FLMR      ++++SG+RH  VWP+LKFGW+IVVG+ +GF G
Sbjct  25   MKMEGASFNVTENHA-ENFLMRAVNFLWQSQESGYRH--VWPDLKFGWEIVVGTFVGFCG  81

Query  419  aafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AAFGSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  82   AAFGSVGGVGGGGIFVPMLSLIVGFDPKSATAISKCM  118



>ref|XP_009783706.1| PREDICTED: uncharacterized protein LOC104232253 [Nicotiana sylvestris]
Length=478

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 8/102 (8%)
 Frame = +2

Query  227  SLKKEAALQ-SIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSI  403
            SLK+EA  Q + +LSDA+    +   +  FL +  +   H   HVWP++KFGW+IVVG+I
Sbjct  33   SLKREAIAQNATELSDAD----YLSTVVNFLWKPNESGYH---HVWPDMKFGWQIVVGTI  85

Query  404  IgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            IGFLGAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  86   IGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKSSTAISKCM  127



>ref|XP_008220035.1| PREDICTED: uncharacterized protein LOC103320179 [Prunus mume]
Length=476

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            S ++   L++ + +    S++ + L       +++ SG++H  VWPE+KFGW+I+VGSI+
Sbjct  29   SAERGLKLEASRFNGTEGSESDYLLRVVTFFWQSERSGYQH--VWPEMKFGWQIIVGSIV  86

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  87   GFCGAAFGSVGGVGGGGIFVPMLSLIMGFDPKSATAISKCM  127



>ref|XP_011026589.1| PREDICTED: uncharacterized protein LOC105127137 [Populus euphratica]
Length=479

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 8/133 (6%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            GGKWR +++V+ +  +FLLA + +     E G L +EA   S +  +  +S + + L + 
Sbjct  5    GGKWRGLKSVLMVLINFLLAFVFV---SAERG-LTREAT--SARTDETGDSVSSYALKAV  58

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + +    G++H  VWPE+KFGW+IV+GS IGFL AAFGSVGGVGGGGIFVPML LI+ 
Sbjct  59   SFLWQPDQQGYQH--VWPEMKFGWQIVLGSTIGFLSAAFGSVGGVGGGGIFVPMLRLIIG  116

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  117  FDPKSATAISKCM  129



>ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46455.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = +2

Query  221  SGSLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHR----HSHVWPELKFGWKI  388
            S ++  EA  Q    SD N+ D      S FLMR       +    ++HVWP++KFGW+I
Sbjct  28   SMTIVSEARQQQEGSSDRNSEDVE----SAFLMRVVNFLWQKGQLGYTHVWPDMKFGWQI  83

Query  389  VVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            VVGSIIGF GAAFGSVGGVGGGGIFVPMLTLI+ FD KS+TAISKCM
Sbjct  84   VVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKCM  130



>ref|XP_009396550.1| PREDICTED: uncharacterized protein LOC103981523 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +2

Query  251  QSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafg  430
            + +KL + N +      + + L R  ++ G  +SHVWP +KF W+I VGS+IGFLGAA G
Sbjct  32   RGLKLMNPNINTIARGEMKRALKRSQQEDGSSYSHVWPAMKFEWRIAVGSVIGFLGAALG  91

Query  431  svggvggggIFVPMLTLILRFDPKSATAISKCM  529
            SVGGVGGGGIFVPMLTLI+ FDPKS+TA+SKCM
Sbjct  92   SVGGVGGGGIFVPMLTLIIGFDPKSSTALSKCM  124



>ref|XP_006366208.1| PREDICTED: uncharacterized protein LOC102587808 isoform X2 [Solanum 
tuberosum]
Length=474

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 6/101 (6%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLKKE   Q+      + SDA   LL+  +    K +   + HVWPE+KFGW+I+VGSII
Sbjct  33   SLKKEIVAQN----ATHQSDAD--LLTSVVQFLWKPNESGYQHVWPEMKFGWQIIVGSII  86

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  87   GFLGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  127



>ref|XP_006366207.1| PREDICTED: uncharacterized protein LOC102587808 isoform X1 [Solanum 
tuberosum]
Length=476

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 6/101 (6%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLKKE   Q+      + SDA   LL+  +    K +   + HVWPE+KFGW+I+VGSII
Sbjct  33   SLKKEIVAQN----ATHQSDAD--LLTSVVQFLWKPNESGYQHVWPEMKFGWQIIVGSII  86

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  87   GFLGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  127



>ref|XP_009367912.1| PREDICTED: uncharacterized protein LOC103957476 [Pyrus x bretschneideri]
Length=475

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = +2

Query  248  LQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            L+  + +    S++++   +   + +++ SG+ H  VWPE+KFGW+IVVGSI+GF GAAF
Sbjct  36   LEGSRFNGTEGSESNYFFKAVNFLWQSEKSGYHH--VWPEMKFGWQIVVGSIVGFCGAAF  93

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  94   GSVGGVGGGGIFVPMLSLIIGFDPKSATAISKCM  127



>ref|XP_008393890.1| PREDICTED: uncharacterized protein LOC103456039 [Malus domestica]
 ref|XP_008352023.1| PREDICTED: uncharacterized protein LOC103415470 [Malus domestica]
Length=489

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = +2

Query  248  LQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            L+  + +    S++++   +   + +++ SG+ H  VWPE+KFGW+IVVGSI+GF GAAF
Sbjct  36   LEGSRFNGTEGSESNYFFKAVNFLWQSEKSGYHH--VWPEMKFGWQIVVGSIVGFCGAAF  93

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  94   GSVGGVGGGGIFVPMLSLIIGFDPKSATAISKCM  127



>ref|XP_010313606.1| PREDICTED: uncharacterized protein LOC101255958 [Solanum lycopersicum]
Length=477

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (74%), Gaps = 12/134 (9%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQ-SIKLSDANNSDAHHHLLS  307
            GGK++ +R V+ I WSFLLA++ +         +K+E   Q + +LSDA+   A    ++
Sbjct  5    GGKFKILRPVLSILWSFLLAAVFVSAERR----IKREVIEQNAAELSDADYLSA----VA  56

Query  308  KFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLIL  487
             FL R  K SG++H  VWP++KFGW+IV+GS IGFLGAAFGSVGGVGGGGIFVPML+LI+
Sbjct  57   NFLWRPNK-SGYQH--VWPDMKFGWQIVLGSTIGFLGAAFGSVGGVGGGGIFVPMLSLIV  113

Query  488  RFDPKSATAISKCM  529
             FDPKSATAISKCM
Sbjct  114  GFDPKSATAISKCM  127



>ref|XP_008347633.1| PREDICTED: uncharacterized protein LOC103410743 isoform X1 [Malus 
domestica]
Length=476

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 10/133 (8%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            G KW+ +R+V  + + F  A + +     E G L+ E +    + +    S++++ L + 
Sbjct  5    GAKWQGLRSVAMVMFHFAAAFVFV---SAERG-LRXEGS----RFNGTEGSESNYLLKAV  56

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + +++ SG+ H  VWPE+KFGW+I+VGSI+GF GAAFGSVGGVGGGGIFVPML+LI+ 
Sbjct  57   NFLWQSEKSGYHH--VWPEMKFGWQIIVGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIIG  114

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  115  FDPKSATAISKCM  127



>ref|XP_009592783.1| PREDICTED: uncharacterized protein LOC104089559 isoform X3 [Nicotiana 
tomentosiformis]
Length=399

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H    ++    F +   K   H H HVWPEL+FGW+++VGS+IGF GAAFGSVG
Sbjct  32   SNNGTIHSTDSYYFFDLFSLLWKKSEMHYH-HVWPELEFGWRVIVGSVIGFFGAAFGSVG  90

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  91   GVGGGGIFVPMLTLIIGFDPKTSTAISKCM  120



>ref|XP_009788571.1| PREDICTED: uncharacterized protein LOC104236361 [Nicotiana sylvestris]
Length=479

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  314  LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRF  493
            L+R   +    + HVWPE+KFGWKI+VGSI+GF GAA GSVGGVGGGGIFVPMLTLI+ F
Sbjct  63   LLRFLWNGKSTYEHVWPEMKFGWKIIVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGF  122

Query  494  DPKSATAISKCM  529
            DPKS+TAISKCM
Sbjct  123  DPKSSTAISKCM  134



>ref|XP_009592782.1| PREDICTED: uncharacterized protein LOC104089559 isoform X2 [Nicotiana 
tomentosiformis]
Length=456

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H    ++    F +   K   H H HVWPEL+FGW+++VGS+IGF GAAFGSVG
Sbjct  32   SNNGTIHSTDSYYFFDLFSLLWKKSEMHYH-HVWPELEFGWRVIVGSVIGFFGAAFGSVG  90

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  91   GVGGGGIFVPMLTLIIGFDPKTSTAISKCM  120



>ref|XP_009592781.1| PREDICTED: uncharacterized protein LOC104089559 isoform X1 [Nicotiana 
tomentosiformis]
Length=473

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H    ++    F +   K   H H HVWPEL+FGW+++VGS+IGF GAAFGSVG
Sbjct  32   SNNGTIHSTDSYYFFDLFSLLWKKSEMHYH-HVWPELEFGWRVIVGSVIGFFGAAFGSVG  90

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  91   GVGGGGIFVPMLTLIIGFDPKTSTAISKCM  120



>gb|KDP34212.1| hypothetical protein JCGZ_07783 [Jatropha curcas]
Length=477

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 93/137 (68%), Gaps = 16/137 (12%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            GGKWR +R+V+ + ++ L+A +++         LK+E +   +   +A+        LS 
Sbjct  5    GGKWRGLRSVLMVSFNILVAFMLV----SADRGLKREISGVQVTQEEAS--------LSS  52

Query  311  FLMRET----KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
            +L++      +     + HVWP++KFGW+IV+G+IIGF GAAFGSVGGVGGGGIF+PMLT
Sbjct  53   YLVKAVDFLWQPDQTSYKHVWPDMKFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFIPMLT  112

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKSATAISKCM
Sbjct  113  LIVGFDPKSATAISKCM  129



>gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=481

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLKKE + +    +  ++SD    +++   + +  +SG+ H  VWP+LKF WKIVVGSII
Sbjct  33   SLKKEYSSRIAIETRDSDSDILTSVVN--FLWQGNNSGYHH--VWPDLKFNWKIVVGSII  88

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPMLTLI+ FDPKSATAISKCM
Sbjct  89   GFLGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKCM  129



>ref|XP_007222835.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
 gb|EMJ24034.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
Length=476

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            S ++   L++ + +    S++ + L       +++ SG++H  VWPE+KFGW+I+ GSI+
Sbjct  29   SAERGLKLEASRFNGTEGSESDYLLRVVTFFWQSERSGYQH--VWPEMKFGWQIIAGSIV  86

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  87   GFCGAAFGSVGGVGGGGIFVPMLSLIMGFDPKSATAISKCM  127



>ref|XP_009631525.1| PREDICTED: uncharacterized protein LOC104121277 [Nicotiana tomentosiformis]
Length=480

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  314  LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRF  493
            L+R   +    + HVWPE+KFGW+I+VGSI+GF GAA GSVGGVGGGGIFVPMLTLI+ F
Sbjct  63   LLRLMWNGKSSYEHVWPEMKFGWRIIVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGF  122

Query  494  DPKSATAISKCM  529
            DPKS+TAISKCM
Sbjct  123  DPKSSTAISKCM  134



>ref|XP_009791161.1| PREDICTED: uncharacterized protein LOC104238494 [Nicotiana sylvestris]
Length=483

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLK+E    +   +    SDA++       + +  +SG++H  VWP++KFGWKIVVGSII
Sbjct  33   SLKREQIYNN--ATHQQQSDANYLTDVVNFLWKPNESGYQH--VWPDMKFGWKIVVGSII  88

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  89   GFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKSSTAISKCM  129



>gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=477

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLKKE + +    +  ++SD    +++   + +  +SG+ H  VWP+LKF WKIVVGSII
Sbjct  33   SLKKEYSSRIAIETRDSDSDILTSVVN--FLWQGNNSGYHH--VWPDLKFNWKIVVGSII  88

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPMLTLI+ FDPKSATAISKCM
Sbjct  89   GFLGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKCM  129



>ref|XP_009611258.1| PREDICTED: uncharacterized protein LOC104104795 isoform X4 [Nicotiana 
tomentosiformis]
Length=382

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRQKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_009611256.1| PREDICTED: uncharacterized protein LOC104104795 isoform X2 [Nicotiana 
tomentosiformis]
Length=453

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRQKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_009623066.1| PREDICTED: uncharacterized protein LOC104114346 [Nicotiana tomentosiformis]
Length=483

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLK+E    +   +    SDA++       + +  +SG++H  VWP++KFGWKI+VGSII
Sbjct  33   SLKREQTYNN--ATHQQQSDANYLTDVVNFLWKPNESGYQH--VWPDMKFGWKIIVGSII  88

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  89   GFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKSSTAISKCM  129



>emb|CAN61520.1| hypothetical protein VITISV_033969 [Vitis vinifera]
Length=382

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            S+K EA+  ++      NS+    +++   + ++  SG++H  VWPE++FGW+IVVGSII
Sbjct  92   SIKHEASTFNVTKEAGFNSNYLSKVVN--FLWQSDRSGYQH--VWPEMEFGWQIVVGSII  147

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+L++ FDPKSATA+SKCM
Sbjct  148  GFFGAAFGSVGGVGGGGIFVPMLSLVIGFDPKSATALSKCM  188



>ref|XP_011081835.1| PREDICTED: uncharacterized protein LOC105164774 [Sesamum indicum]
Length=480

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 6/101 (6%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLK+E    S+  S A++SD+    LS F+    + +   + HVWP+LKF W+IVVGSII
Sbjct  33   SLKQE----SLSRSAAHDSDSD--FLSTFVNFIWQANKSGYHHVWPDLKFNWQIVVGSII  86

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  87   GFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATAISKCM  127



>ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45912.1| conserved hypothetical protein [Ricinus communis]
Length=476

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 17/137 (12%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvl----aDEESGSLKKEAALQSIKLSDANNSDAHHH  298
            GGKWR +R+V+ +  +FLLA +++        E +G+ + E    S     A +      
Sbjct  6    GGKWRGLRSVLMVSLNFLLAFVLVSAERGMRREFTGTPQTEGEGLSTYFVKAVD------  59

Query  299  LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
                  + +   +G+RH  VWPE++FGW+IV+G+IIGF GAAFGSVGGVGGGGIFVPML+
Sbjct  60   -----FLWQPDQTGYRH--VWPEMRFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLS  112

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKSATAISKCM
Sbjct  113  LIIGFDPKSATAISKCM  129



>ref|XP_009611253.1| PREDICTED: uncharacterized protein LOC104104795 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611254.1| PREDICTED: uncharacterized protein LOC104104795 isoform X1 [Nicotiana 
tomentosiformis]
Length=482

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRQKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_009611257.1| PREDICTED: uncharacterized protein LOC104104795 isoform X3 [Nicotiana 
tomentosiformis]
Length=435

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRQKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_004501773.1| PREDICTED: uncharacterized protein LOC101498079 [Cicer arietinum]
Length=484

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  224  GSLKKEAALQSIKLSDANNSDA---HHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVV  394
            G +  E  L  I++S  N +      H+ L+K +    +  G  + HVWP++KFGW++V+
Sbjct  32   GIVSGERRLMKIEVSSFNVTTQKHEQHNFLTKAVNFLWQTDGSGYQHVWPDMKFGWQLVL  91

Query  395  GSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GS IGF GAAFGSVGGVGGGGIFVPML+L++ FDPKS+TAISKCM
Sbjct  92   GSFIGFCGAAFGSVGGVGGGGIFVPMLSLVIGFDPKSSTAISKCM  136



>ref|XP_010113488.1| hypothetical protein L484_026823 [Morus notabilis]
 gb|EXC35515.1| hypothetical protein L484_026823 [Morus notabilis]
Length=460

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            ++ FL +  K S   + HVWPE++FGWKIVVGSI+GF GAA GSVGGVGGGGIFVPMLTL
Sbjct  61   VAHFLWQSGKSS---YQHVWPEMEFGWKIVVGSIVGFFGAALGSVGGVGGGGIFVPMLTL  117

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  118  IVGFDPKSSTAISKCM  133



>ref|XP_007202022.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
 gb|EMJ03221.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
Length=482

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  284  DAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIF  463
            D H     K +    +  G  +  VWPE+KFGWKIVVGSI+GF GAA GSVGGVGGGGIF
Sbjct  55   DIHEAFFVKVVNFLWQAGGSSYQPVWPEMKFGWKIVVGSIVGFFGAALGSVGGVGGGGIF  114

Query  464  VPMLTLILRFDPKSATAISKCM  529
            VPML LI+ FDPKS+TAISKCM
Sbjct  115  VPMLALIIGFDPKSSTAISKCM  136



>ref|XP_008241663.1| PREDICTED: uncharacterized protein LOC103340075 [Prunus mume]
Length=482

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  284  DAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIF  463
            D H     K +    +  G  +  VWPE+KFGWKIVVGSI+GF GAA GSVGGVGGGGIF
Sbjct  55   DIHEAFFVKVVNFLWQAGGSSYQPVWPEMKFGWKIVVGSIVGFFGAALGSVGGVGGGGIF  114

Query  464  VPMLTLILRFDPKSATAISKCM  529
            VPML LI+ FDPKS+TAISKCM
Sbjct  115  VPMLALIIGFDPKSSTAISKCM  136



>ref|XP_004956625.1| PREDICTED: uncharacterized protein LOC101768056 [Setaria italica]
Length=468

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
            +SG+ + HVWP +KFGW+IV+G++IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+T
Sbjct  54   NSGNTYQHVWPPMKFGWRIVLGTLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSST  113

Query  512  AISKCM  529
            AISKCM
Sbjct  114  AISKCM  119



>ref|XP_009777900.1| PREDICTED: uncharacterized protein LOC104227363 isoform X2 [Nicotiana 
sylvestris]
Length=454

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRLKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GS GGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSAGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_009627765.1| PREDICTED: uncharacterized protein LOC104118259 [Nicotiana tomentosiformis]
Length=478

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 79/102 (77%), Gaps = 8/102 (8%)
 Frame = +2

Query  227  SLKKEAALQS-IKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSI  403
            SL++EA  QS  +LSDA+    +   +  FL +  +   H   HVWP++KFGW+IV+G++
Sbjct  33   SLRREAIAQSATELSDAD----YLSTVVNFLWKPNESGYH---HVWPDMKFGWQIVLGTL  85

Query  404  IgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            IGFLGAAFGSVGGVGGGGIFVPML+L++ FDPKS+TAISKCM
Sbjct  86   IGFLGAAFGSVGGVGGGGIFVPMLSLVVGFDPKSSTAISKCM  127



>ref|XP_006340268.1| PREDICTED: uncharacterized protein LOC102587334 [Solanum tuberosum]
Length=477

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 12/134 (9%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQ-SIKLSDANNSDAHHHLLS  307
            GGK + +R V+ I WSFLLA++ +         +K+E   Q + +LSDA+   A  + L 
Sbjct  5    GGKLKILRPVLSILWSFLLAAIFVSAERR----IKREVIEQNAAELSDADYLSAVANFLW  60

Query  308  KFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLIL  487
            K       +SG++H  VWP++KFGW+IV+GS IGFLGAAFGSVGGVGGGGIFVPML+LI+
Sbjct  61   K-----PNESGYQH--VWPDMKFGWQIVLGSTIGFLGAAFGSVGGVGGGGIFVPMLSLIV  113

Query  488  RFDPKSATAISKCM  529
             FDPKSATAISKCM
Sbjct  114  GFDPKSATAISKCM  127



>ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera]
 emb|CBI20891.3| unnamed protein product [Vitis vinifera]
Length=478

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            S+K EA+  ++      NS+    +++   + ++  SG++H  VWPE++FGW+IVVGS+I
Sbjct  29   SIKHEASTFNVTKEAGFNSNYLSKVVN--FLWQSDRSGYQH--VWPEMEFGWQIVVGSVI  84

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+L++ FDPKSATA+SKCM
Sbjct  85   GFFGAAFGSVGGVGGGGIFVPMLSLVIGFDPKSATALSKCM  125



>ref|XP_009777905.1| PREDICTED: uncharacterized protein LOC104227363 isoform X5 [Nicotiana 
sylvestris]
Length=383

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRLKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GS GGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSAGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_011011435.1| PREDICTED: uncharacterized protein LOC105116005 isoform X2 [Populus 
euphratica]
Length=475

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            S    +++H  +    L+RE    G+  +HVWPE++FGWKIV+GSIIGF GAA GSVGGV
Sbjct  40   SRTGGTESHRAMRMLSLVREKGRVGY--THVWPEMRFGWKIVMGSIIGFFGAACGSVGGV  97

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML+LI+ FD KSATA+SKCM
Sbjct  98   GGGGIFVPMLSLIIGFDTKSATAMSKCM  125



>ref|XP_009777896.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777897.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777898.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777899.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRLKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GS GGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSAGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_002299704.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
 gb|EEE84509.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
Length=475

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            S    +++H  +    L+RE    G+  +HVWPE++FGWKIV+GSIIGF GAA GSVGGV
Sbjct  40   SRTGGTESHRAMRMLSLVREKGRVGY--THVWPEMRFGWKIVLGSIIGFFGAACGSVGGV  97

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML+LI+ FD KSATA+SKCM
Sbjct  98   GGGGIFVPMLSLIIGFDTKSATAMSKCM  125



>ref|XP_004291206.1| PREDICTED: uncharacterized protein LOC101310663 [Fragaria vesca 
subsp. vesca]
Length=473

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 10/133 (8%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            G KWR VR+V C+       + V + A+       +   L+S +  + + S   +   + 
Sbjct  5    GAKWRGVRSV-CMVLFNFAVAFVCIKAE-------RGLRLESARFDEDSVSGNDYLFRAV  56

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
              + ++   G+RH  VWPE+KFGW+IVVGS IGF GAAFGSVGGVGGGGIFVPML+LI+ 
Sbjct  57   NFLWQSDKVGYRH--VWPEMKFGWQIVVGSAIGFFGAAFGSVGGVGGGGIFVPMLSLIVG  114

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  115  FDPKSATAISKCM  127



>ref|XP_004245262.1| PREDICTED: uncharacterized protein LOC101258883 [Solanum lycopersicum]
Length=476

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 6/101 (6%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLKKE   Q+      + SDA   LL+  +    K     + HVWP++KFGW+I+VGSII
Sbjct  33   SLKKEIVAQN----ATHQSDAD--LLTSVVQFLWKPDESGYQHVWPDMKFGWEIIVGSII  86

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GFLGAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  87   GFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKSSTAISKCM  127



>ref|XP_011011433.1| PREDICTED: uncharacterized protein LOC105116005 isoform X1 [Populus 
euphratica]
Length=497

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            S    +++H  +    L+RE    G+  +HVWPE++FGWKIV+GSIIGF GAA GSVGGV
Sbjct  62   SRTGGTESHRAMRMLSLVREKGRVGY--THVWPEMRFGWKIVMGSIIGFFGAACGSVGGV  119

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML+LI+ FD KSATA+SKCM
Sbjct  120  GGGGIFVPMLSLIIGFDTKSATAMSKCM  147



>ref|XP_009777901.1| PREDICTED: uncharacterized protein LOC104227363 isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  KLSDANNSDAHH----HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            +++ +NN   H     ++ + F +   K   H H HVWPEL+ GW+++VGSIIGF  AA 
Sbjct  38   RITLSNNGTTHDFESGYVFNLFNILRLKAEMHYH-HVWPELQVGWRVIVGSIIGFFAAAL  96

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GS GGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  97   GSAGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  130



>ref|XP_008799063.1| PREDICTED: uncharacterized protein LOC103713782 [Phoenix dactylifera]
Length=477

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            ++ FL +  + S   + HVWP +KFGWKI+VGSIIGF GAAFGSVGGVGGGGIFVPMLTL
Sbjct  57   VANFLWQPNESS---YQHVWPPMKFGWKIIVGSIIGFFGAAFGSVGGVGGGGIFVPMLTL  113

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  114  IIGFDPKSSTAISKCM  129



>ref|XP_010049082.1| PREDICTED: uncharacterized protein LOC104437756 [Eucalyptus grandis]
 gb|KCW81533.1| hypothetical protein EUGRSUZ_C02892 [Eucalyptus grandis]
Length=477

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 8/82 (10%)
 Frame = +2

Query  302  LSKFLMR------ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIF  463
            L  FL R      ++  +G++H  VWPE+KFGW+IVVG++IGFLGAAFGSVGGVGGGGIF
Sbjct  48   LPNFLSRAVDFLWQSDQTGYQH--VWPEMKFGWQIVVGTVIGFLGAAFGSVGGVGGGGIF  105

Query  464  VPMLTLILRFDPKSATAISKCM  529
            VPML+LI+ FDPKSATAISKCM
Sbjct  106  VPMLSLIMGFDPKSATAISKCM  127



>ref|XP_007046968.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
 gb|EOX91125.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
Length=443

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +2

Query  269  DANNSDAHHHLL--SKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvgg  442
            D  N +    L+  + FL +  K S   +  VWPEL+FGWKIVVGSI+GFLGAA GSVGG
Sbjct  46   DNENENTRGLLVRVANFLWQGGKSS---YEPVWPELEFGWKIVVGSIVGFLGAALGSVGG  102

Query  443  vggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  103  VGGGGIFVPMLTLIIGFDPKSSTAISKCM  131



>gb|ABR16391.1| unknown [Picea sitchensis]
Length=157

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +2

Query  212  DEESGSLKKEAALQSIKLSDANNSDAHHHLLSK-FLMRETKDSGHRHSHVWPELKFGWKI  388
            D  S S + E +++ I      N+  +H L ++ FL R       R   VWPE+KFGW+I
Sbjct  35   DGNSASSETERSMEKIVDPVEGNTLKYHVLKARNFLWRSNISDYQR---VWPEMKFGWRI  91

Query  389  VVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            V+GSI+GF GAA GSVGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  92   VIGSIVGFFGAAVGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKC  137



>ref|XP_010048100.1| PREDICTED: uncharacterized protein LOC104436943 [Eucalyptus grandis]
 gb|KCW80234.1| hypothetical protein EUGRSUZ_C01581 [Eucalyptus grandis]
Length=480

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  + HVWPE++ GW+IVVGSI+GFLGAAFGSVGGVGGGGIFVPMLTLI+ FDPKSA
Sbjct  64   QSDGGGYQHVWPEMELGWQIVVGSIVGFLGAAFGSVGGVGGGGIFVPMLTLIVGFDPKSA  123

Query  509  TAISKCM  529
            TAISKCM
Sbjct  124  TAISKCM  130



>ref|XP_007046967.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX91124.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=476

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +2

Query  269  DANNSDAHHHLL--SKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvgg  442
            D  N +    L+  + FL +  K S   +  VWPEL+FGWKIVVGSI+GFLGAA GSVGG
Sbjct  46   DNENENTRGLLVRVANFLWQGGKSS---YEPVWPELEFGWKIVVGSIVGFLGAALGSVGG  102

Query  443  vggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  103  VGGGGIFVPMLTLIIGFDPKSSTAISKCM  131



>ref|XP_010526181.1| PREDICTED: uncharacterized protein LOC104803812 isoform X1 [Tarenaya 
hassleriana]
Length=478

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            G KWR +R+V+ I  +F LA   +        +L+ EA+  S+   D+      H+   +
Sbjct  5    GSKWRVMRSVVVIAVNFALAFAFVSAER----NLRGEAS--SV---DSEMQGVFHNYFLR  55

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
             +    K  G  + HVWPE++F W+IVVG+++GF GAAFGSVGGVGGGGIFVPML+LI+ 
Sbjct  56   AVNFLWKSDGRGYHHVWPEMEFNWEIVVGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIG  115

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  116  FDPKSATAISKCM  128



>ref|XP_010526182.1| PREDICTED: uncharacterized protein LOC104803812 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +2

Query  131  GGKWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSK  310
            G KWR +R+V+ I  +F LA   +        +L+ EA+  S+   D+      H+   +
Sbjct  5    GSKWRVMRSVVVIAVNFALAFAFVSAER----NLRGEAS--SV---DSEMQGVFHNYFLR  55

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
             +    K  G  + HVWPE++F W+IVVG+++GF GAAFGSVGGVGGGGIFVPML+LI+ 
Sbjct  56   AVNFLWKSDGRGYHHVWPEMEFNWEIVVGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIG  115

Query  491  FDPKSATAISKCM  529
            FDPKSATAISKCM
Sbjct  116  FDPKSATAISKCM  128



>ref|XP_010249715.1| PREDICTED: uncharacterized protein LOC104592187 [Nelumbo nucifera]
Length=481

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 6/92 (7%)
 Frame = +2

Query  266  SDANNS--DAHHHLLSKFL--MRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgs  433
            +  NN   D     L K +  + ++ +SG++H  VWPE+KFGWK++VG+IIGF GAAFGS
Sbjct  38   ASGNNGTRDGESDYLLKIINFLWQSGESGYQH--VWPEMKFGWKVIVGTIIGFCGAAFGS  95

Query  434  vggvggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGVGGGGIFVPMLTLI+ FD KS+TAISKCM
Sbjct  96   VGGVGGGGIFVPMLTLIIGFDAKSSTAISKCM  127



>ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum]
Length=476

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +2

Query  254  SIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgs  433
            +  +S   N++   H  +  L+         + HVWPE++FGW+++VGSI+GF GAA GS
Sbjct  40   TYNISYVENNEMRPHGFAVRLVHFLWSGKSSYEHVWPEMEFGWRVIVGSIVGFFGAALGS  99

Query  434  vggvggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGVGGGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  100  VGGVGGGGIFVPMLTLIIGFDPKSSTAISKCM  131



>gb|KEH35984.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=419

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  239  EAALQSIKLSDANNSDAHHHLLSKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSII  406
            E  L  I+L   N +         FL +      K  G  + HVWPE++FGW+IV+GS I
Sbjct  26   ERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSGYQHVWPEMEFGWQIVLGSFI  85

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  86   GFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  126



>ref|XP_008795085.1| PREDICTED: uncharacterized protein LOC103710932 [Phoenix dactylifera]
Length=411

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 9/131 (7%)
 Frame = +2

Query  137  KWRFVRAVMCIwwsfllaslvlvlaDEESGSLKKEAALQSIKLSDANNSDAHHHLLSKFL  316
            KW +   V+C+ +    A         E G  K EA+   + + +   +  +      FL
Sbjct  8    KWLWPVVVICLSFLLTAAMA-----SAERGP-KSEASGDDVSVEEEMGASDYLLKAVNFL  61

Query  317  MRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFD  496
             +  + S H   HVWP ++FGWKI++GSIIGF GAAFGSVGGVGGGGIFVPMLTLI+ FD
Sbjct  62   WQPNESSYH---HVWPPMRFGWKIIMGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFD  118

Query  497  PKSATAISKCM  529
            PKS+TAISKCM
Sbjct  119  PKSSTAISKCM  129



>ref|NP_001145740.1| uncharacterized protein LOC100279247 [Zea mays]
 gb|ACL52495.1| unknown [Zea mays]
 tpg|DAA61109.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=291

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  GHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAI  517
            G+ + HVWP ++FGW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+TAI
Sbjct  57   GNSYQHVWPPMEFGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSSTAI  116

Query  518  SKCM  529
            SKCM
Sbjct  117  SKCM  120



>gb|ABR16333.1| unknown [Picea sitchensis]
Length=505

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = +2

Query  212  DEESGSLKKEAALQSIKLSDANNSDAHHHLLSK-FLMRETKDSGHRHSHVWPELKFGWKI  388
            D  S S + E +++ I      N+  +H L ++ FL R       R   VWPE+KFGW+I
Sbjct  35   DGNSASSETERSMEKIVDPVEGNTLKYHLLKARNFLWRSNISDYQR---VWPEMKFGWRI  91

Query  389  VVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            V+GSI+GF GAA GSVGGVGGGGIFVPMLTLI+ FD KS+TAISKCM
Sbjct  92   VIGSIVGFFGAAVGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKCM  138



>ref|XP_010649158.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera]
 emb|CBI17534.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +2

Query  278  NSDAHHHLLSK---FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvg  448
            N +     LSK   FL +  K S   + HVWP++KFGWK+VV SIIGF GAA GSVGGVG
Sbjct  51   NKNKEPGFLSKVVHFLWQSGKSS---YQHVWPDMKFGWKLVVASIIGFFGAALGSVGGVG  107

Query  449  gggIFVPMLTLILRFDPKSATAISKCM  529
            GGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  108  GGGIFVPMLTLIVGFDPKSSTAISKCM  134



>ref|XP_006833308.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
 gb|ERM98586.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
Length=477

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +2

Query  242  AALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflga  421
            +A +++ L      + H +   K +    + +   + HVWPE++FGW+IV+G+IIGF GA
Sbjct  29   SAERNLVLRSPEKEEMHGNFALKLVNFLWQPNQSNYEHVWPEMEFGWRIVLGTIIGFFGA  88

Query  422  afgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AFGSVGGVGGGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  89   AFGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCM  124



>ref|XP_002324817.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
 gb|EEF03382.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
Length=474

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +2

Query  260  KLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +LS+A   + ++ +     + ++ +SG++H  VWPEL F W+ V+G+IIGF GAAFGSVG
Sbjct  40   RLSEAEELEPNYLVKIISFLWQSDESGYQH--VWPELSFNWQAVIGTIIGFFGAAFGSVG  97

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FDPKSATAISKCM
Sbjct  98   GVGGGGIFVPMLTLIIGFDPKSATAISKCM  127



>ref|XP_006343068.1| PREDICTED: uncharacterized protein LOC102587876 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343069.1| PREDICTED: uncharacterized protein LOC102587876 isoform X2 [Solanum 
tuberosum]
 ref|XP_006343070.1| PREDICTED: uncharacterized protein LOC102587876 isoform X3 [Solanum 
tuberosum]
Length=483

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAHHH----LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H +    L   F +   K   H H HVWPEL+FGW+++VGS+IGF GAAFGSVG
Sbjct  42   SNNGTTHSYESSYLFDLFNIFWRKSEIHYH-HVWPELEFGWRLIVGSVIGFFGAAFGSVG  100

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVP+LTLI+ FDPK++TAISKCM
Sbjct  101  GVGGGGIFVPVLTLIIGFDPKTSTAISKCM  130



>ref|XP_009800426.1| PREDICTED: uncharacterized protein LOC104246320 isoform X2 [Nicotiana 
sylvestris]
Length=456

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H    ++    F + +     H H HVWPEL+ GW+++VGS+IGF GAAFGSVG
Sbjct  32   SNNGTTHSTDSYYFFDLFNLLQKMSEMHYH-HVWPELECGWRVIVGSVIGFFGAAFGSVG  90

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  91   GVGGGGIFVPMLTLIIGFDPKTSTAISKCM  120



>ref|XP_002303288.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
 gb|EEE78267.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
Length=485

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  HRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAIS  520
            + ++HVWP++KFGWKIVVG+IIGF GAA GSVGGVGGGGIFVPMLTLI+ FD KS+TAIS
Sbjct  70   YGYTHVWPDMKFGWKIVVGTIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKSSTAIS  129

Query  521  KCM  529
            KCM
Sbjct  130  KCM  132



>ref|XP_009800425.1| PREDICTED: uncharacterized protein LOC104246320 isoform X1 [Nicotiana 
sylvestris]
Length=473

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H    ++    F + +     H H HVWPEL+ GW+++VGS+IGF GAAFGSVG
Sbjct  32   SNNGTTHSTDSYYFFDLFNLLQKMSEMHYH-HVWPELECGWRVIVGSVIGFFGAAFGSVG  90

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  91   GVGGGGIFVPMLTLIIGFDPKTSTAISKCM  120



>gb|KEH35985.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=456

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  239  EAALQSIKLSDANNSDAHHHLLSKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSII  406
            E  L  I+L   N +         FL +      K  G  + HVWPE++FGW+IV+GS I
Sbjct  26   ERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSGYQHVWPEMEFGWQIVLGSFI  85

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  86   GFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  126



>gb|KHG02837.1| ATP synthase subunit delta [Gossypium arboreum]
Length=469

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +D    +  VWPE+KFGWKIVVGSI+GFLGAA GSVGGVGGGGIFVPML+LI+ FDPKS+
Sbjct  58   QDGKSAYEPVWPEMKFGWKIVVGSIVGFLGAALGSVGGVGGGGIFVPMLSLIIGFDPKSS  117

Query  509  TAISKCM  529
            TAISKCM
Sbjct  118  TAISKCM  124



>ref|XP_009356692.1| PREDICTED: uncharacterized protein LOC103947501 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349999.1| PREDICTED: uncharacterized protein LOC103941518 isoform X2 [Pyrus 
x bretschneideri]
Length=475

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  +  VWPE+KFGWKIVVGS++GF GAA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  63   QAGGSSYQPVWPEMKFGWKIVVGSVVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSS  122

Query  509  TAISKCM  529
            TAISKCM
Sbjct  123  TAISKCM  129



>ref|XP_003636475.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
 gb|KEH35983.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  239  EAALQSIKLSDANNSDAHHHLLSKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSII  406
            E  L  I+L   N +         FL +      K  G  + HVWPE++FGW+IV+GS I
Sbjct  26   ERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSGYQHVWPEMEFGWQIVLGSFI  85

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  86   GFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  126



>ref|XP_009356691.1| PREDICTED: uncharacterized protein LOC103947501 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349998.1| PREDICTED: uncharacterized protein LOC103941518 isoform X1 [Pyrus 
x bretschneideri]
Length=477

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  +  VWPE+KFGWKIVVGS++GF GAA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  63   QAGGSSYQPVWPEMKFGWKIVVGSVVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSS  122

Query  509  TAISKCM  529
            TAISKCM
Sbjct  123  TAISKCM  129



>ref|XP_003636476.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
Length=480

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  239  EAALQSIKLSDANNSDAHHHLLSKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSII  406
            E  L  I+L   N +         FL +      K  G  + HVWPE++FGW+IV+GS I
Sbjct  26   ERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSGYQHVWPEMEFGWQIVLGSFI  85

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAAFGSVGGVGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  86   GFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCM  126



>ref|XP_008363111.1| PREDICTED: uncharacterized protein LOC103426807 isoform X2 [Malus 
domestica]
Length=475

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  +  VWPE+KFGWKIVVGS++GF GAA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  63   QAGGSSYQPVWPEMKFGWKIVVGSVVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSS  122

Query  509  TAISKCM  529
            TAISKCM
Sbjct  123  TAISKCM  129



>ref|XP_008363110.1| PREDICTED: uncharacterized protein LOC103426807 isoform X1 [Malus 
domestica]
Length=477

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  +  VWPE+KFGWKIVVGS++GF GAA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  63   QAGGSSYQPVWPEMKFGWKIVVGSVVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSS  122

Query  509  TAISKCM  529
            TAISKCM
Sbjct  123  TAISKCM  129



>ref|XP_008338104.1| PREDICTED: uncharacterized protein LOC103401168 isoform X1 [Malus 
domestica]
Length=486

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +2

Query  257  IKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsv  436
            IK   +   D H     + +    +  G  +  VWPE+KF WKIVVGSI+GF GAA GSV
Sbjct  48   IKPEKSVQKDTHESFFVRVVNFLWQAGGSSYQPVWPEMKFDWKIVVGSIVGFFGAALGSV  107

Query  437  ggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GGVGGGGIFVPML LI+ FDPKS+TAISKCM
Sbjct  108  GGVGGGGIFVPMLALIVGFDPKSSTAISKCM  138



>gb|EMT22888.1| hypothetical protein F775_28607 [Aegilops tauschii]
Length=423

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  299  LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
            LL+K      +  G+ + HVWP ++FGWK+V+GS+IGF GA+FGSVGGVGGGGIFVPMLT
Sbjct  46   LLNKIANFMWQTDGNSYQHVWPPMEFGWKMVLGSLIGFFGASFGSVGGVGGGGIFVPMLT  105

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKS+TAISKCM
Sbjct  106  LIIGFDPKSSTAISKCM  122



>ref|XP_008338105.1| PREDICTED: uncharacterized protein LOC103401168 isoform X2 [Malus 
domestica]
Length=484

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +2

Query  257  IKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsv  436
            IK   +   D H     + +    +  G  +  VWPE+KF WKIVVGSI+GF GAA GSV
Sbjct  48   IKPEKSVQKDTHESFFVRVVNFLWQAGGSSYQPVWPEMKFDWKIVVGSIVGFFGAALGSV  107

Query  437  ggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GGVGGGGIFVPML LI+ FDPKS+TAISKCM
Sbjct  108  GGVGGGGIFVPMLALIVGFDPKSSTAISKCM  138



>gb|KHG04871.1| hypothetical protein F383_28778 [Gossypium arboreum]
Length=413

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 5/93 (5%)
 Frame = +2

Query  251  QSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafg  430
            +S+K S+ NN   ++ L +   + ++ +SG+ H  VWPE++F W+IV+GSIIGF GAAFG
Sbjct  38   ESVKESETNN---NYFLKAINFLWQSDESGYHH--VWPEMEFNWQIVLGSIIGFFGAAFG  92

Query  431  svggvggggIFVPMLTLILRFDPKSATAISKCM  529
            SVGGVGGGGIFVPML+LI+ FD KSATAISKCM
Sbjct  93   SVGGVGGGGIFVPMLSLIIGFDAKSATAISKCM  125



>ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum]
Length=486

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  254  SIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgs  433
            +  +S   N++      +  L+         + HVWPE++FGW+++VGSI+GF GAA GS
Sbjct  50   TYNISYVENNEMRPQTFAVRLVHFLWSGKSSYEHVWPEMEFGWRVIVGSIVGFFGAALGS  109

Query  434  vggvggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGVGGGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  110  VGGVGGGGIFVPMLTLIIGFDPKSSTAISKCM  141



>ref|XP_007159528.1| hypothetical protein PHAVU_002G2450000g, partial [Phaseolus vulgaris]
 gb|ESW31522.1| hypothetical protein PHAVU_002G2450000g, partial [Phaseolus vulgaris]
Length=387

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            +D N+S+ +   ++K +     D+   + H WP +KFGWKI+VGSIIGFLG+AFG+VGGV
Sbjct  26   TDQNSSEFN---ITKRVETNDHDAKVFYKHTWPRMKFGWKIIVGSIIGFLGSAFGTVGGV  82

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPMLTLI+ FD KSATAISKCM
Sbjct  83   GGGGIFVPMLTLIVGFDAKSATAISKCM  110



>ref|XP_010915823.1| PREDICTED: uncharacterized protein LOC105040818 [Elaeis guineensis]
Length=475

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = +2

Query  233  KKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgf  412
            K EA    + + +   +  +   +  FL +  + S   + HVWP + FGWKI+VGSIIGF
Sbjct  34   KSEALGDDVSVEEEMGASDYLLKVVNFLWQPNESS---YQHVWPPMTFGWKIIVGSIIGF  90

Query  413  lgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            LGAAFGSVGGVGGGGIFVPMLTL++ FDPKS+TAISKCM
Sbjct  91   LGAAFGSVGGVGGGGIFVPMLTLVIGFDPKSSTAISKCM  129



>dbj|BAK01650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  299  LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
            LL+K      +  G+ + HVWP ++FGWK+V+GS+IGF GA+FGSVGGVGGGGIFVPMLT
Sbjct  47   LLNKIANFMWQTDGNSYQHVWPPMEFGWKMVLGSLIGFFGASFGSVGGVGGGGIFVPMLT  106

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKS+TAISKCM
Sbjct  107  LIIGFDPKSSTAISKCM  123



>gb|KDP38300.1| hypothetical protein JCGZ_05186 [Jatropha curcas]
Length=469

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            ++ FL +  K S   +  VWPE++FGWKIVVGSI+GFLGAA GSVGGVGGGGIFVPMLTL
Sbjct  54   MAHFLWQSGKSS---YDPVWPEMEFGWKIVVGSIVGFLGAALGSVGGVGGGGIFVPMLTL  110

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  111  IIGFDPKSSTAISKCM  126



>gb|KDO79521.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=477

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE++FGWK+VVGSI+GF GAA GSVGGVGGGGIFVPMLTLI+ FDPKSATAISKC
Sbjct  71   YEPVWPEMQFGWKVVVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKC  130

Query  527  M  529
            M
Sbjct  131  M  131



>ref|XP_006425693.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 ref|XP_006466780.1| PREDICTED: uncharacterized protein LOC102622706 [Citrus sinensis]
 gb|ESR38933.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=477

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE++FGWK+VVGSI+GF GAA GSVGGVGGGGIFVPMLTLI+ FDPKSATAISKC
Sbjct  71   YEPVWPEMQFGWKVVVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKC  130

Query  527  M  529
            M
Sbjct  131  M  131



>ref|XP_002516570.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45911.1| conserved hypothetical protein [Ricinus communis]
Length=465

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  + HVWP ++ GW++VVGSIIGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKSA
Sbjct  59   QSDGSGYQHVWPGMELGWQVVVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSA  118

Query  509  TAISKCM  529
            TAISKCM
Sbjct  119  TAISKCM  125



>ref|XP_007024174.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY26796.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=486

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  278  NSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvgggg  457
            N     + + K L     +S  R+ H WP+++FGWKIVVGSI+GF+GAAFGSVGGVGGGG
Sbjct  50   NETQEKNYVRKALKFLELNSKPRYEHEWPDMRFGWKIVVGSILGFVGAAFGSVGGVGGGG  109

Query  458  IFVPMLTLILRFDPKSATAISKCM  529
            IFVPML LI+ FDPKS+TAISKCM
Sbjct  110  IFVPMLALIIGFDPKSSTAISKCM  133



>ref|XP_010048101.1| PREDICTED: uncharacterized protein LOC104436944 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80235.1| hypothetical protein EUGRSUZ_C01582 [Eucalyptus grandis]
Length=474

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +2

Query  248  LQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            L+S+ L      ++++ L +   + +   S ++H  VWPE+ FGW+IVVG++IG  GAAF
Sbjct  36   LESMGLGGMEKPESNYFLRAVDYLWKLNQSSYQH--VWPEMSFGWRIVVGTVIGIFGAAF  93

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPML+L++ FDPKS+TAISKCM
Sbjct  94   GSVGGVGGGGIFVPMLSLVIGFDPKSSTAISKCM  127



>emb|CDP02034.1| unnamed protein product [Coffea canephora]
Length=479

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            L  FL +  K S   + HVWPE++FGWK+VVG+++GFLGAA GSVGGVGGGGIFVPML+L
Sbjct  61   LVHFLWQSGKSS---YQHVWPEMEFGWKLVVGTVVGFLGAALGSVGGVGGGGIFVPMLSL  117

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  118  IIGFDPKSSTAISKCM  133



>ref|XP_010048102.1| PREDICTED: uncharacterized protein LOC104436944 isoform X2 [Eucalyptus 
grandis]
Length=472

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +2

Query  248  LQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaaf  427
            L+S+ L      ++++ L +   + +   S ++H  VWPE+ FGW+IVVG++IG  GAAF
Sbjct  36   LESMGLGGMEKPESNYFLRAVDYLWKLNQSSYQH--VWPEMSFGWRIVVGTVIGIFGAAF  93

Query  428  gsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GSVGGVGGGGIFVPML+L++ FDPKS+TAISKCM
Sbjct  94   GSVGGVGGGGIFVPMLSLVIGFDPKSSTAISKCM  127



>ref|XP_011001598.1| PREDICTED: uncharacterized protein LOC105108832 isoform X1 [Populus 
euphratica]
Length=489

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  HRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAIS  520
            + ++HVWP++KFGW+IVVG+IIGF GAA GSVGGVGGGGIFVPMLTLI+ FD KS+TAIS
Sbjct  70   YGYTHVWPDMKFGWRIVVGTIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKSSTAIS  129

Query  521  KCM  529
            KCM
Sbjct  130  KCM  132



>ref|XP_011001600.1| PREDICTED: uncharacterized protein LOC105108832 isoform X2 [Populus 
euphratica]
Length=485

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  HRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAIS  520
            + ++HVWP++KFGW+IVVG+IIGF GAA GSVGGVGGGGIFVPMLTLI+ FD KS+TAIS
Sbjct  70   YGYTHVWPDMKFGWRIVVGTIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKSSTAIS  129

Query  521  KCM  529
            KCM
Sbjct  130  KCM  132



>gb|AEI98632.1| hypothetical protein 111018.19 [Coffea canephora]
Length=465

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            L  FL +  K S   + HVWPE++FGWK+VVG+++GFLGAA GSVGGVGGGGIFVPML+L
Sbjct  61   LVHFLWQSGKSS---YQHVWPEMEFGWKLVVGTVVGFLGAALGSVGGVGGGGIFVPMLSL  117

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  118  IIGFDPKSSTAISKCM  133



>ref|XP_007024175.1| Sulfite exporter TauE/SafE family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY26797.1| Sulfite exporter TauE/SafE family protein, putative isoform 2 
[Theobroma cacao]
Length=407

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  278  NSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvgggg  457
            N     + + K L     +S  R+ H WP+++FGWKIVVGSI+GF+GAAFGSVGGVGGGG
Sbjct  50   NETQEKNYVRKALKFLELNSKPRYEHEWPDMRFGWKIVVGSILGFVGAAFGSVGGVGGGG  109

Query  458  IFVPMLTLILRFDPKSATAISKCM  529
            IFVPML LI+ FDPKS+TAISKCM
Sbjct  110  IFVPMLALIIGFDPKSSTAISKCM  133



>ref|XP_004287906.1| PREDICTED: uncharacterized protein LOC101304510 [Fragaria vesca 
subsp. vesca]
Length=478

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  +  VWPE+KFGWKI+VG+I+GF GAA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  66   QTGGSSYQPVWPEMKFGWKIIVGTIVGFFGAALGSVGGVGGGGIFVPMLALIIGFDPKSS  125

Query  509  TAISKCM  529
            TAISKCM
Sbjct  126  TAISKCM  132



>ref|XP_008651296.1| PREDICTED: uncharacterized protein LOC100279247 isoform X1 [Zea 
mays]
 tpg|DAA61108.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=470

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  GHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAI  517
            G+ + HVWP ++FGW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+TAI
Sbjct  57   GNSYQHVWPPMEFGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSSTAI  116

Query  518  SKCM  529
            SKCM
Sbjct  117  SKCM  120



>ref|XP_006585193.1| PREDICTED: uncharacterized protein LOC100802321 [Glycine max]
Length=473

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WPE+KFGWKI+VGSIIGFLG+AFG+VGGVGGGGIFVPMLTLI+ FD +SATAISKC
Sbjct  62   YKHTWPEMKFGWKIIVGSIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDARSATAISKC  121

Query  527  M  529
            M
Sbjct  122  M  122



>ref|XP_010667904.1| PREDICTED: uncharacterized protein LOC104884897 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 4/79 (5%)
 Frame = +2

Query  299  LLSKF--LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPM  472
            LL++F      +  SG+ H  VWP++KFGW+IVVGS+IGF GAAFGSVGGVGGGGIFVPM
Sbjct  56   LLAQFANFFWNSDQSGYHH--VWPDMKFGWQIVVGSLIGFCGAAFGSVGGVGGGGIFVPM  113

Query  473  LTLILRFDPKSATAISKCM  529
            L LI+ FDPKSATAISKCM
Sbjct  114  LCLIIGFDPKSATAISKCM  132



>ref|XP_009784620.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784621.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784622.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784623.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  296  HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPML  475
            + +  F +   K   H H H WPEL+FGW+++VGS+IGF  AAFGSVGGVGGGGIFVPML
Sbjct  54   YFVKLFNLMLQKGKMHYH-HFWPELEFGWRVIVGSVIGFFAAAFGSVGGVGGGGIFVPML  112

Query  476  TLILRFDPKSATAISKCM  529
            TLI+ FDPK++TAISKCM
Sbjct  113  TLIIGFDPKTSTAISKCM  130



>ref|XP_010263696.1| PREDICTED: uncharacterized protein LOC104601887 [Nelumbo nucifera]
Length=473

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            L  FL +  K   H   HVWPE++FGW++V+GSIIGF GAA GSVGGVGGGGIFVPMLTL
Sbjct  57   LVNFLWQSGKSIYH---HVWPEMEFGWRLVLGSIIGFFGAAVGSVGGVGGGGIFVPMLTL  113

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  114  IIGFDPKSSTAISKCM  129



>ref|XP_009388715.1| PREDICTED: uncharacterized protein LOC103975470 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 4/80 (5%)
 Frame = +2

Query  302  LSKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVP  469
            LS +L++      +  G  + HVWP++KFGW+IVVGSIIGFLG+AFGSVGGVGGGGI+VP
Sbjct  47   LSDYLLKVVDFLWQSDGSSYQHVWPDMKFGWEIVVGSIIGFLGSAFGSVGGVGGGGIYVP  106

Query  470  MLTLILRFDPKSATAISKCM  529
            MLTLI+ FD KS+TAISKCM
Sbjct  107  MLTLIIGFDAKSSTAISKCM  126



>gb|KCW58608.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=319

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWPE++FGWK+VVGSIIGF GAA GSVGGVGGGGIFVPMLTLI+ 
Sbjct  66   FLWQIGKSS---YEPVWPEMEFGWKLVVGSIIGFFGAALGSVGGVGGGGIFVPMLTLIIG  122

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  123  FDPKSSTAISKCM  135



>ref|XP_006580198.1| PREDICTED: uncharacterized protein LOC100819316 [Glycine max]
Length=475

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WPE+KFGWKI+VGSIIGFLG+AFG+VGGVGGGGIFVPMLTLI+ FD +SATAISKC
Sbjct  64   YKHTWPEMKFGWKIIVGSIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDARSATAISKC  123

Query  527  M  529
            M
Sbjct  124  M  124



>ref|XP_006425694.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 gb|ESR38934.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=498

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE++FGWK+VVGSI+GF GAA GSVGGVGGGGIFVPMLTLI+ FDPKSATAISKC
Sbjct  71   YEPVWPEMQFGWKVVVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKC  130

Query  527  M  529
            M
Sbjct  131  M  131



>gb|KHN48052.1| hypothetical protein glysoja_015522 [Glycine soja]
Length=414

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WPE+KFGWKI+VGSIIGFLG+AFG+VGGVGGGGIFVPMLTLI+ FD +SATAISKC
Sbjct  63   YKHTWPEMKFGWKIIVGSIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDARSATAISKC  122

Query  527  M  529
            M
Sbjct  123  M  123



>ref|XP_007156932.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
 gb|ESW28926.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
Length=470

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            ++ FL  E K S   +  VWP +KFGW+I+VGSIIGF GAA GSVGGVGGGGIFVPML L
Sbjct  56   IANFLWEEGKSS---YEPVWPNMKFGWRIIVGSIIGFSGAALGSVGGVGGGGIFVPMLAL  112

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  113  IIGFDPKSSTAISKCM  128



>ref|XP_002460084.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
 gb|EER96605.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
Length=470

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            K  G+ + HVWP ++ GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+
Sbjct  54   KSDGNSYQHVWPTMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSS  113

Query  509  TAISKCM  529
            TAISKCM
Sbjct  114  TAISKCM  120



>ref|XP_003578003.1| PREDICTED: uncharacterized protein LOC100827421 [Brachypodium 
distachyon]
Length=469

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  299  LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
            LL+K      +  G+ + HVWP ++FGWK+V+G++IGF GA+FGSVGGVGGGGIFVPMLT
Sbjct  45   LLNKIANFLWQSDGNSYHHVWPPMEFGWKVVLGTLIGFFGASFGSVGGVGGGGIFVPMLT  104

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKS+TAISKCM
Sbjct  105  LIIGFDPKSSTAISKCM  121



>gb|KHN06459.1| hypothetical protein glysoja_010803 [Glycine soja]
Length=459

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = +2

Query  320  RETKDSGHR----HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLIL  487
            R    +GH     + H WPE+KFGWKI+VGS+IGFLG+AFG+VGGVGGGGIFVPMLTLI+
Sbjct  51   RGVDTNGHHANGFYKHTWPEMKFGWKIIVGSLIGFLGSAFGTVGGVGGGGIFVPMLTLII  110

Query  488  RFDPKSATAISKCM  529
             FD +SATAISKCM
Sbjct  111  GFDARSATAISKCM  124



>ref|XP_010254104.1| PREDICTED: uncharacterized protein LOC104595187 [Nelumbo nucifera]
Length=481

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 8/102 (8%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHH-HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSI  403
            SLK EA+    + +D   S +++ H ++ FL  ++  SG++H  VWP++KFGW+IV+G+I
Sbjct  34   SLKDEAS----RSNDTEVSLSNYLHKVANFLW-QSDVSGYQH--VWPDMKFGWQIVLGTI  86

Query  404  IgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            IGF GAAFGSVGGVGGGGIFVPMLTLI+ FD KS+TAISKCM
Sbjct  87   IGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKCM  128



>ref|XP_008792340.1| PREDICTED: uncharacterized protein LOC103708984 [Phoenix dactylifera]
Length=478

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +2

Query  221  SGSLKKEAALQSIKLSDANNSDAHHHLLSKFLMRET----KDSGHRHSHVWPELKFGWKI  388
            S  +  E  L+   L D  ++D    + S +L++      +  G  + HVWP ++FGW++
Sbjct  22   SAVVSAERGLKIGGLLDDVSADGETFVFS-YLLKAVGFLWQADGSYYHHVWPPMEFGWRL  80

Query  389  VVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            V+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+TA+SKCM
Sbjct  81   VIGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIVGFDPKSSTALSKCM  127



>gb|EEE69518.1| hypothetical protein OsJ_28979 [Oryza sativa Japonica Group]
Length=481

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G+ + HVWPE++ GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+
Sbjct  67   QTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSS  126

Query  509  TAISKCM  529
            TAISKCM
Sbjct  127  TAISKCM  133



>ref|NP_001062933.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAD29095.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24847.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAG88213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G+ + HVWPE++ GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+
Sbjct  67   QTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSS  126

Query  509  TAISKCM  529
            TAISKCM
Sbjct  127  TAISKCM  133



>gb|EEC84400.1| hypothetical protein OsI_30977 [Oryza sativa Indica Group]
Length=465

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G+ + HVWPE++ GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+
Sbjct  51   QTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSS  110

Query  509  TAISKCM  529
            TAISKCM
Sbjct  111  TAISKCM  117



>ref|XP_010314281.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314282.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314283.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314284.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314285.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314286.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
Length=468

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +2

Query  251  QSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafg  430
            + I  +   N D       K        +   + H WPEL+FGW+++VGS+IGF  AAFG
Sbjct  27   EEIVANGGTNDDFESSYFFKIFKILLHKAKLHYQHFWPELEFGWRVIVGSVIGFFAAAFG  86

Query  431  svggvggggIFVPMLTLILRFDPKSATAISKCM  529
            SVGGVGGGGIFVPMLTLI+ FDPK++TAISKCM
Sbjct  87   SVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCM  119



>ref|XP_006359451.1| PREDICTED: uncharacterized protein LOC102590357 isoform X1 [Solanum 
tuberosum]
 ref|XP_006359452.1| PREDICTED: uncharacterized protein LOC102590357 isoform X2 [Solanum 
tuberosum]
 ref|XP_006359453.1| PREDICTED: uncharacterized protein LOC102590357 isoform X3 [Solanum 
tuberosum]
 ref|XP_006359454.1| PREDICTED: uncharacterized protein LOC102590357 isoform X4 [Solanum 
tuberosum]
 ref|XP_006359455.1| PREDICTED: uncharacterized protein LOC102590357 isoform X5 [Solanum 
tuberosum]
Length=469

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WPEL+FGW+++VGS+IGF  AAFGSVGGVGGGGIFVPMLTLI+ FDPK++TAISKC
Sbjct  59   YQHFWPELEFGWRVIVGSVIGFFAAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKC  118

Query  527  M  529
            M
Sbjct  119  M  119



>ref|XP_009409060.1| PREDICTED: uncharacterized protein LOC103991359 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 5/102 (5%)
 Frame = +2

Query  227  SLKKEAA-LQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSI  403
             L+ EAA  ++++  +   SD    +++ FL R  + S   + HVWP +KFGW+IVVG+I
Sbjct  29   GLRPEAAGAEAVETEEVGVSDYVLKVVN-FLWRPDESS---YQHVWPSMKFGWEIVVGTI  84

Query  404  IgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            IGFLG+AFGSVGGVGGGGI+VPMLTLI+ FD KS+TAISKCM
Sbjct  85   IGFLGSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAISKCM  126



>ref|XP_009409059.1| PREDICTED: uncharacterized protein LOC103991359 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=499

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 5/102 (5%)
 Frame = +2

Query  227  SLKKEAA-LQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSI  403
             L+ EAA  ++++  +   SD    +++ FL R  + S   + HVWP +KFGW+IVVG+I
Sbjct  29   GLRPEAAGAEAVETEEVGVSDYVLKVVN-FLWRPDESS---YQHVWPSMKFGWEIVVGTI  84

Query  404  IgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            IGFLG+AFGSVGGVGGGGI+VPMLTLI+ FD KS+TAISKCM
Sbjct  85   IGFLGSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAISKCM  126



>ref|XP_010070053.1| PREDICTED: uncharacterized protein LOC104456870 [Eucalyptus grandis]
 gb|KCW58607.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=481

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWPE++FGWK+VVGSIIGF GAA GSVGGVGGGGIFVPMLTLI+ 
Sbjct  66   FLWQIGKSS---YEPVWPEMEFGWKLVVGSIIGFFGAALGSVGGVGGGGIFVPMLTLIIG  122

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  123  FDPKSSTAISKCM  135



>ref|XP_004168635.1| PREDICTED: uncharacterized LOC101214783 [Cucumis sativus]
Length=471

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = +2

Query  308  KFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLIL  487
             FL +  K   H   HVWPE+ FGW+IVVGS+IGF+GAAFGSVGGVGGGGI+VPML+LI+
Sbjct  52   NFLWQSDKTGYH---HVWPEMAFGWQIVVGSVIGFMGAAFGSVGGVGGGGIYVPMLSLII  108

Query  488  RFDPKSATAISKCM  529
             FDPKS+TAISKCM
Sbjct  109  GFDPKSSTAISKCM  122



>ref|XP_004136295.1| PREDICTED: uncharacterized protein LOC101214783 [Cucumis sativus]
 gb|KGN60205.1| hypothetical protein Csa_3G889130 [Cucumis sativus]
Length=471

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = +2

Query  308  KFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLIL  487
             FL +  K   H   HVWPE+ FGW+IVVGS+IGF+GAAFGSVGGVGGGGI+VPML+LI+
Sbjct  52   NFLWQSDKTGYH---HVWPEMAFGWQIVVGSVIGFMGAAFGSVGGVGGGGIYVPMLSLII  108

Query  488  RFDPKSATAISKCM  529
             FDPKS+TAISKCM
Sbjct  109  GFDPKSSTAISKCM  122



>gb|KHN36120.1| hypothetical protein glysoja_003243 [Glycine soja]
Length=441

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            +  FL  E K S   +  VWP +KFGW+I+VGSIIGFLGAA GSVGGVGGGGIFVPML L
Sbjct  56   IVNFLWEEGKSS---YEPVWPNMKFGWRIIVGSIIGFLGAALGSVGGVGGGGIFVPMLAL  112

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  113  IIGFDPKSSTAISKCM  128



>ref|XP_003629468.1| hypothetical protein MTR_8g077830 [Medicago truncatula]
Length=480

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTLI+ FDPKS+TA+SKC
Sbjct  62   YERVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTALSKC  121

Query  527  M  529
            M
Sbjct  122  M  122



>ref|XP_010062471.1| PREDICTED: uncharacterized protein LOC104449877 [Eucalyptus grandis]
 gb|KCW69612.1| hypothetical protein EUGRSUZ_F03030 [Eucalyptus grandis]
Length=480

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            ++ VWPE++FGWKIVVGSIIGF GAAFGSVGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  67   YTRVWPEMEFGWKIVVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKC  126

Query  527  M  529
            M
Sbjct  127  M  127



>gb|AET03944.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=473

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTLI+ FDPKS+TA+SKC
Sbjct  62   YERVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTALSKC  121

Query  527  M  529
            M
Sbjct  122  M  122



>ref|XP_009613204.1| PREDICTED: uncharacterized protein LOC104106373 [Nicotiana tomentosiformis]
Length=483

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  296  HLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPML  475
            + +  F +   K   H H H WPE +FGW+++VGS+IGF  AAFGSVGGVGGGGIFVPML
Sbjct  54   YFVKLFNLMLQKGKMHYH-HFWPEFEFGWRVIVGSVIGFFAAAFGSVGGVGGGGIFVPML  112

Query  476  TLILRFDPKSATAISKCM  529
            TLI+ FDPK++TAISKCM
Sbjct  113  TLIIGFDPKTSTAISKCM  130



>gb|AFK35007.1| unknown [Medicago truncatula]
Length=473

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTLI+ FDPKS+TA+SKC
Sbjct  62   YERVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTALSKC  121

Query  527  M  529
            M
Sbjct  122  M  122



>ref|XP_009777903.1| PREDICTED: uncharacterized protein LOC104227363 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009777904.1| PREDICTED: uncharacterized protein LOC104227363 isoform X4 [Nicotiana 
sylvestris]
Length=416

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = +2

Query  341  HRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAIS  520
            H H HVWPEL+ GW+++VGSIIGF  AA GS GGVGGGGIFVPMLTLI+ FDPK++TAIS
Sbjct  2    HYH-HVWPELQVGWRVIVGSIIGFFAAALGSAGGVGGGGIFVPMLTLIIGFDPKTSTAIS  60

Query  521  KCM  529
            KCM
Sbjct  61   KCM  63



>ref|XP_010417351.1| PREDICTED: uncharacterized protein LOC104703106 [Camelina sativa]
Length=481

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +2

Query  275  NNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggg  454
            NN  +   L +   + E+  +G+ H  VWPE +F W+IV+G+++GF GAAFGSVGGVGGG
Sbjct  50   NNESSSFFLKAVNFLWESDQTGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGG  107

Query  455  gIFVPMLTLILRFDPKSATAISKCM  529
            GIFVPML+LI+ FDPKSATAISKCM
Sbjct  108  GIFVPMLSLIIGFDPKSATAISKCM  132



>ref|XP_010098073.1| hypothetical protein L484_026205 [Morus notabilis]
 gb|EXB74510.1| hypothetical protein L484_026205 [Morus notabilis]
Length=470

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 60/65 (92%), Gaps = 2/65 (3%)
 Frame = +2

Query  335  SGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATA  514
            SG++H  VWPE+KFGW+I+VG IIGFLGAAFGSVGGVGGGGIFVPMLTL++ FD KS+TA
Sbjct  53   SGYKH--VWPEMKFGWRIIVGGIIGFLGAAFGSVGGVGGGGIFVPMLTLVMGFDEKSSTA  110

Query  515  ISKCM  529
            ISKCM
Sbjct  111  ISKCM  115



>ref|XP_003517231.1| PREDICTED: uncharacterized protein LOC100801441 [Glycine max]
Length=470

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 3/76 (4%)
 Frame = +2

Query  302  LSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTL  481
            +  FL  E K S   +  VWP +KFGW+I+VGSIIGFLGAA GSVGGVGGGGIFVPML L
Sbjct  56   IVNFLWEEGKSS---YEPVWPNMKFGWRIIVGSIIGFLGAALGSVGGVGGGGIFVPMLAL  112

Query  482  ILRFDPKSATAISKCM  529
            I+ FDPKS+TAISKCM
Sbjct  113  IIGFDPKSSTAISKCM  128



>tpg|DAA39926.1| TPA: hypothetical protein ZEAMMB73_327447 [Zea mays]
Length=497

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
             D G  + HVWP + FGW++VVGS+IGF GAA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  55   NDDGKAYHHVWPPMGFGWRVVVGSLIGFFGAACGSVGGVGGGGIFVPMLALIVGFDPKSS  114

Query  509  TAISKCM  529
            TAISKCM
Sbjct  115  TAISKCM  121



>ref|XP_008466240.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
 ref|XP_008466242.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
Length=471

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = +2

Query  308  KFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLIL  487
             FL +  K   H   HVWPE+ FGW+IVVGS+IGF+GAAFGSVGGVGGGGI+VPML+LI+
Sbjct  52   NFLWQSDKTGYH---HVWPEMVFGWQIVVGSVIGFMGAAFGSVGGVGGGGIYVPMLSLII  108

Query  488  RFDPKSATAISKCM  529
             FDPKS+TAISKCM
Sbjct  109  GFDPKSSTAISKCM  122



>ref|XP_007012055.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
 gb|EOY29674.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
Length=483

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = +2

Query  242  AALQSIKLSD-ANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflg  418
            +A +S+K  D A  S+ +  L +   +  +  SG++H  VWPE++FGW+IV+GSIIGF G
Sbjct  29   SAERSLKNGDSAKESETNFFLKAINFLWRSDQSGYQH--VWPEMEFGWQIVLGSIIGFFG  86

Query  419  aafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AAFGSVGGVGGGGIFVPML LI+ FD KS+TAISKCM
Sbjct  87   AAFGSVGGVGGGGIFVPMLNLIIGFDAKSSTAISKCM  123



>ref|XP_007159577.1| hypothetical protein PHAVU_002G249100g [Phaseolus vulgaris]
 gb|ESW31571.1| hypothetical protein PHAVU_002G249100g [Phaseolus vulgaris]
Length=463

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 7/96 (7%)
 Frame = +2

Query  242  AALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflga  421
            A +  + +S  N +   +H L         DS   + H WP +KFGWKI+VGSI+GFLG+
Sbjct  22   ALILVVTVSAENTTSESNHTLDV-------DSNLHYPHTWPSMKFGWKIIVGSIVGFLGS  74

Query  422  afgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AFG+VGGVGGGGIFVPMLTLI+ FD KSA AISKCM
Sbjct  75   AFGNVGGVGGGGIFVPMLTLIIGFDTKSAIAISKCM  110



>ref|XP_010924740.1| PREDICTED: uncharacterized protein LOC105047500 [Elaeis guineensis]
Length=478

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +2

Query  221  SGSLKKEAALQSIKLSDANNSDAHHHLLSKFL----MRETKDSGHRHSHVWPELKFGWKI  388
            S  +  E   +   L D  ++D    + S  L         D  H H HVWP ++FGW++
Sbjct  22   SAVVSAERGFKIGGLLDDVSADGETFVFSDLLKVVGFLWQADGSHYH-HVWPPMEFGWRL  80

Query  389  VVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            V+GS+IGF GAAFGSVGGVGGGGIFVPMLTLI+ FDPKS+TA+SKCM
Sbjct  81   VIGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIVGFDPKSSTALSKCM  127



>ref|XP_009371582.1| PREDICTED: uncharacterized protein LOC103960817 isoform X1 [Pyrus 
x bretschneideri]
Length=486

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  284  DAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIF  463
            D H     + +    +  G  +  VWPE+KF WKIV+GSI+GF GAA GSVGGVGGGGIF
Sbjct  57   DIHESFFVRVVNFLWQAGGSSYQPVWPEMKFDWKIVLGSIVGFFGAALGSVGGVGGGGIF  116

Query  464  VPMLTLILRFDPKSATAISKCM  529
            VPML LI+ FDPKS+TAISKCM
Sbjct  117  VPMLALIVGFDPKSSTAISKCM  138



>ref|XP_002878880.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55139.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 8/90 (9%)
 Frame = +2

Query  278  NSDAHHHLLSKFLMR------ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            NSD      S F ++      E+   G+RH  VWPE +F W+IV+G+++GF GAAFGSVG
Sbjct  43   NSDETRENESSFFLKAVNFLWESDQIGYRH--VWPEFEFNWQIVLGTLVGFFGAAFGSVG  100

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPML+L++ FDPKSATAISKCM
Sbjct  101  GVGGGGIFVPMLSLVIGFDPKSATAISKCM  130



>ref|XP_008228544.1| PREDICTED: uncharacterized protein LOC103327946 [Prunus mume]
Length=489

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE+K GWKIVVGS+IGF GAAFG+VGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  75   YEHVWPEMKLGWKIVVGSVIGFFGAAFGTVGGVGGGGIFVPMLTLIIGFDQKSSTAISKC  134

Query  527  M  529
            M
Sbjct  135  M  135



>ref|XP_009371583.1| PREDICTED: uncharacterized protein LOC103960817 isoform X2 [Pyrus 
x bretschneideri]
Length=484

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  284  DAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIF  463
            D H     + +    +  G  +  VWPE+KF WKIV+GSI+GF GAA GSVGGVGGGGIF
Sbjct  57   DIHESFFVRVVNFLWQAGGSSYQPVWPEMKFDWKIVLGSIVGFFGAALGSVGGVGGGGIF  116

Query  464  VPMLTLILRFDPKSATAISKCM  529
            VPML LI+ FDPKS+TAISKCM
Sbjct  117  VPMLALIVGFDPKSSTAISKCM  138



>ref|XP_007159523.1| hypothetical protein PHAVU_002G244700g [Phaseolus vulgaris]
 gb|ESW31517.1| hypothetical protein PHAVU_002G244700g [Phaseolus vulgaris]
Length=425

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 7/96 (7%)
 Frame = +2

Query  242  AALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflga  421
            A +  + +S  N +   +H L         DS   + H WP +KFGWKI+VGSI+GFLG+
Sbjct  22   ALILLVTVSAENTTSESNHTLDV-------DSNLHYPHTWPSMKFGWKIIVGSIVGFLGS  74

Query  422  afgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AFG+VGGVGGGGIFVPMLTLI+ FD KSA AISKCM
Sbjct  75   AFGNVGGVGGGGIFVPMLTLIIGFDTKSAIAISKCM  110



>emb|CDO98032.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            ++    + HVWPE+KF W+IVVG++IGF  AA GSVGGVGGGGIFVPML LI+ FDPKS+
Sbjct  56   QNGVMNYRHVWPEMKFSWQIVVGTVIGFFAAALGSVGGVGGGGIFVPMLALIIGFDPKSS  115

Query  509  TAISKCM  529
            TAISKCM
Sbjct  116  TAISKCM  122



>ref|NP_850068.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
 gb|AAM97053.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72117.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42374.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63445.1| At2g25737 [Arabidopsis thaliana]
 gb|AEC07746.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
Length=476

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = +2

Query  251  QSIKLS--DANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaa  424
            +S++LS  +   +++   L +   + E+   G+RH  VWPE +F W+IV+G+++GF GAA
Sbjct  35   KSLRLSTDETRENESSFFLKAINFLWESDQIGYRH--VWPEFEFNWQIVLGTLVGFFGAA  92

Query  425  fgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            FGSVGGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  93   FGSVGGVGGGGIFVPMLSLIIGFDPKSATAISKCM  127



>ref|XP_006369186.1| hypothetical protein POPTR_0001s18380g [Populus trichocarpa]
 gb|ERP65755.1| hypothetical protein POPTR_0001s18380g [Populus trichocarpa]
Length=436

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 70/105 (67%), Gaps = 13/105 (12%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAH----HHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVV  394
            +L    A  S+KL D+  +       HH         T  SG++H  VWP++KFGWK VV
Sbjct  31   TLTMAVAEPSLKLKDSFYNGTQKVEPHH-------GTTSQSGYKH--VWPDMKFGWKTVV  81

Query  395  GSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            G+II FLGAA GSVGGVGGGGIFVPMLTLI+ FD KS+ AISKCM
Sbjct  82   GTIITFLGAACGSVGGVGGGGIFVPMLTLIVGFDSKSSAAISKCM  126



>ref|XP_004509250.1| PREDICTED: uncharacterized protein LOC101512581 [Cicer arietinum]
Length=472

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTLI+ FDPKS+T ISKC
Sbjct  69   YDRVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTPISKC  128

Query  527  M  529
            M
Sbjct  129  M  129



>ref|XP_008380922.1| PREDICTED: uncharacterized protein LOC103443804 [Malus domestica]
Length=474

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  NNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggg  454
             +  A  H L++ L    +     + HVWPE+KF W+IVVG+IIGF+GAAFG+VGGVGGG
Sbjct  38   QDDSATQHYLNRMLNFLWQRGRLGYEHVWPEMKFDWRIVVGTIIGFIGAAFGTVGGVGGG  97

Query  455  gIFVPMLTLILRFDPKSATAISKCM  529
            GIFVPMLTLI+ FD KS+TAIS CM
Sbjct  98   GIFVPMLTLIIGFDEKSSTAISNCM  122



>ref|XP_010691331.1| PREDICTED: uncharacterized protein LOC104904681 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +2

Query  236  KEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgfl  415
             E  L+ +  ++    +    LL K +    +   + + HVWPEL+F W+IVVGS+IGF 
Sbjct  27   NEETLKEVASAEIEMEEIEVSLLRKTINFLWQSGQNTYEHVWPELEFDWRIVVGSLIGFF  86

Query  416  gaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GA+FGSVGGVGGGGIFVPMLTLI+ FD KS+TAISKCM
Sbjct  87   GASFGSVGGVGGGGIFVPMLTLIIGFDSKSSTAISKCM  124



>ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis]
Length=495

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  290  HHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVP  469
            + ++LS        +    ++HVWP+++FGW++V+GSIIGFLGAA GS+GGVGGGGIFVP
Sbjct  58   YKYILSNIFHSLFDNGDSSYTHVWPDMEFGWRVVLGSIIGFLGAALGSIGGVGGGGIFVP  117

Query  470  MLTLILRFDPKSATAISKCM  529
            MLTLI+ FDPK++TA+SKCM
Sbjct  118  MLTLIIGFDPKTSTAVSKCM  137



>gb|KHN10230.1| hypothetical protein glysoja_017834 [Glycine soja]
Length=439

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 70/89 (79%), Gaps = 4/89 (4%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFL--MRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvgg  442
            +    +     L+K L  + ++ +SG++H  VWP+++FGW+IV+G+ +GF GAAFGSVGG
Sbjct  7    NVTTREPQQSFLTKALNFLWQSGESGYQH--VWPDMEFGWEIVLGTFVGFCGAAFGSVGG  64

Query  443  vggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  65   VGGGGIFVPMLSLIIGFDPKSSTAISKCM  93



>ref|XP_003523730.1| PREDICTED: uncharacterized protein LOC100809318 [Glycine max]
Length=472

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 71/89 (80%), Gaps = 4/89 (4%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFL--MRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvgg  442
            +  + +     L+K L  + ++ +SG++H  VWP+++FGW+IV+G+ +GF GAAFGSVGG
Sbjct  40   NVTSREPQQSFLTKALNFLWQSGESGYQH--VWPDMEFGWEIVLGTFVGFCGAAFGSVGG  97

Query  443  vggggIFVPMLTLILRFDPKSATAISKCM  529
            VGGGGIFVPML+LI+ FDPKS+TAISKCM
Sbjct  98   VGGGGIFVPMLSLIIGFDPKSSTAISKCM  126



>ref|XP_011026588.1| PREDICTED: uncharacterized protein LOC105127135 [Populus euphratica]
Length=475

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  260  KLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +LS+A   + ++ +     + ++ +SG++H  VWPEL F W+ V+G+IIGF GAAFGSVG
Sbjct  40   RLSEAEELEPNYLVKIISFLWQSDESGYQH--VWPELSFSWQAVIGTIIGFFGAAFGSVG  97

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPML LI+ FDPKSATAISKC+
Sbjct  98   GVGGGGIFVPMLILIIGFDPKSATAISKCI  127



>ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula]
 ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula]
 gb|AES94934.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 12/87 (14%)
 Frame = +2

Query  305  SKFLMRETK-----------DSGHR-HSHVWPELKFGWKIVVGSIIgflgaafgsvggvg  448
            +KF+ +ETK           +SG   +  VWPE+KF WKI+VGSIIGFLGAA GSVGGVG
Sbjct  43   AKFVEKETKGFLKAMVDFLWESGKSSYEPVWPEMKFDWKIIVGSIIGFLGAALGSVGGVG  102

Query  449  gggIFVPMLTLILRFDPKSATAISKCM  529
            GGGIFVPML LI+ FDPKS+TAISKCM
Sbjct  103  GGGIFVPMLALIIGFDPKSSTAISKCM  129



>ref|XP_010472594.1| PREDICTED: uncharacterized protein LOC104752213 isoform X1 [Camelina 
sativa]
Length=475

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvg  448
            D+N S +       FL  E+  +G+ H  VWPE +F W+IV+G+++GF GAAFGSVGGVG
Sbjct  43   DSNESSSFFLKAVNFLW-ESDQTGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSVGGVG  99

Query  449  gggIFVPMLTLILRFDPKSATAISKCM  529
            GGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  100  GGGIFVPMLSLIIGFDPKSATAISKCM  126



>ref|XP_010472595.1| PREDICTED: uncharacterized protein LOC104752213 isoform X2 [Camelina 
sativa]
Length=472

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvg  448
            D+N S +       FL  E+  +G+ H  VWPE +F W+IV+G+++GF GAAFGSVGGVG
Sbjct  43   DSNESSSFFLKAVNFLW-ESDQTGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSVGGVG  99

Query  449  gggIFVPMLTLILRFDPKSATAISKCM  529
            GGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  100  GGGIFVPMLSLIIGFDPKSATAISKCM  126



>ref|XP_007216479.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
 gb|EMJ17678.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
Length=489

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE+K GWKIVVG++IGF GAAFG+VGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  75   YEHVWPEMKLGWKIVVGTVIGFFGAAFGTVGGVGGGGIFVPMLTLIIGFDQKSSTAISKC  134

Query  527  M  529
            M
Sbjct  135  M  135



>ref|XP_010109461.1| hypothetical protein L484_001800 [Morus notabilis]
 gb|EXC22697.1| hypothetical protein L484_001800 [Morus notabilis]
Length=478

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 62/69 (90%), Gaps = 2/69 (3%)
 Frame = +2

Query  323  ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPK  502
            ++  SG++H  VWP++KFGW+IV+G+IIGF GAAFGSVGGVGGGGIFVPML+LI+ FD K
Sbjct  61   QSDASGYQH--VWPDMKFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDAK  118

Query  503  SATAISKCM  529
            SATAISKCM
Sbjct  119  SATAISKCM  127



>ref|XP_002284423.1| PREDICTED: uncharacterized protein LOC100266912 [Vitis vinifera]
 emb|CBI36119.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWP++KFGW+I+VG+IIGF GAAFGSVGGVGGGGIFVPMLTL++ FD KS+TAISKC
Sbjct  68   YEHVWPDMKFGWQIIVGTIIGFFGAAFGSVGGVGGGGIFVPMLTLVIGFDAKSSTAISKC  127

Query  527  M  529
            M
Sbjct  128  M  128



>ref|XP_010680799.1| PREDICTED: uncharacterized protein LOC104895862 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  299  LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
            LLSK      K     +  VWP+++FGW+IVVGS IGFLGAA GSVGGVGGGGIFVPMLT
Sbjct  53   LLSKMYHFLWKSGEPSYQPVWPDMEFGWRIVVGSFIGFLGAALGSVGGVGGGGIFVPMLT  112

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKS+TAISKCM
Sbjct  113  LIIGFDPKSSTAISKCM  129



>ref|XP_010680798.1| PREDICTED: uncharacterized protein LOC104895862 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=476

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  299  LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLT  478
            LLSK      K     +  VWP+++FGW+IVVGS IGFLGAA GSVGGVGGGGIFVPMLT
Sbjct  53   LLSKMYHFLWKSGEPSYQPVWPDMEFGWRIVVGSFIGFLGAALGSVGGVGGGGIFVPMLT  112

Query  479  LILRFDPKSATAISKCM  529
            LI+ FDPKS+TAISKCM
Sbjct  113  LIIGFDPKSSTAISKCM  129



>ref|XP_010429580.1| PREDICTED: uncharacterized protein LOC104714041 [Camelina sativa]
Length=475

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +2

Query  272  ANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvgg  451
             +N  +   L +   + E+  +G+ H  VWPE +F W+IV+G+++GF GAAFGSVGGVGG
Sbjct  43   GSNESSSFFLRAVNFLWESDQTGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGG  100

Query  452  ggIFVPMLTLILRFDPKSATAISKCM  529
            GGIFVPML+LI+ FDPKSATAISKCM
Sbjct  101  GGIFVPMLSLIIGFDPKSATAISKCM  126



>ref|XP_009381051.1| PREDICTED: uncharacterized protein LOC103969282 [Musa acuminata 
subsp. malaccensis]
Length=475

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL R  + S   + HVWP +KFGW+IVVGSIIGFLG+AFGSVGGVGGGGI+VPMLTLI+ 
Sbjct  58   FLWRPDESS---YRHVWPPMKFGWEIVVGSIIGFLGSAFGSVGGVGGGGIYVPMLTLIIG  114

Query  491  FDPKSATAISKCM  529
            FD KS+TAISKCM
Sbjct  115  FDAKSSTAISKCM  127



>ref|XP_007161546.1| hypothetical protein PHAVU_001G078500g [Phaseolus vulgaris]
 gb|ESW33540.1| hypothetical protein PHAVU_001G078500g [Phaseolus vulgaris]
Length=376

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRF  493
             + ++ +SG++H  VWPE++FGW+I++G+IIGF GAAFGSVGGVGGGGIFVPMLTL++ F
Sbjct  46   FLWQSGESGYQH--VWPEIEFGWRIILGTIIGFFGAAFGSVGGVGGGGIFVPMLTLVIGF  103

Query  494  DPKSATAISKCM  529
            D KS+TA+SKCM
Sbjct  104  DSKSSTAMSKCM  115



>ref|XP_008783526.1| PREDICTED: uncharacterized protein LOC103702749 [Phoenix dactylifera]
Length=506

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  290  HHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVP  469
            H ++L+        +    ++HVWP+++FGW++V+GS IGFLGAA GS+GGVGGGGIFVP
Sbjct  69   HKYILANIFHSLFDNGDSSYTHVWPDMEFGWRVVLGSTIGFLGAALGSIGGVGGGGIFVP  128

Query  470  MLTLILRFDPKSATAISKCM  529
            MLTLI+ FDPK++TAISKCM
Sbjct  129  MLTLIIGFDPKTSTAISKCM  148



>gb|KDO56896.1| hypothetical protein CISIN_1g022146mg [Citrus sinensis]
Length=302

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  335  SGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATA  514
            SG++H  VWP++KFGWKIVV SIIGF GAA GSVGGVGGGGIFVPML LI+ FDPKS+ A
Sbjct  63   SGYKH--VWPDIKFGWKIVVSSIIGFFGAACGSVGGVGGGGIFVPMLNLIIGFDPKSSVA  120

Query  515  ISKCM  529
            +SKCM
Sbjct  121  LSKCM  125



>ref|XP_003546436.1| PREDICTED: uncharacterized protein LOC100816528 [Glycine max]
Length=476

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  242  AALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflga  421
            +AL+ +     + + A    L K +      SG  + H WPE++FGW+I+ G+IIGF+G+
Sbjct  28   SALEHVNHKKIDPTTAETSFLGKVMNFLWSSSGSGYEHTWPEIEFGWRIITGTIIGFVGS  87

Query  422  afgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AFG+VGGVGGGGIFV ML+LI+ FD KSATAISKCM
Sbjct  88   AFGTVGGVGGGGIFVTMLSLIIGFDAKSATAISKCM  123



>gb|EYU21457.1| hypothetical protein MIMGU_mgv1a005411mg [Erythranthe guttata]
Length=484

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvg  448
            D N+   +   +  FL       G    HVWP+++FGW+IV G++IGF GAA GSVGGVG
Sbjct  50   DRNSEPNYFTRIITFL------RGISLPHVWPDMEFGWRIVAGTVIGFFGAALGSVGGVG  103

Query  449  gggIFVPMLTLILRFDPKSATAISKCM  529
            GGGIFVPMLTLI+ FDPKS+TAISKCM
Sbjct  104  GGGIFVPMLTLIIGFDPKSSTAISKCM  130



>ref|XP_002516037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46457.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE++FGWKIV+G +IG  GAA GSVGGVGGGGIFVPMLTLI+ FD KS+TA+SKC
Sbjct  68   YKHVWPEMRFGWKIVLGGVIGVFGAACGSVGGVGGGGIFVPMLTLIVGFDAKSSTALSKC  127

Query  527  M  529
            M
Sbjct  128  M  128



>ref|XP_004235668.1| PREDICTED: uncharacterized protein LOC101262796 [Solanum lycopersicum]
 ref|XP_010318541.1| PREDICTED: uncharacterized protein LOC101262796 [Solanum lycopersicum]
Length=482

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 5/90 (6%)
 Frame = +2

Query  272  ANNSDAHHH----LLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +NN   H +    L   F +   K   + H HVWPE +FGW+++VGS+IGF GAAFGSVG
Sbjct  42   SNNGTTHSYESSYLFDLFNILWRKSEINYH-HVWPEPEFGWRLIVGSVIGFFGAAFGSVG  100

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVP+LTLI+ FDPK++TAISKCM
Sbjct  101  GVGGGGIFVPVLTLIIGFDPKTSTAISKCM  130



>gb|KHM98753.1| hypothetical protein glysoja_030806 [Glycine soja]
Length=479

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  242  AALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflga  421
            +AL+ +     + + A    L K +      SG  + H WPE++FGW+I+ G+IIGF+G+
Sbjct  28   SALEHVNHKKIDPTTAETSFLGKVMNFLWSSSGSGYEHTWPEIEFGWRIITGTIIGFVGS  87

Query  422  afgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            AFG+VGGVGGGGIFV ML+LI+ FD KSATAISKCM
Sbjct  88   AFGTVGGVGGGGIFVTMLSLIIGFDAKSATAISKCM  123



>ref|XP_009140696.1| PREDICTED: uncharacterized protein LOC103864686 [Brassica rapa]
Length=470

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            S A  SD        FL    +   H   HVWPE +F W+IV+G+++GF GAAFGSVGGV
Sbjct  37   SKARESDEPPSFFLDFLWEPDQTGYH---HVWPEFEFNWQIVLGTLVGFFGAAFGSVGGV  93

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML+LI+ FDPKSATA+SKCM
Sbjct  94   GGGGIFVPMLSLIIGFDPKSATALSKCM  121



>emb|CDX77007.1| BnaC04g38020D [Brassica napus]
Length=470

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            S A  SD        FL    +   H   HVWPE +F W+IV+G+++GF GAAFGSVGGV
Sbjct  37   SKARESDEPPSFFLDFLWEPDQTGYH---HVWPEFEFNWQIVLGTLVGFFGAAFGSVGGV  93

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML+LI+ FDPKSATA+SKCM
Sbjct  94   GGGGIFVPMLSLIIGFDPKSATALSKCM  121



>emb|CDY35338.1| BnaA04g15090D [Brassica napus]
Length=470

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +2

Query  266  SDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            S A  SD        FL    +   H   HVWPE +F W+IV+G+++GF GAAFGSVGGV
Sbjct  37   SKARESDEPPSFFLDFLWEPDQTGYH---HVWPEFEFNWQIVLGTLVGFFGAAFGSVGGV  93

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML+LI+ FDPKSATA+SKCM
Sbjct  94   GGGGIFVPMLSLIIGFDPKSATALSKCM  121



>gb|ACU23197.1| unknown [Glycine max]
Length=261

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
             D    +  VWPE++FGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTL++ FD KS+
Sbjct  64   NDGEPTNDRVWPEMEFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSS  123

Query  509  TAISKCM  529
            TA+SKCM
Sbjct  124  TALSKCM  130



>ref|XP_009346009.1| PREDICTED: uncharacterized protein LOC103937781 [Pyrus x bretschneideri]
Length=489

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE+  GWKIVVG+IIGFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  75   YEHVWPEMTIGWKIVVGTIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDQKSSTAISKC  134

Query  527  M  529
            M
Sbjct  135  M  135



>ref|XP_008342687.1| PREDICTED: uncharacterized protein LOC103405461 [Malus domestica]
Length=428

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE+  GWKIVVG+IIGFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  14   YEHVWPEMTIGWKIVVGTIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDQKSSTAISKC  73

Query  527  M  529
            M
Sbjct  74   M  74



>ref|XP_006383214.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
 gb|ERP61011.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
Length=477

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWP++KF W+IVVG+I+GFLGAA GSVGGVGGGGIFVPMLTLI+ 
Sbjct  62   FLFQGGKSS---YEPVWPDMKFDWRIVVGTIVGFLGAALGSVGGVGGGGIFVPMLTLIIG  118

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  119  FDPKSSTAISKCM  131



>ref|XP_006596174.1| PREDICTED: uncharacterized protein LOC100781779 isoform X2 [Glycine 
max]
Length=416

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE++F W+IVVG++IG LGAAFGSVGGVGGGGIFVPML LI+ FDPKSA AISKC
Sbjct  53   YQHVWPEMEFSWRIVVGTLIGILGAAFGSVGGVGGGGIFVPMLILIIGFDPKSAVAISKC  112

Query  527  M  529
            M
Sbjct  113  M  113



>ref|XP_004498483.1| PREDICTED: uncharacterized protein LOC101508758 isoform X1 [Cicer 
arietinum]
Length=458

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
            +S   + H+WP+++FGW I+VG++IG  GAAFGSVGGVGGGGIFVPML LI+ FDPKSAT
Sbjct  47   NSHSGYEHIWPDMEFGWNIIVGTLIGIFGAAFGSVGGVGGGGIFVPMLILIIGFDPKSAT  106

Query  512  AISKCM  529
            AISKCM
Sbjct  107  AISKCM  112



>ref|XP_006596173.1| PREDICTED: uncharacterized protein LOC100781779 isoform X1 [Glycine 
max]
Length=433

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE++F W+IVVG++IG LGAAFGSVGGVGGGGIFVPML LI+ FDPKSA AISKC
Sbjct  53   YQHVWPEMEFSWRIVVGTLIGILGAAFGSVGGVGGGGIFVPMLILIIGFDPKSAVAISKC  112

Query  527  M  529
            M
Sbjct  113  M  113



>ref|XP_004498484.1| PREDICTED: uncharacterized protein LOC101508758 isoform X2 [Cicer 
arietinum]
Length=457

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
            +S   + H+WP+++FGW I+VG++IG  GAAFGSVGGVGGGGIFVPML LI+ FDPKSAT
Sbjct  47   NSHSGYEHIWPDMEFGWNIIVGTLIGIFGAAFGSVGGVGGGGIFVPMLILIIGFDPKSAT  106

Query  512  AISKCM  529
            AISKCM
Sbjct  107  AISKCM  112



>ref|XP_007159524.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31518.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=462

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
            D+   + H WP +KFGWKI+VGS++GFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KSA 
Sbjct  45   DTNLNYPHTWPSIKFGWKIIVGSMVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDTKSAI  104

Query  512  AISKCM  529
            AISKCM
Sbjct  105  AISKCM  110



>ref|XP_006294138.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
 gb|EOA27036.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
Length=472

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 8/91 (9%)
 Frame = +2

Query  275  NNSDAHHHLLSKFLMR------ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsv  436
             +SD      S FL++      E+   G+ H  VWPE +F W+IV+G+++GF GAAFGSV
Sbjct  38   GDSDETREKESSFLIKAVNFLWESNQIGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSV  95

Query  437  ggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GGVGGGGIFVPML+LI+ FDPKSATAISKCM
Sbjct  96   GGVGGGGIFVPMLSLIIGFDPKSATAISKCM  126



>ref|XP_003527825.1| PREDICTED: uncharacterized protein LOC100810784 [Glycine max]
 gb|KHN18202.1| hypothetical protein glysoja_025092 [Glycine soja]
Length=477

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 76/106 (72%), Gaps = 8/106 (8%)
 Frame = +2

Query  218  ESGSLKKEAALQSIKLSDANNSDAHHHLLSKFL--MRETKDSGHRHSHVWPELKFGWKIV  391
            E   +K E A    + +   + +     L+K L  + ++ +SG++H  VWP+++FGW+IV
Sbjct  28   ERSIMKMEVA----RFNVTTSREPQQSFLTKALNFLWQSGESGYQH--VWPDMEFGWQIV  81

Query  392  VGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            VG+ +GF GAAFGSVGGVGGGGIFVPML+LI+ FD KS+TAISKCM
Sbjct  82   VGTFVGFCGAAFGSVGGVGGGGIFVPMLSLIVGFDQKSSTAISKCM  127



>ref|XP_007161342.1| hypothetical protein PHAVU_001G061000g [Phaseolus vulgaris]
 gb|ESW33336.1| hypothetical protein PHAVU_001G061000g [Phaseolus vulgaris]
Length=460

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE++FGW+IVVG+++G LGAAFGSVGGVGGGGIFVPM+ LIL FDPKSA +ISKC
Sbjct  53   YQHVWPEMEFGWRIVVGTLLGILGAAFGSVGGVGGGGIFVPMVILILGFDPKSAVSISKC  112

Query  527  M  529
            M
Sbjct  113  M  113



>ref|XP_010249713.1| PREDICTED: uncharacterized protein LOC104592186 [Nelumbo nucifera]
Length=480

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 6/90 (7%)
 Frame = +2

Query  269  DANNSDAHHHLLSK---FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            +   ++ H + L +   F+ +  K   H   HVWP +KFGW+IV+G+IIGF GAAFGSVG
Sbjct  41   NKGTAEVHSNYLVQIKTFIWQAGKSGYH---HVWPPMKFGWEIVLGTIIGFCGAAFGSVG  97

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FD KS+TAISKCM
Sbjct  98   GVGGGGIFVPMLTLIIGFDAKSSTAISKCM  127



>ref|XP_006465610.1| PREDICTED: uncharacterized protein LOC102613305 isoform X1 [Citrus 
sinensis]
 ref|XP_006465611.1| PREDICTED: uncharacterized protein LOC102613305 isoform X2 [Citrus 
sinensis]
 ref|XP_006465612.1| PREDICTED: uncharacterized protein LOC102613305 isoform X3 [Citrus 
sinensis]
Length=477

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  335  SGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATA  514
            SG++H  VWP++KFGWKIVV SIIGF GAA GSVGGVGGGGIFVPML LI+ FDPKS+ A
Sbjct  63   SGYKH--VWPDIKFGWKIVVSSIIGFFGAACGSVGGVGGGGIFVPMLNLIIGFDPKSSVA  120

Query  515  ISKCM  529
            +SKCM
Sbjct  121  LSKCM  125



>gb|KHN04837.1| hypothetical protein glysoja_047520 [Glycine soja]
Length=448

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPE++F W+IVVG++IG LGAAFGSVGGVGGGGIFVPML LI+ FDPKSA AISKC
Sbjct  53   YQHVWPEMEFSWRIVVGTLIGILGAAFGSVGGVGGGGIFVPMLILIIGFDPKSAVAISKC  112

Query  527  M  529
            M
Sbjct  113  M  113



>ref|XP_006426964.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426965.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426966.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40204.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40205.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40206.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
Length=477

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  335  SGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATA  514
            SG++H  VWP++KFGWKIVV SIIGF GAA GSVGGVGGGGIFVPML LI+ FDPKS+ A
Sbjct  63   SGYKH--VWPDIKFGWKIVVSSIIGFFGAACGSVGGVGGGGIFVPMLNLIIGFDPKSSVA  120

Query  515  ISKCM  529
            +SKCM
Sbjct  121  LSKCM  125



>ref|XP_009353619.1| PREDICTED: uncharacterized protein LOC103944866 [Pyrus x bretschneideri]
Length=474

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  NNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggg  454
             +  A  H L++ L    +     + HVWPE+KFGW+IVVG+IIGF+GAAFG+VGGVGGG
Sbjct  38   QDDSATQHYLNRMLNFLWQKGRLGYEHVWPEMKFGWRIVVGTIIGFIGAAFGTVGGVGGG  97

Query  455  gIFVPMLTLILRFDPKSATAISKCM  529
            G FVPMLTLI+ FD KS+TAISKCM
Sbjct  98   GFFVPMLTLIIGFDEKSSTAISKCM  122



>gb|KDP37239.1| hypothetical protein JCGZ_06295 [Jatropha curcas]
Length=482

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = +2

Query  305  SKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPM  472
            S F++R      ++    ++HVWP++KFGW+IVVG+IIGF GAAFGSVGGVGGGGIFVPM
Sbjct  52   SGFMLRVINFLWQEGQLGYTHVWPDMKFGWRIVVGTIIGFFGAAFGSVGGVGGGGIFVPM  111

Query  473  LTLILRFDPKSATAISKCM  529
            LTLI+ FD KS+TAISK M
Sbjct  112  LTLIIGFDAKSSTAISKFM  130



>ref|XP_002310222.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
 gb|EEE90672.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
Length=477

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWP++KF W++VVG+I+GF GAA GSVGGVGGGGIFVPMLTLI+ 
Sbjct  62   FLFQGGKSS---YEPVWPDMKFDWRVVVGTIVGFFGAALGSVGGVGGGGIFVPMLTLIIG  118

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  119  FDPKSSTAISKCM  131



>ref|XP_003527721.1| PREDICTED: uncharacterized protein LOC100789748 [Glycine max]
 gb|ABC47859.1| membrane protein-like protein [Glycine max]
 gb|KHN22333.1| hypothetical protein glysoja_022089 [Glycine soja]
Length=491

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
             D    +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTL++ FD KS+
Sbjct  64   NDGEPTNDRVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSS  123

Query  509  TAISKCM  529
            TA+SKCM
Sbjct  124  TALSKCM  130



>ref|XP_009403527.1| PREDICTED: uncharacterized protein LOC103987063 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 4/98 (4%)
 Frame = +2

Query  236  KEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgfl  415
            +EAA   + + +   SD    ++  FL +  K S   + HVWP +K GW+IVVG+IIGFL
Sbjct  33   EEAAADVVAVEEVGLSDYVLKVVD-FLWQPDKSS---YQHVWPPMKLGWQIVVGTIIGFL  88

Query  416  gaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            G+AFGSVGGVGGGGI+VPMLTLI+ FD KS+TA+SKCM
Sbjct  89   GSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAMSKCM  126



>gb|ABC47842.1| membrane protein-like protein [Glycine max]
Length=469

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
             D    +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTL++ FD KS+
Sbjct  63   NDGEPTNDRVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSS  122

Query  509  TAISKCM  529
            TA+SKCM
Sbjct  123  TALSKCM  129



>ref|XP_009403528.1| PREDICTED: uncharacterized protein LOC103987063 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 4/98 (4%)
 Frame = +2

Query  236  KEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgfl  415
            +EAA   + + +   SD    ++  FL +  K S   + HVWP +K GW+IVVG+IIGFL
Sbjct  33   EEAAADVVAVEEVGLSDYVLKVVD-FLWQPDKSS---YQHVWPPMKLGWQIVVGTIIGFL  88

Query  416  gaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            G+AFGSVGGVGGGGI+VPMLTLI+ FD KS+TA+SKCM
Sbjct  89   GSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAMSKCM  126



>gb|EPS70855.1| hypothetical protein M569_03905 [Genlisea aurea]
Length=444

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  HRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAIS  520
            + + HVWP+  F W++VVGSIIGFLGAAFGSVGGVGGGGIFVPMLTLI+ FD KSATAIS
Sbjct  57   YGYQHVWPDFAFNWRLVVGSIIGFLGAAFGSVGGVGGGGIFVPMLTLIIGFDAKSATAIS  116

Query  521  KCM  529
            KCM
Sbjct  117  KCM  119



>ref|XP_004959391.1| PREDICTED: uncharacterized protein LOC101762929 [Setaria italica]
Length=459

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  323  ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPK  502
            E    G  + HVWP ++ GW+IV+GS+IGF GAA GSVGGVGGGGIFVPML LI+ FDPK
Sbjct  48   EEMGDGKAYHHVWPPMELGWRIVLGSLIGFFGAACGSVGGVGGGGIFVPMLALIIGFDPK  107

Query  503  SATAISKCM  529
            S+TAISKCM
Sbjct  108  SSTAISKCM  116



>ref|XP_003523605.1| PREDICTED: uncharacterized protein LOC100816633 [Glycine max]
 gb|KHN04486.1| hypothetical protein glysoja_019573 [Glycine soja]
Length=474

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
             D    +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGGGGIF+PMLTL++ FD KS+
Sbjct  63   NDGEPTNDRVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSS  122

Query  509  TAISKCM  529
            TA+SKCM
Sbjct  123  TALSKCM  129



>ref|XP_007216108.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
 gb|EMJ17307.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
Length=439

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPELKF W IVVG++IGF+GA+FG+VGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  69   YEHVWPELKFDWIIVVGTVIGFIGASFGTVGGVGGGGIFVPMLTLIIGFDEKSSTAISKC  128

Query  527  M  529
            M
Sbjct  129  M  129



>ref|XP_011072363.1| PREDICTED: uncharacterized protein LOC105157640 [Sesamum indicum]
Length=473

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 62/72 (86%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRF  493
             +++++D   RH  VWP+++FGW+I +G++IGF GAA GSVGGVGGGGIFVPMLTLI+ F
Sbjct  53   FLQQSRDRVFRH--VWPDMEFGWRIGLGTVIGFFGAALGSVGGVGGGGIFVPMLTLIIGF  110

Query  494  DPKSATAISKCM  529
            DPK++TA+SKCM
Sbjct  111  DPKTSTAVSKCM  122



>ref|XP_004512029.1| PREDICTED: uncharacterized protein LOC101496928 isoform X2 [Cicer 
arietinum]
Length=523

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KF WKI+VGSI+GFLGAA GSVGGVGGGGIFVPML LI+ FDPKS+TAISKC
Sbjct  122  YEPVWPEMKFDWKIIVGSIVGFLGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKC  181

Query  527  M  529
            M
Sbjct  182  M  182



>ref|XP_004512028.1| PREDICTED: uncharacterized protein LOC101496928 isoform X1 [Cicer 
arietinum]
Length=524

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KF WKI+VGSI+GFLGAA GSVGGVGGGGIFVPML LI+ FDPKS+TAISKC
Sbjct  122  YEPVWPEMKFDWKIIVGSIVGFLGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKC  181

Query  527  M  529
            M
Sbjct  182  M  182



>ref|XP_004512031.1| PREDICTED: uncharacterized protein LOC101496928 isoform X4 [Cicer 
arietinum]
Length=522

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KF WKI+VGSI+GFLGAA GSVGGVGGGGIFVPML LI+ FDPKS+TAISKC
Sbjct  122  YEPVWPEMKFDWKIIVGSIVGFLGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKC  181

Query  527  M  529
            M
Sbjct  182  M  182



>ref|XP_004512030.1| PREDICTED: uncharacterized protein LOC101496928 isoform X3 [Cicer 
arietinum]
Length=523

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWPE+KF WKI+VGSI+GFLGAA GSVGGVGGGGIFVPML LI+ FDPKS+TAISKC
Sbjct  122  YEPVWPEMKFDWKIIVGSIVGFLGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKC  181

Query  527  M  529
            M
Sbjct  182  M  182



>ref|XP_007156036.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
 gb|ESW28030.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
Length=471

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  353  HVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
             VWPE+KFGW+IVVGS++GF GAA GSVGGVGGGGIF+PMLTLI+ FD KS+TAISKCM
Sbjct  66   RVWPEMKFGWRIVVGSVVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDAKSSTAISKCM  124



>ref|XP_008228542.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
 ref|XP_008228543.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
Length=479

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWPELKF WKIVV ++IGF+GAAFG+VGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  69   YEHVWPELKFDWKIVVCTVIGFIGAAFGTVGGVGGGGIFVPMLTLIIGFDEKSSTAISKC  128

Query  527  M  529
            M
Sbjct  129  M  129



>ref|XP_006405251.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
 gb|ESQ46704.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
Length=478

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 2/69 (3%)
 Frame = +2

Query  323  ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPK  502
            E+  +G+ H  VWPE +F W+IV+G+++GF GAAFGSVGGVGGGGIFVPML+LI+ FDPK
Sbjct  63   ESDQTGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPK  120

Query  503  SATAISKCM  529
            SATA+SKCM
Sbjct  121  SATAMSKCM  129



>emb|CDY70121.1| BnaC03g72820D [Brassica napus]
Length=463

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 2/69 (3%)
 Frame = +2

Query  323  ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPK  502
            E+  +G+ H  VWPE +F W+IV+G+++GF GAAFGSVGGVGGGGIFVPML+LI+ FDPK
Sbjct  48   ESDQTGYHH--VWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPK  105

Query  503  SATAISKCM  529
            SATA+SKCM
Sbjct  106  SATAMSKCM  114



>ref|XP_011025767.1| PREDICTED: uncharacterized protein LOC105126564 [Populus euphratica]
Length=477

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWP++KF W+I VG+I+GF GAA GSVGGVGGGGIFVPMLTLI+ 
Sbjct  62   FLFQGGKSS---YEPVWPDMKFDWRITVGTIVGFFGAALGSVGGVGGGGIFVPMLTLIIG  118

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  119  FDPKSSTAISKCM  131



>ref|XP_002516036.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46456.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 9/78 (12%)
 Frame = +2

Query  323  ETKDSGHRH---------SHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPML  475
            +T+ +G+ H          HVWPE++ GW+IVVG+IIGF GAAFGS GGVGGGGI+VPML
Sbjct  40   QTQQAGYLHHGNKGHSDYKHVWPEMRIGWRIVVGAIIGFFGAAFGSAGGVGGGGIYVPML  99

Query  476  TLILRFDPKSATAISKCM  529
            TLI+ FD KS+ AISKCM
Sbjct  100  TLIIGFDAKSSIAISKCM  117



>ref|XP_010254876.1| PREDICTED: uncharacterized protein LOC104595716 isoform X1 [Nelumbo 
nucifera]
Length=471

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRF  493
            L+R+ ++S + H  VWPE+K  W++V+GSIIGF GAA GSVGGVGGGGIFVPMLTLI+ F
Sbjct  58   LLRQNENSTYHH--VWPEMKLEWRLVLGSIIGFFGAALGSVGGVGGGGIFVPMLTLIIGF  115

Query  494  DPKSATAISKCM  529
            D KS+TAISKCM
Sbjct  116  DAKSSTAISKCM  127



>ref|XP_006426963.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
 gb|ESR40203.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
Length=479

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMR-ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            +A + + + H+    +++     S   + HVWP++KFGW+IVVG+IIGF G A GSVGGV
Sbjct  38   EATSKNKNDHVEPNIVIKVSAPKSRSGYKHVWPDIKFGWRIVVGTIIGFFGTACGSVGGV  97

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML LI+ FD KS+ A+SKCM
Sbjct  98   GGGGIFVPMLNLIVGFDAKSSAAVSKCM  125



>ref|XP_006465615.1| PREDICTED: uncharacterized protein LOC102614288 isoform X2 [Citrus 
sinensis]
Length=477

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMR-ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            +A + + + H+    +++     S   + HVWP++KFGW+IVVG+IIGF G A GSVGGV
Sbjct  38   EATSENKNDHVEPNIVIKVSAPKSRSGYKHVWPDIKFGWRIVVGTIIGFFGTACGSVGGV  97

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML LI+ FD KS+ A+SKCM
Sbjct  98   GGGGIFVPMLNLIVGFDAKSSAAVSKCM  125



>dbj|BAJ87419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  329  KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSA  508
            +  G  + HVWP LK GWKIV+GS IGF GAAFGS+GGVGGGG+FVPMLTLI+ FDPKS+
Sbjct  51   QSDGTSYHHVWPPLKLGWKIVLGSFIGFFGAAFGSIGGVGGGGVFVPMLTLIIGFDPKSS  110

Query  509  TAISKCM  529
             A+SKCM
Sbjct  111  AAMSKCM  117



>ref|XP_006465614.1| PREDICTED: uncharacterized protein LOC102614288 isoform X1 [Citrus 
sinensis]
Length=479

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMR-ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggv  445
            +A + + + H+    +++     S   + HVWP++KFGW+IVVG+IIGF G A GSVGGV
Sbjct  38   EATSENKNDHVEPNIVIKVSAPKSRSGYKHVWPDIKFGWRIVVGTIIGFFGTACGSVGGV  97

Query  446  ggggIFVPMLTLILRFDPKSATAISKCM  529
            GGGGIFVPML LI+ FD KS+ A+SKCM
Sbjct  98   GGGGIFVPMLNLIVGFDAKSSAAVSKCM  125



>emb|CDX83221.1| BnaA03g22850D [Brassica napus]
Length=462

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 60/69 (87%), Gaps = 2/69 (3%)
 Frame = +2

Query  323  ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPK  502
            E+  +G+ H  VWPE +F W++V+G+++GF GAAFGSVGGVGGGGIFVPML+LI+ FDPK
Sbjct  47   ESDQTGYHH--VWPEFEFNWQVVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPK  104

Query  503  SATAISKCM  529
            SATA+SKCM
Sbjct  105  SATAMSKCM  113



>gb|EPS70854.1| hypothetical protein M569_03904, partial [Genlisea aurea]
Length=479

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL R  ++SG+ H  VWP+L+  WK+VVGS+IGFLGAAFGSVGGVGGGGIFVPMLTLI+ 
Sbjct  61   FLWRP-QESGYHH--VWPDLELNWKLVVGSMIGFLGAAFGSVGGVGGGGIFVPMLTLIIG  117

Query  491  FDPKSATAISKCM  529
            FD KSATAISKCM
Sbjct  118  FDAKSATAISKCM  130



>ref|XP_004302906.1| PREDICTED: uncharacterized protein LOC101294092 [Fragaria vesca 
subsp. vesca]
Length=479

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +2

Query  269  DANNSDAHHHLLSKFLMRET----KDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsv  436
            DA+         S +L R      +     +  VWPE++FGW+IVVG+IIGF+GAAFG+V
Sbjct  39   DASTYSGAEKFQSGYLNRVLSFVWRPGQLGYVAVWPEMEFGWRIVVGTIIGFIGAAFGTV  98

Query  437  ggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GGVGGGGIFVPMLTLI+ FD KS+TA+SKCM
Sbjct  99   GGVGGGGIFVPMLTLIIGFDDKSSTALSKCM  129



>ref|XP_009133962.1| PREDICTED: uncharacterized protein LOC103858367 [Brassica rapa]
Length=462

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 60/69 (87%), Gaps = 2/69 (3%)
 Frame = +2

Query  323  ETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPK  502
            E+  +G+ H  VWPE +F W++V+G+++GF GAAFGSVGGVGGGGIFVPML+LI+ FDPK
Sbjct  47   ESDQTGYHH--VWPEFEFNWQVVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPK  104

Query  503  SATAISKCM  529
            SATA+SKCM
Sbjct  105  SATAMSKCM  113



>gb|ACJ85296.1| unknown [Medicago truncatula]
Length=474

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvgg-ggIFVPMLTLILRFDPKSATAISK  523
            +  VWPE+KFGW+IVVGSI+GF GAA GSVGGVGG  GIF+PMLTLI+ FDPKS+TA+SK
Sbjct  62   YERVWPEMKFGWRIVVGSIVGFFGAALGSVGGVGGWKGIFIPMLTLIIGFDPKSSTALSK  121

Query  524  CM  529
            CM
Sbjct  122  CM  123



>gb|KHN42580.1| hypothetical protein glysoja_042801 [Glycine soja]
Length=469

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 63/72 (88%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  LMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRF  493
             + +  +SG++H  VWP+++FGW+I++G+I+GF GAAFGSVGGVGGGGIFVPML+LI+ F
Sbjct  51   FLWQPGESGYQH--VWPDMEFGWQIILGTIVGFFGAAFGSVGGVGGGGIFVPMLSLIIGF  108

Query  494  DPKSATAISKCM  529
            D KS+TAISKCM
Sbjct  109  DAKSSTAISKCM  120



>ref|XP_007159526.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
 gb|ESW31520.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
Length=464

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VGS++ FLG+AFG+VGGVGGGGIFVPMLTLI+ FD KSATAISKC
Sbjct  58   YKHHWPSMKFGWRIIVGSLVAFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAISKC  117

Query  527  M  529
            M
Sbjct  118  M  118



>gb|KHN06457.1| hypothetical protein glysoja_010801 [Glycine soja]
Length=427

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +K+GWKI+VG+I+GFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KSA AISKC
Sbjct  55   YQHSWPSMKYGWKIIVGTIVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDAKSAIAISKC  114

Query  527  M  529
            M
Sbjct  115  M  115



>gb|KHN06458.1| hypothetical protein glysoja_010802 [Glycine soja]
Length=469

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VG+I+GFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KSATAISKC
Sbjct  59   YKHHWPSMKFGWRIIVGAIVGFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAISKC  118

Query  527  M  529
            M
Sbjct  119  M  119



>ref|XP_006580197.1| PREDICTED: uncharacterized protein LOC100818778 [Glycine max]
Length=469

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VG+I+GFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KSATAISKC
Sbjct  59   YKHHWPSMKFGWRIIVGAIVGFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAISKC  118

Query  527  M  529
            M
Sbjct  119  M  119



>ref|XP_007150626.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
 gb|ESW22620.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
Length=480

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
             SG  + H WP+++FGW+IV GSIIGFLG+AFG+VGGVGGGGIFV ML++I+ FD KSAT
Sbjct  61   SSGSGYQHTWPDIEFGWRIVTGSIIGFLGSAFGTVGGVGGGGIFVTMLSIIIGFDQKSAT  120

Query  512  AISKCM  529
            AISKCM
Sbjct  121  AISKCM  126



>ref|XP_007217721.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
 gb|EMJ18920.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
Length=477

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +2

Query  305  SKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLI  484
            SKFL   +   G  + HVWPE++FGWKI VG+IIGFLGAAFGSVGGVGGGG FVPMLTLI
Sbjct  54   SKFL---SHPGGVVYKHVWPEMRFGWKIAVGTIIGFLGAAFGSVGGVGGGGFFVPMLTLI  110

Query  485  LRFDPKSATAISKCM  529
            + FD KS+TAISKCM
Sbjct  111  IGFDQKSSTAISKCM  125



>ref|XP_002521607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40878.1| conserved hypothetical protein [Ricinus communis]
Length=478

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWPE++F +KIVVG+I+GFLGAA GSVGGVGGGGIFVPMLTL++ 
Sbjct  65   FLWQSGKSS---YEPVWPEMEFNYKIVVGTIVGFLGAALGSVGGVGGGGIFVPMLTLLIG  121

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  122  FDPKSSTAISKCM  134



>ref|XP_006595132.1| PREDICTED: uncharacterized protein LOC100789733 isoform X2 [Glycine 
max]
Length=480

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
             SG  + H WP+++FGW+I+ G+IIGFLG+AFG+VGGVGGGGIFV ML+LI+ FD KSAT
Sbjct  61   SSGSGYQHTWPDIEFGWRIITGTIIGFLGSAFGTVGGVGGGGIFVTMLSLIIGFDAKSAT  120

Query  512  AISKCM  529
            AISKCM
Sbjct  121  AISKCM  126



>ref|XP_003532779.1| PREDICTED: uncharacterized protein LOC100801788 [Glycine max]
 gb|KHN48051.1| hypothetical protein glysoja_015521 [Glycine soja]
Length=469

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VG+++GFLG+AFG+VGGVGGGGIFVPMLTLI+ FD KSATAISKC
Sbjct  59   YKHHWPSMKFGWRIIVGAVVGFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAISKC  118

Query  527  M  529
            M
Sbjct  119  M  119



>gb|KDP37237.1| hypothetical protein JCGZ_06293 [Jatropha curcas]
Length=389

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 3/73 (4%)
 Frame = +2

Query  320  RETKDSGHRHS---HVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            ++  D  H HS   H WP++ FGW+IVVG+IIGFLGAAFGS GGVGGGGIFVPMLTL++ 
Sbjct  49   QKIVDQSHSHSVYKHNWPKMTFGWRIVVGAIIGFLGAAFGSAGGVGGGGIFVPMLTLVIG  108

Query  491  FDPKSATAISKCM  529
            FD KS+ AISKCM
Sbjct  109  FDAKSSIAISKCM  121



>gb|KHN32619.1| hypothetical protein glysoja_022301 [Glycine soja]
Length=490

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
             SG  + H WP+++FGW+I+ G+IIGFLG+AFG+VGGVGGGGIFV ML+LI+ FD KSAT
Sbjct  61   SSGSGYQHTWPDIEFGWRIITGTIIGFLGSAFGTVGGVGGGGIFVTMLSLIIGFDAKSAT  120

Query  512  AISKCM  529
            AISKCM
Sbjct  121  AISKCM  126



>ref|XP_003542098.1| PREDICTED: uncharacterized protein LOC100789733 isoform X1 [Glycine 
max]
Length=487

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  332  DSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSAT  511
             SG  + H WP+++FGW+I+ G+IIGFLG+AFG+VGGVGGGGIFV ML+LI+ FD KSAT
Sbjct  61   SSGSGYQHTWPDIEFGWRIITGTIIGFLGSAFGTVGGVGGGGIFVTMLSLIIGFDAKSAT  120

Query  512  AISKCM  529
            AISKCM
Sbjct  121  AISKCM  126



>gb|EPS67474.1| hypothetical protein M569_07301, partial [Genlisea aurea]
Length=231

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +2

Query  260  KLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvg  439
            + S    ++    LLS F   E+  S    +  WPELKF W++ + ++IGF+G+A G+VG
Sbjct  27   RYSLGRGAEEEPSLLSVF---ESNPSYRSEAKFWPELKFNWRVALATVIGFVGSACGTVG  83

Query  440  gvggggIFVPMLTLILRFDPKSATAISKCM  529
            GVGGGGIFVPMLTLI+ FD KSA AISKCM
Sbjct  84   GVGGGGIFVPMLTLIVGFDSKSAAAISKCM  113



>ref|XP_010999980.1| PREDICTED: uncharacterized protein LOC105107666 [Populus euphratica]
Length=477

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 3/73 (4%)
 Frame = +2

Query  311  FLMRETKDSGHRHSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILR  490
            FL +  K S   +  VWP +KF W+IVVG+ +GFLGAA GSVGGVGGGGIFVPMLTLI+ 
Sbjct  62   FLFQGGKSS---YEPVWPVMKFDWRIVVGTAVGFLGAALGSVGGVGGGGIFVPMLTLIIG  118

Query  491  FDPKSATAISKCM  529
            FDPKS+TAISKCM
Sbjct  119  FDPKSSTAISKCM  131



>gb|KDO56903.1| hypothetical protein CISIN_1g0454882mg, partial [Citrus sinensis]
Length=308

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 9/101 (9%)
 Frame = +2

Query  227  SLKKEAALQSIKLSDANNSDAHHHLLSKFLMRETKDSGHRHSHVWPELKFGWKIVVGSII  406
            SLK EA  +S      + +D +H      +   +  S   + H+WP++KFGWKIVVG+II
Sbjct  34   SLKHEATTES----KNDQADPNH-----VIKISSPKSRSSYKHIWPDIKFGWKIVVGAII  84

Query  407  gflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKCM  529
            GF GAA GSVGG GGGGIF+PML LI+ FD KS+ A+S+CM
Sbjct  85   GFFGAACGSVGGDGGGGIFLPMLNLIVGFDAKSSIALSRCM  125



>gb|KDO79522.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=474

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 3/61 (5%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            +  VWP   FGWK+VVGSI+GF GAA GSVGGVGGGGIFVPMLTLI+ FDPKSATAISKC
Sbjct  71   YEPVWP---FGWKVVVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKC  127

Query  527  M  529
            M
Sbjct  128  M  128



>ref|XP_003629897.1| hypothetical protein MTR_8g088080 [Medicago truncatula]
 gb|AET04373.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=479

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VG+IIGFLG++FG+VGGVGGGGIFVPMLTLI+ FD KSATAISK 
Sbjct  65   YKHTWPGMKFGWRIIVGTIIGFLGSSFGTVGGVGGGGIFVPMLTLIVGFDAKSATAISKF  124

Query  527  M  529
            M
Sbjct  125  M  125



>gb|ACJ86264.1| unknown [Medicago truncatula]
Length=481

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VG+IIGFLG++FG+VGGVGGGGIFVPMLTLI+ FD KSATAISK 
Sbjct  67   YKHTWPGMKFGWRIIVGTIIGFLGSSFGTVGGVGGGGIFVPMLTLIVGFDAKSATAISKF  126

Query  527  M  529
            M
Sbjct  127  M  127



>ref|NP_001061719.1| Os08g0389700 [Oryza sativa Japonica Group]
 dbj|BAD05341.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD05726.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF23633.1| Os08g0389700 [Oryza sativa Japonica Group]
Length=465

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + HVWP ++FGWKIV+G +IGF GAAFGSVGGVGGGGIFVPMLTLI+ FD KS+TAISKC
Sbjct  57   YHHVWPPMEFGWKIVLGILIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKC  116

Query  527  M  529
            M
Sbjct  117  M  117



>ref|XP_004504238.1| PREDICTED: uncharacterized protein LOC101507523 [Cicer arietinum]
Length=468

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  HSHVWPELKFGWKIVVGSIIgflgaafgsvggvggggIFVPMLTLILRFDPKSATAISKC  526
            + H WP +KFGW+I+VG+IIGFLG++FG+VGGVGGGGIFVPMLTL++ FD KSATAISK 
Sbjct  54   YKHTWPGMKFGWRIIVGTIIGFLGSSFGTVGGVGGGGIFVPMLTLVIGFDAKSATAISKF  113

Query  527  M  529
            M
Sbjct  114  M  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514890587360