BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32677_g1_i1 len=1167 path=[1145:0-1166]

Length=1167
                                                                      Score     E

emb|CAN59960.1|  hypothetical protein VITISV_011608                     242   4e-73   Vitis vinifera
ref|XP_007216839.1|  hypothetical protein PRUPE_ppa022514mg             240   2e-72   
ref|XP_008230957.1|  PREDICTED: metalloendoproteinase 1-like            239   6e-72   
gb|EYU29748.1|  hypothetical protein MIMGU_mgv1a025409mg                237   8e-72   
ref|XP_008230962.1|  PREDICTED: metalloendoproteinase 1-like            239   9e-72   
gb|EYU18042.1|  hypothetical protein MIMGU_mgv1a018853mg                238   1e-71   
ref|XP_006482472.1|  PREDICTED: metalloendoproteinase 1-like            235   2e-70   
gb|KDP45996.1|  hypothetical protein JCGZ_11899                         234   4e-70   
ref|XP_003633209.1|  PREDICTED: metalloendoproteinase 1-like            233   2e-69   
ref|XP_007216923.1|  hypothetical protein PRUPE_ppa018181mg             229   8e-69   
ref|XP_008458713.1|  PREDICTED: metalloendoproteinase 1-like            229   1e-68   
gb|KDO37621.1|  hypothetical protein CISIN_1g035681mg                   230   2e-68   
ref|XP_008230963.1|  PREDICTED: metalloendoproteinase 1-like            230   2e-68   
ref|XP_008458907.1|  PREDICTED: metalloendoproteinase 1-like            229   4e-68   
ref|XP_004296560.1|  PREDICTED: metalloendoproteinase 1-like            228   6e-68   
ref|XP_007216922.1|  hypothetical protein PRUPE_ppa018385mg             228   7e-68   
ref|XP_004142457.1|  PREDICTED: metalloendoproteinase 1-like            228   1e-67   
ref|XP_007216949.1|  hypothetical protein PRUPE_ppa016355mg             224   5e-67   
gb|EYU34696.1|  hypothetical protein MIMGU_mgv11b016964mg               226   5e-67   
ref|XP_008352994.1|  PREDICTED: metalloendoproteinase 1-like            225   1e-66   
ref|XP_002280833.1|  PREDICTED: metalloendoproteinase 1                 226   1e-66   Vitis vinifera
ref|XP_008222422.1|  PREDICTED: metalloendoproteinase 1-like            225   1e-66   
ref|XP_008230676.1|  PREDICTED: metalloendoproteinase 1-like            224   2e-66   
ref|XP_002517411.1|  Metalloendoproteinase 1 precursor, putative        224   3e-66   Ricinus communis
ref|XP_002275556.1|  PREDICTED: metalloendoproteinase 1-like            224   3e-66   Vitis vinifera
ref|XP_004288499.1|  PREDICTED: metalloendoproteinase 1-like            224   4e-66   
ref|XP_007014936.1|  Matrixin family protein, putative                  223   6e-66   
gb|EYU34694.1|  hypothetical protein MIMGU_mgv1a023515mg                221   7e-66   
ref|XP_009341183.1|  PREDICTED: metalloendoproteinase 1-like            224   1e-65   
ref|XP_007010413.1|  Matrixin family protein                            222   2e-65   
ref|XP_004296559.1|  PREDICTED: metalloendoproteinase 1-like            222   2e-65   
ref|XP_007010415.1|  Matrixin family protein                            222   2e-65   
ref|XP_010037506.1|  PREDICTED: metalloendoproteinase 1-like            222   2e-65   
ref|XP_008355534.1|  PREDICTED: metalloendoproteinase 1-like            222   2e-65   
ref|XP_010091950.1|  Metalloendoproteinase 1                            224   3e-65   
ref|XP_008230961.1|  PREDICTED: metalloendoproteinase 1-like            222   3e-65   
ref|XP_002517412.1|  Matrix metalloproteinase, putative                 220   1e-64   Ricinus communis
ref|XP_007226174.1|  hypothetical protein PRUPE_ppa015434mg             220   1e-64   
ref|XP_004142461.1|  PREDICTED: metalloendoproteinase 1-like            219   2e-64   
ref|XP_008343421.1|  PREDICTED: metalloendoproteinase 1-like            219   2e-64   
ref|XP_008230960.1|  PREDICTED: metalloendoproteinase 1-like            219   2e-64   
ref|XP_008361888.1|  PREDICTED: metalloendoproteinase 1-like            219   3e-64   
ref|XP_008230675.1|  PREDICTED: metalloendoproteinase 1-like            218   4e-64   
ref|XP_008230959.1|  PREDICTED: metalloendoproteinase 1-like            218   5e-64   
gb|AES96374.2|  matrix metalloproteinase                                220   5e-64   
ref|XP_003613416.1|  Matrix metalloproteinase-9                         221   5e-64   
ref|XP_008458714.1|  PREDICTED: metalloendoproteinase 1-like            218   6e-64   
ref|XP_004297896.1|  PREDICTED: metalloendoproteinase 1-like            218   8e-64   
ref|XP_010037507.1|  PREDICTED: metalloendoproteinase 1-like            218   9e-64   
gb|EPS59674.1|  hypothetical protein M569_15132                         216   1e-63   
ref|NP_001266203.1|  matrix metalloproteinase precursor                 219   1e-63   
ref|XP_004504503.1|  PREDICTED: metalloendoproteinase 1-like            219   1e-63   
ref|XP_006448955.1|  hypothetical protein CICLE_v10017519mg             215   2e-63   
ref|XP_008368314.1|  PREDICTED: LOW QUALITY PROTEIN: metalloendop...    216   2e-63   
ref|XP_011073059.1|  PREDICTED: metalloendoproteinase 1-like            216   5e-63   
ref|XP_007153680.1|  hypothetical protein PHAVU_003G055800g             218   5e-63   
ref|XP_006363533.1|  PREDICTED: metalloendoproteinase 1-like            217   9e-63   
ref|XP_004159087.1|  PREDICTED: metalloendoproteinase 1-like            219   1e-62   
ref|XP_006438497.1|  hypothetical protein CICLE_v10031870mg             217   1e-62   
ref|XP_010255256.1|  PREDICTED: metalloendoproteinase 1-like            215   1e-62   
dbj|BAJ94792.1|  predicted protein                                      216   2e-62   
emb|CBI34985.3|  unnamed protein product                                213   2e-62   
ref|XP_008365496.1|  PREDICTED: metalloendoproteinase 1-like            214   2e-62   
gb|EYU29749.1|  hypothetical protein MIMGU_mgv1a023711mg                213   2e-62   
ref|XP_011071055.1|  PREDICTED: metalloendoproteinase 1-like            216   3e-62   
ref|XP_004139164.1|  PREDICTED: metalloendoproteinase 1-like            214   3e-62   
ref|XP_004297959.1|  PREDICTED: metalloendoproteinase 1-like            214   3e-62   
ref|XP_004142462.1|  PREDICTED: metalloendoproteinase 1-like            213   6e-62   
ref|XP_011072962.1|  PREDICTED: metalloendoproteinase 1-like            213   8e-62   
ref|XP_002520211.1|  Metalloendoproteinase 1 precursor, putative        214   8e-62   Ricinus communis
ref|XP_002280805.2|  PREDICTED: metalloendoproteinase 1-like            213   8e-62   Vitis vinifera
ref|XP_006602365.1|  PREDICTED: metalloendoproteinase 1-like            214   1e-61   
emb|CAN73128.1|  hypothetical protein VITISV_030256                     212   1e-61   Vitis vinifera
ref|XP_006856883.1|  hypothetical protein AMTR_s00055p00201730          214   1e-61   
ref|XP_003530663.1|  PREDICTED: metalloendoproteinase 1-like            214   1e-61   
ref|XP_010273763.1|  PREDICTED: metalloendoproteinase 1-like            213   2e-61   
dbj|BAJ93963.1|  predicted protein                                      213   2e-61   
ref|XP_006482471.1|  PREDICTED: metalloendoproteinase 1-like            209   2e-61   
gb|KDO82628.1|  hypothetical protein CISIN_1g021444mg                   210   7e-61   
ref|XP_010278837.1|  PREDICTED: metalloendoproteinase 1-like            210   1e-60   
emb|CDP00221.1|  unnamed protein product                                211   1e-60   
ref|XP_003560867.1|  PREDICTED: metalloendoproteinase 1-like            211   2e-60   
ref|XP_007010134.1|  Matrixin family protein, putative                  208   2e-60   
dbj|BAJ98922.1|  predicted protein                                      211   2e-60   
ref|XP_010510985.1|  PREDICTED: metalloendoproteinase 1-like            211   2e-60   
ref|XP_010414620.1|  PREDICTED: metalloendoproteinase 1-like            211   2e-60   
gb|ABF58910.1|  matrix metalloprotease 1                                210   3e-60   Nicotiana tabacum [American tobacco]
ref|XP_009758591.1|  PREDICTED: metalloendoproteinase 1-like            210   3e-60   
ref|XP_010039144.1|  PREDICTED: metalloendoproteinase 1-like            209   3e-60   
ref|XP_006448956.1|  hypothetical protein CICLE_v10017926mg             208   4e-60   
ref|XP_009624303.1|  PREDICTED: metalloendoproteinase 1-like            210   5e-60   
ref|XP_006363534.1|  PREDICTED: metalloendoproteinase 1-like            209   6e-60   
emb|CCH68443.1|  matrix metalloproteinase precursor                     209   6e-60   
ref|XP_008458917.1|  PREDICTED: metalloendoproteinase 1-like            207   8e-60   
emb|CBI34986.3|  unnamed protein product                                207   9e-60   
ref|XP_008458910.1|  PREDICTED: metalloendoproteinase 1-like            207   1e-59   
ref|XP_004237082.2|  PREDICTED: metalloendoproteinase 1                 209   1e-59   
ref|XP_004159085.1|  PREDICTED: metalloendoproteinase 1-like            207   1e-59   
emb|CAN73130.1|  hypothetical protein VITISV_030258                     210   1e-59   Vitis vinifera
ref|XP_011085796.1|  PREDICTED: metalloendoproteinase 1-like            207   2e-59   
ref|XP_008353003.1|  PREDICTED: metalloendoproteinase 1-like            208   2e-59   
ref|XP_006431003.1|  hypothetical protein CICLE_v10012543mg             204   2e-59   
ref|XP_004297678.1|  PREDICTED: metalloendoproteinase 1-like            208   2e-59   
ref|XP_008389591.1|  PREDICTED: metalloendoproteinase 1-like            209   2e-59   
gb|KDP45419.1|  hypothetical protein JCGZ_09668                         205   3e-59   
gb|ACJ24812.1|  matrix metalloproteinase                                207   3e-59   Pinus taeda
ref|XP_008443669.1|  PREDICTED: metalloendoproteinase 1-like            206   4e-59   
ref|XP_008458715.1|  PREDICTED: metalloendoproteinase 1-like            206   4e-59   
gb|KCW85819.1|  hypothetical protein EUGRSUZ_B02562                     207   5e-59   
ref|XP_010255281.1|  PREDICTED: metalloendoproteinase 1-like            207   6e-59   
ref|XP_004142465.1|  PREDICTED: metalloendoproteinase 1-like            204   6e-59   
emb|CDY30915.1|  BnaC09g14910D                                          206   6e-59   
gb|KCW49215.1|  hypothetical protein EUGRSUZ_K02795                     207   7e-59   
ref|XP_006300514.1|  hypothetical protein CARUB_v10020497mg             206   8e-59   
gb|ADD21635.1|  matrix metalloprotease 1                                206   9e-59   Nicotiana benthamiana
ref|XP_003517862.1|  PREDICTED: metalloendoproteinase 1-like            206   1e-58   
ref|XP_004142468.1|  PREDICTED: metalloendoproteinase 1-like            203   2e-58   
ref|XP_004509890.1|  PREDICTED: metalloendoproteinase 1-like            206   2e-58   
ref|XP_009113266.1|  PREDICTED: metalloendoproteinase 1                 206   3e-58   
ref|XP_007216020.1|  hypothetical protein PRUPE_ppa014830mg             203   3e-58   
emb|CDY45157.1|  BnaA09g14350D                                          204   3e-58   
ref|XP_002888162.1|  predicted protein                                  204   3e-58   
ref|XP_007217804.1|  hypothetical protein PRUPE_ppa024325mg             206   4e-58   
gb|KGN51345.1|  hypothetical protein Csa_5G522910                       202   4e-58   
gb|KDO75344.1|  hypothetical protein CISIN_1g037265mg                   203   4e-58   
ref|XP_004139163.1|  PREDICTED: metalloendoproteinase 1-like            202   7e-58   
ref|XP_007223246.1|  hypothetical protein PRUPE_ppa007227mg             204   8e-58   
gb|EPS61169.1|  matrixin family protein                                 202   8e-58   
ref|XP_011086481.1|  PREDICTED: metalloendoproteinase 1-like            204   8e-58   
ref|XP_008244963.1|  PREDICTED: metalloendoproteinase 1                 206   8e-58   
ref|XP_004965108.1|  PREDICTED: metalloendoproteinase 1-like            204   1e-57   
ref|XP_010470167.1|  PREDICTED: metalloendoproteinase 1-like            203   1e-57   
ref|NP_176205.1|  Matrixin family protein                               203   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100525.1|  Metalloendoproteinase 1                            204   1e-57   
ref|XP_010043822.1|  PREDICTED: metalloendoproteinase 1-like            207   1e-57   
ref|XP_010913461.1|  PREDICTED: metalloendoproteinase 1-like            203   2e-57   
gb|KGN52417.1|  hypothetical protein Csa_5G633150                       201   2e-57   
gb|KFK40830.1|  hypothetical protein AALP_AA2G047000                    203   2e-57   
ref|XP_009360449.1|  PREDICTED: metalloendoproteinase 1                 203   2e-57   
ref|XP_011042944.1|  PREDICTED: metalloendoproteinase 1-like            202   3e-57   
ref|NP_001048075.1|  Os02g0740700                                       202   4e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87473.1|  hypothetical protein OsI_08881                          202   4e-57   Oryza sativa Indica Group [Indian rice]
gb|KDP21290.1|  hypothetical protein JCGZ_21761                         202   4e-57   
gb|EAZ24565.1|  hypothetical protein OsJ_08327                          202   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001267680.1|  metalloendoproteinase 1-like precursor             201   5e-57   
ref|XP_004965107.1|  PREDICTED: metalloendoproteinase 1-like            200   5e-57   
ref|XP_006838196.1|  hypothetical protein AMTR_s00106p00141160          201   5e-57   
ref|XP_002318762.2|  MATRIX METALLOproteinASE                           202   5e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006495379.1|  PREDICTED: metalloendoproteinase 1-like            197   6e-57   
ref|XP_004142459.1|  PREDICTED: matrix metalloproteinase-9-like         199   8e-57   
emb|CAN76268.1|  hypothetical protein VITISV_004096                     201   1e-56   Vitis vinifera
ref|XP_002267298.2|  PREDICTED: metalloendoproteinase 1                 201   1e-56   Vitis vinifera
ref|XP_006647869.1|  PREDICTED: metalloendoproteinase 1-like            201   1e-56   
ref|XP_009626465.1|  PREDICTED: metalloendoproteinase 1-like            201   2e-56   
ref|XP_004142460.1|  PREDICTED: metalloendoproteinase 1-like            198   2e-56   
ref|XP_006357274.1|  PREDICTED: metalloendoproteinase 1-like            199   2e-56   
ref|XP_006376166.1|  hypothetical protein POPTR_0013s10410g             198   2e-56   
ref|XP_004159086.1|  PREDICTED: matrix metalloproteinase-9-like         198   2e-56   
ref|XP_010552627.1|  PREDICTED: metalloendoproteinase 1                 200   2e-56   
gb|ABK95950.1|  unknown                                                 198   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_003519796.1|  PREDICTED: metalloendoproteinase 1-like            200   2e-56   
dbj|BAE98757.1|  predicted GPI-anchored protein                         200   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300509.1|  hypothetical protein CARUB_v10020468mg             200   4e-56   
ref|NP_177174.1|  matrix metalloproteinase                              199   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46223.1|  hypothetical protein MIMGU_mgv1a025538mg                197   5e-56   
ref|XP_011003818.1|  PREDICTED: metalloendoproteinase 1-like            197   5e-56   
ref|XP_003628627.1|  Matrix metalloproteinase-9                         199   7e-56   
ref|XP_006304956.1|  hypothetical protein CARUB_v10011449mg             199   1e-55   
ref|XP_010110202.1|  Metalloendoproteinase 1                            197   1e-55   
emb|CDY23516.1|  BnaC06g24850D                                          198   1e-55   
ref|NP_001142095.1|  hypothetical protein precursor                     198   1e-55   Zea mays [maize]
gb|EYU46221.1|  hypothetical protein MIMGU_mgv1a010535mg                196   1e-55   
ref|XP_011003815.1|  PREDICTED: metalloendoproteinase 1-like            196   1e-55   
gb|EYU46222.1|  hypothetical protein MIMGU_mgv1a027058mg                196   1e-55   
ref|XP_010415694.1|  PREDICTED: metalloendoproteinase 1-like            198   2e-55   
ref|XP_002887284.1|  hypothetical protein ARALYDRAFT_476141             198   2e-55   
ref|XP_006390919.1|  hypothetical protein EUTSA_v10018701mg             198   2e-55   
ref|NP_001151749.1|  metalloendoproteinase 1 precursor                  197   3e-55   Zea mays [maize]
emb|CDY11609.1|  BnaC06g31300D                                          197   3e-55   
emb|CBI34987.3|  unnamed protein product                                195   3e-55   
ref|XP_007157519.1|  hypothetical protein PHAVU_002G076600g             197   3e-55   
ref|XP_002275671.1|  PREDICTED: metalloendoproteinase 1-like            195   3e-55   Vitis vinifera
ref|XP_010320628.1|  PREDICTED: metalloendoproteinase 1                 197   3e-55   
ref|XP_009410261.1|  PREDICTED: metalloendoproteinase 1                 197   4e-55   
ref|XP_011010763.1|  PREDICTED: metalloendoproteinase 1-like            195   4e-55   
emb|CDX68356.1|  BnaA07g23960D                                          197   4e-55   
gb|EYU35921.1|  hypothetical protein MIMGU_mgv1a019701mg                195   4e-55   
ref|XP_007044491.1|  Matrixin family protein, putative                  197   5e-55   
ref|XP_004143787.1|  PREDICTED: metalloendoproteinase 1-like            196   6e-55   
ref|XP_006367952.1|  PREDICTED: metalloendoproteinase 1-like            196   6e-55   
ref|XP_008798076.1|  PREDICTED: metalloendoproteinase 1-like            197   6e-55   
ref|XP_010264870.1|  PREDICTED: metalloendoproteinase 1-like            194   8e-55   
ref|XP_011085865.1|  PREDICTED: metalloendoproteinase 1-like            193   8e-55   
gb|KDP32993.1|  hypothetical protein JCGZ_13024                         194   8e-55   
gb|EYU42526.1|  hypothetical protein MIMGU_mgv1a011887mg                193   9e-55   
emb|CDY38799.1|  BnaA07g28710D                                          196   1e-54   
ref|XP_010512095.1|  PREDICTED: metalloendoproteinase 1                 195   2e-54   
gb|EYU28648.1|  hypothetical protein MIMGU_mgv1a008442mg                195   2e-54   
ref|XP_008465718.1|  PREDICTED: metalloendoproteinase 1                 194   3e-54   
ref|XP_010255269.1|  PREDICTED: metalloendoproteinase 1-like            193   3e-54   
ref|XP_010272073.1|  PREDICTED: metalloendoproteinase 1                 194   4e-54   
ref|XP_010471013.1|  PREDICTED: metalloendoproteinase 1-like            194   4e-54   
ref|XP_004142843.1|  PREDICTED: metalloendoproteinase 1-like            192   5e-54   
ref|XP_011080437.1|  PREDICTED: metalloendoproteinase 1-like            192   5e-54   
gb|KCW49214.1|  hypothetical protein EUGRSUZ_K02794                     189   6e-54   
ref|XP_009104967.1|  PREDICTED: metalloendoproteinase 1-like            194   7e-54   
ref|XP_004169198.1|  PREDICTED: metalloendoproteinase 1-like            192   7e-54   
gb|KFK41437.1|  hypothetical protein AALP_AA2G130300                    194   8e-54   
ref|XP_004152428.1|  PREDICTED: metalloendoproteinase 1-like            192   9e-54   
ref|XP_009105693.1|  PREDICTED: metalloendoproteinase 1-like            193   1e-53   
gb|KDO37628.1|  hypothetical protein CISIN_1g039411mg                   189   1e-53   
ref|XP_006387200.1|  hypothetical protein POPTR_1544s00200g             191   1e-53   
gb|KCW56124.1|  hypothetical protein EUGRSUZ_I01878                     191   1e-53   
ref|XP_010030761.1|  PREDICTED: metalloendoproteinase 1-like            191   1e-53   
ref|XP_004953898.1|  PREDICTED: metalloendoproteinase 1-like            193   1e-53   
ref|XP_002311051.2|  hypothetical protein POPTR_0008s02790g             190   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009780227.1|  PREDICTED: metalloendoproteinase 1-like            192   2e-53   
ref|NP_173824.2|  putative metalloproteinase                            192   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAC00572.1|  similar to zinc metalloproteinases                      192   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011002109.1|  PREDICTED: metalloendoproteinase 1-like            192   4e-53   
ref|XP_002436777.1|  hypothetical protein SORBIDRAFT_10g008650          191   4e-53   Sorghum bicolor [broomcorn]
ref|XP_006371427.1|  hypothetical protein POPTR_0019s10270g             189   7e-53   
gb|EYU22461.1|  hypothetical protein MIMGU_mgv1a008611mg                191   7e-53   
ref|XP_006414320.1|  hypothetical protein EUTSA_v10025551mg             191   8e-53   
ref|XP_002893327.1|  hypothetical protein ARALYDRAFT_889959             191   9e-53   
ref|XP_002319607.2|  hypothetical protein POPTR_0013s03350g             189   9e-53   Populus trichocarpa [western balsam poplar]
gb|EYU46220.1|  hypothetical protein MIMGU_mgv1a010241mg                189   1e-52   
ref|XP_010089255.1|  Metalloendoproteinase 1                            190   1e-52   
ref|XP_002325947.1|  hypothetical protein POPTR_0019s10230g             189   1e-52   Populus trichocarpa [western balsam poplar]
gb|KGN50256.1|  hypothetical protein Csa_5G162050                       190   1e-52   
gb|EYU34695.1|  hypothetical protein MIMGU_mgv1a024051mg                186   2e-52   
gb|EYU31381.1|  hypothetical protein MIMGU_mgv1a023026mg                187   2e-52   
ref|XP_002322292.2|  hypothetical protein POPTR_0015s11510g             190   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010460187.1|  PREDICTED: metalloendoproteinase 1-like            190   2e-52   
ref|XP_008437072.1|  PREDICTED: metalloendoproteinase 1                 189   2e-52   
ref|XP_003573113.1|  PREDICTED: metalloendoproteinase 1-like            190   2e-52   
ref|NP_001235535.1|  metalloendoproteinase 1 precursor                  187   2e-52   
emb|CDX90504.1|  BnaA03g42770D                                          189   3e-52   
ref|XP_010498935.1|  PREDICTED: metalloendoproteinase 1-like            191   4e-52   
gb|EYU38312.1|  hypothetical protein MIMGU_mgv11b017434mg               186   4e-52   
ref|XP_008458911.1|  PREDICTED: metalloendoproteinase 1-like            187   4e-52   
ref|XP_009629020.1|  PREDICTED: metalloendoproteinase 1-like            189   4e-52   
emb|CDY66521.1|  BnaCnng51190D                                          189   4e-52   
ref|XP_006416025.1|  hypothetical protein EUTSA_v10007920mg             189   4e-52   
ref|XP_010553642.1|  PREDICTED: metalloendoproteinase 1                 189   6e-52   
ref|XP_004510108.1|  PREDICTED: metalloendoproteinase 1-like            187   1e-51   
ref|XP_008458914.1|  PREDICTED: metalloendoproteinase 1-like            186   1e-51   
gb|KCW49213.1|  hypothetical protein EUGRSUZ_K02793                     183   2e-51   
gb|KDP28814.1|  hypothetical protein JCGZ_14585                         187   2e-51   
ref|XP_002452573.1|  hypothetical protein SORBIDRAFT_04g028370          187   3e-51   Sorghum bicolor [broomcorn]
ref|XP_006477577.1|  PREDICTED: metalloendoproteinase 1-like            186   3e-51   
ref|XP_010325488.1|  PREDICTED: metalloendoproteinase 1                 186   3e-51   
ref|XP_006583548.1|  PREDICTED: metalloendoproteinase 1-like            186   3e-51   
gb|KFK44477.1|  hypothetical protein AALP_AA1G261400                    187   4e-51   
gb|ACU20327.1|  unknown                                                 184   4e-51   Glycine max [soybeans]
ref|XP_002511639.1|  Metalloendoproteinase 1 precursor, putative        186   4e-51   Ricinus communis
ref|NP_001057259.1|  Os06g0239100                                       186   4e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00310.1|  hypothetical protein OsI_22327                          186   6e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_010477738.1|  PREDICTED: metalloendoproteinase 1                 186   6e-51   
ref|XP_007039816.1|  Matrixin family protein                            185   9e-51   
emb|CDY40518.1|  BnaC01g19940D                                          185   9e-51   
ref|XP_009136800.1|  PREDICTED: metalloendoproteinase 1-like            185   1e-50   
ref|XP_006355432.1|  PREDICTED: metalloendoproteinase 1-like            185   1e-50   
ref|XP_010910625.1|  PREDICTED: metalloendoproteinase 1-like            185   1e-50   
gb|KHN25070.1|  Metalloendoproteinase 1                                 185   1e-50   
ref|XP_004301194.1|  PREDICTED: metalloendoproteinase 1-like            185   1e-50   
ref|XP_009145660.1|  PREDICTED: metalloendoproteinase 1-like            184   2e-50   
emb|CDY16241.1|  BnaA09g29750D                                          185   2e-50   
gb|AET01165.2|  matrix metalloproteinase                                184   2e-50   
ref|XP_006440301.1|  hypothetical protein CICLE_v10024210mg             183   3e-50   
ref|XP_006387815.1|  hypothetical protein POPTR_0547s00200g             183   3e-50   
ref|XP_004167464.1|  PREDICTED: metalloendoproteinase 1-like            181   6e-50   
ref|XP_004142466.1|  PREDICTED: metalloendoproteinase 1-like            181   6e-50   
ref|XP_006369019.1|  senescence-specific family protein                 183   6e-50   
ref|XP_002870142.1|  hypothetical protein ARALYDRAFT_493212             183   6e-50   
ref|XP_003626689.1|  Matrix metalloproteinase-27                        183   8e-50   
ref|XP_011081262.1|  PREDICTED: metalloendoproteinase 1-like            183   8e-50   
ref|XP_009115471.1|  PREDICTED: metalloendoproteinase 1                 183   9e-50   
ref|XP_002274477.1|  PREDICTED: metalloendoproteinase 1                 182   1e-49   Vitis vinifera
ref|XP_011001486.1|  PREDICTED: metalloendoproteinase 1-like            182   2e-49   
ref|XP_009418044.1|  PREDICTED: metalloendoproteinase 1-like            181   2e-49   
gb|ACB59207.1|  matrixin family protein                                 182   3e-49   
emb|CAN66084.1|  hypothetical protein VITISV_024635                     181   3e-49   
ref|NP_193397.1|  Matrixin family protein                               181   3e-49   
ref|XP_007134548.1|  hypothetical protein PHAVU_010G056300g             181   4e-49   
ref|XP_009368959.1|  PREDICTED: metalloendoproteinase 1-like            179   4e-49   
gb|AAO42162.1|  putative proteinase                                     181   5e-49   
ref|XP_009351242.1|  PREDICTED: metalloendoproteinase 1-like            179   5e-49   
ref|XP_011019812.1|  PREDICTED: metalloendoproteinase 1-like            179   6e-49   
ref|XP_006283956.1|  hypothetical protein CARUB_v10005079mg             181   6e-49   
gb|EAY79487.1|  hypothetical protein OsI_34615                          179   6e-49   
ref|XP_006603838.1|  PREDICTED: metalloendoproteinase 1-like            179   7e-49   
ref|NP_001065361.2|  Os10g0557900                                       179   9e-49   
ref|XP_011094514.1|  PREDICTED: metalloendoproteinase 1                 179   1e-48   
gb|EYU19330.1|  hypothetical protein MIMGU_mgv1a010192mg                178   1e-48   
ref|XP_008458915.1|  PREDICTED: metalloendoproteinase 1-like            177   2e-48   
ref|XP_010264331.1|  PREDICTED: metalloendoproteinase 1-like            179   2e-48   
ref|XP_009610496.1|  PREDICTED: metalloendoproteinase 1-like            179   2e-48   
ref|XP_011020982.1|  PREDICTED: metalloendoproteinase 1-like            175   3e-48   
ref|XP_010055492.1|  PREDICTED: metalloendoproteinase 1                 178   3e-48   
ref|XP_003554856.1|  PREDICTED: metalloendoproteinase 1-like            177   3e-48   
gb|AAM62476.1|  proteinase like protein                                 178   3e-48   
ref|XP_008458912.1|  PREDICTED: metalloendoproteinase 1-like            176   4e-48   
ref|XP_006361512.1|  PREDICTED: metalloendoproteinase 1-like            178   5e-48   
ref|XP_010440122.1|  PREDICTED: metalloendoproteinase 1-like            178   6e-48   
emb|CAN65266.1|  hypothetical protein VITISV_040133                     176   6e-48   
ref|XP_007033352.1|  Matrixin family protein                            175   6e-48   
ref|XP_010647716.1|  PREDICTED: metalloendoproteinase 1-like            176   7e-48   
ref|XP_004248606.1|  PREDICTED: metalloendoproteinase 1-like            177   8e-48   
ref|XP_010444942.1|  PREDICTED: metalloendoproteinase 1-like            177   8e-48   
ref|XP_010451026.1|  PREDICTED: metalloendoproteinase 1-like            177   1e-47   
ref|XP_006375259.1|  hypothetical protein POPTR_0014s05720g             177   1e-47   
gb|KHN16355.1|  Metalloendoproteinase 1                                 174   1e-47   
ref|XP_002464938.1|  hypothetical protein SORBIDRAFT_01g029150          177   1e-47   
ref|XP_006577655.1|  PREDICTED: metalloendoproteinase 1-like            177   1e-47   
gb|EPS70970.1|  hypothetical protein M569_03790                         176   2e-47   
ref|XP_008238512.1|  PREDICTED: metalloendoproteinase 1                 176   2e-47   
ref|XP_009397655.1|  PREDICTED: metalloendoproteinase 1-like            176   2e-47   
ref|XP_008802827.1|  PREDICTED: metalloendoproteinase 1-like            176   3e-47   
ref|XP_010434790.1|  PREDICTED: metalloendoproteinase 1-like            176   3e-47   
emb|CDP09976.1|  unnamed protein product                                174   3e-47   
gb|KHN28682.1|  Metalloendoproteinase 1                                 177   3e-47   
ref|XP_002979138.1|  hypothetical protein SELMODRAFT_110370             176   3e-47   
ref|XP_002988587.1|  hypothetical protein SELMODRAFT_128150             176   3e-47   
ref|XP_004983677.1|  PREDICTED: metalloendoproteinase 1-like            176   4e-47   
ref|XP_011033214.1|  PREDICTED: metalloendoproteinase 1                 176   4e-47   
ref|XP_010053954.1|  PREDICTED: metalloendoproteinase 1                 175   5e-47   
ref|XP_008379873.1|  PREDICTED: metalloendoproteinase 1-like            173   5e-47   
ref|XP_007210794.1|  hypothetical protein PRUPE_ppa018176mg             175   6e-47   
ref|XP_007220919.1|  hypothetical protein PRUPE_ppb025548mg             174   6e-47   
gb|EYU29520.1|  hypothetical protein MIMGU_mgv1a018504mg                172   6e-47   
ref|XP_010538414.1|  PREDICTED: metalloendoproteinase 1                 175   8e-47   
ref|XP_008658321.1|  PREDICTED: metalloendoproteinase 1-like            175   8e-47   
ref|XP_003516663.2|  PREDICTED: metalloendoproteinase 1-like            174   1e-46   
ref|XP_003538740.1|  PREDICTED: metalloendoproteinase 1-like            174   1e-46   
ref|XP_003611315.1|  Matrix metalloproteinase-28                        174   1e-46   
gb|KDP39879.1|  hypothetical protein JCGZ_03410                         174   2e-46   
emb|CDP09487.1|  unnamed protein product                                173   2e-46   
ref|XP_002534615.1|  Metalloendoproteinase 1 precursor, putative        172   2e-46   
ref|XP_010695886.1|  PREDICTED: metalloendoproteinase 1-like            172   2e-46   
ref|XP_007157295.1|  hypothetical protein PHAVU_002G058000g             173   2e-46   
ref|XP_004511690.1|  PREDICTED: metalloendoproteinase 1-like            173   2e-46   
ref|XP_008458913.1|  PREDICTED: metalloendoproteinase 1-like            172   2e-46   
ref|XP_010449738.1|  PREDICTED: metalloendoproteinase 1-like            172   5e-46   
gb|AGT16050.1|  metalloendoproteinase                                   172   5e-46   
ref|XP_007052204.1|  Matrixin family protein                            172   5e-46   
gb|KHN16358.1|  Metalloendoproteinase 1                                 171   5e-46   
ref|XP_011032037.1|  PREDICTED: metalloendoproteinase 1                 174   6e-46   
ref|XP_002969781.1|  hypothetical protein SELMODRAFT_13930              170   9e-46   
ref|XP_008233236.1|  PREDICTED: metalloendoproteinase 1-like            172   1e-45   
gb|KHN34932.1|  Metalloendoproteinase 1                                 171   1e-45   
gb|EYU31934.1|  hypothetical protein MIMGU_mgv1a021000mg                171   1e-45   
ref|XP_011080438.1|  PREDICTED: metalloendoproteinase 1-like            170   2e-45   
ref|XP_004142467.1|  PREDICTED: matrix metalloproteinase-9-like         169   2e-45   
ref|XP_010508218.1|  PREDICTED: metalloendoproteinase 1-like            170   3e-45   
ref|XP_009398117.1|  PREDICTED: metalloendoproteinase 1                 170   4e-45   
ref|XP_008369492.1|  PREDICTED: metalloendoproteinase 1                 169   8e-45   
ref|XP_008376281.1|  PREDICTED: metalloendoproteinase 1-like            169   9e-45   
ref|XP_002304280.1|  hypothetical protein POPTR_0003s07510g             167   1e-44   
ref|XP_009334548.1|  PREDICTED: metalloendoproteinase 1                 169   1e-44   
ref|XP_008373793.1|  PREDICTED: metalloendoproteinase 1-like            169   1e-44   
ref|XP_007157294.1|  hypothetical protein PHAVU_002G058000g             166   2e-44   
gb|KCW77797.1|  hypothetical protein EUGRSUZ_D02088                     168   2e-44   
ref|XP_007033356.1|  Matrixin family protein, putative                  169   2e-44   
dbj|BAJ94176.1|  predicted protein                                      168   2e-44   
gb|KDO75343.1|  hypothetical protein CISIN_1g043086mg                   165   3e-44   
emb|CAN66781.1|  hypothetical protein VITISV_013507                     168   3e-44   
ref|XP_010053486.1|  PREDICTED: metalloendoproteinase 1-like            168   4e-44   
ref|XP_003635123.1|  PREDICTED: metalloendoproteinase 1                 166   4e-44   
ref|XP_003618349.1|  Interstitial collagenase                           166   5e-44   
ref|XP_002533939.1|  Metalloendoproteinase 1 precursor, putative        163   5e-44   
ref|XP_003574325.2|  PREDICTED: metalloendoproteinase 1-like            169   5e-44   
emb|CBI34984.3|  unnamed protein product                                171   6e-44   
ref|XP_010524412.1|  PREDICTED: metalloendoproteinase 1                 167   6e-44   
ref|XP_010518113.1|  PREDICTED: metalloendoproteinase 1-like            166   6e-44   
ref|XP_007219827.1|  hypothetical protein PRUPE_ppa026649mg             166   1e-43   
ref|XP_010692448.1|  PREDICTED: metalloendoproteinase 1                 165   4e-43   
gb|KHN16360.1|  Metalloendoproteinase 1                                 162   1e-42   
ref|XP_006293383.1|  hypothetical protein CARUB_v10023542mg             163   1e-42   
ref|XP_007151139.1|  hypothetical protein PHAVU_004G021000g             161   2e-42   
ref|XP_008458908.1|  PREDICTED: metalloendoproteinase 1-like            162   2e-42   
ref|XP_007216495.1|  hypothetical protein PRUPE_ppa023859mg             157   2e-42   
ref|XP_009143096.1|  PREDICTED: metalloendoproteinase 1                 163   2e-42   
ref|XP_007215990.1|  hypothetical protein PRUPE_ppa011783mg             157   3e-42   
ref|XP_006397684.1|  hypothetical protein EUTSA_v10001525mg             161   5e-42   
emb|CDX74706.1|  BnaA05g04520D                                          161   6e-42   
ref|XP_007041108.1|  Matrix metalloproteinase, putative                 158   1e-41   
ref|XP_001774956.1|  predicted protein                                  159   1e-41   
ref|XP_004963649.1|  PREDICTED: metalloendoproteinase 1-like            160   1e-41   
emb|CDY18956.1|  BnaC04g03940D                                          159   2e-41   
ref|XP_001779172.1|  predicted protein                                  157   2e-41   
ref|XP_007157518.1|  hypothetical protein PHAVU_002G076500g             157   1e-40   
gb|AAC31167.1|  metalloproteinase                                       157   1e-40   
ref|XP_010676950.1|  PREDICTED: metalloendoproteinase 1-like            158   1e-40   
gb|KDO61427.1|  hypothetical protein CISIN_1g037540mg                   157   1e-40   
ref|NP_182030.1|  matrixin family protein                               157   1e-40   
ref|XP_004142464.1|  PREDICTED: metalloendoproteinase 1-like            155   5e-40   
gb|EYU34693.1|  hypothetical protein MIMGU_mgv1a025583mg                150   6e-40   
ref|XP_002880153.1|  matrix metalloproteinase                           155   1e-39   
gb|KFK37298.1|  hypothetical protein AALP_AA4G239100                    154   3e-39   
gb|KGN52411.1|  hypothetical protein Csa_5G632100                       152   4e-39   
gb|EYU29746.1|  hypothetical protein MIMGU_mgv1a022148mg                147   1e-38   
gb|EYU29747.1|  hypothetical protein MIMGU_mgv1a025729mg                147   1e-38   
gb|EYU20655.1|  hypothetical protein MIMGU_mgv1a025968mg                147   1e-38   
ref|XP_006431002.1|  hypothetical protein CICLE_v10013597mg             147   2e-38   
ref|XP_003562240.2|  PREDICTED: metalloendoproteinase 1                 149   2e-37   
emb|CBI32079.3|  unnamed protein product                                149   2e-37   
ref|XP_003613392.1|  Matrix metalloprotease                             148   2e-37   
ref|XP_004142458.1|  PREDICTED: metalloendoproteinase 1-like            143   2e-37   
ref|XP_007099566.1|  Matrix metalloproteinase, putative                 145   3e-37   
ref|WP_001265815.1|  hypothetical protein                               145   1e-36   
gb|KHN28681.1|  Metalloendoproteinase 1                                 144   1e-36   
ref|XP_004167465.1|  PREDICTED: metalloendoproteinase 1-like            142   2e-36   
ref|XP_001176086.1|  PREDICTED: 50 kDa hatching enzyme-like             149   2e-36   
ref|XP_010647721.1|  PREDICTED: metalloendoproteinase 1-like            144   4e-36   
gb|KFP99935.1|  Interstitial collagenase                                147   5e-36   
ref|XP_009911929.1|  PREDICTED: interstitial collagenase-like           147   6e-36   
sp|P91953.1|HE_HEMPU  RecName: Full=50 kDa hatching enzyme; Short...    147   7e-36   
ref|NP_001229632.1|  hatching enzyme precursor                          147   7e-36   
dbj|BAJ90264.1|  predicted protein                                      144   8e-36   
dbj|BAJ93576.1|  predicted protein                                      144   9e-36   
gb|KHN01125.1|  Metalloendoproteinase 1                                 142   1e-35   
gb|AEU03839.1|  MMPL2                                                   146   1e-35   
ref|XP_417176.1|  PREDICTED: interstitial collagenase                   146   1e-35   
ref|XP_009365949.1|  PREDICTED: metalloendoproteinase 1-like            142   1e-35   
ref|XP_006032993.1|  PREDICTED: macrophage metalloelastase-like         141   3e-35   
gb|EYU34692.1|  hypothetical protein MIMGU_mgv1a022100mg                138   3e-35   
ref|XP_002309553.2|  hypothetical protein POPTR_0006s25750g             141   4e-35   
ref|XP_010280672.1|  PREDICTED: interstitial collagenase-like           144   5e-35   
gb|KFQ69201.1|  Interstitial collagenase                                144   6e-35   
ref|XP_006272560.1|  PREDICTED: macrophage metalloelastase-like         140   6e-35   
ref|XP_004308483.1|  PREDICTED: metalloendoproteinase 1-like            140   1e-34   
gb|KFO95068.1|  Interstitial collagenase                                139   1e-34   
ref|XP_007562840.1|  PREDICTED: matrix metalloproteinase-20-like        143   1e-34   
ref|XP_010647717.1|  PREDICTED: metalloendoproteinase 1-like            140   1e-34   
ref|XP_005808976.1|  PREDICTED: matrix metalloproteinase-20-like        143   1e-34   
gb|KFR13854.1|  Interstitial collagenase                                143   1e-34   
ref|XP_009936798.1|  PREDICTED: interstitial collagenase-like           143   2e-34   
ref|WP_014642607.1|  M10 family peptidase                               141   2e-34   
ref|XP_008424216.1|  PREDICTED: matrilysin-like                         142   2e-34   
ref|XP_003203529.1|  PREDICTED: interstitial collagenase-like           142   2e-34   
gb|KFP05997.1|  Interstitial collagenase                                142   2e-34   
ref|XP_008498693.1|  PREDICTED: interstitial collagenase-like           142   2e-34   
gb|KFO86870.1|  Interstitial collagenase                                142   2e-34   
ref|XP_010129795.1|  PREDICTED: interstitial collagenase-like           142   3e-34   
ref|XP_002605755.1|  hypothetical protein BRAFLDRAFT_121873             142   3e-34   
ref|XP_005501543.1|  PREDICTED: interstitial collagenase                142   4e-34   
ref|XP_004447335.1|  PREDICTED: matrix metalloproteinase-26             138   4e-34   
ref|XP_009583185.1|  PREDICTED: interstitial collagenase-like           142   4e-34   
gb|KFW11296.1|  Interstitial collagenase                                142   4e-34   
ref|XP_003415714.1|  PREDICTED: neutrophil collagenase                  142   4e-34   
ref|XP_009988615.1|  PREDICTED: interstitial collagenase-like           141   5e-34   
ref|XP_008502321.1|  PREDICTED: interstitial collagenase-like           136   5e-34   
gb|KFQ92900.1|  Interstitial collagenase                                141   7e-34   
ref|XP_009475126.1|  PREDICTED: interstitial collagenase-like           141   7e-34   
ref|XP_005300409.1|  PREDICTED: matrilysin                              137   8e-34   
gb|KFV64224.1|  Interstitial collagenase                                140   9e-34   
ref|XP_007939268.1|  PREDICTED: matrix metalloproteinase-26             138   9e-34   
ref|XP_009894707.1|  PREDICTED: interstitial collagenase-like           140   1e-33   
gb|KFQ37772.1|  Interstitial collagenase                                140   1e-33   
ref|XP_010185127.1|  PREDICTED: interstitial collagenase-like           140   1e-33   
ref|XP_008634519.1|  PREDICTED: interstitial collagenase-like           140   1e-33   
gb|KFQ89596.1|  Interstitial collagenase                                140   1e-33   
gb|KFO61126.1|  Interstitial collagenase                                140   2e-33   
gb|KFP65914.1|  Interstitial collagenase                                140   2e-33   
gb|KDR20064.1|  Matrix metalloproteinase-24                             140   2e-33   
gb|KFU90951.1|  Interstitial collagenase                                140   2e-33   
gb|EYF01915.1|  Interstitial collagenase precursor                      139   2e-33   
ref|XP_009700218.1|  PREDICTED: interstitial collagenase-like           139   2e-33   
ref|XP_009997677.1|  PREDICTED: interstitial collagenase-like           139   2e-33   
ref|XP_007010972.1|  Matrixin family protein                            137   2e-33   
ref|XP_008348251.1|  PREDICTED: metalloendoproteinase 1-like            133   3e-33   
ref|XP_006371425.1|  hypothetical protein POPTR_0019s10250g             134   3e-33   
ref|XP_008018852.1|  PREDICTED: neutrophil collagenase isoform X2       139   3e-33   
sp|P22757.1|HE_PARLI  RecName: Full=Hatching enzyme; Short=HE; Sh...    140   3e-33   
ref|XP_010298376.1|  PREDICTED: interstitial collagenase-like           139   3e-33   
gb|KFP59384.1|  Interstitial collagenase                                139   3e-33   
ref|XP_005038304.1|  PREDICTED: interstitial collagenase                139   3e-33   
ref|XP_010081082.1|  PREDICTED: interstitial collagenase-like           139   3e-33   
ref|XP_009272902.1|  PREDICTED: interstitial collagenase-like           139   3e-33   
gb|KFO69574.1|  Interstitial collagenase                                139   3e-33   
ref|XP_008018850.1|  PREDICTED: neutrophil collagenase isoform X1       139   3e-33   
ref|XP_010148821.1|  PREDICTED: interstitial collagenase-like           139   3e-33   
ref|XP_009554379.1|  PREDICTED: interstitial collagenase-like           139   3e-33   
ref|XP_004604867.1|  PREDICTED: neutrophil collagenase                  139   4e-33   
gb|KFW04176.1|  Interstitial collagenase                                139   4e-33   
gb|EMC80516.1|  Interstitial collagenase                                138   4e-33   
gb|ELT91654.1|  hypothetical protein CAPTEDRAFT_219025                  139   4e-33   
ref|XP_004134288.1|  PREDICTED: metalloendoproteinase 1-like            135   4e-33   
ref|XP_005998663.1|  PREDICTED: matrix metalloproteinase-20-like        139   4e-33   
gb|KFW95931.1|  Interstitial collagenase                                139   5e-33   
ref|XP_009887703.1|  PREDICTED: interstitial collagenase-like           139   5e-33   
ref|XP_009512512.1|  PREDICTED: interstitial collagenase-like           139   5e-33   
ref|XP_009955558.1|  PREDICTED: interstitial collagenase-like           139   5e-33   
ref|XP_005010575.1|  PREDICTED: interstitial collagenase                139   5e-33   
gb|KFZ52511.1|  Interstitial collagenase                                138   5e-33   
ref|XP_005516272.1|  PREDICTED: interstitial collagenase                138   5e-33   
ref|XP_009320551.1|  PREDICTED: interstitial collagenase-like           138   6e-33   
gb|KGN56360.1|  hypothetical protein Csa_3G117950                       135   6e-33   
ref|XP_010727316.1|  PREDICTED: stromelysin-1-like                      139   6e-33   



>emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera]
Length=319

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 173/276 (63%), Gaps = 26/276 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFN  451
             K L+G +KG +VK +++LK YL++FGY++ +   + T  + + F D LE A++T+Q N+ 
Sbjct  36    KDLEGCQKGHKVKDIHKLKKYLQQFGYLSYSHSEHQTHADNDDFDDLLEFAIKTYQTNYY  95

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------------VPQYSFLPGNPR  583
             L ++G LDS TVS+M+KPRCGV DII    R+                V  YSFL G+PR
Sbjct  96    LKASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSFHTVAHYSFLAGSPR  155

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+  GTP   +++   A  QW+  T  SF +  DY NAD+K     G+HG
Sbjct  156   WPPSKTHLTYAFLSGTPSTTMSAVTRAFGQWASATNFSFAETQDYTNADMKIGFQRGDHG  215

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLG  934
             DG  FDGPGG IAHSF PT+G  H D +ESW   A  G +     D+++V  HE GHLLG
Sbjct  216   DGHPFDGPGGTIAHSFPPTDGRLHFDGDESWVVGAVAGAF-----DVETVALHEIGHLLG  270

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE A+M+P I +G TK  L+ DDIQGI+ALY
Sbjct  271   LGHSSVEGAIMFPTIAYGVTKG-LNEDDIQGIQALY  305



>ref|XP_007216839.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
 gb|EMJ18038.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
Length=296

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 160/254 (63%), Gaps = 9/254 (4%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY++    NN     + F DQLESA++T+Q N++L +
Sbjct  50    LKGCHKGDKVQGIKDLKKYLGKFGYLSR--NNNGHFNDDDFDDQLESAIKTYQINYHLKA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE  640
             TG LD+ TVS MM PRCGV DII      V  YSF  GNP+WP  K  L+YA+  GTP E
Sbjct  108   TGTLDAKTVSNMMMPRCGVADIIN-----VAHYSFFQGNPKWPASKYHLTYAFLQGTPAE  162

Query  641   FVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPT  820
              +     A Q W+     +F++     N DL      G HGDG  FDGPGG IAH+F PT
Sbjct  163   AMGPVSSAFQTWAANKHFTFSEVQSNQNPDLTVSFHRGNHGDGAPFDGPGGTIAHAFAPT  222

Query  821   EGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETKR  1000
              G  H D+ E+WA VG       D+QSV  HE GHLLGLGHS V+ A+M+P IG G T++
Sbjct  223   NGRFHYDAAEAWA-VGAVTG-AFDLQSVALHEIGHLLGLGHSSVQGAIMFPSIGTGVTQQ  280

Query  1001  VLDNDDIQGIKALY  1042
              L  DDIQGIKALY
Sbjct  281   SLHGDDIQGIKALY  294



>ref|XP_008230957.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=310

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 170/269 (63%), Gaps = 24/269 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL+RFGY+N    N+       F DQLE+A++T+Q N++L +
Sbjct  49    LKGCHKGDKVQGIQDLKKYLERFGYLNGDINNDD------FDDQLEAAIKTYQINYHLKA  102

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG---------RRH------RLVPQYSFLPGNPRWPDD  595
             TG LD+ T+S MM PRCGVPDII          +RH        V  Y+F  G+P+WP +
Sbjct  103   TGTLDTKTISKMMMPRCGVPDIINGTTAMRSGKKRHPHHHGGHTVAHYAFFQGSPKWPAN  162

Query  596   KNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             K  L+Y +  GTP   V +   A   W+G T  SF+     ++ADLK    +GEHGDG+ 
Sbjct  163   KYHLTYGFARGTPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGRP  222

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
             FDGPGG++AH++ PT G  H D++E+W  VG   P G+D+++V  HE GHLLGL HS VE
Sbjct  223   FDGPGGVLAHAYAPTNGRFHYDADETWV-VGA-VPGGMDLETVALHEIGHLLGLEHSSVE  280

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              AVM P I  G T+  L  DDIQGIKALY
Sbjct  281   GAVMLPGIRAGFTQS-LHADDIQGIKALY  308



>gb|EYU29748.1| hypothetical protein MIMGU_mgv1a025409mg, partial [Erythranthe 
guttata]
Length=262

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 160/256 (63%), Gaps = 10/256 (4%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + LQGS KG+   G+  +K YL++FGY++NL  NNT    N F D LESA++T+Q NFN+
Sbjct  15    RALQGSVKGNRALGISGIKNYLQKFGYLDNL--NNTQVN-NLFDDALESAIKTYQQNFNI  71

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTP  634
             N TG+LD++TVS M+ PRCGVPDII   H     Y+F  GNP+WP  K  L+Y +    P
Sbjct  72    NPTGILDASTVSTMIIPRCGVPDIINVSH-----YTFFSGNPKWPPSKYNLTYGFLSNVP  126

Query  635   YEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQ  814
                V   + A Q W   T  +F   +     DL      G HGDG +FDGPGG +AH+F 
Sbjct  127   ANAVAPAERAFQNWDNATHFTFKRASSGQTPDLTIGFLRGNHGDGASFDGPGGTLAHAFA  186

Query  815   PTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGET  994
             PT G  H D++E W+ V P       +++V  HE GHLLGLGHS ++AA+MYP +  G+ 
Sbjct  187   PTNGRLHYDADERWS-VDP-VANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGQA  244

Query  995   KRVLDNDDIQGIKALY  1042
             K  L++DDIQGIKALY
Sbjct  245   KIKLNSDDIQGIKALY  260



>ref|XP_008230962.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=314

 Score =   239 bits (609),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 165/270 (61%), Gaps = 20/270 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY+++   NN     + F DQLESA++T+Q N++L +
Sbjct  47    LKGCHKGDKVQGIKDLKKYLGKFGYLSS--NNNGHFNDDDFDDQLESAIKTYQINYHLKA  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHR--------LVPQYSFLPGNPRWPD  592
             TG LD+ TVS MM PRCGV DII        G++           V  YSF  GNP+WP 
Sbjct  105   TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGKKRHPHHHHGGHTVAHYSFFQGNPKWPA  164

Query  593   DKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
              K  L+YA+  GTP E +     A Q W+  T  +F++     N DL      G HGDG 
Sbjct  165   SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEVQSNQNPDLTVSFHRGNHGDGA  224

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGV  952
              FDGPGG IAH+F PT G  H D+ E+WA VG       D+QSV  HE GHLLGLGHS V
Sbjct  225   PFDGPGGTIAHAFAPTNGRFHYDAAEAWA-VGA-VSGAFDLQSVALHEIGHLLGLGHSSV  282

Query  953   EAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             + A+M+P IG G T++ L  DDIQGIKALY
Sbjct  283   QGAIMFPSIGTGVTEQSLHGDDIQGIKALY  312



>gb|EYU18042.1| hypothetical protein MIMGU_mgv1a018853mg [Erythranthe guttata]
Length=287

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 157/256 (61%), Gaps = 10/256 (4%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K LQGS KGD   G+  LK YL++FGY+ NL  NNT    N F D LESA++T+Q NFN+
Sbjct  40    KILQGSVKGDRTLGISGLKSYLQKFGYLENL--NNTQVN-NVFDDALESAIKTYQQNFNI  96

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTP  634
             N TG+LD+ TVS M+ PRCGVPDII   H     Y+F  GNP+WP  K  L+Y +    P
Sbjct  97    NPTGILDAATVSTMIIPRCGVPDIINVSH-----YTFFLGNPKWPASKYNLTYEFLSNVP  151

Query  635   YEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQ  814
                V   + A Q W   T  +F   +    ADL      G HGDG +FDGPGG +AH+F 
Sbjct  152   SNAVAPVERAFQNWDNATHFTFRRSSSDQTADLIIEFQRGYHGDGASFDGPGGTLAHAFA  211

Query  815   PTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGET  994
             PT G  H D++E W+ V P       +++V  HE GHLLGLGHS ++AA+MYP +  G  
Sbjct  212   PTNGRFHYDADERWS-VDP-VANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGTA  269

Query  995   KRVLDNDDIQGIKALY  1042
             K  L+ DDIQGIKALY
Sbjct  270   KIKLNTDDIQGIKALY  285



>ref|XP_006482472.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=320

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 171/274 (62%), Gaps = 23/274 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY--FSDQLESAVRTFQANFNL  454
             L+G  KGD++KG++ELK Y+++FGY+N   Y N S  AN   F + LESA++T+Q N++L
Sbjct  48    LKGCHKGDKIKGIHELKKYMEKFGYLNYDNYKNQSTHANDDDFDELLESAIKTYQLNYHL  107

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------GRRH-------RLVPQYSFLPGNPRWP  589
              STG+LD+NTV+ M  PRCGV DI+        G++        R V  YSF  G+PRWP
Sbjct  108   KSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWP  167

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
               K +L+YA+  GT  + +T    A Q W+  T+  F+   D+ NAD+K    +G+HGDG
Sbjct  168   ASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDG  227

Query  770   QAFD---GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
               FD   GP GIIAH+F PT G  H D++E WA VG       D+++V  HE GHLLGL 
Sbjct  228   NPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQG-AFDLETVALHEIGHLLGLH  285

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS VE A+MYP I  G  K+ L  DDIQGI+ LY
Sbjct  286   HSSVEGAIMYPSIAAG-VKKGLHGDDIQGIRDLY  318



>gb|KDP45996.1| hypothetical protein JCGZ_11899 [Jatropha curcas]
 gb|KDP45997.1| hypothetical protein JCGZ_11900 [Jatropha curcas]
Length=309

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 165/270 (61%), Gaps = 21/270 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             LQGSKKGD++KG++ELK YLK FGY++    N +  + + F D LESA++ +Q N++LN+
Sbjct  43    LQGSKKGDKIKGIHELKKYLKHFGYLS--CENQSFADDDEFDDVLESALKVYQLNYHLNT  100

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG-----------RRH-----RLVPQYSFLPGNPRWPD  592
             TG LD  T+S+MM PRCG+PDII             RH      +V  Y+F  G P+WP 
Sbjct  101   TGFLDYETMSIMMMPRCGIPDIINGSTRMLSGKNNHRHSSSSFHMVSHYTFFRGKPKWPV  160

Query  593   DKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
              K  L+Y +   TP E   +   A + W+  T+  F    DY  ADLK   + GEHGDG 
Sbjct  161   SKYNLTYGFEPSTPTEARGAVANAFETWATVTKFKFTSVQDYKTADLKIGFYRGEHGDGL  220

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGV  952
              FDGPGGI AH+F P +G  H D++E +A VG       D+++V  HE GHLLGL HS +
Sbjct  221   PFDGPGGITAHAFAPQDGRFHYDADEKYA-VGAVQG-AFDLKTVALHEIGHLLGLQHSSL  278

Query  953   EAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             +AAVMY Y   G TK  L  DD+QGI+ALY
Sbjct  279   QAAVMYAYTSRGVTKD-LTADDVQGIRALY  307



>ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=319

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 169/276 (61%), Gaps = 26/276 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFN  451
             K L+G +KG +VK +++LK YL++FGY++ +     T  + + F D LE A++T+Q N+ 
Sbjct  36    KDLEGCQKGHKVKDIHKLKKYLQQFGYLSYSHSEYQTHADNDDFDDLLEFAIKTYQTNYY  95

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------------VPQYSFLPGNPR  583
             L ++G LDS TVS+M+KPRCGV DII    R+                V  YSF  G+PR
Sbjct  96    LKASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSLHTVAHYSFFAGSPR  155

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP     L+YA+  GT    +++   A  QW+  T  +F +  DY NAD+K     G+HG
Sbjct  156   WPPSNTHLTYAFLSGTSSTTMSAVTRAFGQWASATDFTFAETQDYTNADMKIGFQRGDHG  215

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLG  934
             DG  FDGPGG IAHSF PT+G  H D +ESW   A  G +     D+++V  HE GHLLG
Sbjct  216   DGFPFDGPGGTIAHSFSPTDGRLHFDGDESWVVGAVAGAF-----DVETVALHEIGHLLG  270

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE A+++P I FG TK  L+ DDIQGI+ALY
Sbjct  271   LGHSSVEGAIIFPTIAFGVTKG-LNEDDIQGIQALY  305



>ref|XP_007216923.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
 gb|EMJ18122.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
Length=264

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 164/260 (63%), Gaps = 20/260 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL+RFGY+N    N+       F DQLE+A++T+Q N++L +
Sbjct  17    LKGCHKGDKVQGIQDLKKYLERFGYLNGDINNDD------FDDQLEAAIKTYQINYHLKA  70

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRH------RLVPQYSFLPGNPRWPDDKNALSYAWG  622
             TG LD+ TVS MM PRCG      +RH        V  Y+F  G+ +WP +K  L+Y + 
Sbjct  71    TGTLDTKTVSKMMMPRCGK-----KRHPHHHGGHTVAHYAFFQGSAKWPANKYHLTYGFA  125

Query  623   DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
              GTP   V +   A   W+G T  SF+     ++ADLK    +GEHGDGQ FDGPGG++A
Sbjct  126   QGTPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGQPFDGPGGVLA  185

Query  803   HSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIG  982
             H++ PT G  H D++E+W  VG   P G+D+++V  HE GHLLGL HS VE AVM P I 
Sbjct  186   HAYAPTNGRFHYDADETWV-VGA-VPGGMDLETVALHEIGHLLGLAHSSVEGAVMLPGIR  243

Query  983   FGETKRVLDNDDIQGIKALY  1042
              G T+  L  DDIQGIKALY
Sbjct  244   AGFTQS-LHADDIQGIKALY  262



>ref|XP_008458713.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=282

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 169/275 (61%), Gaps = 22/275 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K L G KKGD+V+G++++K YL+ FGY+NN  + ++    + F + LE AV+T+Q N+NL
Sbjct  8     KNLNGCKKGDKVEGIHQMKKYLQHFGYMNNDVHIHSKSSDDEFDEILEFAVKTYQINYNL  67

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII-GR-----------RHRL-------VPQYSFLPGN  577
              +TG LD++T+S M KPRCGV DII GR           RHR        V  ++F  GN
Sbjct  68    KATGTLDNSTISQMSKPRCGVADIINGRTGMKSGKRLVNRHRKIIGHFHEVSHFAFFEGN  127

Query  578   PRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
              +WP+ K+ L+Y +  GTP E ++    A   W+  T  SF+ +++Y NAD+K     G+
Sbjct  128   LKWPNSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESNYENADIKVTFERGD  187

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGL  937
             HGDG  FD  GG++AH+F PT+G  H D+ E WA      P   D+++V  HE GHLLGL
Sbjct  188   HGDGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWADGA--VPNSYDMETVALHEIGHLLGL  245

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              HS VE A+M+P I  G T + L  DDI+GIK LY
Sbjct  246   HHSSVEGAIMWPSI-MGGTTKGLHADDIEGIKVLY  279



>gb|KDO37621.1| hypothetical protein CISIN_1g035681mg [Citrus sinensis]
Length=320

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 170/274 (62%), Gaps = 23/274 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFS--DQLESAVRTFQANFNL  454
             L+G  KGD++KG++ELK Y+++FGY+N   Y N S  A+     + LESA++T+Q N++L
Sbjct  48    LKGCHKGDKIKGIHELKEYMEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHL  107

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------GRRH-------RLVPQYSFLPGNPRWP  589
              STGVLD+NTV+ M  PRCGV DI+        G++        R V  YSF P +P+WP
Sbjct  108   KSTGVLDANTVAKMTIPRCGVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWP  167

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
               K +L+YA+  GT  + +T    A Q W+  T+  F+   D+ NAD+K    +G+HGDG
Sbjct  168   ASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDG  227

Query  770   QAFD---GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
               FD   GP GIIAH+F PT G  H D++E WA VG       D+++V  HE GHLLGL 
Sbjct  228   NPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQG-AFDLETVALHEIGHLLGLH  285

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS VE A+MYP I  G TK  L  DDIQGI+ LY
Sbjct  286   HSSVEGAIMYPSISAGVTKG-LHGDDIQGIRDLY  318



>ref|XP_008230963.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 163/273 (60%), Gaps = 27/273 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY+++   NN     + F DQLESA++T+Q N++L +
Sbjct  47    LKGCHKGDKVQGIQDLKKYLGKFGYLSS---NNGHLNDDDFDDQLESAIKTYQINYHLKA  103

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------------VPQYSFLPGNPRWPD  592
             TG LD+ TVS MM PRCGV DII     +                V  YSF  GNP WP 
Sbjct  104   TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGQKRHPHHHHRGHTVANYSFFQGNPTWPA  163

Query  593   DKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
              K  L+YA+  GTP E +     A Q W+  T  +F++  +  N DL      G+HGDG 
Sbjct  164   SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGT  223

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
              FDGPGG IAH+F PT G  H D++E +   A  G Y     D +++  HE GHLLGLGH
Sbjct  224   PFDGPGGTIAHAFAPTNGRLHYDADERFSVGAVSGAY-----DFETIALHEIGHLLGLGH  278

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S V+ A+M+P +  GET++ L  DDIQGIKALY
Sbjct  279   SSVQEAIMFPSVRSGETQQSLHGDDIQGIKALY  311



>ref|XP_008458907.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=316

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 165/276 (60%), Gaps = 23/276 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYN-NTSPEANYFSDQLESAVRTFQANFN  451
             K L G +KGD+V G++++K YL+ FGY+NN   N + S + + F   LESA++T+Q N+N
Sbjct  41    KNLNGCRKGDKVAGIHQIKEYLQHFGYLNNYLQNYSKSFDDDEFDGVLESAIKTYQLNYN  100

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-------------------VPQYSFLPG  574
             L +TG LD+ T+ LM KPRCGV DII  + R+                   V  Y+F  G
Sbjct  101   LKATGTLDAKTLDLMSKPRCGVADIIDGKTRMKSGKKMVNQHRKINGHFHTVSHYAFFDG  160

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             NP+WP  K  L+Y +  GTP + V     A + W   T  +F+  + Y  AD+K    +G
Sbjct  161   NPKWPASKFHLTYGFLPGTPSKAVAPVGRAFKTWGAHTHFNFSRASKYKKADIKISFRSG  220

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG +FDG GG+IAH F PT+G  H D+ ESWA VG       D+++V  HE GHLLG
Sbjct  221   DHGDGHSFDGVGGVIAHGFAPTDGRLHFDAIESWA-VGAVAD-SFDLETVALHEIGHLLG  278

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             L HS VE A+M+P I  G TK  LD DDI GI ALY
Sbjct  279   LHHSSVEGAIMWPSIMEGTTKG-LDADDIAGINALY  313



>ref|XP_004296560.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 164/268 (61%), Gaps = 19/268 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+VKG+ +LK YL+++GY+N    N++  + + F D LE AV+T+Q N++L S
Sbjct  44    LKGCHKGDKVKGINDLKKYLEKYGYLNYK--NHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG---------RRHR-----LVPQYSFLPGNPRWPDDK  598
             TG LDS TVS M  PRCGV DII          +RH          YSF  GNP+WP  K
Sbjct  102   TGTLDSKTVSKMTTPRCGVADIINGTSSMRSAKKRHHHGSLHTTAHYSFFQGNPKWPSSK  161

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L+Y +   TP E   +   A   W G T  +F+    Y NADLK     G HGDG AF
Sbjct  162   YHLTYGFLPNTPSEATGAVARAFATWEGNTHFTFSQAQSYENADLKIGFQRGNHGDGAAF  221

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGG +AH+F PT GI H D++E+W+ VG   P   D+++V  HE GHLLGLGHS V+ 
Sbjct  222   DGPGGTLAHAFSPTHGIFHYDADETWS-VGA-VPGATDLETVALHEIGHLLGLGHSSVKG  279

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             A+M P +  GET R L  DD+QGIKALY
Sbjct  280   AIMEPTLPTGET-RGLHGDDVQGIKALY  306



>ref|XP_007216922.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
 gb|EMJ18121.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
Length=297

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 159/257 (62%), Gaps = 16/257 (6%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY+++   NN     + F DQLESA++T+Q N++L +
Sbjct  52    LKGCHKGDKVQGIQDLKKYLGKFGYLSS---NNGHLNDDDFDDQLESAIKTYQINYHLKA  108

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE  640
             TG LD+ TVS MM PRCGV DII      V  YSF   NP WP  K  L+YA+  GTP E
Sbjct  109   TGTLDAKTVSNMMMPRCGVADIIN-----VANYSFFEENPTWPASKYHLTYAFLQGTPAE  163

Query  641   FVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPT  820
              +     A Q W+  T  +F++  +  N DL      G+HGDG  FDGPGG IAH+F PT
Sbjct  164   AMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGTPFDGPGGTIAHAFAPT  223

Query  821   EGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGE  991
              G  H D++E +   A  G Y     D ++V  HE GHLLGL HS V+ A+M+P +  G 
Sbjct  224   NGRLHYDADERFSVGAVSGAY-----DFETVALHEIGHLLGLRHSSVQGAIMFPSVRAGV  278

Query  992   TKRVLDNDDIQGIKALY  1042
             T++ L  DDIQGIKALY
Sbjct  279   TQQSLHGDDIQGIKALY  295



>ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52418.1| hypothetical protein Csa_5G633160 [Cucumis sativus]
Length=313

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 166/275 (60%), Gaps = 22/275 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K L+G KKGD+V+G++++K YL+ FGY+NN  +  +    + F + LE AV+T+Q N+NL
Sbjct  39    KNLKGCKKGDKVEGIHQMKKYLQHFGYLNNDVHIRSESSDDEFDEILEFAVKTYQINYNL  98

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------GRR----HRL-------VPQYSFLPGN  577
               TG LD++T+  M KPRCGV DII        G+R    HR        V  ++F  GN
Sbjct  99    KVTGTLDNSTLMQMSKPRCGVADIINGKTSMKSGKRFVNQHRKISGHFHEVSHFAFFEGN  158

Query  578   PRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
              RWPD K+ L+Y +  GTP E ++    A   W+  T  SF+ ++ Y NAD+K     G+
Sbjct  159   LRWPDSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESKYENADIKISFEKGD  218

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGL  937
             HGDG  FD  GG++AH+F PT+G  H D+ E WA      P   D+++V  HE GHLLGL
Sbjct  219   HGDGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWADGA--VPKSYDMETVALHEIGHLLGL  276

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              HS VE A+M+P I  G TK  L  DDI+GIK LY
Sbjct  277   HHSSVEGAIMWPSIMGGATKG-LHADDIEGIKVLY  310



>ref|XP_007216949.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
 gb|EMJ18148.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
Length=252

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 155/257 (60%), Gaps = 12/257 (5%)
 Frame = +2

Query  287   GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             G + GD+V G+ +LK YL RFGY+++    N +   + F DQL SA++T+Q N+NL +TG
Sbjct  1     GFQNGDKVPGIQDLKKYLGRFGYLSS----NNNQTTDDFDDQLASAIKTYQLNYNLKTTG  56

Query  467   VLDSNTVSLMMKPRCGVPDIIG-----RRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGT  631
             +LD+ TVS MM PRCGVPDII      R  + +  Y+F PG P+WP  K  L+YA+  GT
Sbjct  57    ILDAQTVSNMMMPRCGVPDIINGTSSMRSGKQIAHYTFFPGKPKWPASKYHLTYAFLRGT  116

Query  632   PYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSF  811
             P         A   W+  T+  F+        DL        HGDG  FDGPGGI+AHSF
Sbjct  117   PTAAKGPVARAFNTWAAHTQFKFSQARRNQKPDLTVSFHRRSHGDGHPFDGPGGILAHSF  176

Query  812   QPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGE  991
              P +G  H D++E W+ VG        +++V  HE GHLLGLGHS V  A+MYP I  GE
Sbjct  177   APKDGRFHYDADEKWS-VGVVRG-AFHLETVALHEIGHLLGLGHSSVRRAIMYPTISSGE  234

Query  992   TKRVLDNDDIQGIKALY  1042
             TK  L+ DDIQGIKALY
Sbjct  235   TKG-LNRDDIQGIKALY  250



>gb|EYU34696.1| hypothetical protein MIMGU_mgv11b016964mg [Erythranthe guttata]
Length=312

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 164/275 (60%), Gaps = 26/275 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K +QG  KG++ K ++ LK YL +FGY+   P N T    + F + LESAV+T+Q N+N+
Sbjct  43    KTVQGCHKGNKTKEIHNLKKYLHKFGYLQ-YP-NQTHANNDDFDEALESAVKTYQRNYNI  100

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-------------------VPQYSFLPGN  577
             N TG LD+ TVS M  PRCGVPDII  ++ +                   V  YSFLPGN
Sbjct  101   NPTGTLDATTVSKMTTPRCGVPDIINGKNTMQKHGTKEHESNSSSKHIHTVSHYSFLPGN  160

Query  578   PRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             PRWP  K  L+Y +   TP   V     A Q+W+  T  +F+     ++ADL     +G+
Sbjct  161   PRWPRSKTHLTYMFSANTPAAAVGPVSRAFQKWASSTHFTFS--LAQSSADLVIGFHSGD  218

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGL  937
             HGDG  FDG GG +AH+F PT G  H D++E W+ VGP      D+++V  HE GHLLGL
Sbjct  219   HGDGNPFDGRGGTLAHAFAPTNGRFHYDADELWS-VGPVQD-AFDLETVALHEIGHLLGL  276

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHS VEAA+MY  IG G TK  L  DDIQGIK+LY
Sbjct  277   GHSAVEAAIMYSGIGAGVTKN-LHPDDIQGIKSLY  310



>ref|XP_008352994.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 161/275 (59%), Gaps = 32/275 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL++FGY+N    N+       F D LESA++T+Q N++L +
Sbjct  44    LKGCHKGDKVQGIQDLKKYLEKFGYLNGHSDNDD------FDDILESAIKTYQLNYHLKA  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHR-----------LVPQYSFLPGNPR  583
             TG LD+ TVS MM PRCGVPDII        G++              V  YSF PGNP+
Sbjct  98    TGTLDAKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+   TP E   +   A   W+G T  SF+    Y NADL     +G+HG
Sbjct  158   WPSSKYHLTYAFDQTTPTEARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  FDG GG +AH+F PT G  H D++E WA       Y  D+++V  HE GHLLGL H
Sbjct  218   DGNPFDGRGGTLAHAFAPTNGRFHYDADEPWAVGAVEGAY--DLETVALHEIGHLLGLRH  275

Query  944   SGVEAAVMYPYI--GFGETKRVLDNDDIQGIKALY  1042
             S VE AVM   +  GF ++   L  DDIQGIKALY
Sbjct  276   SSVEGAVMSSTVRTGFAQS---LHADDIQGIKALY  307



>ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
 emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera]
Length=319

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 170/277 (61%), Gaps = 24/277 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFN  451
             K LQG  KGDEV G+ +LK YL++FGY++ +   N T  + + F D LESA++T+QAN++
Sbjct  44    KGLQGCHKGDEVNGIQKLKKYLEQFGYLSYSRSKNQTHADDDDFDDLLESAIKTYQANYH  103

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDII--------GRRH------------RLVPQYSFLP  571
             L +TG LDS TVS M+KPRCGV DII        G++             R V  YSF P
Sbjct  104   LEATGDLDSETVSEMVKPRCGVADIINGTNWMLSGKKRQYHGHGHGHGSLRTVAHYSFFP  163

Query  572   GNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFA  751
             G+PRWP  K  L+YA+  GTP   ++    A  +W   T  +F    DY +AD+      
Sbjct  164   GSPRWPPSKTYLTYAFLPGTPNWAMSPVSRAYGRWDSATHFTFGWIQDYTSADMTISFHR  223

Query  752   GEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLL  931
              +HGDG  FDGPGG IAH+F PT G  H D +E+W+ +G   P  +D+++V  HE GHLL
Sbjct  224   LDHGDGSPFDGPGGTIAHAFAPTNGRFHYDGDETWS-IGA-VPNAMDLETVALHEIGHLL  281

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS V+ A+M+P I  G TK  L  DDIQGI+ALY
Sbjct  282   GLGHSSVQNAIMFPSISTGVTKG-LHEDDIQGIRALY  317



>ref|XP_008222422.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=319

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 166/276 (60%), Gaps = 25/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQ--LESAVRTFQANFNL  454
             L+G  KGD + G+++LK+YL++FGY++   +   +P A+       LE AV+T+Q N++L
Sbjct  45    LKGVHKGDHIPGIHDLKLYLEKFGYLS-YAHAKHNPHADDDDFDDFLELAVKTYQLNYHL  103

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG---------RRHRL-----------VPQYSFLPG  574
              +TG+LD+ TVS MM PRCGV DII          ++HR            V  YSF  G
Sbjct  104   KTTGILDTKTVSKMMMPRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFFKG  163

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
               +WP  K+ L+YA+   TP E +     A + W+  T   F+   +Y  AD+K     G
Sbjct  164   KLKWPRSKHHLTYAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFEYG  223

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG +FDGPGG++AH++ PT G  H D+EE W+ VG    Y  D+++V  HE GHLLG
Sbjct  224   DHGDGNSFDGPGGVLAHAYAPTYGKFHYDAEEPWS-VGALEGY-YDLETVALHEIGHLLG  281

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE AVMYPYI  G T   L +DDIQGIK LY
Sbjct  282   LGHSSVEGAVMYPYIASGATNLYLHDDDIQGIKVLY  317



>ref|XP_008230676.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=299

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 160/266 (60%), Gaps = 20/266 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             ++G +KGD V+G+ ++K +L++FGY++    N+       F DQLE A++T+Q N+NL +
Sbjct  39    VKGCRKGDNVQGILDVKKHLEKFGYLSGHSQNDD------FDDQLELAIKTYQLNYNLEA  92

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG----------RRHR--LVPQYSFLPGNPRWPDDKNA  604
             TG LD  TVS MM PRCGVPDII           + H    V +YSF  GNP+WP  K  
Sbjct  93    TGRLDVKTVSNMMIPRCGVPDIINGTTSMISRKIQHHEGLTVSKYSFFSGNPKWPSAKYR  152

Query  605   LSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDG  784
             L+YA+  GTP +     K A Q W+  T+ +F+    Y   DL       +HGDG  FDG
Sbjct  153   LTYAFLQGTPNQAKDPVKRAFQSWANNTQFTFSQVEAYETPDLTISFQRLDHGDGYPFDG  212

Query  785   PGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAV  964
              GG+ AH+F PT+G  H D++E W  VG     G+D+QS+  HE GHLLGL HS VE A+
Sbjct  213   RGGVTAHAFSPTDGRFHYDADEMWV-VGSVNG-GMDLQSIAVHEIGHLLGLNHSSVEEAI  270

Query  965   MYPYIGFGETKRVLDNDDIQGIKALY  1042
             MYP++     KR L  DDIQGIK LY
Sbjct  271   MYPFLNTATVKRNLKPDDIQGIKNLY  296



>ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=311

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 159/274 (58%), Gaps = 24/274 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTS-PEANYFSDQLESAVRTFQANFN  451
             K LQG  KGD +KG+++LK YL+ FGY   L Y N S    + F D LE A++T+Q N++
Sbjct  42    KHLQGCHKGDNLKGIHDLKKYLENFGY---LSYKNQSHSNDDDFDDLLEYALKTYQFNYH  98

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPGNP  580
             LN TG LDS TV+ MM PRCGV DII    R+                 V  Y F PGNP
Sbjct  99    LNVTGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSSTSFHTVSHYEFFPGNP  158

Query  581   RWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             RWP  K  L+Y +  GTP + +    +A Q W+  T   F    DY  AD+      G+H
Sbjct  159   RWPASKYHLTYGFLPGTPNQAMEPVAKAFQTWAANTHFRFTRVQDYRAADITIGFHRGDH  218

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDG GG +AH+F P +G  H D +E WA VG       D+++V  HE GHLLGLG
Sbjct  219   GDGSPFDGRGGTLAHAFAPQDGRFHYDGDEHWA-VGATQG-AFDVETVALHEIGHLLGLG  276

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS VE A+M+P I  G TK  L +DDIQGI+ALY
Sbjct  277   HSSVEGAIMHPSIQSGATKG-LHSDDIQGIRALY  309



>ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=315

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 165/273 (60%), Gaps = 20/273 (7%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFN  451
             K LQG  KGD+V+G+++LK YL +FGY++ +    +T    + F D +ESA++T+Q N++
Sbjct  44    KDLQGCHKGDKVEGIHKLKKYLGQFGYLSYSHSKYHTHANDDDFDDLVESAIKTYQTNYH  103

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRH----------------RLVPQYSFLPGNPR  583
             LN+TG LDS TVS M+KPRCG  DII   +                R V  YSF  G+PR
Sbjct  104   LNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRTVAHYSFFSGSPR  163

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+  GTP   ++    A  QW   T  +F    D+ +AD+       +HG
Sbjct  164   WPPSKTYLTYAFLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHG  223

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  FDGPGG IAH+F PT G  H D +E+W+ +G   P  +D+++V  HE GHLLGLGH
Sbjct  224   DGYPFDGPGGTIAHAFAPTNGRFHYDGDETWS-IGA-VPNAMDLETVALHEIGHLLGLGH  281

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S V+ A+M+P I  G TK  L  DDIQGI ALY
Sbjct  282   SSVQNAIMFPSISSGVTKG-LHEDDIQGISALY  313



>ref|XP_004288499.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 161/268 (60%), Gaps = 19/268 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G +KGD+ KGL +LK YL++FGY+N   Y N S   + F D LE A++T+Q N+ L  
Sbjct  46    LKGRQKGDKFKGLNDLKNYLEKFGYLN---YKNRSLFNDDFDDLLEEAIKTYQINYRLEV  102

Query  461   TGVLDSNTVSLMMKPRCGVPDII-----------GRRH---RLVPQYSFLPGNPRWPDDK  598
             TG LD+ TVS MM PRCGVPDII           G  H        YSF PG+P+WP  K
Sbjct  103   TGKLDNKTVSKMMMPRCGVPDIINGTSFMRSANKGHHHGSIHTTALYSFFPGSPKWPSSK  162

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L+Y +  GT  E   +   A   W+  +R +F+    Y NADLK     G+HGDG  F
Sbjct  163   YHLTYGFLPGTRSEATAAVARAFATWAKSSRFTFSPAQSYYNADLKISFQRGDHGDGVPF  222

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGGI+AHSF P++G  H D++++W  VG   P   D++SV  HE GHLLGL HS +  
Sbjct  223   DGPGGILAHSFCPSDGRFHYDADDTWT-VGA-KPGAFDLESVALHEIGHLLGLQHSSLPG  280

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             AVM P I  G TK  L  DD+QGIKALY
Sbjct  281   AVMAPGIPPGVTKTSLTEDDVQGIKALY  308



>ref|XP_007014936.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY32555.1| Matrixin family protein, putative [Theobroma cacao]
Length=310

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 158/271 (58%), Gaps = 21/271 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             LQG  KG++VK +++LK YL+ FGY++    N T    + F D LESA+RT+Q N+NL +
Sbjct  42    LQGCHKGEKVKDIHKLKKYLESFGYLS-YSKNETHANDDDFDDFLESAIRTYQLNYNLKT  100

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG----------RRH-------RLVPQYSFLPGNPRWP  589
             TG LDS TVS MM  RC V DI            R+H         V  Y+F PGNP+WP
Sbjct  101   TGTLDSKTVSKMMTSRCAVADITNGTTGMRSGKKRQHPAGSKSFHTVAHYAFFPGNPKWP  160

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             D K+ L+YA+  GT  + +     A Q W+  T  SF+   DY NAD+     + +H DG
Sbjct  161   DSKSHLTYAFLPGTRADAINPVVRAFQTWAANTHFSFSRTQDYTNADITISFESRDHADG  220

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
               FDGP G +AH+F PT G  H D++E W+      P    ++++  HE GHLLGL HS 
Sbjct  221   NPFDGPDGTLAHAFAPTNGRFHYDADEQWSV--SVTPGAYHLETIALHEIGHLLGLHHSS  278

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             VE A+MYP    GE+K  L  DDIQGI+ALY
Sbjct  279   VEGAIMYPTFMAGESKG-LHGDDIQGIRALY  308



>gb|EYU34694.1| hypothetical protein MIMGU_mgv1a023515mg, partial [Erythranthe 
guttata]
Length=261

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 158/256 (62%), Gaps = 12/256 (5%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K LQG  KG++ K ++ LK YL +FGY+   P N T    + F + LESAV+T+Q N+++
Sbjct  16    KTLQGCHKGNKSKDIHHLKNYLHQFGYLQ-YP-NETHANNDDFDETLESAVKTYQRNYHI  73

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTP  634
             N TG LD+ TVS M  PRCGVPDII   H     YSF  GNPRWP  K  L+Y +   TP
Sbjct  74    NPTGTLDATTVSKMTTPRCGVPDIIDVSH-----YSFFQGNPRWPPSKTHLTYRFLPNTP  128

Query  635   YEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQ  814
                V     A Q+W+  T  +F+     N+ADL      G+HGDG  FDG GG +AH+F 
Sbjct  129   APAVGPVSRAFQKWASSTHFTFSRAQ--NSADLVIGFHRGDHGDGFPFDGRGGTLAHAFA  186

Query  815   PTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGET  994
             PT G  H D++E W+ VGP      D+++V  HE GHLLGLGHS VEAA+MY  IG G T
Sbjct  187   PTNGRFHYDADERWS-VGPVQD-AFDLETVALHEIGHLLGLGHSSVEAAIMYSGIGAGVT  244

Query  995   KRVLDNDDIQGIKALY  1042
             K  L  DDIQGI+ALY
Sbjct  245   KN-LHADDIQGIRALY  259



>ref|XP_009341183.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=340

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 162/281 (58%), Gaps = 30/281 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY--FSDQLESAVRTFQANFNL  454
             L+G  KGD ++G+++LK+YL++FGY++     N +P AN   F + LE AV+T+Q N++L
Sbjct  61    LKGGHKGDHIEGIHDLKLYLEKFGYLSYAHAKN-NPHANDDDFDNLLELAVKTYQLNYHL  119

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII-------------------------GRRHRLVPQY  559
             N+TG LD  TVS MM PRCGV D+I                         G     V  Y
Sbjct  120   NTTGTLDGETVSKMMMPRCGVADVINGTSSMRSGKKKHHQHDPDHDHHNHGSSVHAVSHY  179

Query  560   SFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKY  739
             SF  G  RWP  K+ L+Y +   TP E +     A + W+  T   F+   +Y  AD+K 
Sbjct  180   SFFKGRLRWPTSKHHLTYGFLPSTPTEAMGPVSHAFRTWASNTHFRFSRSRNYKRADIKI  239

Query  740   HLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHET  919
                  +HGDG  FDG GG++AH++ PT G  H D++E W+ VG    Y  D+++V  HE 
Sbjct  240   SFEYSDHGDGSPFDGKGGVLAHAYAPTNGRFHYDADEPWS-VGALEGY-YDLETVALHEI  297

Query  920   GHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHLLGLGHS VE A+MYPYI  G TK  L +DDIQGIK LY
Sbjct  298   GHLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  338



>ref|XP_007010413.1| Matrixin family protein [Theobroma cacao]
 ref|XP_007099564.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19223.1| Matrixin family protein [Theobroma cacao]
 gb|EOY20464.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 164/274 (60%), Gaps = 22/274 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K LQG  KGD+VK + +LK YL++FGY++    N T    + F D LESA++T+Q NF+L
Sbjct  40    KHLQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDDDFDDLLESAIKTYQLNFHL  98

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII----GRR------HRL--------VPQYSFLPGNP  580
             NS G LD+ TVS MM PRCGV DII    G R      HR         V  Y+F P +P
Sbjct  99    NSNGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSP  158

Query  581   RWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             RWP  K+ L+YA+  GT  + V     A Q W+  T   F+   +Y +AD+       +H
Sbjct  159   RWPPSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDH  218

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDGPGG +AH+F PT G  H D++E+W+      P  + +++V  HE GHLLGLG
Sbjct  219   GDGNPFDGPGGTLAHAFAPTLGRFHYDADETWSVSA--RPGTMHLETVALHEIGHLLGLG  276

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS +E A+MYP I  G T + L  DDI+GIKALY
Sbjct  277   HSSIENAIMYPSITAG-TSKGLARDDIEGIKALY  309



>ref|XP_004296559.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 167/268 (62%), Gaps = 19/268 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+VKG+ +LK YL++FGY+N    N++  + + F D LE AV+T+Q N++L S
Sbjct  44    LKGCHKGDKVKGINDLKKYLEKFGYLNYK--NHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG---------RRHR-----LVPQYSFLPGNPRWPDDK  598
             TG LD  TV+ MM PRCG+PDII          +RH          Y+F  GNP+WP  K
Sbjct  102   TGTLDGKTVAKMMMPRCGLPDIINGTSSMRSAKKRHHHGSIHTTAHYAFPAGNPKWPSSK  161

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L+Y +  GTP E   +   A   W+G T  +F+   +Y NADLK     G+HGDG AF
Sbjct  162   YHLTYGFLPGTPSEATGAVARAFATWAGNTHFTFSQAQNYENADLKIGFEKGDHGDGSAF  221

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGG++AH+F PT+G  H D++E+W+ VG   P   D++++  HE GHLLGL HS VE 
Sbjct  222   DGPGGVLAHAFYPTDGRFHYDADENWS-VGA-KPGAFDLETLALHEIGHLLGLDHSSVEG  279

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             A+M   I  G T R L  DD+QGIKALY
Sbjct  280   AIMSSGIPAGVT-RGLHGDDVQGIKALY  306



>ref|XP_007010415.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19225.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 163/274 (59%), Gaps = 22/274 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K LQG  KGD+VK + +LK YL++FGY++    N T    N F D LESA++T+Q NF+L
Sbjct  40    KHLQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDNDFDDLLESAIKTYQLNFHL  98

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII----GRR------HRL--------VPQYSFLPGNP  580
             NS G LD+ TVS MM PRCGV DII    G R      HR         V  Y+F P +P
Sbjct  99    NSNGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSP  158

Query  581   RWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             RWP  K+ L+YA+  GT  + V     A Q W+  T   F+   +Y +AD+       +H
Sbjct  159   RWPPSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDH  218

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDGPGG +AH+F PT G  H D++E+W+      P  + +++V  HE GHLLGL 
Sbjct  219   GDGNPFDGPGGTLAHAFAPTIGRFHYDADETWSVSA--RPGTMHLETVALHEIGHLLGLS  276

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS +E A+MYP I  G T + L  DDI+GIKALY
Sbjct  277   HSSIENAIMYPSITAG-TSKGLARDDIEGIKALY  309



>ref|XP_010037506.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49212.1| hypothetical protein EUGRSUZ_K02792 [Eucalyptus grandis]
Length=311

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 165/276 (60%), Gaps = 26/276 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY----FSDQLESAVRTFQA  442
             K LQG  KGD+VKGL ELK YL++FGY+N   YN ++ + +     F + LESAV+T+Q 
Sbjct  40    KHLQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQGHANDEDFDELLESAVKTYQL  96

Query  443   NFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------------VPQYSFLPG  574
             N+++  TG LDS TV++M  PRCGV DI+    R+                V  ++F  G
Sbjct  97    NYHMKVTGNLDSQTVAMMTTPRCGVADIVNGTSRMRSGKRTTHHGSNKFHTVGHFTFFDG  156

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             +P+WP  K  L+YA   GT  + +     A + W+  T  +F+   +Y +AD+K      
Sbjct  157   SPKWPSSKYHLTYALDPGTQDDVLGPVSRAFKTWASATHFTFSQSQNYESADIKIAFARR  216

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG  FDGP G+IAH+FQPT G+ H D +E W+ VGP      D+++V  HE GHLLG
Sbjct  217   DHGDGAPFDGPSGVIAHAFQPTIGVFHYDGDEPWS-VGPVRG-SYDLETVALHEIGHLLG  274

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS V  A+MYP I  G +K  L  DD+QGIK LY
Sbjct  275   LGHSSVAGAIMYPTISPGVSKG-LHGDDVQGIKTLY  309



>ref|XP_008355534.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 162/281 (58%), Gaps = 30/281 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY--FSDQLESAVRTFQANFNL  454
             L+G  KGD ++G+++LK+YL++FGY++     N +P AN   F +  E AV+T+Q N++L
Sbjct  30    LRGGHKGDHIEGIHDLKLYLEKFGYLSYAHAKN-NPHANDDDFDNLXELAVKTYQLNYHL  88

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII-------------------------GRRHRLVPQY  559
             N+TG LD  TVS MM PRCGV DII                         G     V  Y
Sbjct  89    NTTGTLDGETVSKMMMPRCGVADIINGTSSMRSGKKKHHHHDPDHDHHNHGSSVHAVSHY  148

Query  560   SFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKY  739
             SF  G  RWP  K+ L+Y +   TP E +     A + W+  T   F+   +Y  AD+K 
Sbjct  149   SFFKGRLRWPTSKHHLTYGFLPNTPTEAMGPVSYAFRTWASNTHFRFSRSRNYRRADIKI  208

Query  740   HLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHET  919
                 G+HGDG  FDG GG++AH++ PT G  H D++E W+ VG    Y  D+++V  HE 
Sbjct  209   SFEYGDHGDGSPFDGEGGVLAHAYAPTNGRFHYDADEPWS-VGALEGY-YDLETVALHEI  266

Query  920   GHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHLLGLGHS VE A+MYPYI  G TK  L +DDIQGIK LY
Sbjct  267   GHLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  307



>ref|XP_010091950.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB47730.1| Metalloendoproteinase 1 [Morus notabilis]
Length=370

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 167/305 (55%), Gaps = 52/305 (17%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN---------------NLPYNNTSPEAN--YF  403
             K L+GSKKGD+V+G+ +LK YL+ FGY+N               +   NN    AN   F
Sbjct  65    KHLEGSKKGDKVQGIRDLKKYLQHFGYLNPTQITKTQITGHSLNDNSINNDISTANDSTF  124

Query  404   SDQLESAVRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL------------  547
              D LE+A++T+Q N+NL  TG LDS T+S MM PRC V DII    R+            
Sbjct  125   DDLLEAAIKTYQTNYNLKPTGTLDSQTLSKMMMPRCAVADIINNDTRMRSKKKSTTSSTK  184

Query  548   --------------------VPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEAL  667
                                 V  YSF  G P+WP  K +L+Y++ +G   E V +   A 
Sbjct  185   NHVHRKLLGQKYVSTDDLQTVSHYSFFSGKPKWPSSKYSLTYSFAEGMLSEDVEAVGRAF  244

Query  668   QQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSE  847
             Q W+  T  SF+       AD++     G+HGDG AFDG GG++AH+F PT+G  H D++
Sbjct  245   QTWASNTHFSFSRAQGNTKADIRVSFERGDHGDGDAFDGAGGVLAHAFSPTDGRLHFDAD  304

Query  848   ESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQG  1027
             E+WA +G       D+++V  HE GH+LGL HS VE A+MYP IG G TK  L+ DDIQG
Sbjct  305   ETWA-IGEVAD-AFDVETVALHEIGHILGLLHSSVEGAIMYPQIGSGLTKG-LNADDIQG  361

Query  1028  IKALY  1042
             I ALY
Sbjct  362   INALY  366



>ref|XP_008230961.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=311

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 156/272 (57%), Gaps = 25/272 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G + GD+V G+ +LK YL RFGY+++    N +   + F DQL SA++T+Q N+NL +
Sbjct  45    LKGFQNGDKVPGIQDLKKYLGRFGYLSS----NNNQTTDEFDDQLASAIKTYQLNYNLKT  100

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG------------------RRHRLVPQYSFLPGNPRW  586
             TG+LD+ TVS MM PRCGVPDII                    +   V  Y+F PG P+W
Sbjct  101   TGILDTQTVSNMMMPRCGVPDIINGTSSMRSGKQSHPPPNHHHKGHTVAHYAFFPGKPKW  160

Query  587   PDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
             P  K  L+YA+  GTP         A   W+  T+  F+        DL        HGD
Sbjct  161   PASKYHLTYAFLRGTPTAAKGPVARAFNTWAAHTQFKFSQAPRNQKPDLTVSFHRRSHGD  220

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G  FDGPGGI+AHSF P +G  H D++E W+ VG        +++V  HE GHLLGLGHS
Sbjct  221   GHPFDGPGGILAHSFAPKDGRFHYDADEKWS-VG-VVRGAFHLETVALHEIGHLLGLGHS  278

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              V  A+MYP I  GETK  L+ DDIQGIKALY
Sbjct  279   SVRRAIMYPTISSGETKG-LNRDDIQGIKALY  309



>ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis]
 gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis]
Length=321

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/290 (44%), Positives = 164/290 (57%), Gaps = 44/290 (15%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN-----YFSDQLESAVRTFQ  439
             K LQG  KGD++KG+ ELK YLK FGY   L YN     AN      F D LESA+RT+Q
Sbjct  39    KHLQGCHKGDKLKGVGELKKYLKHFGY---LSYNKNQSHANEDDDDDFDDPLESAIRTYQ  95

Query  440   ANFNLNSTGVLDSNTVSLMMKPRCGVPDIIG--------------------------RRH  541
              N++LN +G+LDS T S MM PRCGV DII                             H
Sbjct  96    LNYHLNVSGLLDSETASKMMMPRCGVADIINGTTWMESGRKHHRHPHRHHHRRHGPKSLH  155

Query  542   RLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYN  721
             + V  YSF  GNP+WP  K  L+Y++  G P   V     A + W+  T  SF+   DY 
Sbjct  156   K-VSHYSFFSGNPKWPPSKYHLTYSFLPGFPTAAVNPVANAFETWAANTHFSFSWTRDYI  214

Query  722   NADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVD  892
             N+D+    + G+HGDG  FDGPGG +AH+F P  G+ H D++E W   A +G Y     D
Sbjct  215   NSDILISFYRGDHGDGHPFDGPGGTLAHAFAPQNGLFHYDADERWSIGAVLGAY-----D  269

Query  893   IQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             +++   HE GHLLGLGHS VE A+MYP I  GET R L +DD++GI+ LY
Sbjct  270   LETTALHEIGHLLGLGHSSVEGAIMYPQIFAGET-RGLHSDDLEGIRTLY  318



>ref|XP_007226174.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
 gb|EMJ27373.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
Length=321

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 165/276 (60%), Gaps = 25/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQ--LESAVRTFQANFNL  454
             L+G  KGD ++G+++LK+YL++FGY++   +   +P A+       LE AV+T+Q N++L
Sbjct  47    LKGVHKGDHIQGIHDLKLYLEKFGYLS-YAHAKHNPHADDDDFDDFLELAVKTYQLNYHL  105

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG---------RRHRL-----------VPQYSFLPG  574
              +TG LD+ TVS MM  RCGV DII          ++HR            V  YSF  G
Sbjct  106   KTTGTLDAKTVSKMMMSRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFFKG  165

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
               +WP  K+ L++A+   TP E +     A + W+  T   F+   +Y  AD+K     G
Sbjct  166   KLKWPRSKHHLTFAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFEYG  225

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG +FDGPGG++AH++ PT G  H D+EE W+ VG    Y  D+++V  HE GHLLG
Sbjct  226   DHGDGSSFDGPGGVLAHAYAPTYGKFHYDAEEPWS-VGALEGY-YDLETVALHEIGHLLG  283

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE AVMYPYI  G T   L +DDI+GIK LY
Sbjct  284   LGHSSVEGAVMYPYIASGATNLYLHDDDIRGIKVLY  319



>ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52414.1| hypothetical protein Csa_5G632130 [Cucumis sativus]
Length=316

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 164/276 (59%), Gaps = 23/276 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYN-NTSPEANYFSDQLESAVRTFQANFN  451
             K L G KKGD+V+G++++K YL+ FGY+NN   N + S + + F   LESA++T+Q N+N
Sbjct  41    KNLNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYN  100

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-------------------VPQYSFLPG  574
             L +TG +++ T+ LM +PRCG  DI+  + R+                   V  Y+F  G
Sbjct  101   LKATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDG  160

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             NP+WP  K+ L+Y +  GTP + V +   A + W   T  +F+  + Y  AD+K     G
Sbjct  161   NPKWPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETG  220

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG +FDG  G+IAH F P +G  H D+ ESWA VG       D++++  HE GHLLG
Sbjct  221   DHGDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIAD-SFDLETIALHEIGHLLG  278

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             L HS +E A+M+P I  G TK  LD DDI GI ALY
Sbjct  279   LYHSSIERAIMWPSIMEGSTKG-LDADDIAGINALY  313



>ref|XP_008343421.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 158/275 (57%), Gaps = 32/275 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL++FGY+N    N+       F D LESA++T+Q N++L +
Sbjct  44    LKGCHKGDKVQGIQDLKKYLEKFGYLNGHSDNDD------FDDILESAIKTYQLNYHLKA  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHR-----------LVPQYSFLPGNPR  583
             TG LD  TVS MM PRCGVPDII        G++              V  YSF PGNP+
Sbjct  98    TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+   TP     +   A   W+G T  SF+    Y NADL     +G+HG
Sbjct  158   WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  F G GG +AH+F PT G  H D++E WA       Y  D+++V  HE GHLLGL H
Sbjct  218   DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWAVGAVEGAY--DLETVALHEIGHLLGLRH  275

Query  944   SGVEAAVMYPYI--GFGETKRVLDNDDIQGIKALY  1042
             S VE AVM   +  GF ++   L  DDIQGIKALY
Sbjct  276   SSVEGAVMSSTVRTGFAQS---LHADDIQGIKALY  307



>ref|XP_008230960.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 158/274 (58%), Gaps = 30/274 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY+++   NN     + F DQLESA++T+Q N++L +
Sbjct  48    LKGCHKGDKVQGIQDLKKYLGKFGYLSS--NNNGHFNDDDFDDQLESAIKTYQLNYHLKA  105

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPGNPRWP  589
             TG LD+ TVS MM PRCGV DII     +                 V  Y+F  GNP+WP
Sbjct  106   TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
               K  L+YA+  GTP E       A Q W+  T  +F+      N DL      G HGDG
Sbjct  166   ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN--QNPDLTVSFHRGNHGDG  223

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGLG  940
               FDGPGG IAH+F PT G  H D++E +   A  G Y     D+++V  HE GHLLGLG
Sbjct  224   SPFDGPGGTIAHAFAPTNGRFHYDADERFSVGAVSGAY-----DLETVALHEIGHLLGLG  278

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS V  A+MYP I  G TK  L  DDIQGIKALY
Sbjct  279   HSSVLGAIMYPTISPGATKG-LHGDDIQGIKALY  311



>ref|XP_008361888.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 158/275 (57%), Gaps = 32/275 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL++FGY+N    N+       F D LESA++T+Q N++L +
Sbjct  44    LKGCHKGDKVQGIQDLKKYLEKFGYLNGHSDNDD------FDDILESAIKTYQLNYHLKA  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHR-----------LVPQYSFLPGNPR  583
             TG LD  TVS MM PRCGVPDII        G++              V  YSF PGNP+
Sbjct  98    TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+   TP     +   A   W+G T  SF+    Y NADL     +G+HG
Sbjct  158   WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  F G GG +AH+F PT G  H D++E WA       Y  D+++V  HE GHLLGL H
Sbjct  218   DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWAVGAVEGXY--DLETVALHEIGHLLGLRH  275

Query  944   SGVEAAVMYPYI--GFGETKRVLDNDDIQGIKALY  1042
             S VE AVM   +  GF ++   L  DDIQGIKALY
Sbjct  276   SSVEGAVMSSTVRTGFAQS---LHADDIQGIKALY  307



>ref|XP_008230675.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=305

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 158/274 (58%), Gaps = 30/274 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY+++   NN     + F DQLESA++T+Q N++L +
Sbjct  40    LKGCHKGDKVQGIQDLKKYLGKFGYLSS--NNNGHFNDDDFDDQLESAIKTYQLNYHLKA  97

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPGNPRWP  589
             TG LD+ TVS MM PRCGV DII     +                 V  Y+F  GNP+WP
Sbjct  98    TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  157

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
               K  L+YA+  GTP E       A Q W+  T  +F+      N DL      G HGDG
Sbjct  158   ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN--QNPDLTVSFHRGNHGDG  215

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGLG  940
               FDGPGG IAH+F PT G  H D++E +   A  G Y     D+++V  HE GHLLGLG
Sbjct  216   SPFDGPGGTIAHAFAPTNGRFHYDADERFSVGAVSGAY-----DLETVALHEIGHLLGLG  270

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS V  A+MYP I  G TK  L  DDIQGIKALY
Sbjct  271   HSSVLGAIMYPTISPGATKG-LHGDDIQGIKALY  303



>ref|XP_008230959.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 162/271 (60%), Gaps = 26/271 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+  LKIYL++FGY+N    N+     +YF D+LE A++T+Q N++L  
Sbjct  50    LKGCHKGDKVQGIQNLKIYLEKFGYLNGNTNND-----DYFDDELELAIKTYQINYHLKV  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------------GRRHRLVPQYSFLPGNPRWPDD  595
             TG LD+ TV  M  PRCGVPDII               G  H  V  Y+F  GNP+WP +
Sbjct  105   TGTLDAKTVKKMEIPRCGVPDIINGTTSMRSGNKRGGHGSTH-TVGHYAFFQGNPKWPAN  163

Query  596   KNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG--  769
             K  L+Y +  GTP E V +   A   W G T  +F+    + +ADLK     G+HGDG  
Sbjct  164   KYHLTYGFLQGTPSEAVGAVARAFATWQGNTHFTFSQAQSFESADLKIGFGRGDHGDGAN  223

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
              AFDGPG  IAH+F P++G  H D++E+W  VG   P G D+++V  HE GHLLGL HS 
Sbjct  224   NAFDGPGKTIAHAFPPSDGRFHYDADETWV-VGA-VPGGFDLETVALHEIGHLLGLDHSS  281

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             V  AVM   I  G T+  L  DD+QGI+ALY
Sbjct  282   VSGAVMQSQIPSGYTQS-LHADDVQGIRALY  311



>gb|AES96374.2| matrix metalloproteinase [Medicago truncatula]
Length=368

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/280 (44%), Positives = 159/280 (57%), Gaps = 31/280 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K   G  +G    GL +LK Y   FGYI N P +N + +   F + LESAVRT+Q NFNL
Sbjct  53    KNFTGCSRGKTYDGLSKLKNYFNHFGYIPNGPPSNFTDD---FDEALESAVRTYQKNFNL  109

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPD  592
             N TG LD  T++ ++KPRCGV DII     +              V  YSF PG PRWP+
Sbjct  110   NITGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPE  169

Query  593   DKNALSYAWG------DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
                 L+YA+       D T   F      A  QWS  T ++F + T Y+++D+K   ++G
Sbjct  170   GTQTLTYAFDPSENLDDATKQVFA----NAFNQWSKVTTITFTEATSYSSSDIKIGFYSG  225

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETG  922
             +HGDG+AFDG  G +AH+F PT+G  HLD  E W   G          VD++SVV HE G
Sbjct  226   DHGDGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIG  285

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS +E A+MYP I     K  L++DDI+GI+ LY
Sbjct  286   HLLGLGHSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_003613416.1| Matrix metalloproteinase-9 [Medicago truncatula]
Length=393

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/280 (44%), Positives = 159/280 (57%), Gaps = 31/280 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K   G  +G    GL +LK Y   FGYI N P +N + +   F + LESAVRT+Q NFNL
Sbjct  53    KNFTGCSRGKTYDGLSKLKNYFNHFGYIPNGPPSNFTDD---FDEALESAVRTYQKNFNL  109

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPD  592
             N TG LD  T++ ++KPRCGV DII     +              V  YSF PG PRWP+
Sbjct  110   NITGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPE  169

Query  593   DKNALSYAWG------DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
                 L+YA+       D T   F      A  QWS  T ++F + T Y+++D+K   ++G
Sbjct  170   GTQTLTYAFDPSENLDDATKQVFA----NAFNQWSKVTTITFTEATSYSSSDIKIGFYSG  225

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETG  922
             +HGDG+AFDG  G +AH+F PT+G  HLD  E W   G          VD++SVV HE G
Sbjct  226   DHGDGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIG  285

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS +E A+MYP I     K  L++DDI+GI+ LY
Sbjct  286   HLLGLGHSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_008458714.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=319

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/274 (42%), Positives = 165/274 (60%), Gaps = 24/274 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L GS+KGD+V+G+++LK YL +FGY+N     ++  + + F + LESA++T+Q N+NL  
Sbjct  46    LHGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENKDDEFDELLESAIKTYQKNYNLKV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPGNP  580
             TG LD+ T++ M+KPRCGV DII                    G  HR V  ++F  GNP
Sbjct  106   TGTLDAMTIAQMLKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHR-VSHFAFFDGNP  164

Query  581   RWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             +WP  K+ L+Y +  GTP E V+    A   W+  +  +F+   D   +D+     +G+H
Sbjct  165   KWPATKSHLTYGFLPGTPPETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFESGDH  224

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDG GG++AH+F P++G  HLD++ESWA          D+++V  HE GHLLGL 
Sbjct  225   GDGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN--GVVSGSFDLETVALHEIGHLLGLQ  282

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS +E A+M+P +  G +K  L  DDI GIKALY
Sbjct  283   HSSIEGAIMWPQVPEGASKG-LHADDIAGIKALY  315



>ref|XP_004297896.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 161/265 (61%), Gaps = 14/265 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L+GS KGD ++G+ +LK++L++FGY++     N+   + + F D LESAV+ +Q  F+L 
Sbjct  49    LKGSHKGDHIQGILDLKLFLEKFGYLSYGNDKNHIHADDDDFDDVLESAVKDYQHYFHLR  108

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------VPQYSFLPGNPRWPDDKNAL  607
             +TG LD  TVS M KPRCGV D IG  H++          V  YSF     +WP  K  L
Sbjct  109   TTGTLDGKTVSKMTKPRCGVSDHIGV-HKIDYSKKDHIHEVSHYSFFSSKQKWPPSKYHL  167

Query  608   SYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
             +YA+  GT  E +T   +A Q W+  T   F    DY  AD+K     G+HGDG +FDG 
Sbjct  168   TYAFAPGTLSEAMTPIAQAFQTWAASTHFKFRRHRDYKKADIKISFEQGDHGDGSSFDGT  227

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVM  967
             GGI+AH++ PT G  H D++E W+ +G    Y  D+++V  HE GHLLGL HS  E A+M
Sbjct  228   GGILAHAYAPTYGKLHYDADEPWS-IGALEGY-YDLETVALHEIGHLLGLAHSSEEDAIM  285

Query  968   YPYIGFGETKRVLDNDDIQGIKALY  1042
             YPYI  G TK  L +DDI GI+ALY
Sbjct  286   YPYISSGVTKLDLHHDDIHGIRALY  310



>ref|XP_010037507.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49217.1| hypothetical protein EUGRSUZ_K02797 [Eucalyptus grandis]
Length=311

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 164/274 (60%), Gaps = 26/274 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY----FSDQLESAVRTFQANF  448
             LQG  KGD+VKGL ELK YL++FGY+N   YN ++ + N     F + LESA++ +Q N+
Sbjct  42    LQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQTNANDDDFDELLESAIKLYQLNY  98

Query  449   NLNSTGVLDSNTVSLMMKPRCGVPDII-----------GRRH-----RLVPQYSFLPGNP  580
             +L  TG LDS TV++M  PRCG  DI+           G RH       V  ++F  GNP
Sbjct  99    HLKVTGNLDSQTVAMMTMPRCGAADIVNGTSRMRSGKRGTRHGSSNFHTVGHFTFFDGNP  158

Query  581   RWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             +WP  K  L+YA+   T  + V     A   W+  T+ +F+   +Y +AD+K      +H
Sbjct  159   KWPSSKYHLTYAFYPETRDDVVGPVSRAFNTWASATQFTFSQSQNYESADIKIAFARRDH  218

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDGP G+IAH+FQPT G+ H D++E W+  GP      ++++V  HE GHLLGLG
Sbjct  219   GDGAPFDGPNGVIAHAFQPTVGMFHYDADEPWS-AGPVSG-SYNMETVALHEIGHLLGLG  276

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS V  A+MYP I  G +K  L  DD+QGIKALY
Sbjct  277   HSSVAGAIMYPTISPGVSKG-LHGDDVQGIKALY  309



>gb|EPS59674.1| hypothetical protein M569_15132, partial [Genlisea aurea]
Length=260

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/259 (44%), Positives = 158/259 (61%), Gaps = 13/259 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN--YFSDQLESAVRTFQANFNL  454
             L+G + G+  +G++ +K YL+RFGY   L Y    P ++  +F ++L SAVR +QAN+ L
Sbjct  9     LEGCRLGNRSEGIHGVKRYLERFGY---LRYEGNDPHSDDDFFDERLYSAVRVYQANYRL  65

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLV---PQYSFLPGNPRWPDDKNALSYAWGD  625
             N TG LD+ T S+M   RCGVPDI+   + ++   P +SF P   RWP  K  LSY +  
Sbjct  66    NVTGELDAATASVMSLQRCGVPDIVNGTNLMISWRPYFSFFPDRQRWPPKKTHLSYLYLT  125

Query  626   GTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAH  805
               P E++ +   A + W+  TR +F+   D  ++D+    F+G+HGDG  FDGPGG++AH
Sbjct  126   NVPPEYIPAIDRAFESWASVTRFTFHRVED--SSDITVGYFSGDHGDGVPFDGPGGVLAH  183

Query  806   SFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGF  985
             SF PT+G  H D+ E W       P   D+ S+  HE GHLLGLGHS V  A+M+ Y G 
Sbjct  184   SFAPTDGRMHFDAAEPW--FDGVKPDRFDVHSIAMHEIGHLLGLGHSSVREAIMWAYFGL  241

Query  986   GETKRVLDNDDIQGIKALY  1042
             GE +R +  DDI GIKALY
Sbjct  242   GE-RRTIQPDDIDGIKALY  259



>ref|NP_001266203.1| matrix metalloproteinase precursor [Solanum lycopersicum]
 emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=367

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 159/278 (57%), Gaps = 28/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G  V GL ++K Y   FGYINN   N T    + F D LESA++T+Q NFNLN+
Sbjct  48    LLGCHSGQTVDGLAKIKKYFHYFGYINNSSTNFT----DDFDDTLESALKTYQLNFNLNT  103

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPDDK  598
             TGVLD+NT+  ++KPRCG  D++     +              V  YSF PG+PRWP +K
Sbjct  104   TGVLDANTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGSPRWPANK  163

Query  599   NALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G   +       A  +WS  T L+F +   Y +AD+K   F+G+H DG+
Sbjct  164   RDLTYAFAPQNGLTDDIKIVFTRAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHL  928
              FDGP G +AH+F P  G  HLD EE+W   G     G        VD++SV  HE GHL
Sbjct  224   PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGHL  283

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+MYP +G G  +  L NDDI G++ LY
Sbjct  284   LGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_004504503.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=374

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 159/286 (56%), Gaps = 36/286 (13%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             +   G   G    GL +LK Y +RFGYI N P +N + +   F D LESAVR +Q NFNL
Sbjct  52    RNFTGCSPGKTYDGLSKLKNYFQRFGYITNAPPSNFTDD---FDDALESAVRAYQQNFNL  108

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG---------------------RRHRLVPQYSFLP  571
             N TG LD+ T++ ++KPRCGV DII                       +   V  YSF P
Sbjct  109   NVTGELDNATMNYIVKPRCGVADIINGTTSMNSGKFNFNNTSENKENPKFHTVAHYSFFP  168

Query  572   GNPRWPDDKNALSYAWGDGTPYEFVTSTKE-----ALQQWSGWTRLSFNDQTDYNNADLK  736
             G PRWP    +L+YA+    P E +  T +     A  QWS  T ++F++ T ++ AD+K
Sbjct  169   GEPRWPAGTKSLTYAFD---PNENLDETTKQVFANAFNQWSKVTTITFSETTSFSTADIK  225

Query  737   YHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSV  904
                ++G+HGDG+AFDG  G +AH+F PT+G  HLD  E W   G          VD++SV
Sbjct  226   IGFYSGDHGDGEAFDGVLGTLAHAFSPTDGRFHLDKAEDWVVSGDVTESTLSNAVDLESV  285

Query  905   VTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
               HE GHLLGLGHS VE A+MYP I     K  L NDDI GI+ LY
Sbjct  286   AVHEIGHLLGLGHSSVEEAIMYPTISSKTRKVELVNDDIDGIQQLY  331



>ref|XP_006448955.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
 gb|ESR62195.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
Length=241

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 150/241 (62%), Gaps = 12/241 (5%)
 Frame = +2

Query  287  GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
            G++KGD VKG+  LK YL   GY++N  +N+ + + +YF + LESAV+T+Q NFNLN TG
Sbjct  1    GTQKGDTVKGINALKKYLHTLGYLSNHNHNHAA-DGDYFDENLESAVKTYQRNFNLNPTG  59

Query  467  VLDSNTVSLMMKPRCGVPDIIGRRHRLV-------PQYSFLPGNPRWPDDKNALSYAWGD  625
             +D  TVS+M KPRCGVPD+I R  R+          Y F PG P+WP  K  +SYA+  
Sbjct  60   HMDLKTVSMMGKPRCGVPDVINRTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISYAFLP  119

Query  626  GTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG--GII  799
            GT  +     ++A   WS +T  S+    DY+ AD+K     G+HGDG  F GPG   ++
Sbjct  120  GTRTDVQEPVRQAFLTWSKYTPFSYEFVQDYDAADIKISFQRGDHGDGYPFGGPGPYNLL  179

Query  800  AHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYI  979
            AHSF PT+G  H D +E+W  V    P  VD+Q+V  HE GH+LGL HS V+AA+MYP  
Sbjct  180  AHSFSPTDGRAHYDGDENWTVVA--VPGAVDMQTVALHELGHVLGLAHSPVQAAIMYPLA  237

Query  980  G  982
            G
Sbjct  238  G  238



>ref|XP_008368314.1| PREDICTED: LOW QUALITY PROTEIN: metalloendoproteinase 1-like 
[Malus domestica]
Length=309

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/273 (44%), Positives = 158/273 (58%), Gaps = 28/273 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL++FGY+N         +++ F D LESA++T+Q N++  +
Sbjct  44    LKGCHKGDKVQGIQDLKKYLEKFGYLNG------HSDSDDFDDILESAIKTYQVNYHXKA  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHR-----------LVPQYSFLPGNPR  583
             TG LD+ TV  M+ PRCGV DII        G++              V  YSF  GNP+
Sbjct  98    TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFXTGNPK  157

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+   TP E   +   A   W+G T  SF+   +Y NADL      G+HG
Sbjct  158   WPSSKYHLTYAFDQSTPTEARDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  FDG GGI+AH+F PT    H D++E WA       Y  D+++V  HE GHLLGL H
Sbjct  218   DGNPFDGRGGILAHAFPPTNXRFHYDADEXWAVGAVADAY--DLETVALHEIGHLLGLQH  275

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE AVM P +  G T+  L  DDIQGIKALY
Sbjct  276   SSVEGAVMSPGVRSGFTQS-LHADDIQGIKALY  307



>ref|XP_011073059.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 160/268 (60%), Gaps = 17/268 (6%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNN---TSPEANYFSDQLESAVRTFQAN  445
             K L G++KG   KG+ +LK YL  FGY+N+   NN        ++F D LE A++++Q  
Sbjct  47    KTLVGTRKGTTSKGISQLKKYLSHFGYMNH--KNNIILAHQTDDFFDDNLELAIKSYQTF  104

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDI--IGRRHRL---VP----QYSFLPGNPRWPDDK  598
             F L   G++D+NT++ M  PRCGVPD   + R H L   +P     Y F PG P+WP  K
Sbjct  105   FKLEVNGIMDANTITQMSPPRCGVPDSFNLNRSHELYLRIPTLASHYIFFPGEPKWPPTK  164

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
              +L+Y++  G P +   S   A Q W+  +  +F+   DY+ AD+K      +HGDG  F
Sbjct  165   RSLTYSFPSGAPTDVTNSILHATQIWASVSPFTFSYTPDYDQADIKISFQNRDHGDGNPF  224

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGGI+AH++ P++G  H D +E W  V    P   D+Q+V  HE GH+LGLGHS    
Sbjct  225   DGPGGILAHAYAPSDGRLHFDGDERW--VDGVTPGAFDLQTVGLHELGHVLGLGHSNDTG  282

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             AVMYPYIG G  ++VL  DDI GIKALY
Sbjct  283   AVMYPYIGDG-LRKVLGQDDINGIKALY  309



>ref|XP_007153680.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
 gb|ESW25674.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
Length=376

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/282 (43%), Positives = 157/282 (56%), Gaps = 31/282 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L G  +G+   GL  LK Y +RFGY  + P +N S E   F D LESA++T+Q NFNL
Sbjct  51    RNLTGCHRGENYDGLANLKSYFERFGYFPHAPPSNFSDE---FDDALESAIKTYQKNFNL  107

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG------------------RRHRLVPQYSFLPGNP  580
             N TGVLD  T+  ++ PRCGV DII                    R   V  ++  PGNP
Sbjct  108   NVTGVLDDATLQQIVLPRCGVADIINGTTTMNAGKQNETASFSKPRFHTVAHFALFPGNP  167

Query  581   RWPDDKNALSYAWGDGTPYEFVTSTK----EALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
             RWP+    L+YA+  G   +   + K     A  +W+  T L+F +   Y NAD++   F
Sbjct  168   RWPEGTEELTYAFNPGN--DLSNTVKGVFASAFARWAEVTSLTFRETASYFNADIRIGFF  225

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHE  916
             +G+HGDG+ FDG  G +AH+F PT G  HLD++E W   G          VD++SV  HE
Sbjct  226   SGDHGDGEPFDGSLGTLAHAFSPTNGRFHLDADEDWVVSGDVTQSALSSAVDLESVAVHE  285

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS VE AVM+P I     K VL  DDI+GI+ LY
Sbjct  286   IGHLLGLGHSSVEEAVMFPTISSRRKKVVLAQDDIEGIQFLY  327



>ref|XP_006363533.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=370

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 158/278 (57%), Gaps = 28/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G  V GL ++K Y   FGYINN   N T    + F D LESA++T+Q NFNLN+
Sbjct  48    LLGCHSGQTVDGLAKIKKYFHYFGYINNSSSNFT----DDFDDTLESALKTYQLNFNLNT  103

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPDDK  598
             TGVLD++T+  ++KPRCG  D++     +              V  YSF PG PRWP +K
Sbjct  104   TGVLDASTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGRPRWPANK  163

Query  599   NALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G   +       A  +WS  T L+F +   Y +AD+K   F+G+H DG+
Sbjct  164   RDLTYAFAPQNGLTDDIKIVFTHAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHL  928
              FDGP G +AH+F P  G  HLD EE+W   G     G        VD++SV  HE GHL
Sbjct  224   PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGHL  283

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+MYP +G G  +  L NDDI G++ LY
Sbjct  284   LGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=457

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 164/276 (59%), Gaps = 23/276 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYN-NTSPEANYFSDQLESAVRTFQANFN  451
             K L G KKGD+V+G++++K YL+ FGY+NN   N + S + + F   LESA++T+Q N+N
Sbjct  182   KNLNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYN  241

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-------------------VPQYSFLPG  574
             L +TG +++ T+ LM +PRCG  DI+  + R+                   V  Y+F  G
Sbjct  242   LKATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDG  301

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             NP+WP  K+ L+Y +  GTP + V +   A + W   T  +F+  + Y  AD+K     G
Sbjct  302   NPKWPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETG  361

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG +FDG  G+IAH F P +G  H D+ ESWA VG       D++++  HE GHLLG
Sbjct  362   DHGDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIAD-SFDLETIALHEIGHLLG  419

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             L HS +E A+M+P I  G TK  LD DDI GI ALY
Sbjct  420   LYHSSIERAIMWPSIMEGSTKG-LDADDIAGINALY  454


 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = +2

Query  632   PYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSF  811
             P +FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG AFDGPGG++ H+F
Sbjct  7     PVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGGVVGHAF  66

Query  812   QPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGE  991
              PT+G  HLD ++SW+       +  ++ +V  HE GH+LGL HS +  AVM+PYI    
Sbjct  67    APTDGRLHLDGDDSWSAGLEENKF--NVMNVALHELGHVLGLAHSTLPQAVMWPYIDSNA  124

Query  992   TKRVLDNDDIQGIKAL  1039
              K  L++DDI G+ AL
Sbjct  125   LKN-LNDDDIAGLHAL  139



>ref|XP_006438497.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
 ref|XP_006483764.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
 gb|ESR51737.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
Length=371

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 154/281 (55%), Gaps = 32/281 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   GD++ GL +LK Y   FGYI +LP N T    + F D LESAV+T+Q NFNL  
Sbjct  51    FTGCHPGDKMDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEP  106

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------------------GRRHRLVPQYSFLPGN  577
             TG LDS T+  +++PRCG PDI+                     G  H  V  YSF PG 
Sbjct  107   TGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHS-VGHYSFFPGM  165

Query  578   PRWPDDKNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFA  751
             PRWP +K  L+YA+   +    E       A  +WS  T L+F     Y  AD++   F 
Sbjct  166   PRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFT  225

Query  752   GEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWA----QVGPYYPYGVDIQSVVTHET  919
             G+HGDG+ FDGP G +AH+F P  G  HLD +E+W              +D++SV  HE 
Sbjct  226   GDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEI  285

Query  920   GHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHLLGLGHS VE A+MYP I  G  K  L NDDIQGI+ALY
Sbjct  286   GHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALY  326



>ref|XP_010255256.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=309

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 163/277 (59%), Gaps = 32/277 (12%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L+G +KG+ VKGL ELK YL+RFGY+NN        + + F D LE A++T+Q N+NL
Sbjct  43    RHLEGCRKGETVKGLNELKRYLERFGYLNN------HKDDDDFDDLLELAIKTYQLNYNL  96

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG----------RRH-------RLVPQYSFLPGNPR  583
             N TG LD  T+  M  PRCG PDI            ++H         V +YSF  G PR
Sbjct  97    NVTGSLDPETLKQMSLPRCGAPDITNGTTSMRSGKEKKHPHERKTLHTVSRYSFFSGIPR  156

Query  584   WPDDKNALSYAWGDGTPYEFVTSTK----EALQQWSGWTRLSFNDQTDYNNADLKYHLFA  751
             WP  K  L+YA+  GTP   V+S +     A Q+W+  +R  F +  DY  AD+K     
Sbjct  157   WPPSKTLLTYAFLPGTP---VSSMRPVCDRAFQRWAAVSRFRFQETQDYLTADIKISFER  213

Query  752   GEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLL  931
             G+HGD   FDGPGG++AH++ PT+G  H D++E W  +G     G D++SV  HE GHLL
Sbjct  214   GDHGDKYPFDGPGGVLAHAYAPTDGRFHYDADEKW-YIGASLD-GYDVESVAMHEIGHLL  271

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS V  ++MYP +  G  K  LD DDI GI++LY
Sbjct  272   GLGHSSVGNSIMYPSLLMGTQKLKLDQDDIDGIRSLY  308



>dbj|BAJ94792.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92632.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 155/271 (57%), Gaps = 19/271 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GDE  GL  LK YL  FGY++  P   +SP ++ F  +LE+AV T+Q NF LN+
Sbjct  51    LSGCHMGDERDGLARLKDYLSHFGYLSEAP--TSSPFSDAFDAELEAAVATYQRNFGLNA  108

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ----------YSFLPGNPRWPDDKNALS  610
             TGVLD  TVS M+ PRCGV D+I     +             Y++ PG P WP  +  L 
Sbjct  109   TGVLDPPTVSQMVAPRCGVADVINGTSTMDRNASAAGHGRHLYTYFPGGPMWPPFRRELR  168

Query  611   YAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             YA           +T       A  +WS  T L F +    ++AD+    +AG HGDG+A
Sbjct  169   YAITATAATSIDRATLGAVFARAFARWSDATTLRFAEAASESDADITIGFYAGSHGDGEA  228

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             FDGP G +AH+F PT+G  HLD+ E+W     G   P  VD++SV  HE GHLLGLGHS 
Sbjct  229   FDGPLGTLAHAFSPTDGRFHLDAAEAWVADGQGGDAPGAVDLESVAVHEIGHLLGLGHSS  288

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             V+ A+MYP I  G  K  L++DD+QGI++LY
Sbjct  289   VQGAIMYPTIRTGTRKVDLESDDVQGIQSLY  319



>emb|CBI34985.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 159/255 (62%), Gaps = 12/255 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             LQG  KGD+V+G+++LK YL +FGY++ +    +T    + F D +ESA++T+Q N++LN
Sbjct  17    LQGCHKGDKVEGIHKLKKYLGQFGYLSYSHSKYHTHANDDDFDDLVESAIKTYQTNYHLN  76

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPY  637
             +TG LDS TVS M+KPRCG  DII   + +         +PRWP  K  L+YA+  GTP 
Sbjct  77    ATGSLDSETVSQMVKPRCGAADIINGTNWMR--------SPRWPPSKTYLTYAFLPGTPS  128

Query  638   EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQP  817
               ++    A  QW   T  +F    D+ +AD+       +HGDG  FDGPGG IAH+F P
Sbjct  129   WAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGDGYPFDGPGGTIAHAFAP  188

Query  818   TEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETK  997
             T G  H D +E+W+ +G   P  +D+++V  HE GHLLGLGHS V+ A+M+P I  G TK
Sbjct  189   TNGRFHYDGDETWS-IGA-VPNAMDLETVALHEIGHLLGLGHSSVQNAIMFPSISSGVTK  246

Query  998   RVLDNDDIQGIKALY  1042
               L  DDIQGI ALY
Sbjct  247   G-LHEDDIQGISALY  260



>ref|XP_008365496.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=319

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 157/273 (58%), Gaps = 28/273 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL++FGY+N         +++ F D LESA++T+Q N++  +
Sbjct  44    LKGCHKGDKVQGIQDLKKYLEKFGYLNG------HSDSDDFDDILESAIKTYQVNYHXKA  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHR-----------LVPQYSFLPGNPR  583
             TG LD+ TV  M+ PRCGV DII        G++              V  YSF  GNP+
Sbjct  98    TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFFTGNPK  157

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  L+YA+   TP E   +   A   W+G T  SF+   +Y NADL      G+HG
Sbjct  158   WPSSKYHLTYAFDQSTPTEAXDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  FDG GGI+AH+F PT    H D++E+WA       Y  D+++V  HE  HLLGL H
Sbjct  218   DGNPFDGRGGILAHAFPPTNXRFHYDADEAWAVGAVADAY--DLETVALHEIXHLLGLQH  275

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE AVM P    G T+  L  DDIQGIKALY
Sbjct  276   SSVEGAVMSPGXRSGFTQS-LHADDIQGIKALY  307



>gb|EYU29749.1| hypothetical protein MIMGU_mgv1a023711mg, partial [Erythranthe 
guttata]
Length=265

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 153/257 (60%), Gaps = 7/257 (3%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K LQGS KGD + G+  LK YL++FGY++NL  NNT    N F D LESA++T+Q NFN+
Sbjct  13    KLLQGSVKGDRILGISVLKNYLQKFGYLDNL--NNTQIN-NEFDDALESAIKTYQQNFNI  69

Query  455   NSTGVLDSNT-VSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGT  631
             N TGVLD+ T             + +G  H  V  Y+F  GNP+WP  K  L+Y +    
Sbjct  70    NPTGVLDAATPAGTENHESSSSNNQLGHIHT-VSHYTFFSGNPKWPPSKYNLTYGFLSNV  128

Query  632   PYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSF  811
             P   V   + A Q W   T  +F   +    ADL      G+HGDG +FDGPGGI+AH+F
Sbjct  129   PANAVAPAERAFQNWDNATHFTFKRASSGQTADLIIGFQRGDHGDGSSFDGPGGILAHAF  188

Query  812   QPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGE  991
              PT G  H D++E W+ V P     + +++V  HE GHLLGLGHS ++AA+MYP +  G 
Sbjct  189   APTNGRLHYDADERWS-VDP-VANTIHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGT  246

Query  992   TKRVLDNDDIQGIKALY  1042
              K  L+ DDIQGIKALY
Sbjct  247   AKIKLNADDIQGIKALY  263



>ref|XP_011071055.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=374

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 158/273 (58%), Gaps = 23/273 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G KKG +  GL +LK Y + FGY+N   Y++ S E   F D LE AV+T+Q NFNLN+
Sbjct  51    LVGCKKGQKADGLPKLKEYFQYFGYLNT-SYSDFSDE---FDDSLEIAVKTYQLNFNLNA  106

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVP-------------QYSFLPGNPRWPDDKN  601
             TG +D+ T+  ++ PRCG PDI+     + P              YSF P  PRWP  K+
Sbjct  107   TGQIDAETIKRIVVPRCGNPDIVNGTSAMHPGKPSANSTIHTVAHYSFFPNRPRWPPSKS  166

Query  602   ALSYAWGDGTPYEFVTST--KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
              L+YA+        V  T    A ++WS  T L+F + + +N AD++   F+ EHGDG+ 
Sbjct  167   QLTYAFLPENQLSDVVKTVFSRAFERWSEVTTLTFTEISSFNRADIRIGFFSREHGDGEP  226

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYY---PY-GVDIQSVVTHETGHLLGLGH  943
             FDG  G +AH+F P  G CH D EE+W   G +    P   VD++SV  HE GH+LGLGH
Sbjct  227   FDGVLGTLAHAFSPPTGRCHFDGEENWVIDGDFLNGAPLSAVDLESVAVHEIGHILGLGH  286

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+MYP I  G  K  L +DDI GI+ LY
Sbjct  287   SSVEEAIMYPSISSGTRKVELADDDIMGIQELY  319



>ref|XP_004139164.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66657.1| hypothetical protein Csa_1G654860 [Cucumis sativus]
Length=314

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 160/278 (58%), Gaps = 27/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN---NLPYNNTSPEAN-YFSDQLESAVRTFQANF  448
             LQG KKGD VKG+ +LK + + +GY+N   N   +    +AN  F D+LESA++T+Q  F
Sbjct  37    LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDIDANDIFDDRLESAIKTYQQYF  96

Query  449   NLNSTGVLDSNTVSLMMKPRCGVPDII----GR-------------RHRL---VPQYSFL  568
             +LN TG L++ T+S +  PRCG PDII    GR              H L   V  Y+F 
Sbjct  97    HLNPTGSLNAETLSQLATPRCGNPDIINETTGRMLSEDIDNVSSHDHHHLPHAVSHYAFF  156

Query  569   PGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
             PG  RWP  K  L+YA+  GT  +       A   W+  T   F   T+Y  ADLK   +
Sbjct  157   PGRLRWPSTKYRLTYAFLPGTRADAKAPVARAFATWARNTHFKFTLVTNYRRADLKIGFY  216

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHL  928
              G HGDG  FDGPGG +AH+F PT+G  H DS E WA       Y  D+Q+V  HE GHL
Sbjct  217   RGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWAVGAVRGRY--DLQTVALHEIGHL  274

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS V+ A+MYPYI  G TK  L+ DDI+GIK LY
Sbjct  275   LGLGHSTVKNAIMYPYIKSGSTKG-LNVDDIKGIKVLY  311



>ref|XP_004297959.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 154/268 (57%), Gaps = 18/268 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+   KGD+VKG+++LK YL +FG ++ +  N+     ++F   LE AVRT+Q NFNLN 
Sbjct  48    LKCCHKGDKVKGIHDLKKYLHKFGCLDYM--NHIHSNDDHFDQFLEEAVRTYQLNFNLNP  105

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG-----------RRHRLVP---QYSFLPGNPRWPDDK  598
             TG LD  T+S+MMKP CGVPDII             +HR +     Y+   G+ +WP  K
Sbjct  106   TGTLDEKTISMMMKPHCGVPDIINGTTSMRSAKIKHQHRAIHTTVHYTLPDGDYKWPPSK  165

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L++ +  GTP     S  +A   W   T   F+   +  NADLK      +HGDG  F
Sbjct  166   YQLTFGFLPGTPSAATGSIVQAFAIWQKSTHFKFSQSNNPQNADLKISFHKRDHGDGDPF  225

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGG +AH+  PT G  H D+EE+W+      P  +D  SV  HE GHLLGLGHS VE 
Sbjct  226   DGPGGQLAHAAYPTGGTLHYDAEETWSAGAK--PGAMDYGSVGLHEIGHLLGLGHSSVEG  283

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             AVM+P +  G   + L  DDIQGIKALY
Sbjct  284   AVMFPTVTEGVAYKGLHQDDIQGIKALY  311



>ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52413.1| hypothetical protein Csa_5G632120 [Cucumis sativus]
Length=319

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 162/273 (59%), Gaps = 22/273 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L GS+KGD+V+G+++LK YL +FGY+N     ++    + F + LE+A++T+Q N+NL  
Sbjct  46    LYGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENNDDEFDELLETAIKTYQKNYNLKV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------GRRHRL----------VPQYSFLPGNPR  583
             TG LD+ T++ M KPRCGV DII          +R +L          V  ++F  GNP+
Sbjct  106   TGTLDAMTIAQMSKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHSVSHFAFFDGNPK  165

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K+ L+Y +  GTP E V+    A   W+  +  +F+   D   +D+      G+HG
Sbjct  166   WPATKSHLTYGFLPGTPSETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFETGDHG  225

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             DG  FDG GG++AH+F P++G  HLD++ESWA          D+++V  HE GHLLGL H
Sbjct  226   DGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN--GVVSDSFDLETVALHEIGHLLGLQH  283

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S  E A+M+P +  G +K  L  DDI GIKALY
Sbjct  284   SSTEGAIMWPQVPVGASKG-LHVDDIAGIKALY  315



>ref|XP_011072962.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 164/271 (61%), Gaps = 23/271 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNT---SPEANYFSDQLESAVRTFQAN  445
             K L G++KG   KG+ +LK YL  FGY+N+   NNT       ++F D LE A++++Q  
Sbjct  47    KTLIGTQKGTTSKGISQLKKYLSHFGYMNH--KNNTILTHQTDDFFDDNLELAIKSYQTF  104

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDI--IGRRHRL---VP----QYSFLPGNPRWPDDK  598
             F L   G++D+N V+ M  PRCGVPD   + R H+L   +P     Y+F PG P+WP  K
Sbjct  105   FKLKVNGIMDANIVAKMSHPRCGVPDSFNLNRSHKLYLRIPTLASHYTFFPGEPKWPPTK  164

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
              +L+Y++  G P    +S   A Q W+  T   F+ +T+Y+ AD+K      +HGDG  F
Sbjct  165   RSLTYSFPLGGPTNVNSSILHATQIWASVTPFRFSYRTNYDQADIKISFQYRDHGDGYPF  224

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQ---VGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             DGPGGI+AH+F P++G  H D +E W     +G +     D+Q+V  HE GH+LGLGH+ 
Sbjct  225   DGPGGILAHAFAPSDGRLHFDGDERWVDGVTLGAF-----DMQTVGLHELGHVLGLGHTN  279

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
                A+MYPYIG G  ++VL  DDI GIKALY
Sbjct  280   DTGAIMYPYIGDG-LRKVLGQDDINGIKALY  309



>ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=364

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 154/276 (56%), Gaps = 24/276 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K L G + GD+++GL +LK Y   FGYI N   N T    + F D LESA++T+Q NFNL
Sbjct  48    KRLAGCRAGDKLEGLSKLKNYFHYFGYIPNTLSNFT----DDFDDALESAIKTYQQNFNL  103

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPD  592
             N TG LD  T+  +++PRCG  DII     +              V  YSF PG PRWPD
Sbjct  104   NVTGELDEQTLDQLVRPRCGNADIINGSTTMNSGKWQTTTTSFHAVGHYSFFPGTPRWPD  163

Query  593   DKNALSYA-WGDGTPYEFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              K  L+YA W      E   S    A  +WS    ++F +   YN AD++   F+G+HGD
Sbjct  164   SKRDLTYAFWPSNQLTEVEKSVFTRAFDRWSTVIPMNFTETESYNVADIRIGFFSGDHGD  223

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLG  934
             G+ FDG  G +AH+F P  G  HLD EE+W   G          VD++SV  HE GHLLG
Sbjct  224   GEPFDGVLGTLAHAFSPPSGRFHLDGEENWVVSGDISSSTISSAVDLESVAVHEIGHLLG  283

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE A+MYP I     K  L NDDIQGI+ LY
Sbjct  284   LGHSSVEEAIMYPTIPSRTRKIELANDDIQGIQYLY  319



>ref|XP_002280805.2| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=335

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 167/279 (60%), Gaps = 29/279 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPE------ANYFSDQLESAVRTF  436
             K LQG  K D+VKG+++LK YL++FGY   L YN+ S         +YF D LESA++++
Sbjct  61    KDLQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSY  117

Query  437   QANFNLNSTGVLDSNTVSLMMKPRCGVPDIIG---------RRH-------RLVPQYSFL  568
             Q N++L +TG LDS TVS MM+ RCGV DI+          +RH         V  Y F 
Sbjct  118   QTNYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFF  177

Query  569   PGNPRWPDDKNA-LSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             PG+PRWP   NA L+YA+  GTP E       A  +W+  T  +F    D+ NA+L    
Sbjct  178   PGSPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISF  237

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGH  925
              +  HGD   FDGPGG IAH++ PT+G  H D++E W+ VG   P  +D+++V  HE GH
Sbjct  238   HSLLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEWS-VGA-VPGALDVETVALHEIGH  295

Query  926   LLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LLGLGHS V  A+M+P I  G TK  L  DDI+GI+ALY
Sbjct  296   LLGLGHSSVREAIMFPSISTGVTKG-LHRDDIEGIRALY  333



>ref|XP_006602365.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=368

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 155/283 (55%), Gaps = 36/283 (13%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY---FSDQLESAVRTFQANFN  451
               G  +GD+  GL  LK Y +RFGYI + P     P +N+   F D LESA++T+Q NFN
Sbjct  43    FTGCHRGDKYDGLANLKSYFERFGYIPHAP-----PPSNFSDEFDDALESAIKTYQKNFN  97

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIG------------------RRHRLVPQYSFLPGN  577
             LN TGVLD  T+  ++ PRCGV DII                    +   V  +S  PG 
Sbjct  98    LNVTGVLDDATLQKIVLPRCGVADIINGTTTMNAGKENETASFSKPKFHTVAHFSLFPGM  157

Query  578   PRWPDDKNALSYAWGDGTPYEFVTSTK----EALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             PRWP+    L+YA+  G   E   + K     A  +W+  T L F +   Y  AD++   
Sbjct  158   PRWPEGTQELTYAFFPGN--ELSDTVKGVFATAFARWAEVTSLKFRESASYFGADIRIGF  215

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTH  913
             F+G+HGDG+ FDG  G +AH+F PT G  HLD+ E W   G       P  VD++SV  H
Sbjct  216   FSGDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTLSALPTAVDLESVAVH  275

Query  914   ETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             E GHLLGLGHS VE AVM+P I   + K VL  DDI+GI+ LY
Sbjct  276   EIGHLLGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  318



>emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera]
Length=305

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 160/263 (61%), Gaps = 10/263 (4%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFN  451
             K LQG  KGD+V+G+++LK YL +FGY++ +    +T    + F D +ESA++T+Q N++
Sbjct  44    KDLQGCHKGDKVEGIHKLKKYLGQFGYLSYSHSKYHTHANDDDFDDLVESAIKTYQTNYH  103

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPG------NPRWPDDKNALSY  613
             LN+TG LDS TVS M+KPRCG  DII   + +               +PRWP  K  L+Y
Sbjct  104   LNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRSPRWPPSKTYLTY  163

Query  614   AWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGG  793
             A+  GTP   ++    A  QW   T  +F    D+ +AD+       +HGDG  FDGPGG
Sbjct  164   AFLPGTPSWAMSPVSRAXXQWDSATHFTFGXIQDHTSADMTISFHRLDHGDGXPFDGPGG  223

Query  794   IIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYP  973
              IAH+F PT G  H D +E+W+ +G   P  +D+++V  HE GHLLGLGHS V+ A+M+P
Sbjct  224   TIAHAFAPTNGRFHYDGDETWS-IGA-VPNAMDLETVAVHEIGHLLGLGHSSVQNAIMFP  281

Query  974   YIGFGETKRVLDNDDIQGIKALY  1042
              I  G TK  L  DDIQGI ALY
Sbjct  282   SISSGVTKG-LHEDDIQGIXALY  303



>ref|XP_006856883.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
 gb|ERN18350.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
Length=357

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 157/271 (58%), Gaps = 27/271 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYI-NNLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L G  KG+ V GL  +K YL  FGYI  NL + +       F D LESA++T+Q NF LN
Sbjct  43    LSGCHKGEHVPGLTAIKQYLHTFGYIPQNLNFTDD------FDDSLESAIKTYQQNFRLN  96

Query  458   STGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSY  613
             +TG LDS TV  MM PRCGVPD++         R    V +Y+F PGNPRWP  K  L+Y
Sbjct  97    ATGSLDSGTVRQMMSPRCGVPDVVNGTTTMMRSRGLSSVMRYTFFPGNPRWPVWKRNLTY  156

Query  614   AWGDGTPYEFVTS--------TKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             A   GT   F TS           A  +W+  T LSF + T Y+ AD++   F G+HGDG
Sbjct  157   AIRPGT---FSTSDDTAARAVFARAFARWAAATTLSFTESTSYSTADIRIAFFGGDHGDG  213

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             + FDG  G +AH+F P +G  HLD+ E W   G     G+D++SV  HE GH+LGLGHS 
Sbjct  214   EPFDGALGTLAHAFSPPDGRLHLDAAELWVVSGNSR-LGIDLESVAVHEIGHVLGLGHSS  272

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              EAA+M+P I  G  +  L  DDI GI+ LY
Sbjct  273   DEAAIMFPTITTGTRRVELATDDIMGIQELY  303



>ref|XP_003530663.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=370

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/281 (42%), Positives = 153/281 (54%), Gaps = 32/281 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY---FSDQLESAVRTFQANFN  451
               G  +GD+  GL  LK Y +RFGY  + P     P +N+   F D LESA++T+Q NFN
Sbjct  50    FTGCHRGDKYDGLANLKSYFERFGYFPHAP-----PSSNFSDEFDDALESAIKTYQKNFN  104

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIG------------------RRHRLVPQYSFLPGN  577
             LN TGVLD  TV  ++ PRCGV DII                    +   V  ++  PG 
Sbjct  105   LNVTGVLDDATVQQIVLPRCGVADIINGTTTMNAAKENETASFSKPKFHTVAHFTLFPGM  164

Query  578   PRWPDDKNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFA  751
             PRWP+    L+YA+  G+G           A  +W+  T L F +   Y  AD++   F+
Sbjct  165   PRWPEGTQELTYAFFPGNGLSDAVKGVFAAAFARWAEVTSLKFRETASYFGADIRIGFFS  224

Query  752   GEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHET  919
             G+HGDG+ FDG  G +AH+F PT G  HLD+ E W   G       P  VD++SV  HE 
Sbjct  225   GDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTRSALPTAVDLESVAVHEI  284

Query  920   GHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHLLGLGHS VE AVM+P I   + K VL  DDI+GI+ LY
Sbjct  285   GHLLGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  325



>ref|XP_010273763.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=348

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 160/278 (58%), Gaps = 26/278 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN--YFSDQLESAVRTFQANFNL  454
             L+G  KG +VKG+++LK YL++FGY+N  P N +   A+   F + LESAV+T+Q N++L
Sbjct  69    LEGCHKGQDVKGVHQLKRYLEKFGYLNYPPGNKSLTHADDEEFDELLESAVKTYQLNYHL  128

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------GRRHR----------LVPQYSFLPGNP  580
               TG LDS TV  MM PRCG+PDII        G+++            V  Y+F P NP
Sbjct  129   KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHAPSSLHTVSHYTFFPNNP  188

Query  581   RWPDDKNALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
             RWP  K  L+Y +          E  +    A  +W   +  +F +  +   +D+     
Sbjct  189   RWPPSKTHLTYRFRSSASVVGLQELRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFH  248

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHL  928
              G+HGDG +FDG GG +AH+F PT G  H D++ESW+   P  P   D++SV  HE GHL
Sbjct  249   RGDHGDGYSFDGRGGTLAHAFAPTIGRFHYDADESWS-TNPQ-PGVFDLESVAVHEIGHL  306

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS V  A+MYP I  G  KR L  DD+QGI+ALY
Sbjct  307   LGLGHSSVPEAIMYPSIPAGAVKRNLHGDDVQGIRALY  344



>dbj|BAJ93963.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89432.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 152/269 (57%), Gaps = 19/269 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GDE +GL  LK YL RFGY+   P        + F   +E+A+RT+Q NF L +
Sbjct  52    LSGCHFGDERQGLARLKDYLSRFGYLPAPPAKFN----DMFDADMETAIRTYQHNFGLEA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII------GRRHRLVPQYSFLPGNPRWPDDKNALSYAWG  622
             TG LD+ TV+ MM PRCGV DII      G+       YS+ PG+P WP  K +L YA  
Sbjct  108   TGQLDAATVAKMMSPRCGVADIINGTSSMGKTVHGRNLYSYFPGSPSWPRSKKSLRYAIT  167

Query  623   DGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
               T      +T       A  +WS  T L+F +    ++AD+     +G+HGDG+AFDGP
Sbjct  168   AATETTIDRATLSRVFASAFARWSAATTLNFTETASASDADITIGFHSGDHGDGEAFDGP  227

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
              G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLLGLGHS VE
Sbjct  228   LGTLAHAFSPTDGRFHLDASEAWVAGGDVSRASLDAAVDLESVAVHEIGHLLGLGHSSVE  287

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+MYP I     K  L NDD+ GI++LY
Sbjct  288   GAIMYPTITSRTQKVELANDDVVGIQSLY  316



>ref|XP_006482471.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=254

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 155/255 (61%), Gaps = 23/255 (9%)
 Frame = +2

Query  338   LKRFGYINNLPYNNTSPEANY--FSDQLESAVRTFQANFNLNSTGVLDSNTVSLMMKPRC  511
             +++FGY+N   Y N S  AN   F + LESA++T+Q N++L STG+LD+NTV+ M  PRC
Sbjct  1     MEKFGYLNYDNYKNQSKHANDDDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRC  60

Query  512   GVPDII--------GRRH-------RLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFV  646
             GV DI+        G++        R V  YSF  G+PRWP  K +L+YA+  GT  + +
Sbjct  61    GVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAI  120

Query  647   TSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD---GPGGIIAHSFQP  817
             T    A Q W+  T+  F+   D+ NAD+K    +G+HGDG  FD   GP GIIAH+F P
Sbjct  121   TPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAP  180

Query  818   TEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETK  997
             T G  H D++E WA VG       D+++V  HE GHLLGL HS VE A+MYP I  G  K
Sbjct  181   TNGRFHYDADEPWA-VGAVQG-AFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAG-VK  237

Query  998   RVLDNDDIQGIKALY  1042
             + L  DDIQGI+ LY
Sbjct  238   KGLHGDDIQGIRDLY  252



>gb|KDO82628.1| hypothetical protein CISIN_1g021444mg [Citrus sinensis]
Length=312

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 150/272 (55%), Gaps = 32/272 (12%)
 Frame = +2

Query  308   VKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDSNTV  487
             + GL +LK Y   FGYI +LP N T    + F D LESAV+T+Q NFNL  TG LDS T+
Sbjct  1     MDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEPTGQLDSQTM  56

Query  488   SLMMKPRCGVPDII---------------------GRRHRLVPQYSFLPGNPRWPDDKNA  604
               +++PRCG PDI+                     G  H  V  YSF PG PRWP +K  
Sbjct  57    QHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHS-VGHYSFFPGMPRWPSNKRD  115

Query  605   LSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
             L+YA+   +    E       A  +WS  T L+F     Y  AD++   F G+HGDG+ F
Sbjct  116   LTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPF  175

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWA----QVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             DGP G +AH+F P  G  HLD +E+W              +D++SV  HE GHLLGLGHS
Sbjct  176   DGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHS  235

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+MYP I  G  K  L NDDIQGI+ALY
Sbjct  236   SVEDAIMYPSISSGSRKVELANDDIQGIQALY  267



>ref|XP_010278837.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=319

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/278 (42%), Positives = 160/278 (58%), Gaps = 26/278 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNN--TSPEANYFSDQLESAVRTFQANFNL  454
             L+G  KG ++KG+++LK YL++FGY+N  P N   T  + + F + LESAV+T+Q N++L
Sbjct  40    LEGCHKGQDLKGVHQLKRYLEKFGYLNYPPGNKSLTHADDDEFDELLESAVKTYQLNYHL  99

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------GRRH----------RLVPQYSFLPGNP  580
               TG LDS TV  MM PRCG+PDII        G+++            V  Y+F P NP
Sbjct  100   KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHGPSSLHTVSHYTFFPNNP  159

Query  581   RWPDDKNALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
             RWP  K  L+Y +          +  +    A  +W   +  +F +  +   +D+     
Sbjct  160   RWPPSKTHLTYRFRSSVSVVGLQQLRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFH  219

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHL  928
              G+HGDG +FDG GG +AH+F PT G  H D++ESW+   P  P   D++SV  HE GHL
Sbjct  220   RGDHGDGYSFDGRGGTLAHAFAPTVGRFHYDADESWS-TNPQ-PGMFDLESVAVHEIGHL  277

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS V  A+MYP I  G  KR L  DD+QGI+ALY
Sbjct  278   LGLGHSSVPEAIMYPSIPDGAVKRNLHGDDVQGIRALY  315



>emb|CDP00221.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 153/274 (56%), Gaps = 26/274 (9%)
 Frame = +2

Query  287   GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             G   G +V GL +LK Y +RFGYI+    N T    + F D L SA++T+Q NFNLN TG
Sbjct  61    GCHTGQKVDGLAKLKQYFQRFGYIDTSLLNFT----DDFDDYLGSALKTYQRNFNLNETG  116

Query  467   VLDSNTVSLMMKPRCGVPDII---------------GRRHRLVPQYSFLPGNPRWPDDKN  601
              LD+ T+  + +PRCG PDI+                 R   V  YSF PG PRWP  K 
Sbjct  117   ELDAPTLQHITRPRCGNPDIVNGTTSMNSGKVANANSLRPHTVAHYSFFPGMPRWPAGKT  176

Query  602   ALSYAWGDGTPYEFVTST--KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
              L+YA+      E V       A  +WS  T L+F +   ++ AD+K  +F+G+HGDG+ 
Sbjct  177   DLTYAFLPENQVEDVVRRVFANAFDRWSEVTTLNFTETASFSLADIKIGIFSGDHGDGEP  236

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVG-----PYYPYGVDIQSVVTHETGHLLGLG  940
             FDG  G +AH+F P  G  HLD +E+W   G     P     VD++SV  HE GHLLGLG
Sbjct  237   FDGVLGTLAHAFSPPSGRLHLDGDENWVIDGDFFSAPSLASAVDLESVAVHEIGHLLGLG  296

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS VE A+MYP IG    K  L  DDIQGI+ LY
Sbjct  297   HSSVEEAIMYPSIGSATRKVELTKDDIQGIQMLY  330



>ref|XP_003560867.1| PREDICTED: metalloendoproteinase 1-like [Brachypodium distachyon]
Length=383

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 153/272 (56%), Gaps = 18/272 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GDE +GL +LK YL  FGY+   P +N S   + F   +E A+RT+Q NF L+ 
Sbjct  60    LSGCHFGDERQGLGKLKDYLSHFGYLPTPPPSNDSKFNDMFDADMEQAIRTYQQNFGLDV  119

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ--------YSFLPGNPRWPDDKNALSYA  616
             TG LD +TV+ MM PRCGV DII     +           YS+ PG+P WP  K +L YA
Sbjct  120   TGQLDPSTVTKMMSPRCGVADIINGTSTMAKSASIHGRNLYSYFPGSPSWPRSKKSLKYA  179

Query  617   WGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTD-YNNADLKYHLFAGEHGDGQAF  778
                 +      +T       A  +WS  T L+F + TD   +AD+      GEHGDG+AF
Sbjct  180   ITATSATTIDRATLSQVFARAFARWSEATTLNFTETTDAAGDADITIGFHGGEHGDGEAF  239

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY----GVDIQSVVTHETGHLLGLGHS  946
             DGP G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLLGLGHS
Sbjct  240   DGPLGTLAHAFSPTDGRFHLDAAEAWVAGGDVSRAKADDAVDLESVAVHEIGHLLGLGHS  299

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+MYP I     K  L +DD+ GI++LY
Sbjct  300   AVEGAIMYPTITSRTRKVDLASDDVVGIQSLY  331



>ref|XP_007010134.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY18944.1| Matrixin family protein, putative [Theobroma cacao]
Length=288

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 156/272 (57%), Gaps = 21/272 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEA------NYFSDQLESAVRTF  436
             + LQG  KG  V+GL ELK Y K+ GY+N   Y++ S  A      N F D LESA++ +
Sbjct  19    QSLQGCHKGHTVEGLCELKQYFKKLGYLN---YDHASYNAYKHGNDNEFDDHLESAIKAY  75

Query  437   QANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL------VPQYSFLPGNPRWPDDK  598
             Q N+ LN+TG LD++TV  MMK RCG+ D++   +          +Y F  GNP+WP  K
Sbjct  76    QVNYKLNATGNLDADTVKQMMKSRCGIADVMNSNNSRSIYGIGASRYEFFLGNPKWPLSK  135

Query  599   NALSYAWGDGTPYEFVTSTK----EALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
               L+Y +          + +     A Q+W+  +R +F +  +Y  AD++    +GEHGD
Sbjct  136   THLTYNFHSSVEVPLAENVRSVCVRAFQRWANVSRFTFEEVAEYYVADIEIGFHSGEHGD  195

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G  FDGP G +AH+  PT+G  H D++E W+   P  P  VD++SV  HE GHLLGL HS
Sbjct  196   GNPFDGPQGTLAHASPPTDGKLHYDADEDWS-TNP-GPDEVDLESVTVHEIGHLLGLQHS  253

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              V  AVMY Y   G  KR L  DD+ GI+ALY
Sbjct  254   LVPEAVMYAYFDSGMIKRKLHMDDVHGIRALY  285



>dbj|BAJ98922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 151/269 (56%), Gaps = 19/269 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GDE +GL  LK YL RFGY+   P        + F   +E+A+RT+Q NF L +
Sbjct  52    LSGCHFGDERQGLARLKDYLSRFGYLPAPPAKFN----DMFDADMETAIRTYQHNFGLEA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII------GRRHRLVPQYSFLPGNPRWPDDKNALSYAWG  622
             TG LD+ TV+ MM PRCGV DII      G+       YS+ PG+P WP  K +L YA  
Sbjct  108   TGQLDAATVAKMMSPRCGVADIINGTSSMGKTVHGRNLYSYFPGSPSWPRSKKSLRYAIT  167

Query  623   DGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
               T      +T       A  +WS  T L+F +    ++AD+     +G+HGDG+AFDGP
Sbjct  168   AATETTIDRATLSRVFASAFARWSAATTLNFTETASASDADITIGFHSGDHGDGEAFDGP  227

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
              G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLLGLGH  VE
Sbjct  228   LGTLAHAFSPTDGRFHLDASEAWVAGGDVSRASLDAAVDLESVAVHEIGHLLGLGHLSVE  287

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+MYP I     K  L NDD+ GI++LY
Sbjct  288   GAIMYPTITSRTQKVELANDDVVGIQSLY  316



>ref|XP_010510985.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=367

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 154/271 (57%), Gaps = 20/271 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+++ GL +LK Y  RFGYI+     N + +   F D L+SA+ T+Q NFNL  
Sbjct  51    LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVENCTDD---FDDVLQSAIDTYQKNFNLKV  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LDS+T+  ++KPRCG PD+I        GR+ R   +YSF PG PRWP  K  L+YA
Sbjct  108   TGKLDSSTLRQIVKPRCGNPDMIDGFSEMNGGRKLRATERYSFFPGKPRWPKRKRYLTYA  167

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +WS  T L+F        AD+    F+GEHGDG+ FDG  
Sbjct  168   FVTQNNLTEEIKRVFARAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  227

Query  791   GIIAHSFQPTEGICHLDSEESW-------AQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             G +AH+  P  G+ HLDS+E W       ++        VD++SVV HE GHLLGLGHS 
Sbjct  228   GTLAHASSPPTGMLHLDSDEDWLISDGGISRRISSVTSVVDLESVVVHEIGHLLGLGHSS  287

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             VE A+M+P I  G  K  L  DDI+GI+ LY
Sbjct  288   VEDAIMFPAISGGHRKVELAKDDIEGIQHLY  318



>ref|XP_010414620.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=369

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 156/272 (57%), Gaps = 22/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+++ GL +LK Y  RFGYI+    +N + +   F D L+SA+ T+Q NFNL  
Sbjct  54    LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVDNCTDD---FDDVLQSAIDTYQKNFNLKV  110

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LDS+T+  ++KPRCG PD+I        GR+ R   +YSF PG PRWP  K  L+YA
Sbjct  111   TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  170

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +WS  T  +F        AD+    F+GEHGDG+ FDG  
Sbjct  171   FVPQNNLTDEVKRVFARAFTRWSEVTPFNFTRSESLVGADIVIGFFSGEHGDGEPFDGAM  230

Query  791   GIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G +AH+  P  G+ HLDS+E W         ++ P     VD++SVV HE GHLLGLGHS
Sbjct  231   GTLAHASSPPTGMLHLDSDEDWLISDGGISRRILPVTSV-VDLESVVVHEIGHLLGLGHS  289

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+M+P I  G+ K  L  DDI+GI+ LY
Sbjct  290   SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  321



>gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum]
Length=365

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 157/278 (56%), Gaps = 29/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G +V GL ++K Y   FGYI +L     S   + F D LESA++T+Q NFNLN+
Sbjct  47    LLGCHAGQKVDGLAKIKKYFYNFGYIPSL-----SNFTDDFDDALESALKTYQQNFNLNT  101

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------------GRRHRLVPQYSFLPGNPRWPDDK  598
             TGVLD+ T+  +++PRCG  D++               +    V  +SF PG PRWPD K
Sbjct  102   TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  599   NALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G      +    A  +WS  T LSF +   + +AD+K   FAG+H DG+
Sbjct  162   TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHL  928
              FDGP G +AH+F P  G  HLD +E+W   G     G        VD++SV  HE GHL
Sbjct  222   PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGHL  281

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++M+P +  G  +  L NDDIQG++ LY
Sbjct  282   LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_009758591.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana sylvestris]
Length=365

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 157/278 (56%), Gaps = 29/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G +V GL ++K Y   FGYI +L     S   + F D LESA++T+Q NFNLN+
Sbjct  47    LLGCHAGQKVDGLAKIKKYFYNFGYIPSL-----SNFTDDFDDALESALKTYQQNFNLNT  101

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------------GRRHRLVPQYSFLPGNPRWPDDK  598
             TGVLD+ T+  +++PRCG  D++               +    V  +SF PG PRWPD K
Sbjct  102   TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  599   NALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G      +    A  +WS  T LSF +   + +AD+K   FAG+H DG+
Sbjct  162   TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHL  928
              FDGP G +AH+F P  G  HLD +E+W   G     G        VD++SV  HE GHL
Sbjct  222   PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGHL  281

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++M+P +  G  +  L NDDIQG++ LY
Sbjct  282   LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_010039144.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=315

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 158/278 (57%), Gaps = 28/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTS-----PEANYFSDQLESAVRTFQAN  445
             LQG  KG+   G+ ELK YL++FGY+N   YN +       + + F D LE AV+T+Q N
Sbjct  40    LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  96

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPG  574
             ++LN TG LD  T S MM+PRCGV DII    R+                 V  Y+FL G
Sbjct  97    YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  156

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             +PRWP     L+Y +  GTP         A   W+  TR +F+   D+  A+++     G
Sbjct  157   SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARG  216

Query  755   EHGDG--QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHL  928
             +HGDG   +FDGPGG +AH+F PT G+ H D++E WA   P      ++++V  HE GHL
Sbjct  217   DHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHL  276

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+MY  I  G TK  L  DDIQGIKALY
Sbjct  277   LGLGHSDVEGAIMYSSIAPGTTKG-LHADDIQGIKALY  313



>ref|XP_006448956.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
 gb|ESR62196.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
Length=314

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 158/276 (57%), Gaps = 29/276 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSP-------------EANYFSDQLES  421
              QGS+KGD+VKG+++L+ YL+  GYIN    NN SP             E +YF + LES
Sbjct  43    FQGSQKGDKVKGIHQLRKYLQSLGYINQ---NNISPSISLDNSDKESHIEDDYFGEDLES  99

Query  422   AVRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVP---------QYSFLPG  574
             A++T+Q NFNLN+TG LD  T+S M +PRCG+PDII    R+            Y+F  G
Sbjct  100   AIKTYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSADKKYDIHYAFFEG  159

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
              PRWP  K  +++A+  GT  +     + AL  WS W   +F    DY NAD+K     G
Sbjct  160   -PRWPLTKKTVTFAFQPGTRADIHEPVRVALLLWSNWAPFAFEGSNDYENADIKISFQRG  218

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG  FDGP   +AH+F     + H + + +W  V      G D+Q+V  HE GH+LG
Sbjct  219   DHGDGTPFDGPWHTLAHAFSDPYAVVHFNGDVNW--VMGTVKGGFDMQTVALHELGHVLG  276

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             L HS V+AA M+P    G TK  L++DDI+ +K LY
Sbjct  277   LSHSSVKAASMWPSTRAGTTKG-LNDDDIRRMKMLY  311



>ref|XP_009624303.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=365

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 158/278 (57%), Gaps = 29/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G +V GL ++K Y   FGYI +L     S   + F D LESA++T+Q NFNLN+
Sbjct  47    LLGCHAGQKVDGLAKIKKYFYNFGYIPSL-----SNFTDDFDDALESALKTYQQNFNLNT  101

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPDDK  598
             TGVLD+ T+  +++PRCG  D++     +              V  YSF PG PRWP  K
Sbjct  102   TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSPSMHTVAHYSFFPGRPRWPASK  161

Query  599   NALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G      +    A ++WS  T L+F++   + +AD+K   FAG+H DG+
Sbjct  162   TDLTYAFLPQNGLTDNIKSVFSRAFERWSEVTPLTFSETASFQSADIKIGFFAGDHNDGE  221

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHL  928
              FDGP G +AH+F P  G  HLD +E+W   G     G        VD++SV  HE GHL
Sbjct  222   PFDGPMGTLAHAFSPPGGHFHLDGDENWVINGVPIDEGNFFSILSAVDLESVAVHEIGHL  281

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++MYP +  G  +  L NDDIQG++ LY
Sbjct  282   LGLGHSSVEDSIMYPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_006363534.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=363

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 160/272 (59%), Gaps = 22/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G + G +V G+ ++K Y + FGYIN    +N + E   F D LESA++T+Q NFNLN+
Sbjct  48    LLGCQPGQKVDGIAKIKKYFQHFGYINTFTTSNFTDE---FDDTLESALKTYQRNFNLNA  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG+ D  T+  ++KPRCG  D++        G+ H  V  YSF PG P+WP+ K  L+Y+
Sbjct  105   TGLFDEPTIQNLIKPRCGNADVVNGTSTMNAGKPHT-VAHYSFFPGRPKWPESKTDLTYS  163

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    +  +    A  +WS  T LSF +   + +AD+K   F G+H DG+ FDGP 
Sbjct  164   FLPANNLTEDIKSVFSRAFDRWSEVTPLSFTEIASFQSADIKIGFFTGDHNDGEPFDGPM  223

Query  791   GIIAHSFQPTEGICHLDSEESW------AQVGPYYPY--GVDIQSVVTHETGHLLGLGHS  946
             G +AH+F P  G  HLD EE+W         G ++     VD++SV  HE GHLLGLGHS
Sbjct  224   GTLAHAFSPPAGHFHLDGEENWVVDGVPVNDGNFFSILSAVDLESVAVHEIGHLLGLGHS  283

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE ++MYP +  G  +  L +DD++G++ LY
Sbjct  284   SVEDSIMYPSLEAGIRRVELVDDDVKGVQELY  315



>emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=363

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 159/272 (58%), Gaps = 22/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G + G +V G+ ++K Y + FGYINNL   N + E   F D LESA++T+Q NFNL +
Sbjct  49    LLGCQPGQKVDGIAKIKKYFQHFGYINNLTSFNFTDE---FDDTLESALKTYQRNFNLKA  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TGVLD+ T+  ++KPRCG  D++        G+ H  V  YSF PG P+WP+ K  L+YA
Sbjct  106   TGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHT-VAHYSFFPGRPKWPEGKTDLTYA  164

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    +  +    A  +WS  T LSF +   + +AD+K     G+H DG+ FDGP 
Sbjct  165   FLPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPM  224

Query  791   GIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHLLGLGHS  946
             G +AH+F P  G  HLD EE+W   G     G        VD++SV  HE GHLLGLGHS
Sbjct  225   GTLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHS  284

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE ++MYP +  G  +  L  DDI+G++ LY
Sbjct  285   SVEDSIMYPSLESGIRRVELVEDDIKGVQELY  316



>ref|XP_008458917.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=295

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 157/266 (59%), Gaps = 14/266 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPE--ANYFSDQLESAVRTFQANFNL  454
             L G +KGD V+G++ +K YL R+GY+++    ++  E  +N F D LESAV+ +Q    L
Sbjct  33    LYGCRKGDNVEGIHSIKKYLHRYGYLSHNTNTSSHIELNSNTFDDTLESAVKLYQKWSKL  92

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRH---------RLVPQYSFLPGNPRWPDDKNAL  607
             N +G+LD  T+  + KPRCG+PD+I + +          +   Y+  PGN +WPD K  L
Sbjct  93    NVSGILDQQTLDQIFKPRCGLPDVIMKSNSNKNTEDDLEISSHYALFPGNQKWPDYKRHL  152

Query  608   SYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
             +Y + +  P +FV S  EA+++W+  +  +F+   D    D+      G+HGDG  FDGP
Sbjct  153   TYTFTNNFPIDFVPSVTEAMKEWAAHSLFTFSQAADDQVPDINISFQVGDHGDGVPFDGP  212

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVM  967
             GG++ H+F PT+G  HLD ++ W+         V++ +   HE GH+LGL HS V+ AVM
Sbjct  213   GGVVGHAFAPTDGRLHLDGDDKWS--AGLETQKVNVMNAALHELGHVLGLAHSTVQQAVM  270

Query  968   YPYIGFGETKRVLDNDDIQGIKALYP  1045
             +PYI     K + D DDI G+ ALYP
Sbjct  271   WPYIDVYALKALTD-DDIAGLTALYP  295



>emb|CBI34986.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 160/268 (60%), Gaps = 15/268 (6%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTS--PEANYFSDQLESAVRTFQANF  448
             K LQGSKKGD+V+G+++++ YL+RFGY+++      S     ++F D LESA++ FQ  +
Sbjct  37    KDLQGSKKGDKVEGIHKVRNYLQRFGYLSSTHSKTESQVDGDDHFDDDLESAIQAFQTYY  96

Query  449   NLNSTGVLDSNTVSLMMKPRCGVPD---------IIGRRH-RLVPQYSFLPGNPRWPDDK  598
             +L  TG+LD+ T +LM +PRCGVPD           G  H  +   ++F P NPRWP  +
Sbjct  97    HLKPTGILDAPTAALMSRPRCGVPDNPSVTNNTNSHGHSHLNIGTHFAFFPNNPRWPPGQ  156

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L Y    G+  E   +  +A   W+  ++ +F   +D   A+L       EHGDG  F
Sbjct  157   THLLYVLDSGSHSEAADAVGKAFGAWAAISKFTFEQTSDPTVANLNISFQIREHGDGSPF  216

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGG IAH+  PT+G  H D +E+W  VG      +D+Q+V THE GHLLGL HS VEA
Sbjct  217   DGPGGTIAHAAPPTDGRFHFDGDETWV-VGA-VANSIDLQTVATHEIGHLLGLAHSSVEA  274

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             A+M+ YI  G TK  L+ DDI GI ALY
Sbjct  275   AIMFAYIAPGATKG-LNQDDIAGITALY  301



>ref|XP_008458910.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=296

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/268 (40%), Positives = 160/268 (60%), Gaps = 21/268 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGY-INNLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L+GS+ G+ ++G+Y +K+YLKR+GY I N+P  +++   + F   LESA++TFQ   +LN
Sbjct  34    LKGSRIGNNIEGIYSVKLYLKRYGYLITNVPNTDSN---DTFDVLLESAIKTFQKYHSLN  90

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------VPQYSFLPGNPRWPDDKNA  604
              +GVLD  T++LM  PRCG+ DI+   + +              Y+FLPGNP+WP  K  
Sbjct  91    VSGVLDKETLTLMSLPRCGISDIVHNNNVMDNNIQMNSSSFHSHYTFLPGNPKWPISKYN  150

Query  605   LSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDG  784
             L Y + +G P +F      A+ QW+ ++   F++       D+ ++   G HGDG  FDG
Sbjct  151   LKYTFLEGFPNDFKEPVMNAMDQWALFSLFRFSETIGGEEVDITFNFVRGNHGDGHPFDG  210

Query  785   PGGIIAHSFQPTEGICHLDSEESWA--QVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
              GG++AH+F P +G  H D +E WA   VG +    +++  V  HE GH+LGL HS +  
Sbjct  211   KGGVLAHAFGPLDGRVHFDWDEDWADGSVGGF----INVGMVALHELGHVLGLAHSTIRD  266

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             A+M+PY+  GE  R L  DDI+GI+ LY
Sbjct  267   AIMWPYMHVGEQTRGLQFDDIEGIQTLY  294



>ref|XP_004237082.2| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=387

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 159/272 (58%), Gaps = 22/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G + G +V G+ ++K Y + FGYINNL   N + E   F D LESA++T+Q NFNL +
Sbjct  73    LLGCQPGQKVDGIAKIKKYFQHFGYINNLTSFNFTDE---FDDTLESALKTYQRNFNLKA  129

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TGVLD+ T+  ++KPRCG  D++        G+ H  V  YSF PG P+WP+ K  L+YA
Sbjct  130   TGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHT-VAHYSFFPGRPKWPEGKTDLTYA  188

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    +  +    A  +WS  T LSF +   + +AD+K     G+H DG+ FDGP 
Sbjct  189   FLPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPM  248

Query  791   GIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHLLGLGHS  946
             G +AH+F P  G  HLD EE+W   G     G        VD++SV  HE GHLLGLGHS
Sbjct  249   GTLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHS  308

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE ++MYP +  G  +  L  DDI+G++ LY
Sbjct  309   SVEDSIMYPSLESGIRRVELVEDDIKGVQELY  340



>ref|XP_004159085.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 159/266 (60%), Gaps = 14/266 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYI-NNLPYNNTSPE--ANYFSDQLESAVRTFQANFN  451
             L G +KGD V+G+  +K YL+R+GY+ +N+  ++   E  +N F D LESA++ +Q   +
Sbjct  33    LYGCRKGDNVEGIRNIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKWTH  92

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWPDDKNAL  607
             LN +GVLD  T+  M KPRCGV D+              +   Y+  PGNP+WPD K  L
Sbjct  93    LNVSGVLDQETLDQMFKPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNPQWPDYKRHL  152

Query  608   SYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
             +Y + +  P +FV S  EA+ +W+G +  +F++ +D  +AD+       +H DG  FDGP
Sbjct  153   TYVFTNNFPIDFVPSVTEAMARWAGQSLFTFSEASDAQSADINISFQIKDHADGLPFDGP  212

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVM  967
             GGI+ H+F PT+G  HLD ++SW+         V++ +   HE GH+LGL HS +  AVM
Sbjct  213   GGIVGHAFAPTDGRLHLDGDDSWS--AGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVM  270

Query  968   YPYIGFGETKRVLDNDDIQGIKALYP  1045
             +PYI     K  L++DDI G+ ALYP
Sbjct  271   WPYIESNALKN-LNDDDIAGLHALYP  295



>emb|CAN73130.1| hypothetical protein VITISV_030258 [Vitis vinifera]
Length=437

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 167/279 (60%), Gaps = 29/279 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPE------ANYFSDQLESAVRTF  436
             K LQG  K D+VKG+++LK YL++FGY   L YN+ S         +YF D LESA++++
Sbjct  47    KDLQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSY  103

Query  437   QANFNLNSTGVLDSNTVSLMMKPRCGVPDIIG---------RRH-------RLVPQYSFL  568
             Q N++L +TG LDS TVS MM+ RCGV DI+          +RH         V  Y F 
Sbjct  104   QTNYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFF  163

Query  569   PGNPRWPDDKNA-LSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             PG+PRWP   NA L+YA+  GTP E       A  +W+  T  +F    D+ NA+L    
Sbjct  164   PGSPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISF  223

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGH  925
              +  HGD   FDGPGG IAH++ PT+G  H D++E W+ VG   P  +D+++V  HE GH
Sbjct  224   HSLLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEWS-VGA-VPGXLDVETVALHEIGH  281

Query  926   LLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LLGLGHS V  A+M+P I  G TK  L  DDI+GI+A+Y
Sbjct  282   LLGLGHSSVREAIMFPSISTGVTK-GLHRDDIEGIRAVY  319



>ref|XP_011085796.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=314

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/275 (41%), Positives = 156/275 (57%), Gaps = 24/275 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K L+G  KG++ KG++ LK YL +FGY++  P N      + F D LESA++T+Q N+++
Sbjct  43    KHLEGCHKGNKTKGIHHLKHYLHQFGYLD-YP-NQIHANDDDFDDLLESALKTYQHNYHI  100

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ-------------------YSFLPGN  577
               TG LD+ T++ ++ PRCG PDI+   + ++P+                   YSF  GN
Sbjct  101   KPTGTLDTETITKLVTPRCGNPDIVNGTNTMLPRSKKTQNSSSSPSSIHTVSHYSFFRGN  160

Query  578   PRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             PRWP  K  L+Y +   TP   +     A ++W   T  +F+   +    DL       +
Sbjct  161   PRWPPSKTHLTYGFSANTPTNAIDPVVRAFEKWDSATHFTFSRAQNNQRPDLVIGFHRRD  220

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGL  937
             HGDG  FDGPGG IAH+F PT+G  H DSEE+W+ + P       +++V  HE GHLLGL
Sbjct  221   HGDGAPFDGPGGTIAHAFAPTDGRFHYDSEETWS-IAP-NANAFHLETVALHEIGHLLGL  278

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHS VE A+MY  I  G TK  L  DDIQGI+ LY
Sbjct  279   GHSSVEGAIMYARIQRGATKN-LHADDIQGIRVLY  312



>ref|XP_008353003.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=377

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 153/269 (57%), Gaps = 24/269 (9%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G++V GL +LK Y  RFGYI NLP  N + +   F   LE+A++T+Q NFNLN TG LD 
Sbjct  60    GEKVDGLSKLKKYFNRFGYIPNLPTTNLTDD---FDGDLEAALKTYQKNFNLNVTGELDG  116

Query  479   NTVSLMMKPRCGVPDII---------------GRRHRLVPQYSFLPGNPRWPDDKNALSY  613
              T+  ++KPRCG  DI+                 +   V  YSF PG P WP ++  L+Y
Sbjct  117   PTLEHLVKPRCGNADIVNGTTTMNSGKPASYNSTKFHSVSHYSFFPGTPVWPQNRRDLTY  176

Query  614   AW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
             A+   +    E  T    A Q+WS  T L+F + T + +AD+K   F G+HGDG+ FDG 
Sbjct  177   AFLPENELSDEVKTVFVGAFQRWSAATPLTFQETTSFYSADIKIGFFVGDHGDGEPFDGV  236

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVGPYYPY----GVDIQSVVTHETGHLLGLGHSGVE  955
              G +AH+F P  G  HLD +E+W   G    +     VD++SV  HE GHLLGLGHS VE
Sbjct  237   LGTLAHAFSPPSGRFHLDGDENWVITGDISKFSVESAVDLESVAVHEIGHLLGLGHSSVE  296

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+MYP I     K  L +DD+ GI+ LY
Sbjct  297   DAIMYPTISSRTKKVELASDDVLGIQTLY  325



>ref|XP_006431003.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
 gb|ESR44243.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
Length=254

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 154/255 (60%), Gaps = 23/255 (9%)
 Frame = +2

Query  338   LKRFGYINNLPYNNTSPEANYFS--DQLESAVRTFQANFNLNSTGVLDSNTVSLMMKPRC  511
             +++FGY+N   Y N S  A+     + LESA++T+Q N++L STGVLD+NTV+ M  PRC
Sbjct  1     MEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHLKSTGVLDANTVAKMTIPRC  60

Query  512   GVPDII--------GRRH-------RLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFV  646
             GV DI+        G++        R V  YSF P +P+WP  K +L+YA+  GT  + +
Sbjct  61    GVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWPASKFSLTYAFRPGTRSDAI  120

Query  647   TSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD---GPGGIIAHSFQP  817
             T    A Q W+  T+  F+   D+ NAD+K    +G+HGDG  FD   GP GIIAH+F P
Sbjct  121   TPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAP  180

Query  818   TEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETK  997
             T G  H D++E WA VG       D+++V  HE GHLLGL HS VE A+MYP I  G TK
Sbjct  181   TNGRFHYDADEPWA-VGAVQG-AFDLETVALHEIGHLLGLHHSSVEGAIMYPSISAGVTK  238

Query  998   RVLDNDDIQGIKALY  1042
               L  DDIQGI+ LY
Sbjct  239   G-LHGDDIQGIRDLY  252



>ref|XP_004297678.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=373

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 158/275 (57%), Gaps = 33/275 (12%)
 Frame = +2

Query  293   KKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVL  472
             + G++V GL +LK Y   FGYI NLP N T    + F D+L+SA++T+Q NFNLN TG L
Sbjct  58    RPGEKVDGLAKLKKYFNYFGYIPNLPTNCT----DEFDDELQSALKTYQKNFNLNVTGEL  113

Query  473   DSNTVSLMMKPRCGVPDIIG---------------RRHRLVPQYSFLPGNPRWPDDKNAL  607
             D  T++ +++PRCG PDI+                 +   V  YSF PG P WP  +  L
Sbjct  114   DDQTINHLVRPRCGNPDIVNGTTTMHSGKPVTFNNSKLHTVGHYSFFPGTPVWPTGRRDL  173

Query  608   SYAW------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             ++A+       D     FV     A Q+WS    ++F + T Y +AD+K   + G+HGDG
Sbjct  174   TFAFLPDNELSDEAKSVFV----GAFQKWSTVIPMTFTETTSYYSADIKIGFYVGDHGDG  229

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGL  937
             +AFDG  G +AH+F P  G+ HLD +E+W   G          +D++SV  HE GHLLGL
Sbjct  230   EAFDGVLGTLAHAFSPPSGLFHLDGDENWVIGGDISTSTVTSAIDLESVAVHEIGHLLGL  289

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHS VE ++MYP I     K  L NDD++GI++LY
Sbjct  290   GHSSVEESIMYPTITSKTKKVDLANDDVEGIQSLY  324



>ref|XP_008389591.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=387

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 158/273 (58%), Gaps = 32/273 (12%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G++V GL +LK Y  RFGYI NLP  N + E   F D LE+A++T+Q NFNLN TG LD 
Sbjct  60    GEKVDGLGKLKKYFNRFGYIPNLPTANLTDE---FDDDLEAALKTYQKNFNLNVTGELDG  116

Query  479   NTVSLMMKPRCGVPDII---------------GRRHRLVPQYSFLPGNPRWPDDKNALSY  613
              T+  ++KPRCG PDI+                 +   V  YSF PG P WP+++  L+Y
Sbjct  117   PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYSFFPGTPVWPENRRDLTY  176

Query  614   AW------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             A+       D     FV     A Q+WS  T L+F + T +++AD+K   F G+HGDG+ 
Sbjct  177   AFVSENELSDTVKAVFVG----AFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEP  232

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPY----YPYGVDIQSVVTHETGHLLGLGH  943
             FDG  G +AH+F P  G  HLD+EE+W   G          VD++SV  HE GHLLGLGH
Sbjct  233   FDGVLGTLAHAFSPPSGRFHLDAEENWVITGDISKTSVTSAVDLESVAVHEIGHLLGLGH  292

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+MYP I     K  L NDD+ GI++LY
Sbjct  293   SSVEEAIMYPTIASRTKKVELANDDVLGIQSLY  325



>gb|KDP45419.1| hypothetical protein JCGZ_09668 [Jatropha curcas]
Length=270

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 156/275 (57%), Gaps = 35/275 (13%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G++ K +++LK YL++FGY+N     + S ++N F   LESA++T+Q N+ L+ TG LDS
Sbjct  2     GEKNKKIHQLKEYLEQFGYMNK--KGSVSLDSNSFDGDLESAIKTYQLNYRLDPTGTLDS  59

Query  479   NTVSLMMKPRCGVPDIIGRRHRL------------------------VPQYSFLPGNPRW  586
              TV  M+KPRCGVPDII   +R+                        V  Y+F PG P+W
Sbjct  60    ETVETMIKPRCGVPDIINGTNRMQNGNISPSSSPSPSPSSSPNSFHTVSHYAFFPGTPKW  119

Query  587   PDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
                K  L+Y +G  TP   +    +A Q W+  +  +F   TD   AD+K      +HGD
Sbjct  120   EASKYHLTYEFGPQTPPIAIEVISQAFQTWANNSHFTFERGTDITTADIKIRFRKRDHGD  179

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGL  937
             G  FDG GGI+AH++ P +G  H D+EE+W   A+ G Y     D+ +V  HE GHLLGL
Sbjct  180   GIPFDGRGGILAHAYSPQDGRFHFDAEENWVTGAREGAY-----DLGTVALHEIGHLLGL  234

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              HS VE A+MYP I  G TK  L  DDI GI+ALY
Sbjct  235   EHSSVEEAIMYPTIPSGATKG-LHKDDIDGIQALY  268



>gb|ACJ24812.1| matrix metalloproteinase [Pinus taeda]
Length=364

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 159/265 (60%), Gaps = 16/265 (6%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L  + KGD ++GL +LK Y +RFGY++    NN + +   F + +ESAVRT+Q NF LN 
Sbjct  59    LTNACKGDRMQGLPDLKRYFRRFGYLSA--QNNVTED---FDEAVESAVRTYQKNFGLNV  113

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ--YSFLPGNPRWPDDKNALSYAWG----  622
             TGVLD  T+S +M PRCG  DII     +  +  + F PG+PRW  DK  LSYA+     
Sbjct  114   TGVLDEATISQLMVPRCGREDIINGSSAMRGRGLFPFFPGSPRWGPDKRVLSYAFSPDHE  173

Query  623   ---DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGG  793
                + +  E  T    A ++W+    ++F + +DY++AD+K   ++G+HGDG  FDGP G
Sbjct  174   VLSEISLAELSTVVGRAFKRWADVIPITFTESSDYSSADIKVGFYSGDHGDGHPFDGPLG  233

Query  794   IIAHSFQPTEGICHLDSEESWA--QVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVM  967
              +AHSF P +G  HLD+ ESW            +D++S+ THE GHLLGLGH+  +AAVM
Sbjct  234   TLAHSFSPPDGRFHLDAAESWTVDLSSDSAATAIDLESIATHEIGHLLGLGHTTEKAAVM  293

Query  968   YPYIGFGETKRVLDNDDIQGIKALY  1042
             YP I     K  L  DD+ G++ +Y
Sbjct  294   YPSIAPRTRKVDLVLDDVDGVQYVY  318



>ref|XP_008443669.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=313

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 159/279 (57%), Gaps = 29/279 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNT-----SPEANYFSDQLESAVRTFQAN  445
             LQG KKGD VKG+ +LK + + +GY+N+   N T     +   + F D+LE A++T+Q  
Sbjct  36    LQGCKKGDNVKGISKLKNFFRYYGYLNH-QINATGHLIDTDADDTFDDRLEFAIKTYQQY  94

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDII----GR-------------RHRL---VPQYSF  565
             F+LN TG L++ T+S +  PRCG PDII    GR              H L   V  Y+F
Sbjct  95    FHLNPTGSLNAETISQLATPRCGNPDIINESTGRMLSEHNNNDSSHDHHHLPHAVSHYAF  154

Query  566   LPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
              PG  RWP  K  L+YA+  GT  +       A   W+  T   F+  T+Y  ADLK   
Sbjct  155   FPGRRRWPSTKYRLTYAFLPGTRADAKAPVTRAFATWARNTHFKFSLITNYRRADLKIGF  214

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGH  925
             + G HGDG  FDGPGG +AH+F PT+G  H DS E WA       Y  D+Q+V  HE GH
Sbjct  215   YRGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWAVGAVKGRY--DLQTVALHEIGH  272

Query  926   LLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LLGLGHS V  A+MYPYI  G TK  L+ DDI+GIK LY
Sbjct  273   LLGLGHSTVRNAIMYPYIRSGSTKG-LNADDIKGIKVLY  310



>ref|XP_008458715.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=317

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 156/270 (58%), Gaps = 17/270 (6%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQ-LESAVRTFQANFN  451
             K LQG   GD  +G+ ++K YL+RFGYI      +++P  +   DQ LESA++T+Q N N
Sbjct  49    KNLQGCHLGDTKQGIQQIKKYLQRFGYITTNIQKHSNPIFDDTFDQVLESALKTYQTNHN  108

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHR-------------LVPQYSFLPGNPRWPD  592
             L  +G+LDSNT++ + KPRCGV D+I  + R              V  ++F  GN +WP 
Sbjct  109   LAPSGILDSNTLAQIAKPRCGVQDVIKNKKRNQNYKNNGHIHFHKVSHFTFFEGNLKWPS  168

Query  593   DKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
              K  LSY +    P E +     A  +WS  T   F+   DY  AD+K     GEHGD  
Sbjct  169   SKFHLSYGFLPNYPIEAIKPVSRAFSKWSLNTHFKFSHVVDYRKADIKISFERGEHGDNA  228

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGV  952
              FDG GG++AH++ PT+G  H D +E+W+ VG    Y  D+++V  HE GH+LGL HS +
Sbjct  229   PFDGVGGVLAHAYPPTDGRLHFDGDEAWS-VGAISGY-FDVETVALHEIGHILGLQHSTI  286

Query  953   EAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             E A+M+P I  G TK  L  DDI GIK LY
Sbjct  287   EEAIMFPSIPEGVTKG-LHGDDIAGIKTLY  315



>gb|KCW85819.1| hypothetical protein EUGRSUZ_B02562 [Eucalyptus grandis]
Length=374

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/278 (42%), Positives = 155/278 (56%), Gaps = 31/278 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G+   GL  LK Y + FGYI   P N T    + F D L SA++T+Q NFNL  
Sbjct  55    FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  110

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-------VPQYSFLPGNPRWPDD  595
             TG LD  T++ +++PRCG PDI+        G+   L       V  Y+F PG PRWPD 
Sbjct  111   TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  170

Query  596   KNALSYAWGDGTPYEFVTSTKEAL-----QQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             K+ L+YA+    P   ++  ++A+     Q+W+  T L+F     Y  AD+K   F+G+H
Sbjct  171   KSDLTYAF---LPANQLSDDEKAVFSRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDH  227

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHL  928
             GDG+AFDG  G +AH+F P  G  HLD +E+W   G          VD++SV  HE GHL
Sbjct  228   GDGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHL  287

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++MYP I     K  L  DD+QGI+ LY
Sbjct  288   LGLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  325



>ref|XP_010255281.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=378

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 118/276 (43%), Positives = 152/276 (55%), Gaps = 29/276 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G+ V GL  LK Y + FGYI + P N T    + F D  ESA++ +Q NFNLN+
Sbjct  59    FAGCHSGERVDGLAGLKKYFQHFGYIPDSPSNFT----DDFDDAFESALKKYQQNFNLNA  114

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPDDK  598
             TGVLD +T+  M++PRCGV DII     +              V  YSF P  P WP  K
Sbjct  115   TGVLDESTIQQMVRPRCGVADIINGTSTMNSGKSAKSTHSIHTVAHYSFFPYRPTWPPSK  174

Query  599   NALSYAWGDGTPYEFVTSTKEAL-----QQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
               L+YA+    P   ++ T +A+      +WS  T LSF + + Y  AD+K   F G+H 
Sbjct  175   RDLTYAF---LPANQLSDTVKAVFAHSFARWSAVTPLSFTESSVYLTADIKIAFFRGDHN  231

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWA---QVGPYYPYGVDIQSVVTHETGHLLG  934
             DG+ FDG  G +AH+F P +G  HLD  E+W          P  VD++SV  HE GHLLG
Sbjct  232   DGEPFDGVLGTLAHAFSPPDGRFHLDGAENWVVDDARKSSIPSAVDLESVAVHEIGHLLG  291

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS  E A+M+P I  G  K  L NDDIQGI+ LY
Sbjct  292   LGHSSQEEAIMFPTISSGMKKVELANDDIQGIQFLY  327



>ref|XP_004142465.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52409.1| hypothetical protein Csa_5G632080 [Cucumis sativus]
Length=295

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 159/267 (60%), Gaps = 20/267 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             LQGS+ G+ ++G++ +K+YLKR+GY+ N+   N++   N F   LESA++TFQ   +LN 
Sbjct  34    LQGSRIGNNIEGIHNVKLYLKRYGYLTNVESTNSN---NTFDVLLESAIKTFQKYHSLNV  90

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------VPQYSFLPGNPRWPDDKNAL  607
             +GV+D  T++LM  PRCG+PDI+   + +              ++F P N +WP  K  L
Sbjct  91    SGVIDEETLTLMSLPRCGIPDIMHNINVMDNNVQMNSSSFHSHFTFFPDNLKWPVSKYNL  150

Query  608   SYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
              Y + D  P +F      A++QW+ ++   F++  +   AD+ ++   G HGDG  FDG 
Sbjct  151   RYTFLDDFPNDFKEPVMNAMEQWALFSLFRFSEAVEAQEADITFNFVRGNHGDGYPFDGK  210

Query  788   GGIIAHSFQPTEGICHLDSEESWA--QVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAA  961
             GG++AH+F P +G  H D +E WA   VG +    +++  V  HE GH+LGL HS +  A
Sbjct  211   GGVLAHAFGPLDGRVHFDWDEDWADGSVGGF----INVGMVALHELGHVLGLAHSTIRDA  266

Query  962   VMYPYIGFGETKRVLDNDDIQGIKALY  1042
             +M+PY+  GE  R L  DDI+GI+ LY
Sbjct  267   IMWPYMEAGEQTRGLQFDDIEGIQTLY  293



>emb|CDY30915.1| BnaC09g14910D [Brassica napus]
Length=353

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 153/272 (56%), Gaps = 23/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GD+  GL +LK Y  RFGYI     N T    + F D L+SA+ T+Q NFNL  
Sbjct  50    LTGYHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLKSAISTYQKNFNLKV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LD++T+  ++KPRCG PD+I        G++ R V +YSF PG P+WP     LSYA
Sbjct  106   TGKLDASTLGQIVKPRCGNPDMIDGTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSYA  165

Query  617   WG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +W+  T L+F        AD+    FAG+HGDG+ FDGP 
Sbjct  166   FFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGPM  225

Query  791   GIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G +AH+  P  G+ HLD+EE W         Q+ P     VD++SV  HE GHLLGLGHS
Sbjct  226   GTLAHASSPPTGMFHLDNEEDWLISGEDMSRQILPVTSV-VDLESVAVHEIGHLLGLGHS  284

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+MYP I  G  K  L  DDI+GI+ LY
Sbjct  285   SVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  316



>gb|KCW49215.1| hypothetical protein EUGRSUZ_K02795 [Eucalyptus grandis]
Length=405

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 158/278 (57%), Gaps = 28/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTS-----PEANYFSDQLESAVRTFQAN  445
             LQG  KG+   G+ ELK YL++FGY+N   YN +       + + F D LE AV+T+Q N
Sbjct  130   LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  186

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPG  574
             ++LN TG LD  T S MM+PRCGV DII    R+                 V  Y+FL G
Sbjct  187   YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  246

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             +PRWP     L+Y +  GTP         A   W+  TR +F+   D+  A+++     G
Sbjct  247   SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARG  306

Query  755   EHGDG--QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHL  928
             +HGDG   +FDGPGG +AH+F PT G+ H D++E WA   P      ++++V  HE GHL
Sbjct  307   DHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHL  366

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+MY  I  G TK  L  DDIQGIKALY
Sbjct  367   LGLGHSDVEGAIMYSSIAPGTTKG-LHADDIQGIKALY  403



>ref|XP_006300514.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
 gb|EOA33412.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
Length=370

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 155/272 (57%), Gaps = 24/272 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G + G+++ GL +LK Y  RFGYI  +   N + +   F D L+SA+ T+Q NFNL  
Sbjct  53    LAGCQIGEKIDGLSKLKQYFHRFGYITTI--KNCTDD---FDDALQSAINTYQKNFNLKV  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LDS T+  ++KPRCG PD+I        GR+ R   +YSF PG PRWP  K  L+YA
Sbjct  108   TGKLDSFTLRQIVKPRCGNPDMIDGFSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  167

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +W+  T L+F        AD+    F+GEHGDG+ FDG  
Sbjct  168   FLPQNNLTDEVKRVFARAFTRWAEVTPLNFARSESLRGADIFIGFFSGEHGDGEPFDGAM  227

Query  791   GIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G +AH+  P  G+ HLD +E W         ++ P     VD++SVV HE GHLLGLGHS
Sbjct  228   GTLAHASSPPTGMLHLDGDEDWLISDGAISRRILPVTTV-VDLESVVVHEIGHLLGLGHS  286

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+M+P I  G+ K  L  DDI+GI+ LY
Sbjct  287   SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  318



>gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana]
Length=364

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 157/278 (56%), Gaps = 29/278 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G +V GL ++K Y   FGYI++L     S   + F D LESA++T+Q NFNLN+
Sbjct  46    LLGCHAGQKVDGLAKIKKYFYNFGYISSL-----SNFTDDFDDALESALKTYQQNFNLNT  100

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPDDK  598
             TGVLD+ T+  +++PRCG  D++     +              V  +SF PG PRWP+  
Sbjct  101   TGVLDAPTIEHLIRPRCGNADVVNGTSTMNSGKPSAGSQNIHTVAHFSFFPGRPRWPESN  160

Query  599   NALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G      +    A  +WS  T L+F +   + +AD+K   FAG+H DG+
Sbjct  161   RDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLTFTEIASFQSADIKIGFFAGDHNDGE  220

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--------VDIQSVVTHETGHL  928
              FDGP G +AH+F P  G  HLD +E+W   G     G        VD++SV  HE GHL
Sbjct  221   PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGAPIVEGNFFSILSAVDLESVAVHEIGHL  280

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++M+P +  G  +  L NDDIQG++ LY
Sbjct  281   LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  318



>ref|XP_003517862.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 151/277 (55%), Gaps = 22/277 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             +   G + G    GL  LK Y   FGYI+N+  + +S  ++ F D LE+AVR +Q NFNL
Sbjct  57    RNFTGCRPGKTYNGLSNLKNYFHYFGYISNVS-SKSSNFSDDFDDALEAAVRAYQKNFNL  115

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL---------------VPQYSFLPGNPRWP  589
             N TG LD  T++ ++KPRCGV DII     +               V  YSF  G PRWP
Sbjct  116   NITGELDDPTMNQIVKPRCGVADIINGTTTMNSGKTNTTDSPTFHTVAHYSFFDGQPRWP  175

Query  590   DDKNALSYAWGDGTPYEFVTSTK--EALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
                  L+YA+      + V  T    A  +WS  T +SF +   Y  AD++   + G+HG
Sbjct  176   VGTQELTYAFDPDNALDDVIKTVFGNAFSRWSEVTTISFRETASYVAADIRIGFYGGDHG  235

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLL  931
             DG+ FDG  G +AH+F PT G+ HLDS E W   G          VD++SV  HE GHLL
Sbjct  236   DGEPFDGVLGTLAHAFSPTNGMFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLL  295

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS VE A+MYP I     K  L+ DDIQGI+ LY
Sbjct  296   GLGHSSVEDAIMYPTITARTRKVELNEDDIQGIQVLY  332



>ref|XP_004142468.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159089.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52406.1| hypothetical protein Csa_5G631560 [Cucumis sativus]
Length=295

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/272 (38%), Positives = 159/272 (58%), Gaps = 22/272 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY-------FSDQLESAVRT  433
             + L G +K D V+G++ +K YL+R+GY+++    NTS ++N        F D LESA+R 
Sbjct  31    RRLYGCRKDDNVEGIHSIKKYLQRYGYLSH----NTSTDSNIIELNSNKFDDSLESAIRL  86

Query  434   FQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWP  589
             +Q   +LN +G++D  T+  M +PRCGVPD+              +   Y+  P N +WP
Sbjct  87    YQKWSHLNVSGIIDQETLDQMFQPRCGVPDVFKFNSSKNLEDDLEMSSHYALFPNNEKWP  146

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             D K  L+Y + +  P +FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG
Sbjct  147   DYKRHLTYMFTNNFPIDFVPSMTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADG  206

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
              AFDGPGG++ H+F PT+G  HLD +++W+         V++ +   HE GH+LGL HS 
Sbjct  207   FAFDGPGGVVGHAFAPTDGRLHLDGDDTWS--AGLEEKKVNVMNAALHELGHVLGLAHST  264

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             +  AVM+PYI     K  L++DDI GI ALYP
Sbjct  265   LPQAVMWPYIESNALKN-LNDDDIAGIHALYP  295



>ref|XP_004509890.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=377

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 153/282 (54%), Gaps = 29/282 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             +   G   G +  GL  LK Y + FGYI++ P  N S   + F D LE+A++T+Q NFNL
Sbjct  51    RNFTGCHHGVKYDGLSNLKNYFQHFGYISHAPQLNFS---DNFDDALENAIKTYQKNFNL  107

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG--------------------RRHRLVPQYSFLPG  574
             N TG LD NT+  ++ PRCGV DII                      +   +  ++  PG
Sbjct  108   NITGELDDNTLRQIVLPRCGVADIINGTTAMNAGKEKETTSYGHSKPKFHTLSHFTVFPG  167

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTST--KEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP+ K  L+YA+  G        +    A  +WS  T L+F +   Y++AD+K   F
Sbjct  168   QPRWPEGKQELTYAFFPGNDLSKTVKSVFATAFARWSEVTTLTFTETESYSSADMKIGFF  227

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHE  916
              G+HGDG+ FDG  G +AH+F PT G  HLD+ E W   G       P  VD++SV  HE
Sbjct  228   EGDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDISKSSLPTAVDLESVAVHE  287

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS VE A+M+P I     K VL  DD++GI+ LY
Sbjct  288   IGHLLGLGHSSVEDAIMFPTISSRMKKVVLAEDDVRGIQYLY  329



>ref|XP_009113266.1| PREDICTED: metalloendoproteinase 1 [Brassica rapa]
Length=394

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 152/273 (56%), Gaps = 24/273 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GD+  GL +LK Y  RFGYI     N T    + F D L+SA+ T+Q NFNL  
Sbjct  90    LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAISTYQKNFNLKV  145

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------GRRHRLVPQYSFLPGNPRWPDDKNALSY  613
             TG LD++T+  ++KPRCG PD+I         G++ R V +YSF PG P+WP     LSY
Sbjct  146   TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSY  205

Query  614   AWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
             A+   +    E       A  +W+  T L+F        AD+    FAG+HGDG+ FDGP
Sbjct  206   AFVPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGP  265

Query  788   GGIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGH  943
              G +AH+  P  G+ HLD +E W         Q+ P     VD++SV  HE GHLLGLGH
Sbjct  266   MGTLAHASSPPTGMFHLDGDEDWLISGEDMSRQILPVTSV-VDLESVAVHEIGHLLGLGH  324

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+MYP I  G  K  L  DDI+GI+ LY
Sbjct  325   SSVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  357



>ref|XP_007216020.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
 gb|EMJ17219.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
Length=296

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 153/274 (56%), Gaps = 47/274 (17%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL +FGY+++   NN     + F DQLESA++T+Q N++L +
Sbjct  48    LKGCHKGDKVQGIQDLKKYLGKFGYLSS--NNNGHFNDDDFDDQLESAIKTYQINYHLKA  105

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPGNPRWP  589
             TG LD+ TVS MM PRCGV DII     +                 V  Y+F  GNP+WP
Sbjct  106   TGALDAKTVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
               K  L+YA+   TP E    + +                    N DL      G HGDG
Sbjct  166   ASKYHLTYAFLQDTPAEATGPSNQ--------------------NPDLTVSFHRGNHGDG  205

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGLG  940
               FDGPGG IAH+F PT G  H D++E +   A  G Y     D+++V  HE GHLLGLG
Sbjct  206   APFDGPGGTIAHAFAPTNGRFHYDADERFSVGAVSGAY-----DLETVALHEIGHLLGLG  260

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS V+ A+MYP I  G T++ L  DDIQGIKALY
Sbjct  261   HSSVQGAIMYPTISPGVTQQSLHGDDIQGIKALY  294



>emb|CDY45157.1| BnaA09g14350D [Brassica napus]
Length=354

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 152/273 (56%), Gaps = 24/273 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GD+  GL +LK Y  RFGYI     N T    + F D L+SA+ T+Q NFNL  
Sbjct  50    LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAITTYQKNFNLKV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------GRRHRLVPQYSFLPGNPRWPDDKNALSY  613
             TG LD++T+  ++KPRCG PD+I         G++ R V +YSF PG P+WP     LSY
Sbjct  106   TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKLRTVARYSFFPGKPQWPKRNRDLSY  165

Query  614   AWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
             A+   +    E       A  +W+  T L+F        AD+    FAG+HGDG+ FDGP
Sbjct  166   AFFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGP  225

Query  788   GGIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGH  943
              G +AH+  P  G+ HLD +E W         Q+ P     VD++SV  HE GHLLGLGH
Sbjct  226   MGTLAHASSPPTGMFHLDGDEDWLISGEDVSRQILPVTSV-VDLESVAVHEIGHLLGLGH  284

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+MYP I  G  K  L  DDI+GI+ LY
Sbjct  285   SSVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  317



>ref|XP_002888162.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 154/272 (57%), Gaps = 24/272 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+ + GL +LK Y +RFGYI     NN + +   F D L+SA+ T+Q NFNL  
Sbjct  37    LAGCHIGENINGLSKLKQYFRRFGYITGT--NNCTDD---FDDVLQSAINTYQKNFNLKV  91

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LDS+T+  ++KPRCG PD+I        G++ R   +YSF PG PRWP  K  L+YA
Sbjct  92    TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGKKLRATERYSFFPGKPRWPKRKRDLTYA  151

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +W+  T L+F        AD+    F+GEHGDG+ FDG  
Sbjct  152   YVPQNNLTDEVKRVFARAFTRWAEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  211

Query  791   GIIAHSFQPTEGICHLDSEESW--------AQVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G +AH+  P  G+ HLD +E W         +V P     VD++SV  HE GHLLGLGHS
Sbjct  212   GTLAHASSPPTGMLHLDGDEDWLISDGEISRRVLPVTSV-VDLESVAVHEIGHLLGLGHS  270

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+M+P I  G+ K  L  DDI+GI+ LY
Sbjct  271   SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  302



>ref|XP_007217804.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
 gb|EMJ19003.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
Length=406

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 154/256 (60%), Gaps = 10/256 (4%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G  KGD+V+G+ +LK YL++FGY+N    N+     ++F D+LESA++T+Q N++L  
Sbjct  157   LKGCHKGDKVQGIQDLKKYLEKFGYLNGNTNND-----DHFDDELESAIKTYQINYHLKV  211

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE  640
             TG LD+ TV  M  PRCG           V  Y+F  GNP+WP +K  L+Y +  GT  E
Sbjct  212   TGTLDAKTVKKMEMPRCGKKRGGHGSTHTVGHYAFFQGNPKWPANKYHLTYGFLQGTQSE  271

Query  641   FVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG--QAFDGPGGIIAHSFQ  814
              V +   A   W   T  +F+    + +ADLK     G+HGDG   AFDGPG  IAH+F+
Sbjct  272   AVGAVARAFATWQSNTHFTFSQAQSFESADLKIGFGRGDHGDGANNAFDGPGKTIAHAFR  331

Query  815   PTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGET  994
             PT G  H D++E+W  VG   P G D+++V  HE GHLLGL HS V  AVM   I  G T
Sbjct  332   PTNGRFHYDADETWV-VGA-VPGGFDLETVALHEIGHLLGLDHSSVPGAVMQSQIPPGYT  389

Query  995   KRVLDNDDIQGIKALY  1042
             +  L  DD+QGI+ALY
Sbjct  390   QS-LHADDVQGIRALY  404



>gb|KGN51345.1| hypothetical protein Csa_5G522910 [Cucumis sativus]
Length=295

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 159/270 (59%), Gaps = 22/270 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEA-------NYFSDQLESAVRTFQ  439
             L G +KGD V+G++ +K YL+R+GY+++    NTS ++       N F D LESA++ +Q
Sbjct  33    LYGCRKGDNVEGIHSIKKYLQRYGYLSH----NTSIDSHIIELNSNKFDDSLESAIKLYQ  88

Query  440   ANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWPDD  595
                +LN +G+LD  T+  M KPRCGV D+              +   Y+  PGN +WPD 
Sbjct  89    KWSHLNVSGILDQETLDQMFKPRCGVRDVFKFNSNKNLEDDLEMSSHYTLFPGNLKWPDY  148

Query  596   KNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             K  L+Y + +  P +FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG  
Sbjct  149   KRHLTYVFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLP  208

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
             FDGPGG++ H+F PT+G  HLD +++W+         V++ +V  HE GH+LGL HS + 
Sbjct  209   FDGPGGVVGHAFAPTDGRLHLDGDDTWS--AGMEVQKVNVMNVALHELGHVLGLAHSTLP  266

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALYP  1045
              AVM+PYI     K  L++DDI G+ ALYP
Sbjct  267   QAVMWPYIDSNALKN-LNDDDIAGLHALYP  295



>gb|KDO75344.1| hypothetical protein CISIN_1g037265mg [Citrus sinensis]
Length=305

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 156/276 (57%), Gaps = 29/276 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSP-------------EANYFSDQLES  421
              +GS+KGD+VKG+++L+ YL+  GY+N    NN  P             E +YF + LES
Sbjct  34    FRGSQKGDKVKGIHQLRKYLQSLGYVNQ---NNIRPSISLDNSDNESHIEDDYFGEDLES  90

Query  422   AVRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVP---------QYSFLPG  574
             A++T+Q NFNLN+TG LD  T+S M +PRCG+PDII    R+            Y+F  G
Sbjct  91    AIKTYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSTDKKYDIHYAFFEG  150

Query  575   NPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
              PRWP  K  ++YA+  GT  +     + AL  WS W   +F    DY NAD+K     G
Sbjct  151   -PRWPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRG  209

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLG  934
             +HGDG  FDGP   + H+F     + H + + +W  V      G D+Q+V  HE GH+LG
Sbjct  210   DHGDGTPFDGPWHTLGHAFSDPYAVVHFNGDVNW--VMGTVKGGFDMQTVALHELGHVLG  267

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             L HS V+AA M+P    G TK  L++DDI+ +K LY
Sbjct  268   LSHSSVKAASMWPSTRAGTTKG-LNDDDIRRMKMLY  302



>ref|XP_004139163.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66654.1| hypothetical protein Csa_1G654840 [Cucumis sativus]
Length=315

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 160/280 (57%), Gaps = 30/280 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNT-----SPEANYFSDQLESAVRTFQAN  445
             LQGSKKGD VKG+ +LK + +R+GY+N+   N T         + F D+ ESAV+T+Q  
Sbjct  35    LQGSKKGDNVKGISKLKNFFRRYGYLNH-QINVTGHLIDHDADDTFDDRFESAVKTYQQY  93

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDII----GRR--------------HRL---VPQYS  562
             F+LNSTG L++ T+S +  PRCG PDI+    GR               H+L   VP YS
Sbjct  94    FHLNSTGSLNAETLSQLATPRCGNPDILNEATGRMLLENNNNDSSHDHYHQLSHAVPHYS  153

Query  563   FLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYH  742
             F PG PRWP  K  L+Y +   T  +       A   W+  T   F+  T+   ADLK  
Sbjct  154   FFPGRPRWPPTKYHLTYEFLPNTHADAKAPVTRAFATWARHTHFKFSLATNSRRADLKIG  213

Query  743   LFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETG  922
              + G HGDG  FDG GG +AH+F PT+G  H DS E W  VG       D+++V  HE G
Sbjct  214   FYRGNHGDGYPFDGSGGTLAHAFTPTDGRVHFDSTEKWV-VGAVRGR-FDLETVALHEIG  271

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS V+ A+MYP I  G TK  L+ DDI+GI+ LY
Sbjct  272   HLLGLGHSRVKNAIMYPTIESGSTKG-LNADDIEGIEVLY  310



>ref|XP_007223246.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
 gb|EMJ24445.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
Length=377

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 153/273 (56%), Gaps = 33/273 (12%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             GD+V+GL +LK Y   FGYI NLP N T    + F D L+SA++T+Q NFNLN TG LD 
Sbjct  62    GDKVEGLSKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  117

Query  479   NTVSLMMKPRCGVPDIIGRRHRL---------------VPQYSFLPGNPRWPDDKNALSY  613
              T+  ++K RCG PDI+     +               V  YS  PG P WP  +  L+Y
Sbjct  118   RTIQHLVKRRCGNPDIVNGTTTMNSGKPTSSNTSNLHTVAHYSTFPGTPVWPPSRRDLTY  177

Query  614   AW------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             A+       D     F+     A Q+WS  T L+F++ T +  AD+K   F+G+HGDG+ 
Sbjct  178   AFLPENKLADDVKAVFL----RAFQRWSAATPLNFSETTSFYTADIKIGFFSGDHGDGEP  233

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLGH  943
             FDG  G +AH+F P  G  HLD +E+W   G          VD++SV  HE GHLLGLGH
Sbjct  234   FDGVLGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGH  293

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+M+P I     K  L +DD+ GI++LY
Sbjct  294   SSVEEAIMFPTISSRTKKVELASDDVLGIQSLY  326



>gb|EPS61169.1| matrixin family protein, partial [Genlisea aurea]
Length=313

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 157/274 (57%), Gaps = 24/274 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G KKG +  G+  +K YL+ FGY+N+  Y + S E   F + L++AVR +Q NFNL  
Sbjct  7     LVGCKKGIKAAGIGLMKKYLQYFGYLND-SYRDFSDE---FDENLDAAVRDYQLNFNLGV  62

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG--------------RRHRLVPQYSFLPGNPRWPDDK  598
             TG LD +TV LM +PRCG  D+I               R  R V ++SF P  PRWP  +
Sbjct  63    TGELDESTVDLMAQPRCGNLDVINGTSTMASGKSSDTFRGIRNVGRHSFFPNRPRWPPGR  122

Query  599   NALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
             + L+YA+   +  P    ++   A ++WS  T LSF +   +  AD++   F G+HGDG+
Sbjct  123   DRLTYAFLPENRLPAPTRSAFARAFRRWSAVTPLSFVETEAFEGADIRIAFFRGDHGDGE  182

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYY----PYGVDIQSVVTHETGHLLGLG  940
              FDG  G +AH+F P  G  HLD +E+W   G +        VD++SV  HE GHLLGLG
Sbjct  183   PFDGLLGTLAHAFSPPSGRFHLDGDENWVVDGDFLDATRTSAVDLESVAVHEIGHLLGLG  242

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS V  A+MYP I FG  K  L +DDI GI+ LY
Sbjct  243   HSSVREAIMYPTIAFGTRKVDLVDDDIAGIQELY  276



>ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=373

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/277 (42%), Positives = 155/277 (56%), Gaps = 27/277 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G +KG +  GL +LK Y + FGY+NN  Y+N S +   F D LE A+RT+Q NFNL +
Sbjct  52    LDGCRKGVKADGLAKLKKYFQLFGYLNN-SYDNFSDD---FDDYLEKAIRTYQLNFNLYA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPGNPRWP  589
             TG LD+ T+  ++ PRCG PD++     +                 V  YSF P  PRWP
Sbjct  108   TGELDAPTLKHIVLPRCGNPDVVNGTSTMRSGKPSNRYSANSTIHTVAHYSFFPNRPRWP  167

Query  590   DDKNALSYAWGDGTPYEFVTS--TKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
               +  L+YA+        V       A ++WS  T L+F + + +  ADL+   F+G+HG
Sbjct  168   PGRTRLTYAFLPENQLSDVVKGVFARAFERWSEVTPLTFTETSSFYGADLRIGFFSGDHG  227

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYY----PYGVDIQSVVTHETGHLL  931
             DG+ FDG  G +AH+F P  G  HLD +E+W   G +        VD++SV  HE GHLL
Sbjct  228   DGEPFDGVLGTLAHAFSPPAGRFHLDGDENWVIDGDFLNSSPMSAVDLESVAVHEIGHLL  287

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS VE A+MYP I  G  K  L NDDI GI+ LY
Sbjct  288   GLGHSSVEDAIMYPTISSGTRKVELANDDIMGIQELY  324



>ref|XP_008244963.1| PREDICTED: metalloendoproteinase 1 [Prunus mume]
Length=425

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 154/273 (56%), Gaps = 33/273 (12%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             GD+V+GL +LK Y   FGYI NLP N T    + F D L+SA++T+Q NFNLN TG LD 
Sbjct  110   GDKVEGLAKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  165

Query  479   NTVSLMMKPRCGVPDIIGRRHRL---------------VPQYSFLPGNPRWPDDKNALSY  613
              T+  ++KPRCG PDI+     +               V  YS  PG P WP ++  L+Y
Sbjct  166   PTIQHLVKPRCGNPDIVNGTTTMNSGKPSSSNTSNLHTVAHYSTFPGTPVWPLNRRDLTY  225

Query  614   AW------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             A+       D     F+     A ++WS  T L+F++ T +  AD+K   F G+HGDG+ 
Sbjct  226   AFLPENKLADDVKAVFL----RAFERWSAATPLNFSETTSFYTADIKIGFFRGDHGDGEP  281

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLGH  943
             FDG  G +AH+F P  G  HLD +E+W   G          VD++SV  HE GHLLGLGH
Sbjct  282   FDGVLGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGH  341

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+M+P I     K  L +DD+ GI++LY
Sbjct  342   SSVEEAIMFPTISSRTKKVELASDDVLGIQSLY  374



>ref|XP_004965108.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=368

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 155/277 (56%), Gaps = 30/277 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSD----QLESAVRTFQA  442
             + L G   G+E +G+ +LK YL  FGY+         PE++ F+D     LE A++ +Q 
Sbjct  51    RNLTGCHFGEEQQGVAKLKDYLAHFGYL---------PESSGFTDIFDADLEEAIKVYQR  101

Query  443   NFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ--------YSFLPGNPRWPDDK  598
             NF LN TGV+D+ TV+ MM PRCGV D+I     +           YS+ PG+P WP  K
Sbjct  102   NFGLNITGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNLYSYFPGSPSWPRSK  161

Query  599   NALSYAWGD--GTPYEFVTSTK---EALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
               L+YA  D   T  +  T ++    A  +WS  T L+F +     +AD+     AG+HG
Sbjct  162   KRLTYAITDTAATTIDRATLSRVFARAFARWSAATTLNFTETASARDADITIGFHAGDHG  221

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLL  931
             DG+AFDGP G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLL
Sbjct  222   DGEAFDGPLGTLAHAFSPTDGRFHLDAAEAWVAAGDVSRASSDVAVDLESVAVHEIGHLL  281

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS    A+MYP I     K  L +DD+ GI++LY
Sbjct  282   GLGHSSEPGAIMYPTITSRTRKVDLASDDVVGIQSLY  318



>ref|XP_010470167.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=364

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 156/272 (57%), Gaps = 22/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+++ GL +LK Y  RFGYI+    +N + +   F D L+SA+ T+Q NFNL  
Sbjct  49    LAGCHIGEKIDGLSKLKQYFHRFGYISAAAVDNCTDD---FDDVLQSAIDTYQKNFNLKV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------GRRH-RLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LDS+T+  ++KPRCG  D+I       GRR  R   +YSF  G PRWP  K  L+YA
Sbjct  106   TGKLDSSTLRQIVKPRCGNLDMIDGVSEMNGRRKLRTTERYSFFHGKPRWPKRKRDLTYA  165

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E     + A  +WS  T L+F        AD+    F+GEHGDG+ FDG  
Sbjct  166   FVPQNNLTEEVKRVFERAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  225

Query  791   GIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G +AH+  P  G+ HLDS+E W         ++ P     VD++SVV HE GHLLGLGHS
Sbjct  226   GTLAHASSPPTGMLHLDSDEDWLISNGEISRRILPVTSV-VDLESVVVHEIGHLLGLGHS  284

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+M+P I  G+ K  L  DDI+GI+ LY
Sbjct  285   SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  316



>ref|NP_176205.1| Matrixin family protein [Arabidopsis thaliana]
 gb|AAD14473.1| Strong similarity to gi|2829864 F3I6.6 zinc metalloproteinase 
homolog from Arabidopsis thaliana BAC gb|AC002396. EST gb|Z26412 
comes from this gene [Arabidopsis thaliana]
 dbj|BAD44472.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ABF19013.1| At1g59970 [Arabidopsis thaliana]
 gb|AEE33645.1| Matrixin family protein [Arabidopsis thaliana]
Length=360

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 151/272 (56%), Gaps = 24/272 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+ + GL +LK Y +RFGYI       T    + F D L+SA+ T+Q NFNL  
Sbjct  48    LAGCHIGENINGLSKLKQYFRRFGYITT-----TGNCTDDFDDVLQSAINTYQKNFNLKV  102

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LDS+T+  ++KPRCG PD+I        G+  R   +YSF PG PRWP  K  L+YA
Sbjct  103   TGKLDSSTLRQIVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYA  162

Query  617   WG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +W+  T L+F        AD+    F+GEHGDG+ FDG  
Sbjct  163   FAPQNNLTDEVKRVFSRAFTRWAEVTPLNFTRSESILRADIVIGFFSGEHGDGEPFDGAM  222

Query  791   GIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHETGHLLGLGHS  946
             G +AH+  P  G+ HLD +E W         ++ P     VD++SV  HE GHLLGLGHS
Sbjct  223   GTLAHASSPPTGMLHLDGDEDWLISNGEISRRILPVTTV-VDLESVAVHEIGHLLGLGHS  281

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              VE A+M+P I  G+ K  L  DDI+GI+ LY
Sbjct  282   SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  313



>ref|XP_010100525.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB82659.1| Metalloendoproteinase 1 [Morus notabilis]
Length=374

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/280 (42%), Positives = 151/280 (54%), Gaps = 30/280 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K   G + G +  GL +LK Y K FGYI +  +N T      F D+LESA++T+Q NFNL
Sbjct  51    KNFTGCRPGQKSDGLSKLKDYFKNFGYIPDSQHNFTDD----FDDELESAIKTYQKNFNL  106

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------------VPQYSFLPGNPRW  586
             N TG LD  T+  +MK RCG  DI+     +                V  YSF  G P W
Sbjct  107   NVTGELDDKTIENLMKSRCGNADIVNGTSTMNSGKPASSNSSLNFHAVRHYSFFEGRPTW  166

Query  587   PDDKNALSYAWGDGTPYEFVTSTKE----ALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             P+    L+YA+      E   +TKE    A ++W+  T L+F +   Y  ADLK   + G
Sbjct  167   PEYHRDLTYAFLPDN--ELSNTTKEVFTRAFERWAAVTTLTFTETDSYYEADLKVAFYTG  224

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETG  922
             +HGDG+ FDG  G +AH+F PT G  HLD  E+W   G          +D++SV  HE G
Sbjct  225   DHGDGEPFDGVLGTLAHAFSPTSGRFHLDGAETWVAEGDVTKSSTSSAIDLESVAVHEIG  284

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE A+MYP I     K  L +DDIQGI+ LY
Sbjct  285   HLLGLGHSSVEEAIMYPTISAKTRKVELASDDIQGIQELY  324



>ref|XP_010043822.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=499

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/278 (42%), Positives = 155/278 (56%), Gaps = 31/278 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G+   GL  LK Y + FGYI   P N T    + F D L SA++T+Q NFNL  
Sbjct  180   FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  235

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-------VPQYSFLPGNPRWPDD  595
             TG LD  T++ +++PRCG PDI+        G+   L       V  Y+F PG PRWPD 
Sbjct  236   TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  295

Query  596   KNALSYAWGDGTPYEFVTSTKEAL-----QQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             K+ L+YA+    P   ++  ++A+     Q+W+  T L+F     Y  AD+K   F+G+H
Sbjct  296   KSDLTYAF---LPANQLSDDEKAVFSRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDH  352

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHL  928
             GDG+AFDG  G +AH+F P  G  HLD +E+W   G          VD++SV  HE GHL
Sbjct  353   GDGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHL  412

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++MYP I     K  L  DD+QGI+ LY
Sbjct  413   LGLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  450



>ref|XP_010913461.1| PREDICTED: metalloendoproteinase 1-like [Elaeis guineensis]
Length=366

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/273 (42%), Positives = 155/273 (57%), Gaps = 28/273 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY---FSDQLESAVRTFQANFN  451
             L G  +GD   GL +LK YL RFGY+         P AN+   F + LE A++T+Q NF 
Sbjct  53    LSGCHRGDNRTGLADLKDYLSRFGYL---------PTANFTDAFDEALEEALKTYQQNFG  103

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDII----GRRHRLVP---QYSFLPGNPRWPDDKNALS  610
             LN+TG LD +TVS ++ PRCGV DII      R   +P    Y++ PG+P WP  K  L+
Sbjct  104   LNATGSLDDSTVSQLIIPRCGVADIINGTSSMRSAKLPGRNLYAYFPGSPTWPSWKRDLT  163

Query  611   YAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             YA    +     TS        A  +W+  T L+F +    ++AD++   ++G+HGDG+ 
Sbjct  164   YALVSTSAVSIDTSALRTVFARAFGRWAAATTLTFTESDSVSDADIQIGFYSGDHGDGEP  223

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYP----YGVDIQSVVTHETGHLLGLGH  943
             FDG  G +AH+F PT+G  HLD+ E W   G          VD++SV  HE GHLLGLGH
Sbjct  224   FDGVLGTLAHAFSPTDGRFHLDAAEQWVADGDVTQASSNVAVDLESVAVHEIGHLLGLGH  283

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+MYP I     K  L +DD++GI+ LY
Sbjct  284   SSVEEAIMYPTIKTKTKKVELASDDVEGIQNLY  316



>gb|KGN52417.1| hypothetical protein Csa_5G633150 [Cucumis sativus]
Length=294

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 157/272 (58%), Gaps = 22/272 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY-------FSDQLESAVRT  433
             + L G +KGD V+G++ +K YL+R+GY+++    NTS ++N        F D LESA+R 
Sbjct  30    RRLNGCRKGDNVEGIHNIKKYLQRYGYLSH----NTSTDSNIIELNSNKFDDSLESAIRL  85

Query  434   FQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWP  589
             +Q   +LN +G+LD  T+  M + RCG+ D+              +   Y   P N +WP
Sbjct  86    YQKWSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWP  145

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             D K  L+Y + +  P +FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG
Sbjct  146   DYKRHLTYMFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADG  205

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
              AFDGPGG++ H+F PT+G  HLD ++SW+          ++ +V  HE GH+LGL HS 
Sbjct  206   SAFDGPGGVVGHAFAPTDGRLHLDGDDSWS--AGLEENKFNVMNVALHELGHVLGLAHST  263

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             +  AVM+PYI     K  L++DDI G+ ALYP
Sbjct  264   LPQAVMWPYIDSNALKN-LNDDDIAGLHALYP  294



>gb|KFK40830.1| hypothetical protein AALP_AA2G047000 [Arabis alpina]
Length=364

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 151/271 (56%), Gaps = 18/271 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GD++ GL +LK Y  RFGY+       T+   + F D L+SA+ T+Q NFNL  
Sbjct  46    LAGCHVGDKIDGLSKLKQYFHRFGYLTTTTTAGTNFTDD-FDDILQSAINTYQKNFNLKV  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRLVPQYSFLPGNPRWPDDKNALSYA  616
             TG LD++T+  ++KPRCG PD+I        GR+ R   +YSF PG PRWP  K  L+YA
Sbjct  105   TGNLDASTLRQIVKPRCGNPDMIDGVSEMNAGRKLRTTERYSFFPGKPRWPKRKRDLTYA  164

Query  617   W--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             +   +    E       A  +WS  T L+F        AD+    FAGEHGDG+ FDG  
Sbjct  165   FVPQNNLTDEVKRVFARAFTRWSEVTPLNFTRSESILRADIVIGFFAGEHGDGEPFDGAM  224

Query  791   GIIAHSFQPTEGICHLDSEESWAQVGPYYPYG-------VDIQSVVTHETGHLLGLGHSG  949
             G +AH+  P  G+ HLD +E W         G       VD++SV  HE GHLLGLGHS 
Sbjct  225   GTLAHASSPPTGMFHLDGDEDWLISEDEISRGILPVTSVVDLESVAVHEIGHLLGLGHSS  284

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             VE ++MYP I  G+ K  L  DDI+GI+ LY
Sbjct  285   VEDSIMYPAIAGGDRKVELGKDDIEGIQHLY  315



>ref|XP_009360449.1| PREDICTED: metalloendoproteinase 1 [Pyrus x bretschneideri]
Length=375

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 156/273 (57%), Gaps = 32/273 (12%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G++V GL +LK Y  RFGYI NLP  N + +   F D LE+A++T+Q NFNLN TG LD 
Sbjct  60    GEKVDGLGKLKKYFNRFGYIPNLPTANLTDD---FDDDLEAALKTYQTNFNLNVTGELDG  116

Query  479   NTVSLMMKPRCGVPDII---------------GRRHRLVPQYSFLPGNPRWPDDKNALSY  613
              T+  ++KPRCG PDI+                 +   V  Y+F PG P WP ++  L+Y
Sbjct  117   PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYTFFPGTPVWPQNRRDLTY  176

Query  614   AW------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             A+       D     FV     A Q+WS  T L+F + T +++AD+K   F G+HGDG+ 
Sbjct  177   AFVPENELSDPVKAVFV----GAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEP  232

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLGH  943
             FDG  G +AH+F P  G  HLD +E+W   G          VD++SV  HE GHLLGLGH
Sbjct  233   FDGVLGTLAHAFSPPSGRFHLDGDENWVIAGDISKSSVTSAVDLESVAVHEIGHLLGLGH  292

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S VE A+MYP I     K  L NDD+ GI++LY
Sbjct  293   SSVEGAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_011042944.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=373

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 151/275 (55%), Gaps = 27/275 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G++  GL +LK Y + FGYI N   N T    + F D +ESA+RT+Q NFNLN 
Sbjct  58    LSGCHAGEKYDGLAKLKSYFQYFGYIPNSLSNFT----DDFDDSIESAIRTYQQNFNLNI  113

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRH-------RLVPQYSFLPGNPRWPDD  595
             TG LD  TV+ ++ PRCG PDI+        G+ H         V  YSF  G PRW   
Sbjct  114   TGQLDDQTVNHIVLPRCGNPDIVNGTTSMNSGKTHNTSSRHVHTVSHYSFFTGMPRW--R  171

Query  596   KNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             K AL+YA+  G+    E  T    A  +WS    L+F      N AD+    ++G+HGDG
Sbjct  172   KKALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIPLTFTQTDSINTADIGIGFYSGDHGDG  231

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGL  937
             + FDG  G +AHSF P  G  HLD +ESW   G          VD++SV  HE GHLLGL
Sbjct  232   EPFDGVLGTLAHSFSPPSGQFHLDGDESWVVTGDVRTSSLTTAVDLESVAVHEIGHLLGL  291

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHS VE ++MYP I     K  L +DDIQGI+ LY
Sbjct  292   GHSSVEVSIMYPTISSRTKKVELADDDIQGIQVLY  326



>ref|NP_001048075.1| Os02g0740700 [Oryza sativa Japonica Group]
 dbj|BAD15762.1| putative zinc metalloproteinase [Oryza sativa Japonica Group]
 dbj|BAF09989.1| Os02g0740700 [Oryza sativa Japonica Group]
Length=372

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 157/277 (57%), Gaps = 27/277 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F D LE+A+  +Q NF LN+
Sbjct  50    LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------------GRRHRLVPQYSFLPGNPRWPDDKN  601
             TG LD++TV  M+ PRCGV D+I               R R +  YS+ PG P WP  + 
Sbjct  108   TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHL--YSYFPGGPMWPPFRR  165

Query  602   ALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              L YA    +      +T       A  +W+  TRL F + +  +NAD+    ++G+HGD
Sbjct  166   NLRYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGD  225

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG-----PYYPYGVDIQSVVTHETGHLL  931
             G+AFDGP G +AH+F PT+G  HLD+ E+W   G       +   VD++SV  HE GHLL
Sbjct  226   GEAFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLL  285

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS V  ++MYP I  G  K  L++DD+ GI++LY
Sbjct  286   GLGHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>gb|EAY87473.1| hypothetical protein OsI_08881 [Oryza sativa Indica Group]
Length=372

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 157/277 (57%), Gaps = 27/277 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F D LE+A+  +Q NF LN+
Sbjct  50    LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------------GRRHRLVPQYSFLPGNPRWPDDKN  601
             TG LD++TV  M+ PRCGV D+I               R R +  YS+ PG P WP  + 
Sbjct  108   TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHL--YSYFPGGPMWPPFRR  165

Query  602   ALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              L YA    +      +T       A  +W+  TRL F + +  +NAD+    ++G+HGD
Sbjct  166   NLRYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGD  225

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG-----PYYPYGVDIQSVVTHETGHLL  931
             G+AFDGP G +AH+F PT+G  HLD+ E+W   G       +   VD++SV  HE GHLL
Sbjct  226   GEAFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLL  285

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS V  ++MYP I  G  K  L++DD+ GI++LY
Sbjct  286   GLGHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>gb|KDP21290.1| hypothetical protein JCGZ_21761 [Jatropha curcas]
Length=371

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 152/279 (54%), Gaps = 27/279 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K L G + G ++ GL +LK Y   FGYI N   N T    + F D LESA++T+Q NFNL
Sbjct  51    KKLSGCRAGQKLDGLNKLKQYFHDFGYIPNTFANFT----DDFDDALESALKTYQQNFNL  106

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG-----------------RRHRLVPQYSFLPGNPR  583
             N TG LD  T+S ++KPRCG  DI+                       V  Y+F PG+PR
Sbjct  107   NVTGELDEQTLSQLIKPRCGNADIVNGTTAMNSGKWTPPFNTTSHFHTVGHYTFFPGSPR  166

Query  584   WPDDKNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WPD K  L+YA+  G+    E  +    A  +WS    ++F +   +  AD++   F+G+
Sbjct  167   WPDSKRDLTYAFWPGNNLTTEAKSVFTRAFDRWSTVIPMTFAETDSFTIADIRIGFFSGD  226

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPY----YPYGVDIQSVVTHETGH  925
             HGDG+ FDG  G +AH+F P  G  HLD +E+W   G          VD++SV  HE GH
Sbjct  227   HGDGEPFDGVLGTLAHAFSPPSGRFHLDGDENWVVSGDISDSSIISAVDLESVAVHEIGH  286

Query  926   LLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LLGLGHS VE A+MYP I     K  L  DDI G++ LY
Sbjct  287   LLGLGHSSVEDAIMYPTIPSRTRKVELAQDDIDGVQQLY  325



>gb|EAZ24565.1| hypothetical protein OsJ_08327 [Oryza sativa Japonica Group]
Length=372

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 157/277 (57%), Gaps = 27/277 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F D LE+A+  +Q NF LN+
Sbjct  50    LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------------GRRHRLVPQYSFLPGNPRWPDDKN  601
             TG LD++TV  M+ PRCGV D+I               R R +  YS+ PG P WP  + 
Sbjct  108   TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSSAALRGRNL--YSYFPGGPMWPPFRR  165

Query  602   ALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              L YA    +      +T       A  +W+  TRL F + +  +NAD+    ++G+HGD
Sbjct  166   NLRYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGD  225

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG-----PYYPYGVDIQSVVTHETGHLL  931
             G+AFDGP G +AH+F PT+G  HLD+ E+W   G       +   VD++SV  HE GHLL
Sbjct  226   GEAFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLL  285

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS V  ++MYP I  G  K  L++DD+ GI++LY
Sbjct  286   GLGHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>ref|NP_001267680.1| metalloendoproteinase 1-like precursor [Cucumis sativus]
 emb|CAB76364.1| matrix metalloproteinase [Cucumis sativus]
 gb|KGN52412.1| hypothetical protein Csa_5G632110 [Cucumis sativus]
Length=320

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 156/273 (57%), Gaps = 20/273 (7%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN-YFSDQLESAVRTFQANFN  451
             K LQG   GD  +G++++K YL+RFGYI      +++P  +  F   LESA++T+Q N N
Sbjct  49    KNLQGCHLGDTKQGIHQIKKYLQRFGYITTNIQKHSNPIFDDTFDHILESALKTYQTNHN  108

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDII---------------GRRH-RLVPQYSFLPGNPR  583
             L  +G+LDSNT++ +  PRCGV D+I               G  H   V  ++F  GN +
Sbjct  109   LAPSGILDSNTIAQIAMPRCGVQDVIKNKKTKKRNQNFTNNGHTHFHKVSHFTFFEGNLK  168

Query  584   WPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             WP  K  LSY +    P + +     A  +WS  T   F+   DY  AD+K     GEHG
Sbjct  169   WPSSKLHLSYGFLPNYPIDAIKPVSRAFSKWSLNTHFKFSHVADYRKADIKISFERGEHG  228

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGH  943
             D   FDG GG++AH++ PT+G  H D +++W+ VG    Y  D+++V  HE GH+LGL H
Sbjct  229   DNAPFDGVGGVLAHAYAPTDGRLHFDGDDAWS-VGAISGY-FDVETVALHEIGHILGLQH  286

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S +E A+M+P I  G TK  L  DDI GIKALY
Sbjct  287   STIEEAIMFPSIPEGVTKG-LHGDDIAGIKALY  318



>ref|XP_004965107.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=321

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 154/277 (56%), Gaps = 30/277 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSD----QLESAVRTFQA  442
             + L G   G+E +G+ +LK YL  FGY+         PE++ F+D     LE A++ +Q 
Sbjct  51    RNLTGCHFGEEQQGVAKLKDYLAHFGYL---------PESSGFTDIFDADLEEAIKVYQR  101

Query  443   NFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ--------YSFLPGNPRWPDDK  598
             NF LN TGV+D+ TV+ MM PRCGV D+I     +           YS+ PG+P WP  K
Sbjct  102   NFGLNITGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNLYSYFPGSPSWPRSK  161

Query  599   NALSYAWGD--GTPYEFVTSTK---EALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
               L+YA  D   T  +  T ++    A  +WS  T L+F +     +AD+     AG+HG
Sbjct  162   KRLTYAITDTAATTIDRATLSRVFARAFARWSAATTLNFTETASARDADITIGFHAGDHG  221

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLL  931
             DG+AFDGP G +AH+F PT+G  HLD+ E+W   G           D++SV  HE GHLL
Sbjct  222   DGEAFDGPLGTLAHAFAPTDGRFHLDAAEAWVAAGDVSRASSDVAYDLESVAVHEIGHLL  281

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS    A+MYP I     K  L +DD+ GI++LY
Sbjct  282   GLGHSSEPGAIMYPSITPRTRKVDLASDDVVGIQSLY  318



>ref|XP_006838196.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
 gb|ERN00765.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
Length=355

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 157/268 (59%), Gaps = 20/268 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
              Q +  G  + G+ ELK Y +RFGY+ N P N++    + F ++ ESAVRT+QA  +L+ 
Sbjct  50    FQDAPLGSNITGMVELKKYFQRFGYLLN-PPNSSETLTDCFDEEFESAVRTYQARLSLSV  108

Query  461   TGVLDSNTVSLMMKPRCGVPDI-IGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPY  637
             TG LD +T++ +M PRCG+PD  +G     V  Y+F PG P+WP  K AL+Y        
Sbjct  109   TGRLDPDTLAQVMTPRCGMPDKGLGGPFHEVGHYAFFPGVPKWPRGKKALTYGISPTNMV  168

Query  638   EFV------TSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGII  799
              ++       +   A  +WS    L+F +  DY  AD+K   F+G+HGDGQ FDG  GI+
Sbjct  169   NYLDMEDVRMALSRAFDRWSNVIPLNFTETQDYYGADIKIGFFSGDHGDGQPFDGVLGIL  228

Query  800   AHSFQPTEGICHLDSEESWAQVGPYYPYGV-------DIQSVVTHETGHLLGLGHSGVEA  958
             AH+F P+ G  HLD+ E+W+       +GV       D++SV THE GHLLGLGHS  + 
Sbjct  229   AHAFSPSNGNFHLDASETWST-----DFGVQKSRVAIDLESVATHEIGHLLGLGHSKEKE  283

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             A+MYP +     K  L +DDI G+++LY
Sbjct  284   AIMYPSLSPRTKKMELRSDDIIGVQSLY  311



>ref|XP_002318762.2| MATRIX METALLOproteinASE [Populus trichocarpa]
 gb|EEE96982.2| MATRIX METALLOproteinASE [Populus trichocarpa]
Length=373

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 151/275 (55%), Gaps = 27/275 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G++  GL +LK Y + FGYI N   N T      F D LESA+RT+Q NFNLN 
Sbjct  58    LSGCHAGEKYDGLAKLKSYFQYFGYIPNSLSNFTDD----FDDSLESALRTYQQNFNLNI  113

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRH-------RLVPQYSFLPGNPRWPDD  595
             TG LD  TV+ +++PRCG PDI+        G+ H         V  YSF  G PRW   
Sbjct  114   TGQLDDQTVNHIVRPRCGNPDIVNGSSSMNSGKTHNTSSSHVHTVSHYSFFTGMPRW--R  171

Query  596   KNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             K AL+YA+  G+    E  T    A  +WS    L+F      N AD+    ++G+HGDG
Sbjct  172   KQALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIPLTFTQADSINAADIGIGFYSGDHGDG  231

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGL  937
             + FDG  G +AHSF P  G  HLD +E+W   G          VD++SV  HE GHLLGL
Sbjct  232   EPFDGVLGTLAHSFSPPSGQFHLDGDENWVVTGDVRTSSLTTAVDLESVAVHEIGHLLGL  291

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHS VE ++MYP I     K  L +DDIQGI+ LY
Sbjct  292   GHSSVEESIMYPTISSRTKKVELADDDIQGIQVLY  326



>ref|XP_006495379.1| PREDICTED: metalloendoproteinase 1-like, partial [Citrus sinensis]
Length=235

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 142/232 (61%), Gaps = 21/232 (9%)
 Frame = +2

Query  401   FSDQLESAVRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDII--------GRRH-----  541
             F + LESA++T+Q N++L STG+LD+NTV+ M  PRCGV DI+        G++      
Sbjct  5     FDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNH  64

Query  542   --RLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTD  715
               R V  YSF  G+PRWP  K +L+YA+  GT  + +T    A Q W+  T+  F+   D
Sbjct  65    HFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIED  124

Query  716   YNNADLKYHLFAGEHGDGQAFD---GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG  886
             + NAD+K    +G+HGDG  FD   GP GIIAH+F PT G  H D++E WA VG      
Sbjct  125   FANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQG-A  182

Query  887   VDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              D+++V  HE GHLLGL HS VE A+MYP I  G  K+ L  DDIQGI+ LY
Sbjct  183   FDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAG-VKKGLHGDDIQGIRDLY  233



>ref|XP_004142459.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 153/264 (58%), Gaps = 12/264 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYI-NNLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L G +KGD V+G++ +K YL+R+GY+ +N   +     +N F D LESA++ +Q   +LN
Sbjct  33    LYGCRKGDNVEGIHNIKKYLQRYGYLSHNTDSHIIELNSNKFDDSLESAIKLYQKWSHLN  92

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWPDDKNALSY  613
              +G+LD  T+  M +PRCGV D+              +   Y+  PGN +WPD K  L+Y
Sbjct  93    VSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRHLTY  152

Query  614   AWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGG  793
              + +  P  FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG  FDGPGG
Sbjct  153   VFTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDGPGG  212

Query  794   IIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYP  973
             ++ H+F P +G  HLD ++SW+         V++ +   HE GH+LGL HS +  AVM+P
Sbjct  213   VVGHAFAPIDGRLHLDGDDSWS--AGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVMWP  270

Query  974   YIGFGETKRVLDNDDIQGIKALYP  1045
             YI     K  L++DDI G+ ALYP
Sbjct  271   YIDSNALKN-LNDDDIAGLHALYP  293



>emb|CAN76268.1| hypothetical protein VITISV_004096 [Vitis vinifera]
Length=364

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 151/278 (54%), Gaps = 29/278 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K   G   GD+  GL +LK Y   FGYI+N  Y +       F D  E A++T+Q NFNL
Sbjct  47    KKFAGCHAGDKADGLAKLKEYFHYFGYIHNSNYTDD------FDDAFEQALKTYQLNFNL  100

Query  455   NSTGVLDSNTVSLMMKPRCGVPDI----------------IGRRHRLVPQYSFLPGNPRW  586
             N+TG LD  T++ ++ PRCG  DI                 G  H  V  YSF  G P W
Sbjct  101   NTTGQLDXATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHT-VGHYSFFDGKPVW  159

Query  587   PDDKNALSYAW-GDGTPYEFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             P+ K  L+Y +  D    + V +    A ++W+  T L+F +   Y +ADL+   + G+H
Sbjct  160   PESKRNLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDH  219

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHL  928
             GDG+AFDG  G +AH+F PT G  HLD EE+W   G          +D++SV  HE GHL
Sbjct  220   GDGEAFDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHL  279

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+MYP I     K  L +DDIQGI+ LY
Sbjct  280   LGLGHSSVEEAIMYPTITSRTKKVELASDDIQGIQELY  317



>ref|XP_002267298.2| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
Length=373

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 151/278 (54%), Gaps = 29/278 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K   G   GD+  GL +LK Y   FGYI+N  Y +       F D  E A++T+Q NFNL
Sbjct  56    KKFAGCHAGDKADGLAKLKEYFHYFGYIHNSNYTDD------FDDAFEQALKTYQLNFNL  109

Query  455   NSTGVLDSNTVSLMMKPRCGVPDI----------------IGRRHRLVPQYSFLPGNPRW  586
             N+TG LD  T++ ++ PRCG  DI                 G  H  V  YSF  G P W
Sbjct  110   NTTGQLDEATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHT-VGHYSFFDGKPVW  168

Query  587   PDDKNALSYAW-GDGTPYEFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             P+ K  L+Y +  D    + V +    A ++W+  T L+F +   Y +ADL+   + G+H
Sbjct  169   PESKRNLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDH  228

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHL  928
             GDG+AFDG  G +AH+F PT G  HLD EE+W   G          +D++SV  HE GHL
Sbjct  229   GDGEAFDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHL  288

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+MYP I     K  L +DDIQGI+ LY
Sbjct  289   LGLGHSSVEEAIMYPTITSRTKKVELASDDIQGIQELY  326



>ref|XP_006647869.1| PREDICTED: metalloendoproteinase 1-like [Oryza brachyantha]
Length=373

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 154/277 (56%), Gaps = 27/277 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F D LE+A+  +Q NF LN+
Sbjct  53    LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDALEAAIAAYQRNFGLNA  110

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------------GRRHRLVPQYSFLPGNPRWPDDKN  601
             TG LD+ TV  M+ PRCGV D+I               R R +  YS+ PG PRWP  + 
Sbjct  111   TGELDTTTVDQMVVPRCGVADVINGTSTMDRNSSAAALRGRHL--YSYFPGGPRWPPFRR  168

Query  602   ALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              L YA    +      +T       A  +W+  T L F +    +NAD+    ++G+HGD
Sbjct  169   NLRYAITATSATSIDRATLSAVFARAFSRWAAATTLQFTEVASASNADITIGFYSGDHGD  228

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG-----PYYPYGVDIQSVVTHETGHLL  931
             G+AFDGP G +AH+F PT+G  HLD+ E+W   G       +   VD++SV  HE GHLL
Sbjct  229   GEAFDGPLGTLAHAFSPTDGRFHLDAAEAWVANGDVSTASSFGTAVDLESVAVHEIGHLL  288

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS V  ++MYP I  G  K  L +DD+ GI++LY
Sbjct  289   GLGHSSVPDSIMYPTIRTGSRKVELQSDDVSGIQSLY  325



>ref|XP_009626465.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 154/277 (56%), Gaps = 32/277 (12%)
 Frame = +2

Query  287   GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             G   G +V+GL ++K Y + FGYIN+L  N     ++ F D L SAV+T+Q NFNLN+TG
Sbjct  52    GCHVGQKVEGLAKIKQYFQHFGYINSLSKN----FSDEFDDVLFSAVKTYQLNFNLNTTG  107

Query  467   VLDSNTVSLMMKPRCGVPDIIGRRHRL--------------VPQYSFLPGNPRWPDDKNA  604
               D+ T+  M+KPRCG PDI+     +              +  +SF  G PRWP  K  
Sbjct  108   EFDAVTLQHMIKPRCGNPDIVNGTTSMNSGNSPANSPAMHTMAHFSFFEGRPRWPPSKTN  167

Query  605   LSYAWGDGTPYEFVTSTKEA-----LQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             L+YA+    P   +T + +A       +WS  T LSF +   Y  AD++     G+HGDG
Sbjct  168   LNYAF---LPENQLTDSVKAAFGRAFDKWSEVTPLSFTETGSYRTADIRIGFLVGDHGDG  224

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYP------YGVDIQSVVTHETGHLL  931
               FDGP  I+AH+F P  G  HLD EE+W   G +         GVD++SV  HE GHLL
Sbjct  225   NPFDGPMKILAHAFSPPTGFFHLDGEENWVVDGGFLKEPVLEISGVDLESVAVHEIGHLL  284

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GL HS  + A+M+P +G G  K  L +DDI+G+  LY
Sbjct  285   GLDHSSKKEAIMFPTLGAGVRKVELSSDDIKGVHMLY  321



>ref|XP_004142460.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=294

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 157/268 (59%), Gaps = 14/268 (5%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPE--ANYFSDQLESAVRTFQAN  445
             + L G +KGD V+G++ +K YL+R+GY++ N+  ++   E  +N F D LESA++ +Q  
Sbjct  30    RRLYGCRKGDNVEGIHSIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKW  89

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWPDDKN  601
              +LN +G+LD  T+  M + RCG+ D+              +   Y   P N +WPD K 
Sbjct  90    SHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNEKWPDYKR  149

Query  602   ALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD  781
              L+Y + +  P +FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG AFD
Sbjct  150   HLTYMFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFD  209

Query  782   GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAA  961
             GPGG++ H+F PT+G  HLD ++SW+          ++ +V  HE GH+LGL HS +  A
Sbjct  210   GPGGVVGHAFAPTDGRLHLDGDDSWS--AGLEENKFNVMNVALHELGHVLGLAHSTLPQA  267

Query  962   VMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             VM+PYI     K  L++DDI G+ ALYP
Sbjct  268   VMWPYIDSNALKN-LNDDDIAGLHALYP  294



>ref|XP_006357274.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=338

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 147/269 (55%), Gaps = 24/269 (9%)
 Frame = +2

Query  287   GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             G + G ++KGL ++K Y K FGYI+N   N+ + E   F   L SA++T+Q NFNLN TG
Sbjct  60    GCRVGQKIKGLAKIKQYFKHFGYIDNSLSNDFTDE---FDQLLFSALKTYQLNFNLNITG  116

Query  467   VLDSNTVSLMMKPRCGVPDII-GRRH---------RLVPQYSFLPGNPRWPDDKNALSYA  616
               D  T+  M+KPRCG PDI+ G  H           V  +SF  G PRWP  K+ L YA
Sbjct  117   EFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKYA  176

Query  617   W------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
             +       D     F    + A  +WS  T L+F +   Y   D++   F  +HGDG  F
Sbjct  177   FLPENQLTDSVKVAF----RRAFDKWSKVTPLTFKEMDSYRLVDIRIRFFVRDHGDGNPF  232

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG-VDIQSVVTHETGHLLGLGHSGVE  955
             DGP  I+AH+F P     HLD EE+W   G Y   G VD++SV  HE GHLLGL H   +
Sbjct  233   DGPMKILAHAFAPPTRFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIGHLLGLDHLSEK  292

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+M+P I  G  K  L  DDI+G++ LY
Sbjct  293   EAIMFPTIEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_006376166.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
 gb|ERP53963.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
Length=304

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 155/268 (58%), Gaps = 18/268 (7%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L+G +KG  V+GL ELK YLKRFGY  +    + +   + F D LESA++T+Q  F+L
Sbjct  41    QKLEGVRKGQTVEGLVELKQYLKRFGYYPS----DVNLMTSDFDDLLESALKTYQNYFHL  96

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGR-------RHRLVPQYSFLPGNPRWPDDKNALSY  613
             N TG+LD +T+  MM PRCG+ DI          +  +V  Y+F  G P+W   K  L+Y
Sbjct  97    NVTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTY  156

Query  614   AWG-DGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
              +G DG          +   +A ++WS  + L+F + +D  +A++    + G+HGDG  F
Sbjct  157   TFGSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYPF  216

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPG I+AH+F P  G  H D++E W+   P     +D++SV  HE GHLLGL HS    
Sbjct  217   DGPGKILAHAFSPENGRFHYDADEKWS-TNPAMD-QIDLESVAVHEIGHLLGLAHSSDSN  274

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             AVMYP I  G  KR L  DDI GI ALY
Sbjct  275   AVMYPSIAAGTKKRNLAQDDIDGIHALY  302



>ref|XP_004159086.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 153/264 (58%), Gaps = 12/264 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYI-NNLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L G +KGD V+G++ +K YL+R+GY+ +N   +     +N F D LESA++ +Q   +LN
Sbjct  33    LYGCRKGDNVEGIHNIKKYLQRYGYLSHNTDSHIIELNSNKFDDSLESAIKLYQKWSHLN  92

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWPDDKNALSY  613
              +G+LD  T+  M +PRCGV D+              +   Y+  PGN +WPD K  L+Y
Sbjct  93    VSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRHLTY  152

Query  614   AWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGG  793
              + +  P  FV S  EA+ +W+  +  +F++ +D  +AD+       +H DG  FDGPGG
Sbjct  153   VFTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDGPGG  212

Query  794   IIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYP  973
             ++ H+F P +G  HLD ++SW+         V++ +   HE GH+LGL HS +  AVM+P
Sbjct  213   VVGHAFAPIDGRLHLDGDDSWS--AGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVMWP  270

Query  974   YIGFGETKRVLDNDDIQGIKALYP  1045
             YI     K  +++DDI G+ ALYP
Sbjct  271   YIESNALKN-MNDDDIAGLHALYP  293



>ref|XP_010552627.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=376

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/283 (39%), Positives = 152/283 (54%), Gaps = 30/283 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             +   G + GD+V GLY+LK Y +RFGYI   P N +    + F D L  A+  +Q NF L
Sbjct  47    RNFTGCRSGDKVDGLYKLKQYFQRFGYI---PENFSGNFTDDFDDILRHAIEMYQRNFRL  103

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPG  574
             N +G LD  TV  ++ PRCG PDI+                    G+R   + +YS  PG
Sbjct  104   NVSGELDELTVRHLVIPRCGNPDIVNGSSAMHGGKKYEVNFAGRRGQRFHALKRYSLFPG  163

Query  575   NPRWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP+D+  L+YA+   +    E       A  +W+  T+L+F     + ++D+    +
Sbjct  164   EPRWPEDRRQLTYAFDPRNALTEEVKGVFGRAFARWAAVTKLTFTRVETFPDSDITIGFY  223

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPY-----YPYGVDIQSVVTH  913
              G+HGDG+ FDG  G +AH+F P  G  HLDS+E+W   G           VD++SV  H
Sbjct  224   TGDHGDGEPFDGVLGTLAHAFSPPSGRFHLDSDENWVVSGDVGGILSMTSAVDLESVAVH  283

Query  914   ETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             E GHLLGLGHS +E ++MYP I  G  K  L  DDI GI+ LY
Sbjct  284   EIGHLLGLGHSTIEDSIMYPTISTGRRKVELTRDDIDGIQYLY  326



>gb|ABK95950.1| unknown [Populus trichocarpa]
Length=304

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 155/268 (58%), Gaps = 18/268 (7%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L+G +KG  V+GL ELK YLKRFGY  +    + +   + F D LESA++T+Q  F+L
Sbjct  41    QKLEGVRKGQTVEGLVELKQYLKRFGYYPS----DVNLMTSDFDDLLESALKTYQNYFHL  96

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGR-------RHRLVPQYSFLPGNPRWPDDKNALSY  613
             N TG+LD +T+  MM PRCG+ DI          +  +V  Y+F  G P+W   K  L+Y
Sbjct  97    NVTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTY  156

Query  614   AWG-DGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
              +G DG          +   +A ++WS  + L+F + +D  +A++    + G+HGDG  F
Sbjct  157   TFGSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYPF  216

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPG I+AH+F P  G  H D++E W+   P     +D++SV  HE GHLLGL HS    
Sbjct  217   DGPGKILAHAFSPENGRFHYDADEKWS-TNPAMD-QIDLESVAVHEIGHLLGLAHSSDSN  274

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             AVMYP I  G  KR L  DDI GI ALY
Sbjct  275   AVMYPSIAAGTKKRNLAQDDIDGIHALY  302



>ref|XP_003519796.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 150/277 (54%), Gaps = 22/277 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             +   G + G    GL  LK Y + FGYI+    + +S   + F D LE+A++ +Q NFNL
Sbjct  56    RNFTGCRPGKTYNGLSNLKNYFQYFGYISK-ALSKSSNFTDDFDDALEAAIKAYQKNFNL  114

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL---------------VPQYSFLPGNPRWP  589
             N TG LD  T++ ++KPRCGV DII     +               V  YSF  G PRWP
Sbjct  115   NITGELDDPTMNQIVKPRCGVADIINGTTTMNSGKSNTTDSPKFHSVAHYSFFDGQPRWP  174

Query  590   DDKNALSYAWGDGTPYEFVTST--KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
             +    L+YA+      + V+ T    A  +WS  T +SF + + Y  AD++   + G+HG
Sbjct  175   EGTQELTYAFDPDNALDDVSKTVFGNAFSRWSEVTTISFRETSSYAAADIRIGFYGGDHG  234

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLL  931
             DG+ FDG  G +AH+F PT G  HLDS E W   G          VD++SV  HE GHLL
Sbjct  235   DGEPFDGVLGTLAHAFSPTNGRFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLL  294

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS VE A+MYP I     K  L+ DDI GI+ LY
Sbjct  295   GLGHSSVEDAIMYPTITARTRKVELNEDDILGIQVLY  331



>dbj|BAE98757.1| predicted GPI-anchored protein [Arabidopsis thaliana]
Length=378

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 153/280 (55%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NFNLN 
Sbjct  47    FTGCHHGQNVDGLYRIKKYFQRFGYI---PETFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  104   TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WP ++  L+YA+    P   E  +    A  +WS  T L+F     ++ +D+    + G+
Sbjct  164   WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  224   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|XP_006300509.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
 gb|EOA33407.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
Length=380

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 152/280 (54%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  49    FTGCHHGQNVDGLYRIKKYFQRFGYI---PETFSGNFTDDFDDVLKTAVELYQRNFRLNV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  106   TGELDALTIKHIVIPRCGNPDVVNGTSLMHNGRRKTFEVNFSRSHLHAVKRYTLFPGEPR  165

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WP ++  L+YA+    P   E  +    A  +WS  T L+F    D+ ++D+    + G+
Sbjct  166   WPRNRRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTPSEDFTSSDITIGFYTGD  225

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  226   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  285

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G  K  L NDD++GI+ LY
Sbjct  286   HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  325



>ref|NP_177174.1| matrix metalloproteinase [Arabidopsis thaliana]
 gb|AAB61099.1| Similar to Glycine metalloendoproteinase (gb|U63725) [Arabidopsis 
thaliana]
 gb|AEE35027.1| matrix metalloproteinase [Arabidopsis thaliana]
Length=378

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 153/280 (55%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NFNLN 
Sbjct  47    FTGCHHGQNVDGLYRIKKYFQRFGYI---PETFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  104   TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WP ++  L+YA+    P   E  +    A  +WS  T L+F     ++ +D+    + G+
Sbjct  164   WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  224   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>gb|EYU46223.1| hypothetical protein MIMGU_mgv1a025538mg [Erythranthe guttata]
Length=293

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/261 (43%), Positives = 153/261 (59%), Gaps = 14/261 (5%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINN-LPYNNTSPEANYFSDQLESAVRTFQANFN  451
             K L G+ KGD+ KGL +LK YLK  GYIN+ +P N      ++F D LE A++ +Q  +N
Sbjct  42    KALSGTHKGDKSKGLNKLKEYLKNLGYINSKIPTNKYD---DFFDDTLELAIKKYQEFYN  98

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGT  631
             +  TG LD  TV+LM+KPRCGV D++         Y  L G   WP +K  L+Y+    T
Sbjct  99    IKITGFLDPETVTLMLKPRCGVADLLTTNRTPFRSYYNLSGY-SWPPNKRNLTYSLPKDT  157

Query  632   PYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSF  811
               +  T   +AL +W   +  +F    D+ N+D+K      +HGDG  FDGP G++ HSF
Sbjct  158   RKDAYTPIVKALIKWVSVSPFNFTFTDDFENSDVKISFETRDHGDGYPFDGPYGVLGHSF  217

Query  812   QPTEGICHLDSEESW---AQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIG  982
              PT+G  H D+EE+W   A+ G +Y     + +V  HE GH+LGL HS  E ++MY YIG
Sbjct  218   YPTDGRLHFDAEENWKPFAEAGSFY-----LGTVALHELGHILGLAHSQDEKSIMYAYIG  272

Query  983   FGETKRVLDNDDIQGIKALYP  1045
              GE K  L  DDI GIK++YP
Sbjct  273   EGENKD-LTQDDIHGIKSIYP  292



>ref|XP_011003818.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 153/274 (56%), Gaps = 23/274 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G +KG  VKGL ELK +LK  GY     + +    ++ F +  ESA++T+Q N+ LN 
Sbjct  39    LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLNV  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII----------------GRRHRLVPQYSFLPGNPRWPD  592
             TG LDS+T+  +M PRCGVPD I                 R+   V  YSF  G PRWP 
Sbjct  98    TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  593   DKNALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
              K  L+Y +          E  ++   A Q+W+  T+ +F + +  + AD+     +G+H
Sbjct  158   SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDGPG I+AH+F PT+G  H D++E W+   P     VD++SV  HE GHLLGL 
Sbjct  218   GDGDPFDGPGRILAHAFAPTDGRLHYDADEKWS-TNPSTD-EVDLESVAVHEIGHLLGLD  275

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS  + ++M+  I  G  KR L  DDI GI+ALY
Sbjct  276   HSMDQNSIMFAEIPQGTIKRELGQDDIDGIRALY  309



>ref|XP_003628627.1| Matrix metalloproteinase-9 [Medicago truncatula]
 gb|AET03103.1| matrix metalloproteinase [Medicago truncatula]
Length=373

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 151/282 (54%), Gaps = 29/282 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             +   G ++G+   GL  LK Y + FGYI   P +N S +     D L+ A++T+Q NFNL
Sbjct  47    RNFTGCRQGENYNGLSNLKNYFQHFGYIPRSPKSNFSDDF---DDDLQEAIKTYQKNFNL  103

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG--------------------RRHRLVPQYSFLPG  574
             N TG LD  T+  +M PRCGV DII                      R   V  ++  PG
Sbjct  104   NVTGELDDMTLRQVMLPRCGVADIINGTTTMNAGKDTETTSNSDSKLRFHTVSHFTVFPG  163

Query  575   NPRWPDDKNALSYAWGDGTPY-EFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP+ K  L+YA+  G    E V S    A  +WS  T L F + T Y+ AD+K   F
Sbjct  164   QPRWPEGKQELTYAFFPGNELTETVKSVFATAFARWSEVTTLKFTETTLYSGADIKIGFF  223

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHE  916
              G+HGDG+ FDG  G +AH+F P  G  HLD+ E W   G       P  VD++SV  HE
Sbjct  224   NGDHGDGEPFDGSLGTLAHAFSPRNGRFHLDAAEDWVVSGDVSKSSLPTAVDLESVAVHE  283

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS  E A+M+P I     K VL +DD++GI+ LY
Sbjct  284   IGHLLGLGHSSEEEAIMFPTISSRMKKVVLADDDVRGIQYLY  325



>ref|XP_006304956.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
 gb|EOA37854.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
Length=381

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 153/282 (54%), Gaps = 31/282 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G++  GLY+LK Y + FGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  49    FTGCHAGNKYDGLYKLKQYFQHFGYI---PETFSGNFTDDFDDILKNAVEMYQRNFRLNV  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPGNP  580
             TGVLD  T+  ++ PRCG PD++                    G+R   V +YSF PG P
Sbjct  106   TGVLDELTLKQVVIPRCGNPDVVNGTSTMHSGRRTYEVSFSGGGQRFHAVKRYSFFPGEP  165

Query  581   RWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             RWP  +  L+YA+   +    E  T    A  +W+  T L+F     ++N+D+    ++G
Sbjct  166   RWPRHRRDLTYAFNPRNMLTEEVKTVFSRAFARWAEVTPLTFTRVESFSNSDIFIGFYSG  225

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGP------YYPYGVDIQSVVTHE  916
             EHGDG+ FDGP   +AH+F P  G  HLD EE+W   G         P  VD++SV  HE
Sbjct  226   EHGDGEPFDGPMRTLAHAFSPPTGHFHLDREENWIISGEGGDGVISVPEAVDLESVAVHE  285

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS VE ++MYP I  G+ K  L  DD++G++ LY
Sbjct  286   IGHLLGLGHSSVEGSIMYPTIMTGKRKVDLTTDDVEGVQYLY  327



>ref|XP_010110202.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXC25440.1| Metalloendoproteinase 1 [Morus notabilis]
Length=332

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 154/292 (53%), Gaps = 42/292 (14%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY--------FSDQLESAVRTF  436
             L G  KG+ V GL ELK YL+RFGY+++    N +   NY        F D LESA++ +
Sbjct  43    LTGGHKGEIVPGLSELKQYLQRFGYLDSEAVENVAEAQNYDDVNSIDYFDDVLESAIKAY  102

Query  437   QANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------------  547
             Q N+NLN TG LD  TV  MM PRCG PD +                             
Sbjct  103   QRNYNLNVTGTLDPPTVRQMMLPRCGFPDTVNGTTSFPISHDHDHDHDHNHDHDHVHKQL  162

Query  548   ---VPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTK----EALQQWSGWTRLSFND  706
                V  YSF  G+PRW  +K  L+Y +  G      ++ +     A Q+W+  TR +F +
Sbjct  163   IHGVRHYSFFRGSPRW--NKYQLTYRFVAGVQVPGTSNIRSIVYRAFQRWARVTRFTFTE  220

Query  707   QTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG  886
                   +D+    F G HGD   FDG GG IAH++ P+ G  H D++E W++  P Y Y 
Sbjct  221   VASNVQSDISIGFFRGYHGDNAPFDGTGGTIAHAYAPSVGWFHYDADEYWSE-NPNY-YQ  278

Query  887   VDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             +D++SV  HE GHLLGL HS V AA+MYP I  G  KR L+ DDI GI+ALY
Sbjct  279   MDLESVAVHEIGHLLGLDHSTVAAAIMYPSINSGAIKRELNADDINGIRALY  330



>emb|CDY23516.1| BnaC06g24850D [Brassica napus]
Length=373

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 151/276 (55%), Gaps = 25/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL+ +K Y +RFGYI   P   T    + F D L++AV  +Q NF LN 
Sbjct  47    FTGCHHGQNVDGLFRIKKYFQRFGYI---PQTYTGNFTDDFDDILKAAVELYQKNFGLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------------GRRHRL--VPQYSFLPGNPRWPDD  595
             TG LD+ T+  ++ PRCG PD++             GR  RL  V  Y+  PG PRWP D
Sbjct  104   TGELDALTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  596   KNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             +  L+YA+    P   E       A  +W+  T L+F +   +  +D+    + G+HGDG
Sbjct  164   RRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETGHLLG  934
             + FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE GHLLG
Sbjct  224   EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>ref|NP_001142095.1| hypothetical protein precursor [Zea mays]
 gb|ACF87634.1| unknown [Zea mays]
 gb|AFW85192.1| hypothetical protein ZEAMMB73_264759 [Zea mays]
Length=370

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/277 (39%), Positives = 152/277 (55%), Gaps = 26/277 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G++ +GL ++K YL RFGY   LP  ++    + F   LE A++ +Q NF L  
Sbjct  52    LTGCHLGEQQQGLAKVKDYLSRFGY---LPPESSGSFNDVFDADLEEAIKVYQRNFGLGI  108

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ--------------YSFLPGNPRWPDDK  598
             TGV+D++TV+ MM PRCGV DII     +                 +++ PG+P WP  +
Sbjct  109   TGVMDASTVAQMMAPRCGVADIINGTSTMGGGSASASAAHARGRNLFTYFPGSPSWPRSR  168

Query  599   NALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
              +L+YA    +      +T       A  +WS  T L+F +     +AD+    +AG+HG
Sbjct  169   KSLTYAVTQTSLTSIDRATLSQVLARAFARWSAATTLTFTETASERDADITIGFYAGDHG  228

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLL  931
             DG+AFDGP G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLL
Sbjct  229   DGEAFDGPLGTLAHAFSPTDGRFHLDAAEAWDASGDVARAASDVAVDLESVAVHEIGHLL  288

Query  932   GLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GLGHS   AA+M+P I    +K  L  DD+ GI+ LY
Sbjct  289   GLGHSAEPAAIMFPTITSRTSKVDLAQDDVAGIQNLY  325



>gb|EYU46221.1| hypothetical protein MIMGU_mgv1a010535mg [Erythranthe guttata]
Length=309

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 148/268 (55%), Gaps = 14/268 (5%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN--YFSDQLESAVRTFQANF  448
             K L G +KG+  KGL  LK YL   GY+N        P AN   F + LE A+R +Q+ F
Sbjct  44    KNLVGIRKGNSAKGLSHLKNYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFF  103

Query  449   NLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ---------YSFLPGNPRWPDDKN  601
              L  TG+LD +TV  +M+PRCGV D     ++ + Q         Y+F PG P WP  K 
Sbjct  104   KLKVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKR  163

Query  602   ALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD  781
             +L+Y++  GT  +       A   W   +   F    DY NAD+K      +HGDG  FD
Sbjct  164   SLTYSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFD  223

Query  782   GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAA  961
             GP GI+AH+F PT+G  H+D +E W      Y    D+Q+V  HE GH+LGL H+G   A
Sbjct  224   GPLGILAHAFAPTDGRLHMDGDEKWCD--GVYEGQFDMQTVGLHEMGHILGLMHTGDVGA  281

Query  962   VMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             VMYPYIG   +++ L  DD+ GIKALYP
Sbjct  282   VMYPYIG-PNSRKGLGQDDVDGIKALYP  308



>ref|XP_011003815.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 153/274 (56%), Gaps = 23/274 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G +KG  VKGL ELK +L+  GY     + +    ++ F +  ESA++T+Q N+ LN 
Sbjct  39    LEGCQKGQNVKGLKELKHHLRNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLNV  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII----------------GRRHRLVPQYSFLPGNPRWPD  592
             TG LDS+T+  +M PRCGVPD I                 R+   V  YSF  G PRWP 
Sbjct  98    TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  593   DKNALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
              K  L+Y +          E  ++   A Q+W+  T+ +F + +  + AD+     +G+H
Sbjct  158   SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLG  940
             GDG  FDGPG I+AH+F PT+G  H D++E W+   P     VD++SV  HE GHLLGL 
Sbjct  218   GDGDPFDGPGRILAHAFAPTDGRLHYDADEKWS-TNPRTD-EVDLESVAVHEIGHLLGLD  275

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS  + ++M+  I  G  KR L  DDI GI+ALY
Sbjct  276   HSMDQNSIMFAEIPQGTIKRELGQDDIDGIRALY  309



>gb|EYU46222.1| hypothetical protein MIMGU_mgv1a027058mg, partial [Erythranthe 
guttata]
Length=284

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 147/268 (55%), Gaps = 14/268 (5%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN--YFSDQLESAVRTFQANF  448
             K L G +KG   KGL  LK YL   GY+N        P AN   F + LE A+R +Q+ F
Sbjct  19    KNLVGIRKGTTAKGLSHLKSYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFF  78

Query  449   NLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ---------YSFLPGNPRWPDDKN  601
              L  TG+LD +TV  +M+PRCGV D     ++ + Q         Y+F PG P WP  K 
Sbjct  79    KLKVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKR  138

Query  602   ALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD  781
             +L+Y++  GT  +       A   W   +   F    DY NAD+K      +HGDG  FD
Sbjct  139   SLTYSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFD  198

Query  782   GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAA  961
             GP GI+AH+F PT+G  H+D +E W      Y    D+Q+V  HE GH+LGL H+G   A
Sbjct  199   GPLGILAHAFAPTDGRLHMDGDEKWCD--GVYEGQFDMQTVGLHEMGHILGLMHTGDVGA  256

Query  962   VMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             VMYPYIG   +++ L  DD+ GIKALYP
Sbjct  257   VMYPYIG-PNSRKGLGQDDVDGIKALYP  283



>ref|XP_010415694.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 150/280 (54%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  48    FTGCHHGQNVDGLYRIKKYFQRFGYI---PETFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  105   TGELDAFTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRSRLHAVKRYTLFPGEPR  164

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WP D+  L+YA+    P   E       A  +WS  T L+F     ++ +D+    + G+
Sbjct  165   WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  225   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G  K  L NDD++GI+ LY
Sbjct  285   HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_002887284.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63543.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 153/280 (55%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V+GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  47    FTGCHHGQNVEGLYRIKKYFQRFGYI---PETFSGNFTDDFDDILKTAVELYQRNFKLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  104   TGELDAMTIKHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WP ++  L+YA+    P   E  +    A  +WS  T L+F     ++ +D+    + G+
Sbjct  164   WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSDSFSTSDITIGFYTGD  223

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  224   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|XP_006390919.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
 gb|ESQ28205.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
Length=383

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 151/285 (53%), Gaps = 34/285 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL  +K Y +RFGYI   P   +    + F D L+SAV  +Q NF LN 
Sbjct  47    FTGCHHGQNVDGLNRIKKYFQRFGYI---PETFSGNFTDDFDDILKSAVELYQKNFRLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII----------------------GRRHRL--VPQYSFL  568
             TG LD+ T+  ++ PRCG PD++                      GRR R   V +Y+  
Sbjct  104   TGELDALTIKHIVIPRCGNPDVVNGTSLMHGERRRKTFEVNFSPGGRRPRFHSVKRYTLF  163

Query  569   PGNPRWPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYH  742
             PG PRWP D+  L+YA+    P   E  +    A  +WS  T L+F     ++ AD+   
Sbjct  164   PGEPRWPSDRRDLTYAFDPRNPLTEEVKSVFSRAFGRWSEVTELNFTKIESFSTADITIG  223

Query  743   LFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVV  907
              + G+HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV 
Sbjct  224   FYTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVA  283

Query  908   THETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              HE GHLLGLGHS VE ++MYP I  G  K  L NDD++GI+ LY
Sbjct  284   VHEIGHLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  328



>ref|NP_001151749.1| metalloendoproteinase 1 precursor [Zea mays]
 gb|ACG44214.1| metalloendoproteinase 1 precursor [Zea mays]
Length=365

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 152/273 (56%), Gaps = 21/273 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F   LE+A+ T+Q NF LN+
Sbjct  46    LSGCHMGEERQGLAGLKDYLSHFGYLPPPPPSSPFSDA--FDQNLEAAIATYQRNFGLNA  103

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ----------YSFLPGNPRWPDDKNALS  610
             TG LD +TVS M+ PRCGV D+I     +             Y++ PG P WP  +  L 
Sbjct  104   TGALDPSTVSQMVAPRCGVADVINGTSTMARSSSADAHGRHLYAYFPGGPTWPPFRRDLK  163

Query  611   YAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             YA    +      ST       A  +W+  T L F +    ++AD+    ++G HGDG+ 
Sbjct  164   YAITATSAASIDRSTLSDVFARAFSRWAAATNLRFAETASESDADITIGFYSGSHGDGEP  223

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYG-VDIQSVVTHETGHLLGLGH  943
             FDGP G +AH+F PT+G  HLD+ E+W   + V      G VD++SV  HE GHLLGLGH
Sbjct  224   FDGPLGTLAHAFSPTDGRFHLDAAEAWVAGSDVSRSSATGAVDLESVAVHEIGHLLGLGH  283

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S V  A+MYP I  G  K  L+ DD+QGI++LY
Sbjct  284   SSVPDAIMYPTIRTGTRKVELEADDVQGIQSLY  316



>emb|CDY11609.1| BnaC06g31300D [Brassica napus]
Length=373

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 151/276 (55%), Gaps = 25/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL+ +K Y +RFGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  47    FTGCHHGQNVDGLFRIKKYFQRFGYI---PETYSGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-------VPQYSFLPGNPRWPDD  595
             TG LD+ T+  ++ PRCG PD++        GRR          V  Y+  PG PRWP D
Sbjct  104   TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  596   KNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             +  L+YA+    P   E  +    A  +WS  T L+F +   +  +D+    + G+HGDG
Sbjct  164   RRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETGHLLG  934
             + FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE GHLLG
Sbjct  224   EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE ++MYP I  G+ K  L +DD++GI+ LY
Sbjct  284   LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>emb|CBI34987.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 157/269 (58%), Gaps = 17/269 (6%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN---YFSDQLESAVRTFQAN  445
             K LQGS+KGD+V+G++++K YL+ FGY+ +  ++ T  + +   +F D LESA++ FQ  
Sbjct  30    KDLQGSQKGDKVEGIHKVKKYLQHFGYLGST-HSQTETQVDSEDHFDDALESAIKAFQTY  88

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPD---------IIGRRH-RLVPQYSFLPGNPRWPDD  595
             ++L  TG+LD+ T + M + RCGVPD           G  H  +   Y+F P  PRWP  
Sbjct  89    YHLKPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAG  148

Query  596   KNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             K  L Y+    +  E   +   A   W+G T  +F   +D   A+L       +HGDG+ 
Sbjct  149   KRHLLYSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKVRDHGDGRP  208

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
             FDG GGI+AH+F PT+G  H D +E+W  +G      +D+Q+V  HE GHLLGL H+ V+
Sbjct  209   FDGRGGILAHAFAPTDGRFHFDGDETWV-IGA-VANSMDLQTVARHEIGHLLGLAHTPVQ  266

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+MY  I  G TK  L+ DDI GI+ALY
Sbjct  267   EAIMYAIISPGVTKG-LNQDDIDGIRALY  294



>ref|XP_007157519.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
 gb|ESW29513.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
Length=377

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 146/274 (53%), Gaps = 23/274 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G + G    GL  LK Y   FGYI   P +N + +   F D LE+AV+ +Q NFNLN 
Sbjct  60    FTGCRHGKAYDGLSNLKNYFHYFGYIPTAPPSNFTDD---FDDALEAAVKAYQKNFNLNI  116

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG--------------RRHRLVPQYSFLPGNPRWPDDK  598
             TG LD  T+  +++PRCGV D+I                +   V  YSF  G PRWP   
Sbjct  117   TGELDDATMQQIVRPRCGVADVINGTTTMNGKSNTTTTPKFHTVAHYSFFDGMPRWPQGT  176

Query  599   NALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+YA+   +G           A ++W+  T +SF++ + Y  AD+    ++G+HGDG+
Sbjct  177   EELTYAFEPDNGLDDTVKGVFSNAFKRWAEVTTISFSEASSYAVADITIGFYSGDHGDGE  236

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLG  940
              FDG  G +AH+F PT G+ HLD  E W   G          VD++SV  HE GHLLGLG
Sbjct  237   PFDGVLGTLAHAFSPTNGMFHLDEAEDWVATGDVTEASMSNAVDLESVAVHEIGHLLGLG  296

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS +E A+MYP I     K  L  DDI+GI+ LY
Sbjct  297   HSSIEEAIMYPTISAKTRKVELAEDDIEGIQVLY  330



>ref|XP_002275671.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=303

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 157/269 (58%), Gaps = 17/269 (6%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN---YFSDQLESAVRTFQAN  445
             K LQGS+KGD+V+G++++K YL+ FGY+ +  ++ T  + +   +F D LESA++ FQ  
Sbjct  37    KDLQGSQKGDKVEGIHKVKKYLQHFGYLGST-HSQTETQVDSEDHFDDALESAIKAFQTY  95

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPD---------IIGRRH-RLVPQYSFLPGNPRWPDD  595
             ++L  TG+LD+ T + M + RCGVPD           G  H  +   Y+F P  PRWP  
Sbjct  96    YHLKPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAG  155

Query  596   KNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             K  L Y+    +  E   +   A   W+G T  +F   +D   A+L       +HGDG+ 
Sbjct  156   KRHLLYSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKVRDHGDGRP  215

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
             FDG GGI+AH+F PT+G  H D +E+W  +G      +D+Q+V  HE GHLLGL H+ V+
Sbjct  216   FDGRGGILAHAFAPTDGRFHFDGDETWV-IGA-VANSMDLQTVARHEIGHLLGLAHTPVQ  273

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+MY  I  G TK  L+ DDI GI+ALY
Sbjct  274   EAIMYAIISPGVTKG-LNQDDIDGIRALY  301



>ref|XP_010320628.1| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=357

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 151/266 (57%), Gaps = 21/266 (8%)
 Frame = +2

Query  287   GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             G + G ++KGL ++K Y +RFGYI++   N+ + E   F   L SA++++Q NFNLN TG
Sbjct  51    GCRVGQKIKGLAKIKQYFQRFGYIDDSLSNDFTDE---FDQLLLSALKSYQLNFNLNVTG  107

Query  467   VLDSNTVSLMMKPRCGVPDIIGRRH-------RLVPQYSFLPGNPRWPDDKNALSYAW--  619
               D +T+  M+KPRCG PDI  + +         V  +SF  G  RWP  K+ L YA+  
Sbjct  108   EFDFSTLQNMVKPRCGNPDIAKKGYGGKTPMDHTVAHFSFFEGQRRWPSSKSKLKYAFLP  167

Query  620   ----GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGP  787
                  D     F    + A  +WS  T L+F +   Y +AD++   F  +HGDG  FDGP
Sbjct  168   ENQLTDSVKLAF----RRAFDKWSKVTPLTFKEMGSYRSADIRIGFFVRDHGDGNPFDGP  223

Query  788   GGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG-VDIQSVVTHETGHLLGLGHSGVEAAV  964
               ++AH+F P  G  HLD EE+W   G Y   G VD++SV  HE GHLLGL HS  + AV
Sbjct  224   MKVLAHAFAPPIGFFHLDGEENWMVDGEYLKEGMVDLESVAVHEIGHLLGLDHSFEKDAV  283

Query  965   MYPYIGFGETKRVLDNDDIQGIKALY  1042
             M+P +  G  K  L  DDI+G++ LY
Sbjct  284   MFPTLEDGTRKVELSRDDIEGVQMLY  309



>ref|XP_009410261.1| PREDICTED: metalloendoproteinase 1 [Musa acuminata subsp. malaccensis]
Length=361

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 148/272 (54%), Gaps = 21/272 (8%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L G + G+   GL +LK YL +FGY+   P N T    N F D LE+A++T+Q NF L
Sbjct  43    RNLSGCRFGEHRPGLADLKEYLNQFGYLPAAP-NFT----NSFDDNLEAAIKTYQRNFGL  97

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ-------YSFLPGNPRWPDDKNALSY  613
             N TG LD  TV  ++ PRCG+PDII     +          Y++ PG P WP DK  L Y
Sbjct  98    NVTGELDDATVEQLIVPRCGMPDIINGTSTMNSSFVRGRNLYAYFPGTPTWPSDKTELKY  157

Query  614   AWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
             A    +      S        A  +WS  T L+F +    ++AD+    + G HGDG+ F
Sbjct  158   AITATSAVSIDLSVLKTVFARAFGRWSAATTLTFTETDSSSDADITIGFYNGSHGDGEPF  217

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYP----YGVDIQSVVTHETGHLLGLGHS  946
             DG  G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLLGLGHS
Sbjct  218   DGVLGTLAHAFSPTDGRFHLDAAETWVAEGDVTQADSDVAVDLESVAVHEIGHLLGLGHS  277

Query  947   GVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              V  A+MYP I     K  L +DD++GI+ LY
Sbjct  278   SVAEAIMYPTIKTRTKKVDLASDDVEGIQNLY  309



>ref|XP_011010763.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=308

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 155/272 (57%), Gaps = 22/272 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLE--SAVRTFQANFN  451
             L  S+KG  V  L+ +K YLK+FGY++ +L  N    + +         SA+RT+Q NF+
Sbjct  39    LVESQKGQSVSKLHLVKQYLKKFGYLDYDLSSNKNRNQVDDDEFDDLLESAIRTYQQNFH  98

Query  452   LNSTGVLDSNTVSLMMKPRCGVPDIIGR-RHRLVPQ---------YSFLPGNPRWPDDKN  601
             L  TG LD  TV+ MMKPRCGV DI    +HR   +         YSF PG PRW   K 
Sbjct  99    LEVTGRLDKRTVNQMMKPRCGVADIFNSTKHRNSSKSSDGVANADYSFFPGAPRW--SKK  156

Query  602   ALSYAWGDGTPYEFVTS----TKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
              L Y +G         S     K++ Q+W+  T  +F +  +  +AD+K   +  +HGD 
Sbjct  157   HLKYTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDD  216

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             + FDGPGGI AH F+PT G+ H D++E+W+         +D++SV  HE GHLLGLGHSG
Sbjct  217   EPFDGPGGIFAHGFRPTIGMLHFDADETWSSNPGRLE--LDLESVAVHEIGHLLGLGHSG  274

Query  950   VEA-AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
                 A+MYPY  +G+TKR L  DDI GI+ LY
Sbjct  275   DHPDAIMYPYFDYGKTKRNLQEDDIDGIRDLY  306



>emb|CDX68356.1| BnaA07g23960D [Brassica napus]
Length=373

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 151/276 (55%), Gaps = 25/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL+ +K Y +RFGYI   P   T    + F D L++AV  +Q NF L+ 
Sbjct  47    FTGCHHGQNVDGLFRIKKYFQRFGYI---PETYTGNFTDDFDDILKAAVELYQKNFRLDV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII-------------GRRHRL--VPQYSFLPGNPRWPDD  595
             TG LD+ T+  ++ PRCG PD++             GR  RL  V  Y+  PG PRWP D
Sbjct  104   TGELDAPTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  596   KNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             +  L+YA+    P   E       A  +W+  T L+F +   +  +D+    + G+HGDG
Sbjct  164   RRDLTYAFDPRNPLTNEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETGHLLG  934
             + FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE GHLLG
Sbjct  224   EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>gb|EYU35921.1| hypothetical protein MIMGU_mgv1a019701mg [Erythranthe guttata]
Length=304

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 148/262 (56%), Gaps = 12/262 (5%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G +KG + KGL ELK +L   GY+ N      +   + F D LE A++ +Q  F+LN 
Sbjct  45    LVGVRKGQKAKGLVELKTHLSNLGYMKNNNNEAKA-NNDLFDDDLELAIKKYQVFFHLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHR--------LVPQYSFLPGNPRWPDDKNALSYA  616
              G+LD+ TV  ++ PRCGV D +             +   Y+F PG P+WP  K  L+Y+
Sbjct  104   NGILDAKTVEHLLLPRCGVADFVNLNASQFKNEIPTIASHYTFFPGEPKWPPGKTNLTYS  163

Query  617   WGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGI  796
             +  G   E + + K+A Q W+G T   F   TDY++AD+K      +H DG AFDG GGI
Sbjct  164   FPPGASNEVMQAIKDATQLWAGVTHFKFTYITDYDHADIKISFQVWDHKDGAAFDGRGGI  223

Query  797   IAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             +AH+F P++G  H D +E W  V    P   D+Q V  HE GH+LGLGH+    A+M P 
Sbjct  224   LAHAFAPSDGRLHFDGDEVW--VDGVVPGKFDLQMVGLHELGHVLGLGHTTDGGAIMTPT  281

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +G G  ++ L  DDI GIKALY
Sbjct  282   LGSG-FRKGLGQDDINGIKALY  302



>ref|XP_007044491.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY00323.1| Matrixin family protein, putative [Theobroma cacao]
Length=369

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 150/278 (54%), Gaps = 26/278 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K   G + G++  GL +LK Y   FGYI N P N     ++ F+D+LE A++ +Q NFNL
Sbjct  49    KKFAGCQSGEKRDGLSKLKQYFNNFGYIPNSPTN----FSDDFNDELEKALKIYQQNFNL  104

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGR----------------RHRLVPQYSFLPGNPRW  586
             N TG LD  T+  +++PRCG  DI+                    R    Y+F PG P W
Sbjct  105   NVTGQLDDQTLQQIVRPRCGNADIVNGTSSMNSGKSSSFHTTGHFRTTAHYAFFPGRPFW  164

Query  587   PDDKNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             P ++  L+Y +   +    E       A ++WS  T L+F     + +AD+K   ++G+H
Sbjct  165   PANRRDLTYGFLPANELSDEVKAVFTRAFEKWSAVTPLTFTQTDSFFSADIKIAFYSGDH  224

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPY----YPYGVDIQSVVTHETGHL  928
             GDG+ FDG  G +AH+F PT G  HLD  E+W   G          VD++SV  HE GHL
Sbjct  225   GDGEPFDGVLGTLAHAFSPTNGRFHLDLAENWVVSGDVTTSSLSSAVDLESVAVHEIGHL  284

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE A+M+P I     K  L NDD+ GI++LY
Sbjct  285   LGLGHSSVEDAIMFPTISSRTRKVELANDDVDGIQSLY  322



>ref|XP_004143787.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004157318.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN51182.1| hypothetical protein Csa_5G484630 [Cucumis sativus]
Length=366

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 153/276 (55%), Gaps = 25/276 (9%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K L+G + GD   GL  LK YL RFGYI + P N T    + F   L+SA++T+Q NFNL
Sbjct  44    KKLKGCRPGDRFNGLSNLKTYLNRFGYIPSSP-NFT----DLFDPLLQSALKTYQTNFNL  98

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL---------------VPQYSFLPGNPRWP  589
             N+TG+LD  T++ +  PRCG+PDII     +               V  YSF PG P WP
Sbjct  99    NATGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGQPTGRQSPHFHSVSHYSFFPGRPIWP  158

Query  590   DDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHG  763
               +  L+YA+    P   E       A  +W+  T L+F+    + +AD++   +AG+HG
Sbjct  159   AHRRDLTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRSADIRIGFYAGDHG  218

Query  764   DGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYP---YGVDIQSVVTHETGHLLG  934
             DG+ FDG  G +AH+F P  G  HLD +ESW   G         +D++SV  HE GHLLG
Sbjct  219   DGEPFDGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLG  278

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE ++M+P I     K  L  DDI GI+ LY
Sbjct  279   LGHSSVEESIMFPTITSRTRKVDLAADDINGIQELY  314



>ref|XP_006367952.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=369

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 149/269 (55%), Gaps = 24/269 (9%)
 Frame = +2

Query  287   GSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             G + G ++KGL ++K Y + FGYI+N   N+ + E   F   L SA++T+Q NFNLN TG
Sbjct  60    GCRVGQKIKGLAKIKQYFQHFGYIDNSLSNDFTDE---FDQLLFSALKTYQLNFNLNITG  116

Query  467   VLDSNTVSLMMKPRCGVPDII-GRRH---------RLVPQYSFLPGNPRWPDDKNALSYA  616
               D  T+  M+KPRCG PDI+ G  H           V  +SF  G PRWP  K+ L YA
Sbjct  117   EFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKYA  176

Query  617   W------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
             +       D     F    + A  +WS  T L+F +   Y  AD++   F  +HG+G  F
Sbjct  177   FLPENQLTDSVKVAF----RRAFDKWSKVTPLTFKEMDSYRLADIRIGFFVRDHGNGNPF  232

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG-VDIQSVVTHETGHLLGLGHSGVE  955
             DGP  I+AH+F P  G  HLD EE+W   G Y   G VD++SV  HE  HLLGL HS  +
Sbjct  233   DGPMKILAHTFAPPTGFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIRHLLGLDHSFEK  292

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+M+P +  G  K  L  DDI+G++ LY
Sbjct  293   EAIMFPTLEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_008798076.1| PREDICTED: metalloendoproteinase 1-like, partial [Phoenix dactylifera]
Length=410

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 152/270 (56%), Gaps = 22/270 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+   GL +LK YL RFGY   LP +N +   + F D LE A+RT+Q NF LN+
Sbjct  48    LSGCHPGENRAGLADLKDYLSRFGY---LPTSNFT---DAFDDALEEALRTYQQNFGLNA  101

Query  461   TGVLDSNTVSLMMKPRCGVPDII----GRRHRLVP---QYSFLPGNPRWPDDKNALSYAW  619
             TG LD +TV+ ++ PRCGV DI+      R   +P    Y++ PGNP WP  K  L+YA 
Sbjct  102   TGSLDDSTVNQLIIPRCGVADIVNGTSSMRSAKLPGRNLYAYFPGNPTWPSWKRDLTYAL  161

Query  620   GDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDG  784
                +     TS        A  +WS  T L+F +    ++AD+K   ++G+HGDG+ FDG
Sbjct  162   VSTSAVSIDTSAISTVFARAFGRWSAATTLTFTETDSASDADIKIGFYSGDHGDGEPFDG  221

Query  785   PGGIIAHSFQPTEGICHLDSEESWAQVGPYY----PYGVDIQSVVTHETGHLLGLGHSGV  952
               G +AH+F PT+G  HLD+ E W   G          VD++SV  HE GHLLGLGHS  
Sbjct  222   VLGTLAHAFSPTDGRFHLDAAEQWVADGDVTEASSSVAVDLESVAVHEIGHLLGLGHSSE  281

Query  953   EAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
               A+MYP I     K  L +DD+ GI+ LY
Sbjct  282   AEAIMYPTIKTRTKKVELASDDVDGIQNLY  311



>ref|XP_010264870.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=318

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 154/281 (55%), Gaps = 35/281 (12%)
 Frame = +2

Query  284   QGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNST  463
             +G  KGD VKGL ++K YL+RFGY+++   ++   + +     LESA++T+Q N+NL  T
Sbjct  42    EGCHKGDRVKGLNQVKRYLQRFGYLDHHNDDDDDFDHH-----LESAIKTYQLNYNLKET  96

Query  464   GVLDSNTVSLMMKPRCGVPDII---------------------GRRHRL--VPQYSFLPG  574
             G LD  TV  MM PRCGVPDII                     GR+  L     Y+F   
Sbjct  97    GSLDVATVKQMMLPRCGVPDIIKGETWMRSGKEKKEKRLLGVSGRKTTLGFSSHYTFFNN  156

Query  575   NP--RWPDDKNALSYAWGDGTPYEFVTS---TKEALQQWSGWTRLSFNDQTDYNNADLKY  739
              P  +WP  K  L Y      P + +        A  +W+  +  +F +  D ++AD+++
Sbjct  157   TPTPKWPPYKMHLKYVLDSTVPVDDLLMHPLCYVAFARWAAVSNFTFEETQDLSSADIRF  216

Query  740   HLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHET  919
               F G+HGDG  FDGPGG++AH++ P +G  H DSEE W   G    + +D  SV  HE 
Sbjct  217   SFFKGDHGDGNPFDGPGGVLAHAYAPIDGRVHFDSEERWT-TGIRADW-IDTASVAMHEI  274

Query  920   GHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHLLGLGHS    AVM+PYI  G  K  L  DDIQGI++LY
Sbjct  275   GHLLGLGHSSEHGAVMFPYIDVGSQKVNLHPDDIQGIQSLY  315



>ref|XP_011085865.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=283

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 153/280 (55%), Gaps = 36/280 (13%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYI---NNLPYNNTSPEANYFSDQLESAVRTFQAN  445
             K L+G  KG++ K ++ LK YL +FGY+   N +  NN     N F D LESA++ +Q  
Sbjct  14    KHLEGCHKGNKTKDIHHLKHYLHQFGYLDYPNQIHANN-----NDFDDLLESALKEYQRY  68

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVP-------------------QYSFL  568
             +N+N TG +D+ T++ M+ PRCG  DI+   + ++P                   QYSF 
Sbjct  69    YNINPTGAVDAETIAKMVIPRCGNRDIVHGTNTMLPRPNKKENSNSSTNSIHTVSQYSFF  128

Query  569   PGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
             PGN RW   K  L+Y +   TP   +     A  +W   T  +F+   +    DL     
Sbjct  129   PGNLRW--SKTHLTYGFSPNTPTATIDPVIRAFAKWDSATHFTFSRAQNNQRPDLIIGFH  186

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYG--VDIQSVVTHETG  922
               +HGDG  FDGPGG IAH+F P++G  H DS+E+W+      P G    +++V  HE G
Sbjct  187   RRDHGDGSPFDGPGGTIAHAFAPSDGRFHYDSDEAWSMS----PVGNAFHLETVALHEIG  242

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS V  A+MYP I  G TK  L  DDIQGIKALY
Sbjct  243   HLLGLGHSSVADAIMYPSISRGATKN-LHADDIQGIKALY  281



>gb|KDP32993.1| hypothetical protein JCGZ_13024 [Jatropha curcas]
Length=306

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 147/262 (56%), Gaps = 11/262 (4%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K LQG  KGD++KG+ ELK YLK FGY+     N      +YF D LESA++ +Q N+ L
Sbjct  48    KRLQGCHKGDKIKGIQELKEYLKYFGYLRYK--NRAHANDDYFDDVLESAIKMYQQNYRL  105

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ------YSFLPGNPRWPDDKNALSYA  616
              +TG L S TVS MM PRCGV D+     +          Y+F PGNP+WP  K AL+Y 
Sbjct  106   KTTGSLTSETVSKMMMPRCGVADLTNGTIKKSSNAYHTSGYTFFPGNPKWPASKYALTYE  165

Query  617   WGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGI  796
                 TP   +   + A Q W+  T  +F+      N D+   L+ G+HGDG  FD  G I
Sbjct  166   LRYDTPPHLIPPLQNAFQAWANVTPFTFSPFHGRGNPDITIGLYKGDHGDGYPFDAFGAI  225

Query  797   IAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
              AHS+ P +G  H +S   +  +G  +P   D  +V +HE GHLLGLGHS  E A+MYP 
Sbjct  226   AAHSWPPQDGRLHFNSYGRFC-IGA-FPNLYDFGTVASHEIGHLLGLGHSRDEEAIMYPV  283

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
               FG  K +    DI+G++ALY
Sbjct  284   APFGRVKGI-HQYDIEGVRALY  304



>gb|EYU42526.1| hypothetical protein MIMGU_mgv1a011887mg [Erythranthe guttata]
Length=267

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 146/260 (56%), Gaps = 15/260 (6%)
 Frame = +2

Query  293   KKGDEVKGLYELKIYLKRFGYIN--NLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTG  466
             +KGD++KG+ ELK YL   GY+N  N   N      N F   L+ A++ +Q  +NLN TG
Sbjct  10    QKGDKIKGVVELKKYLTYLGYLNRNNCSNNQKIKSNNIFDKPLQLALKKYQKFYNLNVTG  69

Query  467   VLDSNTVSLMMKPRCGVPDIIGRRHRLVP------QYSFLPGNPRWPDDKNALSYAWGDG  628
             +LDS TV+ M KPRC +PD      + V        Y+FLPG PRW   K  L YA+   
Sbjct  70    ILDSKTVAKMHKPRCAMPDFYNHSCKNVKFLTTDSLYAFLPGQPRW--KKRILKYAFSAS  127

Query  629   TPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGI--IA  802
             TP E + + + A ++W+  T   F     ++ A ++     GEHGD   F GP  I  +A
Sbjct  128   TPKEAILAIELAFKEWASVTNFKFEPTRKFDGAHVRILFLHGEHGDDLPFGGPEPIGGVA  187

Query  803   HSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIG  982
             HS+ P  G  H D+   W+  G    +  DI++V  HE GH+LGLGHS    AVMYP + 
Sbjct  188   HSYPPPIGEVHFDAGLKWSNKGERNAF--DIKTVGLHELGHILGLGHSSDANAVMYPLVH  245

Query  983   FGETKRVLDNDDIQGIKALY  1042
              GETK+ LD DDI+GIKALY
Sbjct  246   LGETKK-LDADDIKGIKALY  264



>emb|CDY38799.1| BnaA07g28710D [Brassica napus]
Length=370

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 150/276 (54%), Gaps = 25/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL+ +K Y +RFGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  47    FTGCHHGQNVDGLFRIKKYFQRFGYI---PETYSGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-------VPQYSFLPGNPRWPDD  595
             TG LD+ T+  ++ PRCG PD++        GRR          V  Y+  PG PRWP D
Sbjct  104   TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  596   KNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             +  L+YA+    P   E       A  +WS  T L+F +   +  +D+    + G+HGDG
Sbjct  164   RRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETGHLLG  934
             + FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE GHLLG
Sbjct  224   EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS VE ++MYP I  G+ K  L +DD++GI+ LY
Sbjct  284   LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>ref|XP_010512095.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=378

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 149/280 (53%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NF L  
Sbjct  48    FTGCHHGQNVDGLYRIKKYFQRFGYI---PETFSGNFTDDFDDILKAAVELYQRNFRLKV  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  105   TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             WP D+  L+YA+    P   E       A  +WS  T L+F     ++ +D+    + G+
Sbjct  165   WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  225   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G  K  L NDD++GI+ LY
Sbjct  285   HLLGLGHSSVEDSIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>gb|EYU28648.1| hypothetical protein MIMGU_mgv1a008442mg [Erythranthe guttata]
Length=374

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 152/282 (54%), Gaps = 36/282 (13%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G  KG + +GL +LK Y + FGY+NN  Y N S +   F + LESAV+++Q NFNLN 
Sbjct  56    LTGCHKGVKSQGLPKLKKYFQFFGYLNN-SYTNFSDD---FDEYLESAVKSYQLNFNLNV  111

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------VPQYSFLPGNPRWP  589
             TG LD+ T++ ++ PRCG  DI+     +                 V  YSF P  PRWP
Sbjct  112   TGQLDAPTLNHIVLPRCGNADIVNGTSIMRSGKSPNTYSANSTIHTVAHYSFFPDRPRWP  171

Query  590   DDKNALSYAW------GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFA  751
                  L+YA+       D     F      A ++WS  T  +F +   + +ADLK   F 
Sbjct  172   PGTTQLTYAFLPENQLSDAVKGVF----SRAFERWSEVTAFTFVETASFYDADLKIAFFG  227

Query  752   GEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYY-----PYGVDIQSVVTHE  916
             G+HGDG+ FDG  G +AH+F P  G  HLD +E+W   G +         VD++SV  HE
Sbjct  228   GDHGDGEPFDGVMGTLAHAFAPPAGRFHLDGDENWVIDGNFLGAAASVAAVDLESVAVHE  287

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS VE A+MYP I     K  L NDDI GI+ LY
Sbjct  288   IGHLLGLGHSSVEEAIMYPTISSSTRKVELANDDIMGIQELY  329



>ref|XP_008465718.1| PREDICTED: metalloendoproteinase 1 [Cucumis melo]
Length=362

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 151/275 (55%), Gaps = 27/275 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANY---FSDQLESAVRTFQAN  445
             K L+G + GD + GL  LK YL  FGYI         P  N+   F   L+SA++T+Q N
Sbjct  44    KKLKGCRPGDRLNGLSNLKTYLNHFGYI--------PPSPNFTDLFDPLLQSALKTYQTN  95

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDIIGR-------RH----RLVPQYSFLPGNPRWPD  592
             FNLN+TG+LD  T++ +  PRCG+PDII         RH      V  Y+F PG P WP 
Sbjct  96    FNLNATGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGRHSPHFHSVSHYTFFPGRPIWPA  155

Query  593   DKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              +  L+YA+    P   E       A  +W+  T L+F+    +  AD++   +AG+HGD
Sbjct  156   HRRDLTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRTADIRIGFYAGDHGD  215

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYP---YGVDIQSVVTHETGHLLGL  937
             G+ FDG  G +AH+F P  G  HLD +ESW   G         +D++SV  HE GHLLGL
Sbjct  216   GEPFDGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGL  275

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             GHS VE ++M+P I     K  L  DDI GI+ LY
Sbjct  276   GHSSVEESIMFPTITSRTRKVDLAADDINGIQELY  310



>ref|XP_010255269.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=316

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/278 (41%), Positives = 150/278 (54%), Gaps = 30/278 (11%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L+GS+KGD VKGL E K YL RFGY+++   ++           LESA++T+Q  +NL
Sbjct  44    RHLEGSRKGDRVKGLNEAKRYLHRFGYLDHHNDDDDF------DHHLESAIKTYQLYYNL  97

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII-----------------GRRHRL--VPQYSFLPGN  577
             N TG LD  TV  MM PRCG PDII                 GR+  +     Y+F   +
Sbjct  98    NETGSLDFETVKQMMLPRCGFPDIINGETWMRSGKEKNRRLGGRKTAVGFSSHYAFFNNS  157

Query  578   PRWPDDKNALSYAWGDGTPYEFVTSTK---EALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              +WP  K  L YA     P++ V        A  +W+  +  +F    D ++AD+    F
Sbjct  158   LKWPPSKMHLKYALDTNVPFDDVVMNPLCYVAFDKWAAISDFTFERTYDLSSADILISFF  217

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHL  928
              G+HGDG  FDGPGG++AHSF PT G  H D EE+W  V        D++SV  HE GHL
Sbjct  218   KGDHGDGHLFDGPGGVLAHSFAPTGGRLHYDLEENW--VAGIRAGSFDLESVAVHEIGHL  275

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGL H+ V  AVM+ Y+  G  K  L  DDI G++ALY
Sbjct  276   LGLWHTPVTEAVMFAYLKDGTQKVNLHQDDIDGLRALY  313



>ref|XP_010272073.1| PREDICTED: metalloendoproteinase 1 [Nelumbo nucifera]
Length=371

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 153/273 (56%), Gaps = 23/273 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G + G++V GL +LK Y   FGYI + P N T    + F D +ESA++ +Q NFNLN+
Sbjct  54    FAGCRNGEQVDGLGKLKEYFHHFGYIPDSPSNFT----DDFDDTMESALKKYQQNFNLNA  109

Query  461   TGVLDSNTVSLMMKPRCGVPDII------------GRRHRL--VPQYSFLPGNPRWPDDK  598
             TGVLD++T+  +++PRCGV DII               H L  V  Y+F P  P WP  +
Sbjct  110   TGVLDNSTIQQLIRPRCGVADIINGTNTMSSGKSAASTHSLHTVGHYTFFPHQPTWPSSR  169

Query  599   NALSYAW-GDGTPYEFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
               L+Y +  D    + V +   +A  +W+  T L+F     Y+ AD+K   + G+H DG+
Sbjct  170   LDLTYGFLPDNQLSDTVKAVFAKAFARWAAVTPLTFTMTDSYSMADIKIAFYTGDHSDGE  229

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWA---QVGPYYPYGVDIQSVVTHETGHLLGLGH  943
              FDG  G +AH+F PT+G  HLD  E+W             VD++SV  HE GHLLGLGH
Sbjct  230   PFDGVLGTLAHAFSPTDGRFHLDGAENWVVDDASKSSISSAVDLESVAVHEIGHLLGLGH  289

Query  944   SGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             S    A+MYP I  G  K  L +DDI+GI+ LY
Sbjct  290   SSYGDAIMYPTISSGTKKVELWSDDIEGIQLLY  322



>ref|XP_010471013.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 149/280 (53%), Gaps = 29/280 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY +K Y +RFGYI   P   +    + F D L++AV  +Q NF LN 
Sbjct  48    FTGCHHGQNVDGLYRIKKYFQRFGYI---PETFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL-----------VPQYSFLPGNPR  583
             TG LD+ T+  ++ PRCG PD++        GRR              V +Y+  PG PR
Sbjct  105   TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  584   WPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
             W  D+  L+YA+    P   E       A  +WS  T L+F     ++ +D+    + G+
Sbjct  165   WRKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVTHETG  922
             HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  HE G
Sbjct  225   HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  923   HLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HLLGLGHS VE ++MYP I  G  K  L NDD++GI+ LY
Sbjct  285   HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_004142843.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 155/270 (57%), Gaps = 22/270 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEA-------NYFSDQLESAVRTFQ  439
             L G +KGD V+G++ +K YL+R+GY+++    NTS ++       N F D LESA++ +Q
Sbjct  33    LYGCRKGDNVEGIHSIKKYLQRYGYLSH----NTSIDSHIIELNSNKFDDSLESAIKLYQ  88

Query  440   ANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRH--------RLVPQYSFLPGNPRWPDD  595
                +LN +G+LD  T+  M + RCG+ D+              +   Y   P N +WPD 
Sbjct  89    KWSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDY  148

Query  596   KNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             K  L+Y + +  P +F+ S  EA+ +W+  +  +F++ +D  +AD+       +H DG  
Sbjct  149   KRHLTYMFTNNFPIDFMPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLP  208

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVE  955
             FDGPGG++ H+F PT+G  HLD +++W+         V++ +   HE GH+LGL HS + 
Sbjct  209   FDGPGGVVGHAFAPTDGRLHLDGDDTWS--AGMEVQKVNVMNAALHELGHVLGLAHSTLP  266

Query  956   AAVMYPYIGFGETKRVLDNDDIQGIKALYP  1045
              AVM+PYI     K  L++DDI G+ ALYP
Sbjct  267   QAVMWPYIDSNALKN-LNDDDIAGLHALYP  295



>ref|XP_011080437.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=308

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 155/269 (58%), Gaps = 18/269 (7%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEAN----YFSDQLESAVRTFQA  442
             K L G++KG   KG+ +LK YL R GY+N+   NN +  AN    +F D+LE A++ +Q 
Sbjct  45    KTLIGARKGTTSKGIPQLKKYLSRLGYMND---NNHTTPANQTNDFFDDKLELAIKRYQT  101

Query  443   NFNLNSTGVLDSNTVSLMMKPRCGVPDI-IGRRHRLVPQ-------YSFLPGNPRWPDDK  598
              F L    ++D NTV+ M +PRCGVPD  +   + L  Q       Y+FLP  P WP  K
Sbjct  102   FFKLTVNRIMDDNTVTQMSRPRCGVPDFNLNTSNELFLQIPTSASHYTFLPNKPTWPRTK  161

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L+Y++      +   + + A + W+ ++   F+   +Y+ AD+K     G HGDG  F
Sbjct  162   RNLTYSFPVIARRDVYPAIEHATELWAFFSSFKFSYTQNYDRADIKISFQYGNHGDGYPF  221

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DG GGI+ H+  PT GI H D++E+W  V    P   D+Q++  HE GH+LGLGH+    
Sbjct  222   DGRGGILGHALPPTIGILHYDADENW--VNGETPGAFDLQTIGLHELGHILGLGHTNDVR  279

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             A+MYP +  G  ++VL  DD+ GIKALYP
Sbjct  280   AIMYPNMDPG-VRKVLGQDDMDGIKALYP  307



>gb|KCW49214.1| hypothetical protein EUGRSUZ_K02794, partial [Eucalyptus grandis]
Length=227

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 139/256 (54%), Gaps = 34/256 (13%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             LQG  KG+   G+ ELK YL++F                      E AV+T+Q N++LN 
Sbjct  2     LQGCHKGNHTGGIRELKRYLEKF----------------------EFAVKTYQLNYHLNV  39

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE  640
             TG LD  T S MM+PRCGV DII    R+          PRWP     L+Y +  GTP  
Sbjct  40    TGTLDPQTTSKMMRPRCGVADIINGTTRM---------GPRWPASNYHLTYGFLPGTPEA  90

Query  641   FVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG--QAFDGPGGIIAHSFQ  814
                    A   W+  TR +F+   D+  A+++     G+HGDG   +FDGPGG +AH+F 
Sbjct  91    ATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARGDHGDGAHNSFDGPGGTLAHAFP  150

Query  815   PTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGET  994
             PT G+ H D++E WA   P      ++++V  HE GHLLGLGHS VE A+MY  I  G T
Sbjct  151   PTVGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHLLGLGHSDVEGAIMYSSIAPGTT  210

Query  995   KRVLDNDDIQGIKALY  1042
             K  L  DDIQGIKALY
Sbjct  211   KG-LHADDIQGIKALY  225



>ref|XP_009104967.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=381

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 151/284 (53%), Gaps = 33/284 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL+ +K Y +RFGYI   P   T    + F D L++AV  +Q NF L+ 
Sbjct  47    FTGCHHGQNVDGLFRIKKYFQRFGYI---PETYTGNFTDDFDDILKAAVELYQKNFRLDV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------------------GRRHRL--VPQYSFLP  571
             TG LD+ T+  ++ PRCG PD++                     GR  RL  V  Y+  P
Sbjct  104   TGELDAPTIKHIVIPRCGNPDVVNGTSVMHNGRRKTFEVNFSPGGRIPRLHTVKHYTLFP  163

Query  572   GNPRWPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             G PRWP D+  L+YA+    P   E       A  +W+  T L+F +   +  +D+    
Sbjct  164   GEPRWPKDRRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGF  223

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVT  910
             + G+HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  
Sbjct  224   YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  911   HETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HE GHLLGLGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_004169198.1| PREDICTED: metalloendoproteinase 1-like, partial [Cucumis sativus]
Length=321

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 148/262 (56%), Gaps = 17/262 (6%)
 Frame = +2

Query  296   KGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLD  475
             KG EV G+ ELK YL RFGY+   P NN S   + F DQ  SA+  +Q    L+ TG LD
Sbjct  9     KGTEVNGISELKKYLNRFGYLPLPPQNNFS---DIFDDQFVSALSLYQNRLGLSVTGKLD  65

Query  476   SNTVSLMMKPRCGVPDII-----GRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDG----  628
             S T++ +M PRCG+ D+      G       +Y+F  G PRW    + L+YA        
Sbjct  66    SETIATIMSPRCGISDLTKFNNNGSTIHSTRRYAFFNGQPRWIR-ASTLTYALSPDYTID  124

Query  629   --TPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
               TP E     + +  +WS    L+F + +DY+++D++   + G+HGDG+AFDG  G++A
Sbjct  125   YLTPSEIRKVVRRSFSRWSAVIPLNFTESSDYDSSDIRIGFYRGDHGDGEAFDGVLGVLA  184

Query  803   HSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             H+F P  G  HLD+ E WA           VD++SVVTHE GH+LGL HS V+ +VMYP 
Sbjct  185   HAFSPENGRLHLDAAERWAVDFEKEKSKVAVDLESVVTHEIGHVLGLAHSAVKESVMYPS  244

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +     K  L  DD++GI+ LY
Sbjct  245   LSPRGKKVDLRIDDVEGIQVLY  266



>gb|KFK41437.1| hypothetical protein AALP_AA2G130300 [Arabis alpina]
Length=380

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 150/284 (53%), Gaps = 33/284 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GLY LK Y +RFGYI   P   +    + F D L++AV  +Q NF L+ 
Sbjct  47    FTGCHHGQTVDGLYRLKKYFQRFGYI---PETFSGNFTDDFDDVLKTAVELYQKNFQLDV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL---------------VPQYSFLP  571
             TG LD+ T+  M+ PRCG PD++        GRR                     Y+  P
Sbjct  104   TGELDALTIKHMVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSPGGRGPRLHTFKHYTLFP  163

Query  572   GNPRWPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             G PRWP ++  L+YA+    P   E       A Q+WS  T L+F     +  +D+    
Sbjct  164   GEPRWPRNRRDLTYAFDPRNPLTEEVKGVFSRAFQRWSDVTALNFTLIDSFTRSDITIGF  223

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVT  910
             ++G+HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  
Sbjct  224   YSGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  911   HETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HE GHLLGLGHS VE ++MYP I  G+ K  L NDD++GI+ LY
Sbjct  284   HEIGHLLGLGHSSVEDSIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_004152428.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=323

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 148/262 (56%), Gaps = 17/262 (6%)
 Frame = +2

Query  296   KGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLD  475
             KG EV G+ ELK YL RFGY+   P NN S   + F DQ  SA+  +Q    L+ TG LD
Sbjct  19    KGTEVNGISELKKYLNRFGYLPLPPQNNFS---DIFDDQFVSALSLYQNRLGLSVTGKLD  75

Query  476   SNTVSLMMKPRCGVPDII-----GRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDG----  628
             S T++ +M PRCG+ D+      G       +Y+F  G PRW    + L+YA        
Sbjct  76    SETIATIMSPRCGISDLTKFNNNGSTIHSTRRYAFFNGQPRWIR-ASTLTYALSPDYTID  134

Query  629   --TPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
               TP E     + +  +WS    L+F + +DY+++D++   + G+HGDG+AFDG  G++A
Sbjct  135   YLTPSEIRKVVRRSFSRWSAVIPLNFTESSDYDSSDIRIGFYRGDHGDGEAFDGVLGVLA  194

Query  803   HSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             H+F P  G  HLD+ E WA           VD++SVVTHE GH+LGL HS V+ +VMYP 
Sbjct  195   HAFSPENGRLHLDAAERWAVDFEKEKSKVAVDLESVVTHEIGHVLGLAHSAVKESVMYPS  254

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +     K  L  DD++GI+ LY
Sbjct  255   LSPRGKKVDLRIDDVEGIQVLY  276



>ref|XP_009105693.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=378

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 150/284 (53%), Gaps = 33/284 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G  V GL+ +K Y +RFGYI   P   T    + F D L++AV  +Q NF LN 
Sbjct  47    FTGCHHGQNVDGLFRIKKYFQRFGYI---PETYTGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------GRRHRL---------------VPQYSFLP  571
             TG LD+ T+  ++ PRCG PD++        GRR                  V  Y+  P
Sbjct  104   TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVNFSPGGKVPRLHTVKHYTLFP  163

Query  572   GNPRWPDDKNALSYAWGDGTPY--EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             G PRWP D+  L+YA+    P   E       A  +WS  T L+F +   +  +D+    
Sbjct  164   GEPRWPRDRRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGF  223

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY-----GVDIQSVVT  910
             + G+HGDG+ FDG  G +AH+F P  G  HLD++E+W   G    +      VD++SV  
Sbjct  224   YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  911   HETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HE GHLLGLGHS VE ++MYP I  G+ K  L +DD++GI+ LY
Sbjct  284   HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  327



>gb|KDO37628.1| hypothetical protein CISIN_1g039411mg [Citrus sinensis]
Length=222

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 130/222 (59%), Gaps = 19/222 (9%)
 Frame = +2

Query  425   VRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL----------------VPQ  556
             ++T+Q N++LNSTGVLD NTV++M +PRCGV DI+    R+                V  
Sbjct  1     MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSH  60

Query  557   YSFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLK  736
             Y F PG PRWP   + L+YA+  GTP E + +   A Q W+  +   F+   DY NA+LK
Sbjct  61    YEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLK  120

Query  737   YHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHE  916
                  G HGD   FDG GG IAH+  P  GI   D++E WA VG   P   D+++V  HE
Sbjct  121   ISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWA-VGA-RPGAFDLETVALHE  178

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGL HS VE A+MY YI  G TK  L  DD+QGI+ALY
Sbjct  179   IGHLLGLDHSLVEGAIMYAYIDPGATKG-LHTDDVQGIRALY  219



>ref|XP_006387200.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
 gb|ABK94796.1| unknown [Populus trichocarpa]
 gb|ERP46114.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
Length=309

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 155/272 (57%), Gaps = 25/272 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G KKG  V+GL ELK YLK+ GY    P ++ +  ++ F D LE A++T+Q  F+LN 
Sbjct  43    LEGVKKGQTVQGLIELKQYLKKLGY---YPSDDITLTSSDFDDHLELALKTYQEYFHLNV  99

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG-------------RRHRLVPQYSFLPGNPRWPDDKN  601
             TG LDS+T+  M+ PRCG PDII              ++  +V  Y+F  G  +WP  K 
Sbjct  100   TGNLDSSTIQQMVIPRCGTPDIINTPSTKPNSTKSKHKKVHMVAHYAF--GAEKWPPSKY  157

Query  602   ALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             AL+Y +G G          +   +A Q W+  ++ +F + T   +AD+    ++G+HGD 
Sbjct  158   ALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFQEATAGASADIVIEFYSGDHGDR  217

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
               FDGPG  +AH+F P +G  H D++E+W+   P      D++SV  HE GHLLGL HS 
Sbjct  218   YPFDGPGKTLAHAFYPQDGRLHYDADENWS-TDPAMD-QTDLESVTVHEIGHLLGLHHST  275

Query  950   VE-AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
                 A+MYP I  G+ KR L  DDI GI ALY
Sbjct  276   DHPEAIMYPTIEAGKKKRDLAQDDIDGIHALY  307



>gb|KCW56124.1| hypothetical protein EUGRSUZ_I01878 [Eucalyptus grandis]
Length=294

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 151/270 (56%), Gaps = 18/270 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L+G  KG   +G+ E+K YL+ FGY       N  +   + F + LESA++++Q  ++L 
Sbjct  25    LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  84

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRH-----------RLVPQYSFLPGNPRWPDDKNA  604
              TG LD++TV+ M  PRCGVPD +  RH           R+V +Y+F P  PRWP  K  
Sbjct  85    VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  144

Query  605   LSYAWG---DGTPYEFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
             L+YA+G      P E +      A Q+W+  T  +F++ +     DL    + G+HGDG 
Sbjct  145   LNYAFGPVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGDGY  204

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGV  952
              FDGPG I+AHSF PT+G  H D EE W+       +  D++SV  HE GHLLGL H+  
Sbjct  205   PFDGPGKILAHSFSPTDGRFHYDVEEQWSTNPSSTQF--DLESVTLHEIGHLLGLAHTPD  262

Query  953   EAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             + AVM+  I  G  KR L  DDI GI ALY
Sbjct  263   QNAVMFATISPGAQKRDLRQDDIDGIHALY  292



>ref|XP_010030761.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=311

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 151/270 (56%), Gaps = 18/270 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L+G  KG   +G+ E+K YL+ FGY       N  +   + F + LESA++++Q  ++L 
Sbjct  42    LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  101

Query  458   STGVLDSNTVSLMMKPRCGVPDIIGRRH-----------RLVPQYSFLPGNPRWPDDKNA  604
              TG LD++TV+ M  PRCGVPD +  RH           R+V +Y+F P  PRWP  K  
Sbjct  102   VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  161

Query  605   LSYAWG---DGTPYEFVTST-KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
             L+YA+G      P E +      A Q+W+  T  +F++ +     DL    + G+HGDG 
Sbjct  162   LNYAFGPVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGDGY  221

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGV  952
              FDGPG I+AHSF PT+G  H D EE W+       +  D++SV  HE GHLLGL H+  
Sbjct  222   PFDGPGKILAHSFSPTDGRFHYDVEEQWSTNPSSTQF--DLESVTLHEIGHLLGLAHTPD  279

Query  953   EAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             + AVM+  I  G  KR L  DDI GI ALY
Sbjct  280   QNAVMFATISPGAQKRDLRQDDIDGIHALY  309



>ref|XP_004953898.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=372

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 153/274 (56%), Gaps = 22/274 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F + LE+A+ T+Q NF LN+
Sbjct  53    LSGCHMGEERQGLAGLKDYLSHFGYLPPPPSSSPFTDA--FDEDLEAAIATYQRNFGLNA  110

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ-----------YSFLPGNPRWPDDKNAL  607
             TG LD++TV+ M+ PRCGV D+I     +              Y++ PG PRWP  +  L
Sbjct  111   TGALDASTVAQMVSPRCGVADVINGTSTMARNSSAAGAHGRHLYAYFPGGPRWPPFRRDL  170

Query  608   SYAWGDGTPYEFVTSTKEAL-----QQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQ  772
              YA    +      ST   +      QW+  T L F +    ++AD+    + G HGDG+
Sbjct  171   KYAITATSATSIDRSTLSDVFARAFAQWAAATNLRFAETASESDADITIGFYTGSHGDGE  230

Query  773   AFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLGLG  940
              FDGP G +AH+F PT+G  HLD+ E+W   G       P  VD++SV  HE GHLLGLG
Sbjct  231   PFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGGDVSRASSPGVVDLESVAVHEIGHLLGLG  290

Query  941   HSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HS V  A+MYP I  G  K  L+ DD+QGI++LY
Sbjct  291   HSSVPEAIMYPTIRTGTRKVELEADDVQGIQSLY  324



>ref|XP_002311051.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
 gb|EEE88418.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
Length=295

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 153/269 (57%), Gaps = 29/269 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L  S+KG  V  L+ +K YLK+FGY++           +  +D+LESA+RT+Q NF+L  
Sbjct  39    LVESQKGQSVSKLHLVKQYLKKFGYLD----------YDLSNDRLESAIRTYQQNFHLEV  88

Query  461   TGVLDSNTVSLMMKPRCGVPDII-GRRHRLVPQ---------YSFLPGNPRWPDDKNALS  610
             TG LD  TV+ MMKPRCGV DI    +H    +         YSF PG PRW      L 
Sbjct  89    TGRLDKRTVNQMMKPRCGVADIFNSTKHHNSSKSSDGVANADYSFFPGAPRW--SSKHLK  146

Query  611   YAWGDGTPYEFVTS----TKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
             Y +G         S     K++ Q+W+  T  +F +  +  +AD+K   +  +HGD + F
Sbjct  147   YTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEPF  206

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGGI AH F+PT G+ H D++E+W+   P     +D++SV  HE GHL  LGHS    
Sbjct  207   DGPGGIFAHGFRPTIGMLHFDADETWSS-NP-GSLELDLESVAVHEIGHLPELGHSEDHP  264

Query  959   -AVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              A+MYPY  +G+TKR L  DDI+GI+ LY
Sbjct  265   DAIMYPYFDYGKTKRSLQEDDIEGIRDLY  293



>ref|XP_009780227.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana sylvestris]
Length=356

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 152/263 (58%), Gaps = 18/263 (7%)
 Frame = +2

Query  296   KGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLD  475
             KG E+ G+ ELK Y +RFGY++N+P  N +   ++F + LESAV  +Q N  L  TG LD
Sbjct  56    KGSELTGMSELKKYFQRFGYLSNIPDQNFT---DFFDEDLESAVLNYQQNLGLTVTGKLD  112

Query  476   SNTVSLMMKPRCGVPDII-----GRRHRLVPQYSFLPGNPRWPDDK-NALSYAWGDGTPY  637
               T++ +M PRCG+ D+      G  H     Y++  G PRW       LSYA+ +    
Sbjct  113   DETMNEIMLPRCGMSDLAHEHDHGSLHT-TRNYAYFYGRPRWMKSSPMILSYAFSENYMI  171

Query  638   EFV------TSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGII  799
             +++      ++ K A  +WS    ++F +  DY  AD+K   F G+HGDG+ FDG  G++
Sbjct  172   DYIDISEIKSAFKRAFSRWSSAIPVNFTEAEDYYTADIKIGFFRGDHGDGEPFDGVLGVL  231

Query  800   AHSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYP  973
             AH+F P  G  HLD+ E+WA           VD++SV THE GH+LGL HS V+ AVMYP
Sbjct  232   AHAFSPENGRFHLDAAETWAVDFDEERSRVAVDLESVATHEIGHVLGLAHSSVKDAVMYP  291

Query  974   YIGFGETKRVLDNDDIQGIKALY  1042
              +     KR L  DD++G++ALY
Sbjct  292   SLSPRTKKRDLKLDDVEGVQALY  314



>ref|NP_173824.2| putative metalloproteinase [Arabidopsis thaliana]
 gb|AAU90055.1| At1g24140 [Arabidopsis thaliana]
 gb|AEE30482.1| putative metalloproteinase [Arabidopsis thaliana]
Length=384

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 149/284 (52%), Gaps = 34/284 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN--NLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
               G   G +  GLY LK Y + FGYI   NL  N T    + F D L++AV  +Q NF L
Sbjct  49    FTGCHAGKKYDGLYMLKQYFQHFGYITETNLSGNFT----DDFDDILKNAVEMYQRNFQL  104

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPG  574
             N TGVLD  T+  ++ PRCG PD++                    G+R   V  YSF PG
Sbjct  105   NVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPG  164

Query  575   NPRWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP ++  L+YA+   +    E  +    A  +W   T L+F     ++ +D+    +
Sbjct  165   EPRWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFY  224

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGP------YYPYGVDIQSVVT  910
             +GEHGDG+ FDGP   +AH+F P  G  HLD EE+W   G            VD++SV  
Sbjct  225   SGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAV  284

Query  911   HETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HE GHLLGLGHS VE ++MYP I  G  K  L  DD++G++ LY
Sbjct  285   HEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>gb|AAC00572.1| similar to zinc metalloproteinases [Arabidopsis thaliana]
Length=377

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 149/284 (52%), Gaps = 34/284 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN--NLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
               G   G +  GLY LK Y + FGYI   NL  N T    + F D L++AV  +Q NF L
Sbjct  42    FTGCHAGKKYDGLYMLKQYFQHFGYITETNLSGNFT----DDFDDILKNAVEMYQRNFQL  97

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPG  574
             N TGVLD  T+  ++ PRCG PD++                    G+R   V  YSF PG
Sbjct  98    NVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPG  157

Query  575   NPRWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP ++  L+YA+   +    E  +    A  +W   T L+F     ++ +D+    +
Sbjct  158   EPRWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFY  217

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGP------YYPYGVDIQSVVT  910
             +GEHGDG+ FDGP   +AH+F P  G  HLD EE+W   G            VD++SV  
Sbjct  218   SGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAV  277

Query  911   HETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HE GHLLGLGHS VE ++MYP I  G  K  L  DD++G++ LY
Sbjct  278   HEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  321



>ref|XP_011002109.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=372

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 145/278 (52%), Gaps = 28/278 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L G   G +  GL +LK Y + FGYI N   N T      F D LESA+RT+Q NFNL
Sbjct  53    QQLAGCHAGKKYDGLAKLKNYFQYFGYIPNSLSNFTDD----FDDNLESALRTYQQNFNL  108

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII----------------GRRHRLVPQYSFLPGNPRW  586
             N TG LD  TV+ +++PRCG PDII                      V  YSF  G PRW
Sbjct  109   NVTGQLDDQTVNHIVRPRCGNPDIINGSTSMNSGKTNNTSSSHHFHTVSHYSFFTGQPRW  168

Query  587   PDDKNALSYAW--GDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
                K AL+Y +   +    E       A  +WS    L+F+       AD++   F+G+H
Sbjct  169   --RKQALTYVFLPENQLSDEVKAVFSRAFDRWSTVIPLNFSQTDSIYTADIRIAFFSGDH  226

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHL  928
             GDG+ FDG  G +AH+F P  G  HLD +E W   G          VD++SV  HE GHL
Sbjct  227   GDGEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTGDVRTSALTSAVDLESVAVHEIGHL  286

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++MYP I     K  L +DDI+GI+ LY
Sbjct  287   LGLGHSSVEESIMYPSISSRTRKVELASDDIEGIQTLY  324



>ref|XP_002436777.1| hypothetical protein SORBIDRAFT_10g008650 [Sorghum bicolor]
 gb|EER88144.1| hypothetical protein SORBIDRAFT_10g008650 [Sorghum bicolor]
Length=370

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 153/276 (55%), Gaps = 27/276 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G++ +GL ++K YL  FGY   LP  ++S   + F   LE A++ +Q NF L+ 
Sbjct  53    LTGCHFGEQQQGLAKVKDYLSHFGY---LP-ESSSGFNDLFDADLEEAIKVYQRNFGLDV  108

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ-------------YSFLPGNPRWPDDKN  601
             TG +D++TV+ MM PRCGV D+I     +                +++ PG+P WP  K 
Sbjct  109   TGAMDASTVAQMMAPRCGVADVINGTSTMGSGGSGSSSHLHGRNLFTYFPGSPSWPRSKK  168

Query  602   ALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGD  766
              L+YA    +      +T       A  +WS  T L+F +  D ++AD+    +AG+HGD
Sbjct  169   RLTYAITQTSLTSIDRATLSQVFARAFARWSAATTLNFTEAAD-DDADITIAFYAGDHGD  227

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVG----PYYPYGVDIQSVVTHETGHLLG  934
             G+AFDGP G +AH+F PT+G  HLD+ E+W   G          VD++SV  HE GHLLG
Sbjct  228   GEAFDGPLGTLAHAFSPTDGRFHLDAAEAWVATGDVSRASSDAAVDLESVAVHEIGHLLG  287

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHSG  +A+MYP I     K  L  DD+ GI+ LY
Sbjct  288   LGHSGEPSAIMYPTITSRTRKVDLAEDDVAGIQNLY  323



>ref|XP_006371427.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
 gb|ERP49224.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
Length=308

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 152/272 (56%), Gaps = 26/272 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G +KG  V+GL ELK YLK+FGY    P + T   ++ F D LE A++T+Q  F+LN 
Sbjct  43    LEGVQKGQTVQGLVELKQYLKKFGY---YPSDITLTSSD-FDDHLELALKTYQEYFHLNV  98

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG-------------RRHRLVPQYSFLPGNPRWPDDKN  601
             TG LDS+T+  MM PRCG+PDII               +  +V  Y F  G  +WP  K 
Sbjct  99    TGNLDSSTIQQMMIPRCGMPDIINTPSTKPNSTTSKHNKFHMVVHYDF--GTRKWPPSKY  156

Query  602   ALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             AL+Y +G G          +    A Q W+  +  +F + TD  +AD+    F+G+HGD 
Sbjct  157   ALTYRFGSGVQVVGSDTLRSVCSNAFQTWAKVSPFTFQEATDGASADIVIEFFSGDHGDQ  216

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
               FDGPG  +AH F P +G  H D++E+W+   P      D++SV  HE GHLLGL HS 
Sbjct  217   DPFDGPGKQLAHGFFPQDGRLHYDADENWS-TDPAMD-QTDLESVTVHEIGHLLGLYHSK  274

Query  950   VE-AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
                 A+MYP I  G+ KR L  DDI GI ALY
Sbjct  275   DHPEAIMYPTIAPGKKKRDLAQDDIDGIHALY  306



>gb|EYU22461.1| hypothetical protein MIMGU_mgv1a008611mg [Erythranthe guttata]
Length=368

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 155/271 (57%), Gaps = 21/271 (8%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G +KG +  GL +LK Y + FGY+NN  Y++ S +   F + LESAVR +Q NFNLN+
Sbjct  51    LAGCQKGRKADGLAKLKKYFQYFGYLNN-SYSDYSDD---FDELLESAVRNYQLNFNLNA  106

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG-----RRH------RLVPQYSFLPGNPRWPDDKNAL  607
             TG LD+ T+  +++PRCG PD +      RR         V  YSF P  PRWP  K  L
Sbjct  107   TGKLDAPTLDHIVRPRCGNPDFVNGTSTMRRRDDHATIHTVAHYSFFPDRPRWPARKTQL  166

Query  608   SYAWGDGTPYEFVTS--TKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD  781
             +YA+        V       A ++WS  T L+F +   Y  AD++   F G+HGDG+ FD
Sbjct  167   TYAFAPENQLSAVVRGVFARAFERWSEATTLTFVETASYGRADIRIGFFGGDHGDGEPFD  226

Query  782   GPGGIIAHSFQPTEGICHLDSEESWAQVGPYY----PYGVDIQSVVTHETGHLLGLGHSG  949
             G  G +AH+F P  G  HLD +E+W   G +        VD++SV  HE GH+LGLGHS 
Sbjct  227   GVLGTLAHAFAPPNGRFHLDGDENWVIDGNFLNGAPRTAVDLESVAVHEIGHVLGLGHST  286

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             VE A+MYP I  G  K  L NDD+ GI+ LY
Sbjct  287   VEEAIMYPTISSGTRKVELANDDVLGIQELY  317



>ref|XP_006414320.1| hypothetical protein EUTSA_v10025551mg [Eutrema salsugineum]
 gb|ESQ55773.1| hypothetical protein EUTSA_v10025551mg [Eutrema salsugineum]
Length=359

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 147/262 (56%), Gaps = 19/262 (7%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQ----LESAVRTFQANFNLNSTG  466
             G  V G+ ELK YL RFGY+     ++    A  FSD     LE A+  +Q N  L  TG
Sbjct  58    GSHVSGVSELKRYLHRFGYVKE---DDGGDGAKNFSDVFDGPLEYAISLYQQNLGLPITG  114

Query  467   VLDSNTVSLMMKPRCGVPD--IIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE  640
              LD++TV+LM  PRCGV D  +I         Y++  G P+W  +++ L+YA+      E
Sbjct  115   KLDTSTVTLMSSPRCGVTDTHMIDNGFHTTAHYTYFDGKPKW--NRDTLTYAFSKTHKLE  172

Query  641   FVTST------KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
             ++TS       + A  QW+    +SF +  DY  ADLK   FAG+HGDGQ FDG  G +A
Sbjct  173   YLTSDDVKTVFRRAFDQWASVIPVSFEEVDDYTVADLKIGFFAGDHGDGQPFDGVLGTLA  232

Query  803   HSFQPTEGICHLDSEESWAQVGPYYP--YGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             H+F P  G  HLD+ E+W   G +      VD++SVVTHE GHLLGLGHS  E+AVMYP 
Sbjct  233   HAFAPKNGRLHLDAAETWVVDGDFKESDVAVDLESVVTHEIGHLLGLGHSSQESAVMYPS  292

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +     K  L  DD+ G+  LY
Sbjct  293   LRPRTKKVDLTVDDVAGVLKLY  314



>ref|XP_002893327.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69586.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 151/284 (53%), Gaps = 34/284 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYI--NNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
               G   G +  GLY+LK Y + FGYI   +L  N T    + F D L++AV  +Q NF L
Sbjct  49    FTGCHAGKKYDGLYKLKQYFQHFGYIPETDLSGNFT----DDFDDILKNAVEMYQRNFQL  104

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPG  574
             N TGVLD  T+  ++ PRCG PD++                    G+R   V  YSF PG
Sbjct  105   NVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRRTFEVSFAGRGQRFHTVKHYSFFPG  164

Query  575   NPRWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP ++  L+YA+   +    E  +    A  +W+  T L+F     ++ +D+    +
Sbjct  165   EPRWPRNRRDLTYAFDPRNSLTEEVKSVFSRAFARWAEVTPLTFTRVERFSTSDISIGFY  224

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGP------YYPYGVDIQSVVT  910
             +GEHGDG+ FDGP   +AH+F P  G  HLD EE+W   G            VD++SV  
Sbjct  225   SGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVDEAVDLESVAV  284

Query  911   HETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             HE GHLLGLGHS VE ++MYP I  G  K  L  DD++G++ LY
Sbjct  285   HEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>ref|XP_002319607.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
 gb|EEE95530.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
Length=312

 Score =   189 bits (480),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 109/275 (40%), Positives = 153/275 (56%), Gaps = 24/275 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G +KG  VKGL ELK +LK  GY     + +    ++ F +  ESA++T+Q N+ L  
Sbjct  39    LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLKV  97

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------GR--------RHRLVPQYSFLPGNPRWP  589
             TG LDS+T+  +M PRCGVPD I         GR        +   V  YSF  G PRWP
Sbjct  98    TGSLDSDTIKELMIPRCGVPDPINHVDTSKQAGRTEHDSKSSKFHTVSHYSFFGGTPRWP  157

Query  590   DDKNALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGE  757
               K  L+Y +          E  ++   A Q+W+  T+ +F + ++ + AD+     +G+
Sbjct  158   SSKFHLTYTFSSSVQVIDMQELRSACSRAFQKWADVTQFTFQEASEGSQADIVIGFQSGD  217

Query  758   HGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGL  937
             HGD   FDGPG I+AH+F PT+G  H D++E W+   P     VD++SV  HE GHLLGL
Sbjct  218   HGDRYPFDGPGRILAHAFAPTDGRFHYDADEKWS-TNPSAD-EVDLESVAVHEIGHLLGL  275

Query  938   GHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              HS  + ++M+  I  G  KR L  DDI GI+ALY
Sbjct  276   DHSMDQNSIMFAEIPQGTIKRDLGQDDIAGIRALY  310



>gb|EYU46220.1| hypothetical protein MIMGU_mgv1a010241mg [Erythranthe guttata]
Length=318

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 148/269 (55%), Gaps = 15/269 (6%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEAN--YFSDQLESAVRTFQAN  445
             K L G++KG+  KGL  LK YL   GY+N +      SPE N   F + LE AVR +Q+ 
Sbjct  52    KNLVGTRKGNTAKGLSHLKGYLSNLGYMNIDSIIAKPSPEQNNDSFDENLELAVRAYQSF  111

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPD---IIGRRHRLV------PQYSFLPGNPRWPDDK  598
             F L  TGVLD+ TV+ MM+PRCGV D   ++ + H +         Y+F PG P W   K
Sbjct  112   FKLKVTGVLDAATVNQMMQPRCGVADNFSVLNQTHLMTESPVIAKHYTFFPGKPVWWPGK  171

Query  599   NALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAF  778
               L+Y++  G  Y+      EA   W+  +   F    DY+ AD+K      +HGD   F
Sbjct  172   TDLTYSFPAGASYDLDEGIFEATGLWNNNSIFKFAYIKDYDKADVKISFQVWDHGDRAPF  231

Query  779   DGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEA  958
             DGPGG++AH+F PT+G  H D  E W  V        D+QSV  HE GH+LGLGHS    
Sbjct  232   DGPGGVLAHAFAPTDGRLHFDGSEKW--VDGVKDGAFDVQSVGLHELGHILGLGHSADAN  289

Query  959   AVMYPYIGFGETKRVLDNDDIQGIKALYP  1045
             AVM+P     + ++ L  DDI GIKALYP
Sbjct  290   AVMWPTFQ-TKQRKGLGQDDIDGIKALYP  317



>ref|XP_010089255.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB37580.1| Metalloendoproteinase 1 [Morus notabilis]
Length=343

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 149/266 (56%), Gaps = 24/266 (9%)
 Frame = +2

Query  290   SKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGV  469
             +++G  V G+ ELK YL RFGY+  LP N    +A  F    ESA+  FQ+   L+ +G 
Sbjct  7     AQRGSHVNGISELKTYLHRFGYL--LPENANFSDA--FDATFESAILHFQSKLGLSLSGK  62

Query  470   LDSNTVSLMMKPRCGVPDII------GRRHRLVPQYSFLPGNPRWPDDK-NALSYAWGDG  628
             LD +T+S +  PRCGVPD I      G RH     Y + PG PRW       L+YA+   
Sbjct  63    LDFDTMSQISAPRCGVPDTISTFTLHGTRH-----YMYFPGKPRWARRMPMKLTYAFSPD  117

Query  629   TPYEFVTST------KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
                 +++S+      K A  +W+    +SF +  DY  AD+K   + GEHGD + FDG  
Sbjct  118   YTIRYLSSSEIKAVFKRAFARWASVIPVSFVETEDYVYADIKIGFYHGEHGDSEPFDGVL  177

Query  791   GIIAHSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAV  964
             G++AHSF P  G  HLD+ E+WA           +D++SV THE GHLLGL HS V+ AV
Sbjct  178   GVLAHSFSPENGKVHLDAAETWAVDFRSEKSAVAMDLESVATHEIGHLLGLAHSSVKEAV  237

Query  965   MYPYIGFGETKRVLDNDDIQGIKALY  1042
             MYP +   E K  L  DDI+G++ALY
Sbjct  238   MYPTLKPREKKLDLQLDDIEGVQALY  263



>ref|XP_002325947.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
 gb|EEF00329.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
Length=308

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 155/272 (57%), Gaps = 26/272 (10%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L+G +KG  V+GL ELK YLK+FGY    P + T   ++ F D LE A++T+Q  F+LN 
Sbjct  43    LEGIQKGQTVEGLIELKQYLKKFGY---YPSDITLTSSD-FDDHLELALKTYQEYFHLNV  98

Query  461   TGVLDSNTVSLMMKPRCGVPDIIG-------------RRHRLVPQYSFLPGNPRWPDDKN  601
             TG LDS+T+  MM PRCG+PDII              ++  +V  Y+F  G  +WP  K 
Sbjct  99    TGNLDSSTIQQMMIPRCGMPDIINTPSAKPNSTKSKHKKVHVVAHYAF--GAQKWPPSKY  156

Query  602   ALSYAWGDGTPY----EFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
             AL+Y +G G          +   +A Q W+  ++ +F + T   +AD+    F+G+HGD 
Sbjct  157   ALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFREATGGASADIVIEFFSGDHGDQ  216

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
               FDGPG  +AH+F P +G  H D++E+W+   P     +D+++V  HE GHLLGL HS 
Sbjct  217   SPFDGPGNQLAHAFYPQDGRLHYDADENWS-TDPAMD-QIDLETVTVHEIGHLLGLYHSK  274

Query  950   VE-AAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
                 A+MYP    G  KR L  DDI GI ALY
Sbjct  275   DHPEAIMYPTTQRGSKKRDLAQDDIDGIHALY  306



>gb|KGN50256.1| hypothetical protein Csa_5G162050 [Cucumis sativus]
Length=370

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 148/262 (56%), Gaps = 17/262 (6%)
 Frame = +2

Query  296   KGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLD  475
             KG EV G+ ELK YL RFGY+   P NN S   + F DQ  SA+  +Q    L+ TG LD
Sbjct  66    KGTEVNGISELKKYLNRFGYLPLPPQNNFS---DIFDDQFVSALSLYQNRLGLSVTGKLD  122

Query  476   SNTVSLMMKPRCGVPDII-----GRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDG----  628
             S T++ +M PRCG+ D+      G       +Y+F  G PRW    + L+YA        
Sbjct  123   SETIATIMSPRCGISDLTKFNNNGSTIHSTRRYAFFNGQPRWIR-ASTLTYALSPDYTID  181

Query  629   --TPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
               TP E     + +  +WS    L+F + +DY+++D++   + G+HGDG+AFDG  G++A
Sbjct  182   YLTPSEIRKVVRRSFSRWSAVIPLNFTESSDYDSSDIRIGFYRGDHGDGEAFDGVLGVLA  241

Query  803   HSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             H+F P  G  HLD+ E WA           VD++SVVTHE GH+LGL HS V+ +VMYP 
Sbjct  242   HAFSPENGRLHLDAAERWAVDFEKEKSKVAVDLESVVTHEIGHVLGLAHSAVKESVMYPS  301

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +     K  L  DD++GI+ LY
Sbjct  302   LSPRGKKVDLRIDDVEGIQVLY  323



>gb|EYU34695.1| hypothetical protein MIMGU_mgv1a024051mg, partial [Erythranthe 
guttata]
Length=224

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 133/227 (59%), Gaps = 24/227 (11%)
 Frame = +2

Query  419   SAVRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRL-----------------  547
             SAV+T+Q N+++N TG LD+ TVS M  PRCGVPDII  ++ +                 
Sbjct  1     SAVKTYQRNYHINPTGTLDATTVSKMTTPRCGVPDIIDGKNTMQKHGTKEHESNSSSKHI  60

Query  548   --VPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYN  721
               V  YSF  GNPRWP  K  L+Y +   TP   V     A Q+W+  T  +F+     +
Sbjct  61    HTVSHYSFFQGNPRWPPSKTHLTYRFLPNTPGAAVGPVSRAFQKWASSTHFTFS--LAQS  118

Query  722   NADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQS  901
             +ADL      G+HGDG  FDG GG +AH+F PT G  H D++E W+ VGP      D+++
Sbjct  119   SADLVIGFHRGDHGDGNPFDGRGGTLAHAFAPTNGRFHYDADEQWS-VGPVQD-AFDLET  176

Query  902   VVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             V  HE GHLLGLGHS VEAA+MY  IG G TK  L  DDIQGI+ALY
Sbjct  177   VALHEIGHLLGLGHSSVEAAIMYSGIGAGVTKG-LHADDIQGIRALY  222



>gb|EYU31381.1| hypothetical protein MIMGU_mgv1a023026mg, partial [Erythranthe 
guttata]
Length=267

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/264 (40%), Positives = 149/264 (56%), Gaps = 18/264 (7%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYI--NNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             L G++KG + K + ELK +L   GY+  NN   N    + + F D LE A++ +Q  F+L
Sbjct  10    LIGARKGHKAKSVLELKKHLSNIGYMKHNN---NEAKEKTDLFDDDLELAIKKYQVFFHL  66

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIG--------RRHRLVPQYSFLPGNPRWPDDKNALS  610
             + TG+LD+ TV  ++ PRCGV D +         +   L   Y+F PG P+WP  K  L+
Sbjct  67    DVTGILDAKTVKNLLLPRCGVADFVNLNASQFKNKIPTLASHYTFFPGEPKWP--KTNLT  124

Query  611   YAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPG  790
             Y++  GT  + + + K+A Q W+  +   F    DY++AD+K      EHGDG  FDG G
Sbjct  125   YSFPPGTRADALQAIKDATQMWASVSNFKFTYIADYDHADIKISFQVWEHGDGTPFDGRG  184

Query  791   GIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMY  970
             G +AHS  P + + H D +E WA      P   D+Q++  HE GH LGLGH+    A+MY
Sbjct  185   GALAHSSGPYDSLLHFDGDELWAD--GVVPGKYDLQTIGLHELGHKLGLGHTNDGGAIMY  242

Query  971   PYIGFGETKRVLDNDDIQGIKALY  1042
             P IG G  ++ L  DDI GIKALY
Sbjct  243   PTIGSG-FRKGLGKDDIDGIKALY  265



>ref|XP_002322292.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
 gb|EEF06419.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
Length=375

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 145/278 (52%), Gaps = 28/278 (10%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             + L G   G +  GL +LK Y + FGYI N   N T      F D LESA+RT+Q NFNL
Sbjct  56    QQLAGCHAGKKYDGLAKLKHYFQYFGYIPNSLSNFTDD----FDDYLESALRTYQQNFNL  111

Query  455   NSTGVLDSNTVSLMMKPRCGVPDII--------------GRRHRL--VPQYSFLPGNPRW  586
             N TG LD  TV+ +++PRCG PDII                 H L  V  YSF  G PRW
Sbjct  112   NVTGELDDQTVNHVVRPRCGNPDIINGSTSMNSGKTNNTSSSHHLHTVSHYSFFTGQPRW  171

Query  587   PDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
                K AL+Y +   +    E       A  +WS    L+F+       AD++   F+G+H
Sbjct  172   R--KQALTYVFSPENQLSDEVKAVFSRAFDRWSTVIPLNFSQTDSIYTADIRIAFFSGDH  229

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQV----GPYYPYGVDIQSVVTHETGHL  928
             GDG+ FDG  G +AH+F P  G  HLD +E W              VD++SV  HE GHL
Sbjct  230   GDGEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTDDVRTSTLTSAVDLESVAVHEIGHL  289

Query  929   LGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGLGHS VE ++MYP I     K  L  DDI+GI+ LY
Sbjct  290   LGLGHSSVEESIMYPSISSRTRKVELATDDIEGIQTLY  327



>ref|XP_010460187.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=381

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 148/282 (52%), Gaps = 31/282 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G+   GLY+LK Y + FGYI      N + +   F D L++AV  +Q NF LN 
Sbjct  51    FTGCHVGETYDGLYKLKQYFQHFGYIPETLSGNFTDD---FDDILKNAVEMYQRNFRLNV  107

Query  461   TGVLDSNTVSLMMKPRCGVPDII------------------GRRHRL--VPQYSFLPGNP  580
             TGVLD  T+  +M PRCG PD++                  GR  R   V +YS  PG P
Sbjct  108   TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHAVKRYSLFPGEP  167

Query  581   RWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             RWP ++  L+YA+   +    E  T    A  +W+  T L+F     +  +D+    +AG
Sbjct  168   RWPSNRRDLTYAFDPRNKLTEEVKTVFSRAFARWAQVTPLTFTRVQSFRTSDIFIGFYAG  227

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGP------YYPYGVDIQSVVTHE  916
             EHGDG+ FDGP   +AH+F P  G  HLD+EE+W                +D++SV  HE
Sbjct  228   EHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISSEGGDGVLSVTEAIDLESVAVHE  287

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS VE ++MYP I  G  K  L  +D++G++ LY
Sbjct  288   IGHLLGLGHSSVEGSIMYPTITTGMRKVELTTNDVEGVQYLY  329



>ref|XP_008437072.1| PREDICTED: metalloendoproteinase 1 [Cucumis melo]
Length=363

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 151/262 (58%), Gaps = 17/262 (6%)
 Frame = +2

Query  296   KGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLD  475
             KG EV G+ ELK YL RFGY+   P NN S   + F DQ  SA+  +Q    L+ TG LD
Sbjct  59    KGTEVNGMSELKKYLNRFGYLPIPPQNNFS---DIFDDQFVSALSLYQNRLGLSVTGKLD  115

Query  476   SNTVSLMMKPRCGVPDII-----GRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE  640
             S T++ +M PRCG+ D+      G       +Y+F  G PRW    + L+YA       +
Sbjct  116   SETIASIMSPRCGISDLTKINNNGSTIHSTRRYAFFNGQPRWIR-SSTLTYALSPDYTID  174

Query  641   FVTST------KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
             ++TS+      + +  +WS    L+F + +DY+++D++   + G+HGDG+AFDG  G++A
Sbjct  175   YLTSSEIRKVVRRSFSRWSAVIPLNFTESSDYDSSDIRIGFYRGDHGDGEAFDGVLGVLA  234

Query  803   HSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             H+F P  G  HLD+ E WA           VD++SVVTHE GH+LGL HS V+ +VMYP 
Sbjct  235   HAFSPENGRLHLDAAERWAVNFEKEKSKVAVDLESVVTHEIGHVLGLAHSTVKESVMYPS  294

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +     K  L  DD++GI+ LY
Sbjct  295   LSPRGKKVDLRIDDVEGIQVLY  316



>ref|XP_003573113.1| PREDICTED: metalloendoproteinase 1-like [Brachypodium distachyon]
Length=383

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 154/282 (55%), Gaps = 34/282 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E  GL +LK YL  FGY   LP  ++S  ++ F   LE+A+ T+Q NF LN+
Sbjct  50    LSGCHMGEERAGLGKLKDYLSHFGY---LPEPSSS-FSDAFDADLEAAIATYQRNFGLNT  105

Query  461   TGVLDSNTVSLMMKPRCGVPDII---------------GRRHRLVPQYSFLPGNPRWPDD  595
             TG LD +TVS M+ PRCGV D+I                 R R +  Y++ PG P WP  
Sbjct  106   TGALDPSTVSQMLAPRCGVADVINGSSTMDRSSNATSASARGRHL--YAYFPGGPSWPPF  163

Query  596   KNALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEH  760
             +  L YA    +      +      + A  +W+  T L F +     +AD+    +AG H
Sbjct  164   RRELRYAITASSAISIDKAALSGVFERAFARWAAATTLRFAEAESAADADITIGFYAGAH  223

Query  761   GDGQAFDGPGGIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQSVVTHE  916
             GDG+AFDGP G +AH+F PT+G  HLD+ E+WA          G      VD++SV  HE
Sbjct  224   GDGEAFDGPLGTLAHAFSPTDGRFHLDAAEAWAVSGSGGDDSSGGPGSASVDLESVAVHE  283

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS V+ A+MYP I  G  K  L  DD++GI++LY
Sbjct  284   IGHLLGLGHSSVQGAIMYPTIRTGTRKVELRQDDVEGIQSLY  325



>ref|NP_001235535.1| metalloendoproteinase 1 precursor [Glycine max]
 sp|P29136.2|MEP1_SOYBN RecName: Full=Metalloendoproteinase 1; AltName: Full=SMEP1; Flags: 
Precursor [Glycine max]
 gb|AAB26959.1| metalloproteinase [Glycine max]
Length=305

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/259 (40%), Positives = 140/259 (54%), Gaps = 16/259 (6%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G   KGL  +K Y    GYI N P+ + +     F D L SA++T+Q N+NLN TG  D 
Sbjct  48    GQNYKGLSNVKNYFHHLGYIPNAPHFDDN-----FDDTLVSAIKTYQKNYNLNVTGKFDI  102

Query  479   NTVSLMMKPRCGVPDIIGRRHR-----LVPQYSFLPGNPRWPDDKNALSYAWGDGTPYE-  640
             NT+  +M PRCGVPDII   ++     ++  Y+F    PRW      L+YA+      + 
Sbjct  103   NTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEPRLDD  162

Query  641   -FVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQP  817
              F ++   A  +W+    ++F + T Y  A++K    +  HGD   FDGPGGI+ H+F P
Sbjct  163   TFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGHAFAP  222

Query  818   TEGICHLDSEESWAQVGPYYPYGV----DIQSVVTHETGHLLGLGHSGVEAAVMYPYIGF  985
             T+G CH D++E W   G      V    D++SV  HE GHLLGLGHS    A+MYP I  
Sbjct  223   TDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPP  282

Query  986   GETKRVLDNDDIQGIKALY  1042
                K  L  DDI GI+ LY
Sbjct  283   RTRKVNLAQDDIDGIRKLY  301



>emb|CDX90504.1| BnaA03g42770D [Brassica napus]
Length=364

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 148/257 (58%), Gaps = 11/257 (4%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G  V G+ ELK YL RFGY+ +    ++   ++ F  +LESA+  FQ N  L  TG LD+
Sbjct  65    GSHVSGVSELKRYLHRFGYVKDDGSGSSKNFSDVFDGRLESAISLFQQNLGLPITGRLDT  124

Query  479   NTVSLMMKPRCGVPD--IIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYEFVTS  652
             +TV+LM  PRCGV D  +I     +  +Y++  G P+W  +++ L+YA+ +    ++ TS
Sbjct  125   STVTLMSSPRCGVSDTHMINNGMHVTARYTYFGGKPKW--NRDTLTYAFSETHKLDYPTS  182

Query  653   T------KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQ  814
                    + A  +W+    +SF +  DY  A+LK   FAG+HGDG+ FDG  G +AH+F 
Sbjct  183   DDVKTVFRRAFGRWASVIPVSFKEVDDYTTANLKIGFFAGDHGDGKPFDGVLGTLAHAFA  242

Query  815   PTEGICHLDSEESWAQVGPY-YPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGE  991
             P  G  H D+ E+W     +     VD++SV THE GHLLGLGHS  E+AVMYP +    
Sbjct  243   PKNGRVHFDAAETWVVNDDFGSKVAVDLESVATHEIGHLLGLGHSSRESAVMYPILPPRT  302

Query  992   TKRVLDNDDIQGIKALY  1042
              K  L  DD+ G+  LY
Sbjct  303   KKVDLTVDDVAGVLRLY  319



>ref|XP_010498935.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=425

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 149/282 (53%), Gaps = 31/282 (11%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
               G   G+   GLY+LK Y + FGYI      N + +   F D L++AV  +Q NF LN 
Sbjct  95    FTGCHVGETYDGLYKLKQYFQHFGYIPETLSGNFTDD---FDDILKNAVEMYQRNFRLNV  151

Query  461   TGVLDSNTVSLMMKPRCGVPDII------------------GRRHRL--VPQYSFLPGNP  580
             TGVLD  T+  +M PRCG PD++                  GR  R   V +YS  PG P
Sbjct  152   TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHAVKRYSLFPGEP  211

Query  581   RWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAG  754
             RWP ++  L+YA+   +    E  T    A  +W+  T L+F     +  +D+    ++G
Sbjct  212   RWPRNRRDLTYAFDPRNKLTEEVKTVFSRAFARWAEVTPLTFTHVESFRTSDIFIGFYSG  271

Query  755   EHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGP------YYPYGVDIQSVVTHE  916
             EHGDG+ FDGP   +AH+F P  G  HLD+EE+W   G            +D++SV  HE
Sbjct  272   EHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISGEGGDGVLSVTEAIDLESVAVHE  331

Query  917   TGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              GHLLGLGHS VE ++MYP I  G  K  L  +D++G++ LY
Sbjct  332   IGHLLGLGHSSVEGSIMYPTITTGMRKVELTTNDVEGVQYLY  373



>gb|EYU38312.1| hypothetical protein MIMGU_mgv11b017434mg [Erythranthe guttata]
Length=251

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 137/233 (59%), Gaps = 21/233 (9%)
 Frame = +2

Query  401   FSDQLE-SAVRTFQANFNLNSTGVLDSNTVSLMMKPRCGVPDII----------GRRH--  541
             F +QLE SA++T+Q N+++  TG+LD+ TVS M  PRCG  DI+          G+++  
Sbjct  16    FINQLEESAIKTYQRNYHIAPTGILDATTVSKMTTPRCGYADIVNGINTMQLNKGKKYLN  75

Query  542   -----RLVPQYSF-LPGNPRWPDDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFN  703
                    V  Y F +P N RWP  K  L+Y +   TP   V     A Q+W   +  SF+
Sbjct  76    SNNDIHTVSHYRFTVPRNRRWPRSKANLTYRFLPNTPEIAVGPVSRAFQKWHSISGFSFS  135

Query  704   DQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPY  883
                D ++ DL    F   HGDG  FDGPGG+ AH+F+PT+G  H D++E W+  GP  P 
Sbjct  136   RVQDSSSTDLVIGFFKRSHGDGAPFDGPGGVTAHAFRPTDGRLHYDADEKWSD-GP-APD  193

Query  884   GVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              +D++S+  HE GHLLGLGHS V+AA+MY Y+ +G  K   D DDI GIKALY
Sbjct  194   AMDLESIAVHEIGHLLGLGHSDVKAAIMYSYLNYGMNKTKFDADDINGIKALY  246



>ref|XP_008458911.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 147/271 (54%), Gaps = 25/271 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L GS+K D  +G++++K YL+R+GY+++   NN S +A  F D LESA++++Q  F LN 
Sbjct  40    LIGSRKNDNFEGIHKVKAYLQRYGYLSDEKENNLSIDA--FDDDLESAIKSYQKVFKLNV  97

Query  461   TGVLDSNTVSLMMKPRCGVPD-----------------IIGRRHRLVPQYSFLPGNPRWP  589
             +GVLD  T+  M +PRCGV D                  IG  H     Y F P   +WP
Sbjct  98    SGVLDRETLQQMARPRCGVTDDFILVAQQDHENNNTNIQIGGSH-----YMFYPNKLKWP  152

Query  590   DDKNALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG  769
              +K  L+Y +    P E   +   A   W   T+ +F+       AD+      G+HGDG
Sbjct  153   VEKRHLTYGFIHNYPPEHAAAVIRAFDTWEANTKFTFSHAARVQTADILLSFERGDHGDG  212

Query  770   QAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             + FDGPGG + H+F   +G  H D +E W + G ++    D++SV  HE GH LGLGHS 
Sbjct  213   KPFDGPGGALGHAFGAIDGRVHFDGDEQW-ETGSFWQEYFDVESVALHEIGHALGLGHSR  271

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
               +AVM+  +  G TK  L  DDI+GI ALY
Sbjct  272   EPSAVMWANMDSGVTKTHLTIDDIEGIHALY  302



>ref|XP_009629020.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=356

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/262 (40%), Positives = 149/262 (57%), Gaps = 16/262 (6%)
 Frame = +2

Query  296   KGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLD  475
             KG E+ G+ ELK Y +RFGY+ N+P +N +   ++F + LESAV  +Q N  L  TG LD
Sbjct  56    KGSELPGMSELKKYFQRFGYLTNIPDHNFT---DFFDEDLESAVLNYQKNLGLTVTGKLD  112

Query  476   SNTVSLMMKPRCGVPDIIGRRHR----LVPQYSFLPGNPRW-PDDKNALSYAWGDGTPYE  640
               T++ +M PRCG+ D               Y++  G PRW       LSYA+ +    +
Sbjct  113   DETMNEIMLPRCGMSDSAHEHDHSSLHTTRNYAYFYGRPRWMKSSPMILSYAFSENYMID  172

Query  641   FV------TSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIA  802
             ++      ++ K A  +WS    ++F +  DY  AD+K   F G+HGDG+ FDG  G++A
Sbjct  173   YIDISEIKSAFKRAFSRWSSAIPVNFTEAEDYYRADIKIGFFRGDHGDGEPFDGVLGVLA  232

Query  803   HSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPY  976
             H+F P  G  HLD+ E+WA           VD++SV THE GH+LGL HS V+ AVMYP 
Sbjct  233   HAFSPENGRFHLDAAETWAVDFDEERSRVAVDLESVATHEIGHVLGLAHSSVKDAVMYPS  292

Query  977   IGFGETKRVLDNDDIQGIKALY  1042
             +     KR L  DD++G++ALY
Sbjct  293   LSPRMKKRDLKLDDVEGVQALY  314



>emb|CDY66521.1| BnaCnng51190D [Brassica napus]
Length=365

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 146/257 (57%), Gaps = 11/257 (4%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNSTGVLDS  478
             G  V G+ ELK YL RFGY+ +   +++   ++ F  +LESA+  +Q N  L  TG LD+
Sbjct  65    GSHVSGVSELKRYLHRFGYVKDNGSDSSKSFSDVFDGRLESAISLYQKNLGLPITGRLDT  124

Query  479   NTVSLMMKPRCGVPD--IIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGDGTPYEF---  643
             +TV+LM  PRCGV D  +I     +  +Y++  G P+W  D   L+YA+ +    ++   
Sbjct  125   STVTLMSSPRCGVSDTHMINNGMHVTARYTYFGGKPKWSRD--TLTYAFSETHKLDYPIS  182

Query  644   ---VTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGGIIAHSFQ  814
                 T  + A  +W+    +SF +  DY  A+LK   FAG+HGDGQ FDG  G +AH+F 
Sbjct  183   DDVKTVFRRAFGRWASVIPVSFKEVDDYTTANLKIGFFAGDHGDGQPFDGVLGTLAHAFA  242

Query  815   PTEGICHLDSEESWAQVGPY-YPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYIGFGE  991
             P  G  H D+ E+W     +     VD++SV THE GHLLGLGHS  E+AVMYP +    
Sbjct  243   PKNGRVHFDAAETWVVNDDFGSKVAVDLESVATHEIGHLLGLGHSSRESAVMYPTLRPRT  302

Query  992   TKRVLDNDDIQGIKALY  1042
              K  L  DD+ G+  LY
Sbjct  303   KKVDLTVDDVAGVLRLY  319



>ref|XP_006416025.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
 gb|ESQ34378.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
Length=382

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 154/285 (54%), Gaps = 35/285 (12%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYIN-NLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
               G   G +V GLY+LK Y + FGYI   LP N T    + F D L++AV T+Q NF+LN
Sbjct  49    FTGCHAGMKVNGLYKLKQYFQHFGYIRQTLPKNFT----DDFDDILKNAVETYQRNFHLN  104

Query  458   STGVLDSNTVSLMMKPRCGVPDII---------------------GRRHRLVPQYSFLPG  574
              TG LD  T+  ++ PRCGVPDI+                     G R   V +YSF PG
Sbjct  105   ITGELDELTLKHVVMPRCGVPDIVNGTSTMHNGRRRTYEVSFSGKGPRFHAVKRYSFFPG  164

Query  575   NPRWPDDKNALSYAWG--DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLF  748
              PRWP+    L+YA+   +    E  +    A  +W+    ++F     ++ +D++   +
Sbjct  165   EPRWPERNRDLTYAFDPRNSLTEEVKSVFSRAFVRWAEVIPVTFTRVEVFSISDIRIGFY  224

Query  749   AGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWAQVGPY-------YPYGVDIQSVV  907
             +G+HGDG+ FDG  G +AH+F P  G  HLD +E+W   G             VD++SV 
Sbjct  225   SGDHGDGEPFDGVMGTLAHAFSPPNGHFHLDGDENWIVSGDVGGDRLLSVTAAVDLESVA  284

Query  908   THETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
              HE GHLLGLGHS V+ ++MYP I  G  K  L +DD++G++ LY
Sbjct  285   VHEIGHLLGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  329



>ref|XP_010553642.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=375

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 145/287 (51%), Gaps = 39/287 (14%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   GD V GL +LK Y +RFGYI      N + +   F D LESA+R +Q NF+L  
Sbjct  47    LAGCHAGDRVSGLSKLKQYFRRFGYITTAATGNFTDD---FDDVLESAIRIYQKNFDLKV  103

Query  461   TGVLDSNTVSLMMKPRCGVPDII--------------------GRRHRLVPQYSFLPGNP  580
             TG LD+ T+  ++ PRCG  D+I                      R R   +YSF PG P
Sbjct  104   TGELDAATLRQIVLPRCGNSDVIDGSSDMNAGKGFQKTAMTAGAARIRTTKRYSFFPGKP  163

Query  581   RWPDDKNALSYAWGDGTPYEFVTST-----KEALQQWSGWTRLSFNDQTDYNNADLKYHL  745
             RWP  K  L YA+    P   +T         A  +W+  T L F        AD+    
Sbjct  164   RWPARKRDLIYAF---VPQNNLTEDVKRVFSRAFDRWANVTPLRFTRSGSLLRADIVIGF  220

Query  746   FAGEHGDGQAFDGPGGIIAHSFQPTEGICHLDSEESWA--------QVGPYYPYGVDIQS  901
             F+G+HGDG+ FDG  G +AH+  P  G+ HLD +E W         +        VD++S
Sbjct  221   FSGDHGDGEPFDGAMGTLAHASSPPTGMFHLDGDEDWLISDGGGENRRILSVTSLVDLES  280

Query  902   VVTHETGHLLGLGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             V  HE GHLLGLGHS V+ A+MYP I  G+ K  L  DDI+GI+ LY
Sbjct  281   VAVHEIGHLLGLGHSSVKDAIMYPTIAGGDRKVELAKDDIEGIQHLY  327



>ref|XP_004510108.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=354

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 155/271 (57%), Gaps = 26/271 (10%)
 Frame = +2

Query  299   GDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQL----ESAVRTFQANFNLNSTG  466
             G+ + G+ + K YL RFGY+N  P ++ +     FSD+     ESA+  +Q N  +  TG
Sbjct  44    GNNITGISQFKRYLSRFGYLN--PPHDHNNRIITFSDEFDASFESALIKYQRNLGVQVTG  101

Query  467   VLDSNTVSLMMKPRCGVPDI--------IGRRHRLVPQYSFLPGNPRWPDDKN---ALSY  613
              LD+NTVS MM PRCGVPD         + + H     + + PG PRW  D +    L+Y
Sbjct  102   KLDTNTVSEMMTPRCGVPDTKTHHQHNNMTKMHS-TKHFVYFPGKPRWSRDNDMPITLNY  160

Query  614   AWG------DGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQA  775
             A+       +    +   + K A  +WS    +SF +  DY+ AD+K   ++G+HGDG+A
Sbjct  161   AFSREYMIHNINMQDIKKTFKRAFSRWSRVIPVSFIETEDYSFADIKIGFYSGDHGDGEA  220

Query  776   FDGPGGIIAHSFQPTEGICHLDSEESWA--QVGPYYPYGVDIQSVVTHETGHLLGLGHSG  949
             FDG  G++AHSF P  G  HLD+ E+WA    G      +D++SV THE GHLLGL HS 
Sbjct  221   FDGVLGVLAHSFSPEIGRLHLDAAETWAVDMDGTKSEVAIDLESVATHEIGHLLGLSHSC  280

Query  950   VEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             V+ AVMYP +   + +  L+ DDI+G+++LY
Sbjct  281   VKEAVMYPSLRPRDKRADLNIDDIKGVQSLY  311



>ref|XP_008458914.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 148/267 (55%), Gaps = 17/267 (6%)
 Frame = +2

Query  281   LQGSKKGDE-VKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLN  457
             L GS K D  V+G++++K YL+R+GY NN   NN S +A  F D+LESA++ +Q   NL 
Sbjct  40    LIGSSKNDNIVEGIHKVKAYLQRYGYFNNENDNNLSTDA--FDDRLESAIKLYQKFSNLK  97

Query  458   STGVLDSNTVSLMMKPRCGVPD----IIGRRHRLV--------PQYSFLPGNPRWPDDKN  601
              +GVLD  T+  M KPRCGV D    I  + H            +Y+F   N  WP ++ 
Sbjct  98    VSGVLDRETLQQMSKPRCGVRDTFASIAQQEHENKNTNIEIGGSRYTFFFNNVSWPAERK  157

Query  602   ALSYAWGDGTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFD  781
              LSY +    P +FV     A Q W   T+ SF        AD+      G HGD QAFD
Sbjct  158   HLSYGFIHNYPPQFVDPLLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGAHGDYQAFD  217

Query  782   GPGGIIAHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAA  961
             G GGI+AHS    +G  H D++E+W ++       VD++SV  HE GH LGLGHS   +A
Sbjct  218   GEGGILAHSLGAIDGRVHFDADEAWERIP--IEQRVDLESVALHELGHTLGLGHSSEISA  275

Query  962   VMYPYIGFGETKRVLDNDDIQGIKALY  1042
             VM+ Y+  G  K  L  DDI+GI+ALY
Sbjct  276   VMFAYMEPGLYKTRLTIDDIEGIRALY  302



>gb|KCW49213.1| hypothetical protein EUGRSUZ_K02793, partial [Eucalyptus grandis]
Length=236

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/261 (42%), Positives = 144/261 (55%), Gaps = 35/261 (13%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTS-----PEANYFSDQLESAVRTFQAN  445
             LQG  KGD   G+ ELK YL++FGY+N   YN +       + + F D LE AV+T+Q N
Sbjct  2     LQGCHKGDHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  58

Query  446   FNLNSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDDKNALSYAWGD  625
             ++LN TG LD  T S MM+P                        PRWP     L+Y +  
Sbjct  59    YHLNVTGTLDPQTTSKMMRP------------------------PRWPASNYHLTYGFLP  94

Query  626   GTPYEFVTSTKEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDG--QAFDGPGGII  799
             GTP         A  +W+  TR +F+   D+  A+++     G+HGDG   +FDGPGG +
Sbjct  95    GTPEAATAPVARAFAKWTSVTRFTFSYVQDHQFANIQIGFARGDHGDGAHNSFDGPGGTL  154

Query  800   AHSFQPTEGICHLDSEESWAQVGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVMYPYI  979
             AH+F PT G+ H D++E WA   P      ++++V  HE GHLLGLGHS VEAA+MY  I
Sbjct  155   AHAFPPTSGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHLLGLGHSDVEAAIMYSSI  214

Query  980   GFGETKRVLDNDDIQGIKALY  1042
               G TK  L  DDIQGIKALY
Sbjct  215   APGTTKG-LHADDIQGIKALY  234



>gb|KDP28814.1| hypothetical protein JCGZ_14585 [Jatropha curcas]
Length=360

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 144/265 (54%), Gaps = 13/265 (5%)
 Frame = +2

Query  275   KPLQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNL  454
             K    ++KG  V G+ ELK Y   FGY+    ++N +   + F   LESAV  +QA   L
Sbjct  54    KSFLNARKGSHVSGMSELKRYFHHFGYLPLRDFHNIT---DIFDAHLESAVFRYQAKLGL  110

Query  455   NSTGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQYSFLPGNPRWPDD-KNALSYAWGDGT  631
               TG LD  T+S MM PRCGVPD + + H     Y + PG PRW       L+YA+    
Sbjct  111   PITGKLDVLTLSQMMAPRCGVPDTVQKLH-FSKNYVYFPGKPRWARHIPMTLTYAFSPVN  169

Query  632   PYEFVTST------KEALQQWSGWTRLSFNDQTDYNNADLKYHLFAGEHGDGQAFDGPGG  793
                +++        K A  +W     +SF +  DY  AD+K   ++G+HGDG+ FDG  G
Sbjct  170   RISYLSLADIKDVFKRAFGRWESVIPVSFIETNDYGFADIKIGFYSGDHGDGEPFDGALG  229

Query  794   IIAHSFQPTEGICHLDSEESWAQ--VGPYYPYGVDIQSVVTHETGHLLGLGHSGVEAAVM  967
             ++AHSF P  G  HLD+ E+W            VD++SV  HE GHLLGL HS V+ AVM
Sbjct  230   VLAHSFSPESGKFHLDASETWTVDFEMEKSKVAVDLESVAIHEIGHLLGLAHSSVKEAVM  289

Query  968   YPYIGFGETKRVLDNDDIQGIKALY  1042
             YP +   + K  L  DD+QG++ALY
Sbjct  290   YPSLKPRKKKVELSVDDVQGVQALY  314



>ref|XP_002452573.1| hypothetical protein SORBIDRAFT_04g028370 [Sorghum bicolor]
 gb|EES05549.1| hypothetical protein SORBIDRAFT_04g028370 [Sorghum bicolor]
Length=368

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 150/276 (54%), Gaps = 24/276 (9%)
 Frame = +2

Query  281   LQGSKKGDEVKGLYELKIYLKRFGYINNLPYNNTSPEANYFSDQLESAVRTFQANFNLNS  460
             L G   G+E +GL  LK YL  FGY+   P ++   +A  F   LESA+ T+Q NF LN+
Sbjct  48    LSGCHMGEERQGLAGLKDYLSHFGYLPPPPPSSPFSDA--FDQDLESAIATYQRNFGLNA  105

Query  461   TGVLDSNTVSLMMKPRCGVPDIIGRRHRLVPQ-------------YSFLPGNPRWPDDKN  601
             TG LD++TVS M+ PRCGV D+I     +                Y++  G P WP  + 
Sbjct  106   TGALDASTVSQMVSPRCGVADVINGTSTMAKSSSSSADDAHGRHLYAYFAGEPTWPPFRR  165

Query  602   ALSYAWGDGTPYEFVTSTKEALQQWSGW-----TRLSFNDQTDYNNADLKYHLFAGEHGD  766
              L YA    +      ST   +   +       T L F +    ++AD+    +AG HGD
Sbjct  166   DLKYAITATSETSIDRSTLSDVFARAFARWAAATNLRFEETASESDADITIGFYAGSHGD  225

Query  767   GQAFDGPGGIIAHSFQPTEGICHLDSEESW---AQVGPYYPYG-VDIQSVVTHETGHLLG  934
             G+ FDGP G +AH+F PT+G  HLD+ E+W   + V      G VD++SV  HE GHLLG
Sbjct  226   GEPFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGSDVSLSSTSGAVDLESVAVHEIGHLLG  285

Query  935   LGHSGVEAAVMYPYIGFGETKRVLDNDDIQGIKALY  1042
             LGHS V  A+MYP I  G  K  L+ DD+QGI++LY
Sbjct  286   LGHSSVPDAIMYPTIRTGTRKVELEADDVQGIQSLY  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2857070746292