BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32635_g1_i1 len=326 path=[304:0-325]

Length=326
                                                                      Score     E

ref|XP_006430727.1|  hypothetical protein CICLE_v10013181mg           63.5    1e-10   
gb|KDO63208.1|  hypothetical protein CISIN_1g036197mg                 62.4    3e-10   
emb|CDX95132.1|  BnaC05g05390D                                        62.4    4e-10   
ref|XP_009148019.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    5e-10   
gb|AAP54510.1|  Nonspecific lipid-transfer protein 2, putative        60.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79130.1|  hypothetical protein OsI_34237                        60.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006367504.1|  PREDICTED: probable non-specific lipid-trans...  59.7    4e-09   
ref|XP_009113158.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    4e-09   
emb|CDY12874.1|  BnaA09g14000D                                        59.7    4e-09   
gb|ACJ68106.1|  hypothetical protein                                  59.3    5e-09   Brassica napus [oilseed rape]
ref|XP_011021288.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    5e-09   
ref|XP_006292881.1|  hypothetical protein CARUB_v10019146mg           59.3    5e-09   
ref|XP_010232168.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    7e-09   
emb|CDP02751.1|  unnamed protein product                              57.8    2e-08   
ref|XP_006362364.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    2e-08   
ref|XP_008809160.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    2e-08   
ref|XP_006482397.1|  PREDICTED: probable non-specific lipid-trans...  57.4    3e-08   
emb|CDY40472.1|  BnaC09g14300D                                        57.4    3e-08   
ref|NP_001043932.1|  Os01g0691100                                     57.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004234576.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    4e-08   
gb|EAY75443.1|  hypothetical protein OsI_03343                        57.8    5e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008809159.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    6e-08   
ref|XP_006292428.1|  hypothetical protein CARUB_v10018643mg           56.2    7e-08   
ref|XP_006383409.1|  hypothetical protein POPTR_0005s15210g           56.2    7e-08   
ref|XP_002466001.1|  hypothetical protein SORBIDRAFT_01g049830        55.5    1e-07   Sorghum bicolor [broomcorn]
gb|EAY79133.1|  hypothetical protein OsI_34240                        55.1    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003624381.1|  Non-specific lipid-transfer protein              55.1    2e-07   
gb|AAP54508.1|  Nonspecific lipid-transfer protein 2, putative        55.1    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010450959.1|  PREDICTED: probable non-specific lipid-trans...  55.1    2e-07   
ref|XP_002443686.1|  hypothetical protein SORBIDRAFT_07g000330        54.3    2e-07   Sorghum bicolor [broomcorn]
emb|CDF66370.1|  lipid transfer protein                               54.3    3e-07   
ref|XP_009418385.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-07   
ref|XP_008240231.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-07   
ref|XP_011076327.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-07   
ref|XP_007211115.1|  hypothetical protein PRUPE_ppa025024mg           54.3    3e-07   
ref|XP_009113157.1|  PREDICTED: probable non-specific lipid-trans...  53.9    4e-07   
emb|CDF66372.1|  lipid transfer protein                               53.9    4e-07   
emb|CDG03099.1|  LTP (lipid transfer protein)                         53.9    4e-07   
ref|NP_001065005.1|  Os10g0504900                                     53.5    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006395305.1|  hypothetical protein EUTSA_v10005534mg           53.9    5e-07   
gb|EAY79134.1|  hypothetical protein OsI_34241                        53.5    5e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006365399.1|  PREDICTED: probable non-specific lipid-trans...  53.5    6e-07   
ref|XP_010440916.1|  PREDICTED: probable non-specific lipid-trans...  53.5    6e-07   
ref|NP_001065007.1|  Os10g0505500                                     53.5    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003552717.1|  PREDICTED: probable non-specific lipid-trans...  53.5    7e-07   
ref|XP_009388790.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    7e-07   
ref|XP_006468752.1|  PREDICTED: probable non-specific lipid-trans...  53.1    7e-07   
ref|XP_006448406.1|  hypothetical protein CICLE_v10017614mg           53.1    8e-07   
gb|AAX95718.1|  Protease inhibitor/seed storage/LTP family, putative  53.1    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010528501.1|  PREDICTED: probable non-specific lipid-trans...  52.8    9e-07   
ref|XP_006286025.1|  hypothetical protein CARUB_v10007556mg           52.8    1e-06   
ref|XP_010528993.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-06   
ref|XP_006391441.1|  hypothetical protein EUTSA_v10019362mg           52.8    1e-06   
gb|AGT16134.1|  hypothetical protein SHCRBa_127_N06_F_60              52.8    1e-06   
emb|CDG03100.1|  LTP (lipid transfer protein)                         52.8    1e-06   
ref|XP_010440915.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-06   
ref|XP_010528502.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-06   
ref|XP_006417775.1|  hypothetical protein EUTSA_v10009190mg           52.4    1e-06   
emb|CDG03097.1|  LTP (lipid transfer protein)                         52.4    1e-06   
ref|XP_008393327.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    2e-06   
gb|KFK43095.1|  hypothetical protein AALP_AA1G079200                  52.4    2e-06   
ref|NP_001238401.1|  uncharacterized protein LOC100306409 precursor   52.4    2e-06   
ref|XP_010528992.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-06   
ref|XP_007139181.1|  hypothetical protein PHAVU_008G008200g           52.4    2e-06   
ref|XP_010450660.1|  PREDICTED: probable non-specific lipid-trans...  52.0    2e-06   
ref|XP_010108883.1|  hypothetical protein L484_027077                 52.0    2e-06   
ref|XP_009111220.1|  PREDICTED: probable non-specific lipid-trans...  52.0    2e-06   
ref|XP_009347476.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-06   
ref|XP_007152725.1|  hypothetical protein PHAVU_004G154200g           52.0    2e-06   
ref|XP_004961318.1|  PREDICTED: probable non-specific lipid-trans...  52.0    2e-06   
ref|NP_001068293.1|  Os11g0620300                                     52.0    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006405797.1|  hypothetical protein EUTSA_v10028232mg           52.0    3e-06   
ref|NP_973968.1|  bifunctional inhibitor/lipid-transfer protein/s...  51.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198633.1|  bifunctional inhibitor/lipid-transfer protein/s...  51.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAG28936.1|  lipid transfer protein                               51.6    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362363.1|  PREDICTED: probable non-specific lipid-trans...  51.2    3e-06   
ref|XP_002889662.1|  hypothetical protein ARALYDRAFT_887994           51.2    4e-06   
ref|NP_849769.1|  bifunctional inhibitor/lipid-transfer protein/s...  51.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37583.1|  unknown                                               51.2    4e-06   
ref|XP_011035101.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-06   
emb|CDY52889.1|  BnaC06g27820D                                        51.2    4e-06   
ref|XP_008374782.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-06   
ref|NP_001065008.1|  Os10g0505700                                     51.2    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009360132.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-06   
gb|KDP35032.1|  hypothetical protein JCGZ_09320                       51.2    4e-06   
ref|XP_002464407.1|  hypothetical protein SORBIDRAFT_01g017700        51.2    4e-06   Sorghum bicolor [broomcorn]
ref|XP_002889663.1|  hypothetical protein ARALYDRAFT_887996           50.8    5e-06   
ref|XP_007217198.1|  hypothetical protein PRUPE_ppa013890mg           50.8    5e-06   
gb|EEC68552.1|  hypothetical protein OsI_36865                        51.2    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010435719.1|  PREDICTED: probable non-specific lipid-trans...  50.8    5e-06   
ref|XP_010475550.1|  PREDICTED: probable non-specific lipid-trans...  50.8    5e-06   
ref|XP_006430726.1|  hypothetical protein CICLE_v10013191mg           50.8    5e-06   
gb|AAB47967.1|  nonspecific lipid transfer protein                    50.8    6e-06   Hordeum vulgare [barley]
ref|XP_009804140.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    6e-06   
ref|NP_001235108.1|  uncharacterized protein LOC100306442 precursor   50.4    6e-06   
ref|XP_002889661.1|  hypothetical protein ARALYDRAFT_887993           50.8    6e-06   
ref|XP_009781752.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    7e-06   
gb|AFP49331.1|  non-specific lipid-transfer protein type 2            50.4    7e-06   
ref|XP_008229267.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    7e-06   
ref|NP_001065006.1|  Os10g0505000                                     50.4    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAS68185.1|  lipid transfer-like protein                           50.4    7e-06   Brassica napus var. napus [annual rape]
gb|ACG48207.1|  nonspecific lipid-transfer protein precursor          50.4    7e-06   Zea mays [maize]
ref|XP_004299573.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    8e-06   
ref|XP_008229268.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    8e-06   
gb|EAY79135.1|  hypothetical protein OsI_34242                        50.4    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008444076.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    9e-06   
emb|CDM81734.1|  unnamed protein product                              50.1    9e-06   
emb|CDP02752.1|  unnamed protein product                              50.1    1e-05   
emb|CDY01688.1|  BnaC04g30640D                                        50.4    1e-05   
gb|KEH44195.1|  Lipid transfer protein                                50.1    1e-05   
ref|XP_003558992.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    1e-05   
ref|XP_006405794.1|  hypothetical protein EUTSA_v10028094mg           50.1    1e-05   
ref|XP_004234577.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    1e-05   
ref|XP_009613748.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    1e-05   
ref|XP_004288629.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    2e-05   
ref|XP_002440196.1|  hypothetical protein SORBIDRAFT_09g027600        49.7    2e-05   Sorghum bicolor [broomcorn]
ref|XP_002875492.1|  hypothetical protein ARALYDRAFT_905202           49.3    2e-05   
ref|XP_010320740.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    2e-05   
ref|XP_009599113.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    2e-05   
ref|XP_009626576.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    2e-05   
ref|XP_010227440.1|  PREDICTED: probable non-specific lipid-trans...  48.9    2e-05   
ref|XP_006855789.1|  hypothetical protein AMTR_s00044p00213430        48.9    2e-05   
gb|KGN53813.1|  hypothetical protein Csa_4G141210                     48.9    2e-05   
ref|XP_006367505.1|  PREDICTED: uncharacterized protein LOC102587705  49.7    2e-05   
ref|XP_006482208.1|  PREDICTED: probable non-specific lipid-trans...  48.9    2e-05   
ref|NP_001058516.1|  Os06g0705400                                     48.9    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AGT16137.1|  hypothetical protein SHCRBa_127_N06_F_390             48.9    3e-05   
ref|NP_001146849.1|  LOC100280457 precursor                           48.9    3e-05   Zea mays [maize]
ref|XP_009589151.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    3e-05   
ref|XP_002889660.1|  hypothetical protein ARALYDRAFT_887992           48.9    3e-05   
ref|NP_001275625.1|  probable non-specific lipid-transfer protein...  48.5    3e-05   
ref|XP_009792617.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    3e-05   
gb|AAA33933.1|  lipid transfer protein                                48.5    3e-05   Senecio odorus
ref|XP_009127492.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    3e-05   
emb|CDY47738.1|  BnaA02g16570D                                        48.5    4e-05   
gb|KGN53816.1|  hypothetical protein Csa_4G141240                     48.5    4e-05   
ref|XP_006405795.1|  hypothetical protein EUTSA_v10028000mg           48.5    4e-05   
ref|XP_002284213.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    4e-05   Vitis vinifera
gb|KGN53818.1|  hypothetical protein Csa_4G146250                     48.1    4e-05   
ref|XP_003571950.1|  PREDICTED: uncharacterized protein LOC100829407  50.8    4e-05   
ref|XP_010279350.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    4e-05   
ref|XP_009804692.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    4e-05   
ref|XP_002449439.1|  hypothetical protein SORBIDRAFT_05g011660        48.1    4e-05   Sorghum bicolor [broomcorn]
ref|XP_009386356.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    4e-05   
gb|ACJ68107.1|  lipid transfer-like protein                           48.1    5e-05   Brassica napus [oilseed rape]
ref|XP_008782311.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    5e-05   
ref|XP_006292537.1|  hypothetical protein CARUB_v10018768mg           48.1    5e-05   
gb|ACM78620.1|  non-specific lipid-transfer protein type 2            48.1    5e-05   Tamarix hispida
gb|AAS79106.1|  probable lipid transfer protein family protein        48.1    5e-05   Tamarix androssowii
ref|XP_008453433.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    5e-05   
ref|XP_009357787.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    5e-05   
ref|XP_004241634.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    6e-05   
ref|XP_010926507.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    6e-05   
dbj|BAA25680.1|  Lipid transfer protein                               47.8    6e-05   Brassica rapa
ref|NP_001148293.1|  LOC100281901 precursor                           47.8    6e-05   Zea mays [maize]
gb|AFK45248.1|  unknown                                               47.8    7e-05   
ref|XP_010036906.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    7e-05   
gb|KGN63840.1|  hypothetical protein Csa_1G024245                     47.8    7e-05   
ref|NP_001268090.1|  alcohol dehydrogenase 7                          50.1    7e-05   
gb|KDP32977.1|  hypothetical protein JCGZ_13008                       47.8    7e-05   
ref|XP_008810040.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    7e-05   
emb|CDX95131.1|  BnaC05g05400D                                        47.8    7e-05   
ref|NP_001236829.1|  uncharacterized protein LOC100500614 precursor   47.4    8e-05   
emb|CDY50600.1|  BnaC02g16970D                                        47.4    8e-05   
ref|XP_004972106.1|  PREDICTED: probable non-specific lipid-trans...  47.4    8e-05   
dbj|BAJ86749.1|  predicted protein                                    47.4    9e-05   
ref|XP_009139763.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    9e-05   
ref|XP_008444077.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    9e-05   
gb|EMT28561.1|  Non-specific lipid-transfer protein 2                 47.4    9e-05   
gb|AAP37973.1|  seed specific protein Bn15D80B                        47.4    9e-05   Brassica napus [oilseed rape]
ref|XP_002458343.1|  hypothetical protein SORBIDRAFT_03g031716        47.0    9e-05   Sorghum bicolor [broomcorn]
ref|XP_002449441.1|  hypothetical protein SORBIDRAFT_05g011680        47.4    9e-05   Sorghum bicolor [broomcorn]
sp|P20145.1|NLTP2_HORVU  RecName: Full=Probable non-specific lipi...  47.4    9e-05   Hordeum vulgare [barley]
emb|CDX93626.1|  BnaA06g04220D                                        47.0    1e-04   
ref|XP_009596861.1|  PREDICTED: non-specific lipid-transfer prote...  47.0    1e-04   
dbj|BAB01987.1|  lipid transfer protein-like                          47.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235834.1|  PREDICTED: non-specific lipid-transfer prote...  47.0    1e-04   
ref|XP_002887008.1|  hypothetical protein ARALYDRAFT_894246           47.0    1e-04   
ref|XP_004512892.1|  PREDICTED: probable non-specific lipid-trans...  47.0    1e-04   
ref|NP_001148304.1|  LOC100281913 precursor                           47.0    1e-04   Zea mays [maize]
ref|XP_009105236.1|  PREDICTED: non-specific lipid-transfer prote...  47.0    1e-04   
ref|XP_006368152.1|  PREDICTED: probable non-specific lipid-trans...  46.6    1e-04   
ref|XP_009589620.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    1e-04   
gb|EMT31755.1|  Putative non-specific lipid-transfer protein AKCS9    46.6    1e-04   
ref|NP_001056241.1|  Os05g0550300                                     46.6    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008444080.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    1e-04   
gb|AAD27634.1|AF128457_8  hypothetical protein                        48.5    1e-04   Oryza sativa Indica Group [Indian rice]
gb|EMS65238.1|  Non-specific lipid-transfer protein 2                 46.6    1e-04   
ref|XP_006397095.1|  hypothetical protein EUTSA_v10029435mg           46.6    2e-04   
emb|CBI33621.3|  unnamed protein product                              46.2    2e-04   
ref|XP_006482207.1|  PREDICTED: probable non-specific lipid-trans...  46.6    2e-04   
gb|KDP32978.1|  hypothetical protein JCGZ_13009                       46.6    2e-04   
ref|XP_009357786.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    2e-04   
ref|NP_001077480.1|  protease inhibitor/seed storage/LTP family p...  46.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA42889.1|  TPA: nonspecific lipid-transfer protein              46.6    2e-04   
ref|XP_009777694.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    2e-04   
ref|XP_006417774.1|  hypothetical protein EUTSA_v10009184mg           46.6    2e-04   
ref|NP_001056242.1|  Os05g0550600                                     46.6    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982670.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    2e-04   
ref|XP_004982669.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    2e-04   
ref|XP_006406624.1|  hypothetical protein EUTSA_v10021828mg           46.6    2e-04   
dbj|BAJ25798.1|  putative non-specific lipid-transfer protein typ...  46.2    2e-04   
ref|XP_003620406.1|  Non-specific lipid-transfer protein              46.2    2e-04   
ref|XP_008381283.1|  PREDICTED: non-specific lipid-transfer prote...  46.2    2e-04   
ref|XP_002878145.1|  protease inhibitor/seed storage/lipid transf...  46.2    2e-04   
gb|EYU41301.1|  hypothetical protein MIMGU_mgv1a021579mg              46.2    2e-04   
ref|XP_009151803.1|  PREDICTED: non-specific lipid-transfer prote...  46.2    2e-04   
ref|XP_010034442.1|  PREDICTED: non-specific lipid-transfer prote...  46.2    2e-04   
ref|XP_009613979.1|  PREDICTED: non-specific lipid-transfer prote...  46.2    2e-04   
sp|Q43681.1|NLTP_VIGUN  RecName: Full=Probable non-specific lipid...  46.2    2e-04   Vigna unguiculata
gb|KHN42434.1|  Putative non-specific lipid-transfer protein AKCS9    46.2    2e-04   
ref|XP_004986022.1|  PREDICTED: non-specific lipid-transfer prote...  46.2    2e-04   
gb|EMT21725.1|  Putative non-specific lipid-transfer protein AKCS9    46.2    2e-04   
ref|XP_006292190.1|  hypothetical protein CARUB_v10018396mg           46.2    2e-04   
emb|CDM81735.1|  unnamed protein product                              46.2    2e-04   
ref|XP_007033193.1|  Bifunctional inhibitor/lipid-transfer protei...  46.2    2e-04   
emb|CDP00664.1|  unnamed protein product                              45.8    2e-04   
ref|XP_006362367.1|  PREDICTED: non-specific lipid-transfer prote...  45.8    3e-04   
emb|CDX77289.1|  BnaC08g03340D                                        45.8    3e-04   
ref|XP_006656462.1|  PREDICTED: probable non-specific lipid-trans...  45.8    3e-04   
gb|KFK26688.1|  hypothetical protein AALP_AA8G280300                  45.8    3e-04   
ref|XP_010450960.1|  PREDICTED: non-specific lipid-transfer prote...  45.8    3e-04   
ref|XP_007044235.1|  Bifunctional inhibitor/lipid-transfer protei...  45.8    3e-04   
ref|XP_009145909.1|  PREDICTED: non-specific lipid-transfer prote...  45.8    3e-04   
ref|XP_009357223.1|  PREDICTED: non-specific lipid-transfer prote...  45.8    3e-04   
ref|XP_004961319.1|  PREDICTED: non-specific lipid-transfer prote...  45.8    3e-04   
ref|XP_008444079.1|  PREDICTED: non-specific lipid-transfer prote...  45.8    3e-04   
ref|XP_009148020.1|  PREDICTED: probable non-specific lipid-trans...  45.4    4e-04   
ref|XP_006300368.1|  hypothetical protein CARUB_v10022343mg           45.4    4e-04   
ref|XP_009128011.1|  PREDICTED: non-specific lipid-transfer prote...  45.4    4e-04   
ref|XP_004982671.1|  PREDICTED: non-specific lipid-transfer prote...  45.4    4e-04   
emb|CDX92224.1|  BnaA05g21830D                                        45.4    4e-04   
ref|XP_006395306.1|  hypothetical protein EUTSA_v10005391mg           45.4    4e-04   
ref|XP_010062206.1|  PREDICTED: non-specific lipid-transfer prote...  45.4    4e-04   
emb|CAH69201.1|  type 2 non specific lipid transfer protein precu...  45.4    4e-04   Triticum aestivum [Canadian hard winter wheat]
gb|KFK33268.1|  hypothetical protein AALP_AA6G352500                  45.4    4e-04   
ref|XP_003567950.1|  PREDICTED: non-specific lipid-transfer prote...  45.4    4e-04   
emb|CDY45874.1|  BnaC02g22460D                                        45.4    4e-04   
ref|XP_002437557.1|  hypothetical protein SORBIDRAFT_10g029330        45.4    4e-04   Sorghum bicolor [broomcorn]
ref|XP_002870865.1|  hypothetical protein ARALYDRAFT_916549           45.4    4e-04   
emb|CDY51937.1|  BnaAnng11140D                                        45.4    4e-04   
gb|KHN44569.1|  Putative non-specific lipid-transfer protein AKCS9    45.1    5e-04   
ref|NP_001152008.1|  nonspecific lipid-transfer protein AKCS9 pre...  45.1    5e-04   Zea mays [maize]
ref|NP_001152727.1|  nonspecific lipid-transfer protein AKCS9 pre...  45.4    5e-04   Zea mays [maize]
ref|XP_006293217.1|  hypothetical protein CARUB_v10019541mg           45.1    5e-04   
gb|AFK34114.1|  unknown                                               45.1    5e-04   
ref|XP_010419026.1|  PREDICTED: non-specific lipid-transfer prote...  45.1    5e-04   
ref|XP_004232333.1|  PREDICTED: non-specific lipid-transfer prote...  45.1    5e-04   
ref|XP_003535202.1|  PREDICTED: non-specific lipid-transfer prote...  45.1    5e-04   
ref|XP_004234627.1|  PREDICTED: non-specific lipid-transfer prote...  45.1    5e-04   
ref|XP_002464408.1|  hypothetical protein SORBIDRAFT_01g017710        45.1    5e-04   Sorghum bicolor [broomcorn]
gb|ABK92836.1|  unknown                                               45.1    5e-04   Populus trichocarpa [western balsam poplar]
gb|EMS49764.1|  Non-specific lipid-transfer protein 2G                45.1    5e-04   
ref|XP_006405796.1|  hypothetical protein EUTSA_v10028346mg           45.1    5e-04   
ref|NP_188456.1|  Bifunctional inhibitor/lipid-transfer protein/s...  45.1    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357827.1|  PREDICTED: probable non-specific lipid-trans...  45.1    5e-04   
ref|XP_010480382.1|  PREDICTED: non-specific lipid-transfer prote...  44.7    5e-04   
ref|XP_010317726.1|  PREDICTED: non-specific lipid-transfer prote...  45.1    6e-04   
emb|CDY48021.1|  BnaA04g26690D                                        45.1    6e-04   
ref|XP_008389256.1|  PREDICTED: non-specific lipid-transfer prote...  45.1    6e-04   
ref|XP_004234622.1|  PREDICTED: non-specific lipid-transfer prote...  44.7    6e-04   
dbj|BAK07816.1|  predicted protein                                    44.7    6e-04   
gb|EYU40792.1|  hypothetical protein MIMGU_mgv1a022792mg              44.7    7e-04   
gb|EMS52279.1|  Non-specific lipid-transfer protein 2G                44.7    7e-04   
ref|XP_009145000.1|  PREDICTED: non-specific lipid-transfer prote...  44.7    7e-04   
gb|KFK41090.1|  hypothetical protein AALP_AA2G084400                  44.7    7e-04   
ref|XP_008362493.1|  PREDICTED: non-specific lipid-transfer prote...  44.7    7e-04   
ref|XP_009346593.1|  PREDICTED: non-specific lipid-transfer prote...  44.7    7e-04   
ref|XP_006304814.1|  hypothetical protein CARUB_v10012448mg           44.7    7e-04   
ref|XP_004966368.1|  PREDICTED: probable non-specific lipid-trans...  44.7    7e-04   
gb|EMT06942.1|  Putative non-specific lipid-transfer protein          44.7    7e-04   
ref|XP_006654745.1|  PREDICTED: non-specific lipid-transfer prote...  44.7    7e-04   
dbj|BAM28757.1|  lipid transfer protein homolog                       44.7    7e-04   
gb|KHN25489.1|  Non-specific lipid-transfer protein 2                 44.7    8e-04   
ref|NP_001150566.1|  nonspecific lipid-transfer protein precursor     44.7    8e-04   Zea mays [maize]
ref|XP_006855792.1|  hypothetical protein AMTR_s00044p00213670        44.3    8e-04   
ref|NP_198632.1|  Bifunctional inhibitor/lipid-transfer protein/s...  44.7    8e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDM83892.1|  unnamed protein product                              44.3    8e-04   
gb|EMT00048.1|  Putative non-specific lipid-transfer protein AKCS9    44.3    9e-04   
ref|XP_002870864.1|  protease inhibitor/seed storage/lipid transf...  44.3    9e-04   
ref|XP_008339633.1|  PREDICTED: non-specific lipid-transfer prote...  44.3    9e-04   
ref|XP_006301055.1|  hypothetical protein CARUB_v10021448mg           44.3    9e-04   
pdb|1L6H|A  Chain A, Solution Structure Of Plant Nsltp2 Purified ...  43.9    9e-04   
emb|CDY24453.1|  BnaC05g35010D                                        44.3    0.001   



>ref|XP_006430727.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
 gb|ESR43967.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
Length=103

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
             + +A+L+  +  +   P P    CN   LTPC PA  +   PST CC  LRQQ P CLC
Sbjct  14   FMASALLLATVVFSRELPVPEAVTCNPSQLTPCLPAFTWTAPPSTVCCNSLRQQRP-CLC  72

Query  225  EYLRK--YPGY--AANARKAFRACGVPEPRC  305
             YLR   Y  Y  + N+R+    CGVP PRC
Sbjct  73   TYLRNPLYKQYYDSPNSRRIAVTCGVPFPRC  103



>gb|KDO63208.1| hypothetical protein CISIN_1g036197mg [Citrus sinensis]
Length=103

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
             + +A+L+  +  +   P P    CN   LTPC PA  +   PST CC  LRQQ P CLC
Sbjct  14   FMASALLLATVVFSRELPVPEAVTCNPSQLTPCLPAFTWTAPPSTVCCNSLRQQRP-CLC  72

Query  225  EYLRK--YPGY--AANARKAFRACGVPEPRC  305
             YLR   Y  Y  + N R+    CGVP PRC
Sbjct  73   TYLRNPLYKQYYDSPNYRRIAVTCGVPFPRC  103



>emb|CDX95132.1| BnaC05g05390D [Brassica napus]
Length=99

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 8/95 (8%)
 Frame = +3

Query  42   AIIMTAMLIGELELTM---AQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            AI M  +++  L L +   A        CN + L+PC PA+  G+ PSTECC +L+++ P
Sbjct  6    AICMAFLIVLVLSLALTNAAMEDEKVLSCNPKELSPCSPAVKTGSKPSTECCAMLKKEEP  65

Query  213  KCLCEYLRK--YPGY--AANARKAFRACGVPEPRC  305
             CLC Y+    Y  Y  + NA KAF ACG+P   C
Sbjct  66   -CLCGYVNDPVYGQYIKSKNAHKAFSACGIPPLSC  99



>ref|XP_009148019.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Brassica 
rapa]
Length=99

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 6/92 (7%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPP-GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I    +L+  L LT A         CN + L PC PA+  G+ PSTECC +L+++ P CL
Sbjct  9    IAFVIVLVSSLALTNAAVEDEKVLACNPKELNPCSPAVKTGSKPSTECCAMLKKEEP-CL  67

Query  222  CEYLRK--YPGY--AANARKAFRACGVPEPRC  305
            C Y+    Y  Y  + NA KAF +CG+P   C
Sbjct  68   CGYINDPVYGQYIKSKNAHKAFSSCGIPPLSC  99



>gb|AAP54510.1| Nonspecific lipid-transfer protein 2, putative [Oryza sativa 
Japonica Group]
 gb|AAX95717.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
Length=100

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = +3

Query  102  PPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARK  269
            PPPP C+   L+PC   I FGTAPS  CC  L+ Q   C C+Y +   Y  Y  + NARK
Sbjct  29   PPPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQ-GCFCQYAKDPMYASYINSTNARK  87

Query  270  AFRACGVPEPRC  305
               ACG+P P C
Sbjct  88   MIAACGIPLPNC  99



>gb|EAY79130.1| hypothetical protein OsI_34237 [Oryza sativa Indica Group]
Length=98

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 40/72 (56%), Gaps = 5/72 (7%)
 Frame = +3

Query  102  PPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARK  269
            PPPP C+   L+PC   I FGTAPS  CC  L+ Q   C C+Y +   Y  Y  + NARK
Sbjct  27   PPPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQ-GCFCQYAKDPMYASYINSTNARK  85

Query  270  AFRACGVPEPRC  305
                CG+P P C
Sbjct  86   MIATCGIPLPNC  97



>ref|XP_006367504.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 13/92 (14%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I +  +L+GEL +  +        CN   L PC PAI+ G  PS  CC  L++Q P CLC
Sbjct  13   IAILVILLGELLVIESV------TCNVMELVPCSPAIISGQPPSEVCCAKLKEQVP-CLC  65

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
             Y     L+ Y G + NA+K F+ CGVP P+C
Sbjct  66   GYFNDPTLKPYVG-SPNAQKVFQTCGVPIPKC  96



>ref|XP_009113158.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPP-PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I +  +L+  L+LT A         C +  L PC  A   G+ PS ECC  L++Q   CL
Sbjct  9    IALVIVLVSSLDLTSAAVEEEIKVACVQTELIPCFVAAFIGSQPSAECCEKLKEQ-QSCL  67

Query  222  CEYLRK--YPGYAANARKAFRACGVPEPRC  305
            C Y+    +  +  NA+  F+ACGVP P C
Sbjct  68   CGYISNPVFGQFYKNAQNVFKACGVPYPTC  97



>emb|CDY12874.1| BnaA09g14000D [Brassica napus]
Length=97

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPP-PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I +  +L+  L+LT A         C +  L PC  A   G+ PS ECC  L++Q   CL
Sbjct  9    IALVIVLVSSLDLTSAAVEEEIKVACVQTELIPCFVAAFIGSQPSAECCEKLKEQ-QSCL  67

Query  222  CEYLRK--YPGYAANARKAFRACGVPEPRC  305
            C Y+    +  +  NA+  F+ACGVP P C
Sbjct  68   CGYISNPVFGQFYKNAQNVFKACGVPYPTC  97



>gb|ACJ68106.1| hypothetical protein [Brassica napus]
Length=97

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPP-PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I +  +L+  L+LT A         C +  L PC  A   G+ PS ECC  L++Q   CL
Sbjct  9    IALVIVLVSSLDLTSAAVEEEIKVACVQTELIPCFVAAFIGSQPSAECCEKLKEQ-QSCL  67

Query  222  CEYLRK--YPGYAANARKAFRACGVPEPRC  305
            C Y+    +  +  NA+  F+ CGVP P+C
Sbjct  68   CGYISNPVFGQFYKNAQNVFKTCGVPYPKC  97



>ref|XP_011021288.1| PREDICTED: non-specific lipid-transfer protein 2 [Populus euphratica]
Length=94

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 11/92 (12%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             +++T ML+ E +++ A+       CN   L+PC  AI   T PST CC  L++Q P CL
Sbjct  10   VMVVTTMLLAEAQVSQAE------TCNPEQLSPCLGAITSSTPPSTTCCSKLKEQKP-CL  62

Query  222  CEYLRK--YPGYAAN--ARKAFRACGVPEPRC  305
            C YL+      Y ++  ARK   ACGVP P C
Sbjct  63   CGYLKDPSLKQYVSSPGARKVVSACGVPYPSC  94



>ref|XP_006292881.1| hypothetical protein CARUB_v10019146mg [Capsella rubella]
 gb|EOA25779.1| hypothetical protein CARUB_v10019146mg [Capsella rubella]
Length=95

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQP----PPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPK  215
             MT M+I  + ++M+ P          C    L  C PA++ G APSTECC  L+ Q P 
Sbjct  3    FMTVMVITLVIVSMSSPRGFNGVVAQSCVPTDLMSCLPAMISGGAPSTECCDKLKVQEP-  61

Query  216  CLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            CLC Y++   Y  Y +  NARK   AC +P P C
Sbjct  62   CLCSYIKNPMYSSYVSSQNARKTLTACNIPYPTC  95



>ref|XP_010232168.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=97

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 48/92 (52%), Gaps = 7/92 (8%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +I+  ML        A    P   C+ RAL PC P IL GTAPST CC  LR+  P CLC
Sbjct  8    LILAVMLAASGSSCRASRAAPAAKCDPRALRPCAPVILLGTAPSTACCVKLRELKP-CLC  66

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     L KY   + ++RK   ACG+  P C
Sbjct  67   KYAKNRDLGKYIN-SRDSRKVAAACGLRVPIC  97



>emb|CDP02751.1| unnamed protein product [Coffea canephora]
Length=95

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 11/95 (12%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            L S +++ A+++GE+E++ A        C+   L+PC  AI+    PS  CC  LR+Q P
Sbjct  8    LCSVLLLVAVIVGEVEVSRAV------TCSPTELSPCVGAIISNQPPSPACCSKLREQRP  61

Query  213  KCLCEYLR----KYPGYAANARKAFRACGVPEPRC  305
             CLC YLR    +    + NAR+   +CGVP PRC
Sbjct  62   -CLCGYLRDPNLRQYVNSPNARRVASSCGVPTPRC  95



>ref|XP_006362364.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=96

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 7/85 (8%)
 Frame = +3

Query  57   AMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR  236
            A  +GE  L  AQ P     C+ R L+PCGPA +   +P+ ECC  L++ T KC CE+LR
Sbjct  17   AFFLGEF-LVTAQVPL----CDNRKLSPCGPAFVLNESPTKECCATLKEVTQKCFCEFLR  71

Query  237  K--YPGYAANARKAFRACGVPEPRC  305
                  +    +  F  C +P P C
Sbjct  72   NPVTVRFVEFPQDVFGLCKLPFPTC  96



>ref|XP_008809160.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=93

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN  AL+ C  +IL GT P++ CC  L+ Q P C C+Y +   + GY  ++NARK   AC
Sbjct  28   CNPSALSACSASILNGTPPNSACCAKLKSQQP-CFCQYKKNPSFSGYVNSSNARKIISAC  86

Query  285  GVPEPRC  305
            GV  PRC
Sbjct  87   GVSVPRC  93



>ref|XP_006482397.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=103

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 46/91 (51%), Gaps = 5/91 (5%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
             + +A+L+  +  +   P      CN   L PC PA      PST CC  LRQQ P CLC
Sbjct  14   FMSSALLLATVVFSRELPVAEAVTCNPSQLIPCLPAFTSTAPPSTVCCNSLRQQRP-CLC  72

Query  225  EYLRK--YPGY--AANARKAFRACGVPEPRC  305
             YLR   Y  Y  + N+R+    CGVP PRC
Sbjct  73   TYLRNPLYKQYYDSPNSRRIAVTCGVPFPRC  103



>emb|CDY40472.1| BnaC09g14300D [Brassica napus]
Length=97

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPP-PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I +  +L+  L+LT A         C +  L PC  A   G+ PS ECC  L++Q   CL
Sbjct  9    IALVIVLVSSLDLTSAAVEEEIKVACVQTELIPCFVAAFIGSQPSAECCGKLKEQ-QSCL  67

Query  222  CEYLRK--YPGYAANARKAFRACGVPEPRC  305
            C Y++   +  +  N++  F ACGVP P C
Sbjct  68   CGYIQNPTFGQFIKNSQNVFTACGVPYPTC  97



>ref|NP_001043932.1| Os01g0691100 [Oryza sativa Japonica Group]
 dbj|BAD82487.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05846.1| Os01g0691100 [Oryza sativa Japonica Group]
 gb|EAZ13163.1| hypothetical protein OsJ_03082 [Oryza sativa Japonica Group]
 dbj|BAG88981.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00800.1| unnamed protein product [Oryza sativa Japonica Group]
Length=103

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = +3

Query  99   PPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANA  263
            P     C+  AL PC  AIL+G APST CC  LR Q  +CLC Y     LRKY   + N+
Sbjct  32   PAAATKCDPLALRPCAAAILWGEAPSTACCAGLRAQK-RCLCRYAKNPDLRKYIN-SQNS  89

Query  264  RKAFRACGVPEPRC  305
            RK   AC VP PRC
Sbjct  90   RKVAAACSVPAPRC  103



>ref|XP_004234576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=97

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 14/93 (15%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTE-CCRILRQQTPKCL  221
            I M  +L+GEL +  +        CN   L PC PAI++G  P  + CC  L++Q P CL
Sbjct  13   IAMLVILLGELLVVESI------NCNAMELVPCAPAIIWGQLPPLDACCAKLKEQVP-CL  65

Query  222  CEYLRK-----YPGYAANARKAFRACGVPEPRC  305
            C Y +      Y   + NA+K F+ACGV  P+C
Sbjct  66   CIYFKDPMMKPYVD-SPNAKKVFQACGVTTPKC  97



>gb|EAY75443.1| hypothetical protein OsI_03343 [Oryza sativa Indica Group]
Length=212

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = +3

Query  99   PPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANA  263
            P     C+  AL PC  AIL+G APST CC  LR Q  +CLC Y     LRKY   + N+
Sbjct  141  PAAATKCDPLALRPCAAAILWGEAPSTACCAGLRAQ-KRCLCRYAKNPDLRKYIN-SQNS  198

Query  264  RKAFRACGVPEPRC  305
            RK   AC VP PRC
Sbjct  199  RKVAAACSVPAPRC  212



>ref|XP_008809159.1| PREDICTED: non-specific lipid-transfer protein 2 [Phoenix dactylifera]
Length=93

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 6/95 (6%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            + ++I+   +L+  L L  A P      C+   L+PC  AILF + PS+ CC  L+ Q P
Sbjct  1    MKASILFMCVLLCGLLLNQA-PTTTAATCDPSELSPCAGAILFSSPPSSACCAELKAQQP  59

Query  213  KCLCEYLR--KYPGY--AANARKAFRACGVPEPRC  305
             C C+Y +     GY  + N+RKA  ACGV  PRC
Sbjct  60   -CFCQYAKNPNLSGYINSPNSRKAVAACGVSIPRC  93



>ref|XP_006292428.1| hypothetical protein CARUB_v10018643mg [Capsella rubella]
 gb|EOA25326.1| hypothetical protein CARUB_v10018643mg [Capsella rubella]
Length=104

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 39/67 (58%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C+   L+ C PA+  G APSTECC  L+ Q P CLC Y+R   Y  Y +  NARK   AC
Sbjct  39   CSATELSSCLPAMTSGAAPSTECCDKLKVQEP-CLCTYIRNPMYSTYVSSPNARKTLTAC  97

Query  285  GVPEPRC  305
             VP P C
Sbjct  98   NVPYPAC  104



>ref|XP_006383409.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
 gb|ERP61206.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
Length=94

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 11/92 (12%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             +++  ML+ E +++ AQ       CN   L+PC  AI+  T PST CC  L++Q P CL
Sbjct  10   VMVVATMLLAEAQVSQAQT------CNPGQLSPCLGAIMSSTPPSTTCCSKLKEQKP-CL  62

Query  222  CEYLR----KYPGYAANARKAFRACGVPEPRC  305
            C YL+    K    +  ARK    CGVP P C
Sbjct  63   CGYLKDPSLKQFVSSPGARKVASDCGVPYPSC  94



>ref|XP_002466001.1| hypothetical protein SORBIDRAFT_01g049830 [Sorghum bicolor]
 gb|EER92999.1| hypothetical protein SORBIDRAFT_01g049830 [Sorghum bicolor]
Length=92

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 7/82 (9%)
 Frame = +3

Query  75   LELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYA  254
            + L +A        CN   LT C  A+L G APS  CC  L+ Q   CLC++  K P YA
Sbjct  13   MMLVLAAETASAASCNAGQLTVCASAMLSGAAPSAACCSNLKAQ-QGCLCQF-AKNPAYA  70

Query  255  A-----NARKAFRACGVPEPRC  305
                  NARK   +CGV  PRC
Sbjct  71   RYVNSPNARKTVASCGVALPRC  92



>gb|EAY79133.1| hypothetical protein OsI_34240 [Oryza sativa Indica Group]
Length=99

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 8/92 (9%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILR-QQTPKCL  221
            +++ A+ +G +   +         C+   L  C   I +GTAPS  CC  LR QQ   CL
Sbjct  11   LLLVAVAVGAMATAVVTVAAQ---CDPEQLVACASPIFYGTAPSESCCSNLREQQKEGCL  67

Query  222  CEYLRK--YPGYA--ANARKAFRACGVPEPRC  305
            C+Y +   Y  Y    NARK   ACG+P P C
Sbjct  68   CQYAKDPMYASYVNNTNARKTIAACGIPIPSC  99



>ref|XP_003624381.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES80599.1| Lipid transfer protein [Medicago truncatula]
Length=95

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 11/90 (12%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            ++M  +++    +  AQ       C+   L PC  AI+F + PS ECC  LR+QTP C C
Sbjct  11   MLMVVLMVEVATIAEAQ------NCDPNELLPCAGAIIFNSTPSAECCSKLREQTP-CFC  63

Query  225  EYLR--KYPGYAAN--ARKAFRACGVPEPR  302
            EY+R   Y  Y  +  AR+   AC V  P 
Sbjct  64   EYIRDPDYSQYVNSPRAREVASACNVVIPN  93



>gb|AAP54508.1| Nonspecific lipid-transfer protein 2, putative [Oryza sativa 
Japonica Group]
 gb|AAX95716.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|EAZ16615.1| hypothetical protein OsJ_32087 [Oryza sativa Japonica Group]
Length=100

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            C+   L+PC   I FGTAPS  CC  L+ Q   C C+Y +   Y  Y  + NARK   AC
Sbjct  34   CDPGLLSPCAAPIFFGTAPSASCCSSLKAQQ-GCFCQYAKDPTYASYINSTNARKMIAAC  92

Query  285  GVPEPRC  305
            G+P P C
Sbjct  93   GIPLPNC  99



>ref|XP_010450959.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=104

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 14/102 (14%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPG---------CNERALTPCGPAILFGTAPSTECCR  191
            +A++    LIG +    +       G         C+   L+ C PA+  G APST+CC 
Sbjct  4    TAVVFIVFLIGAIIFPNSIRSTVVEGSGEEVINVTCSATELSSCLPAMTSGDAPSTQCCT  63

Query  192  ILRQQTPKCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
             L++Q   CLC Y++   Y  Y +  NARK   AC VP P C
Sbjct  64   KLKEQ-ESCLCSYIKNPLYSSYVSSPNARKTLEACTVPYPTC  104



>ref|XP_002443686.1| hypothetical protein SORBIDRAFT_07g000330 [Sorghum bicolor]
 gb|EES13181.1| hypothetical protein SORBIDRAFT_07g000330 [Sorghum bicolor]
Length=89

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 39/86 (45%), Gaps = 3/86 (3%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYL  233
             AML+    +           CN  AL  C  A++ G  P+  CC  LR Q P CLC Y 
Sbjct  5    VAMLMALAVVVAVSSGGASADCNIAALASCNAAVIQGAKPTAMCCSSLRAQEP-CLCTYQ  63

Query  234  R--KYPGYAANARKAFRACGVPEPRC  305
               KY  Y  NARK   +CG+  P C
Sbjct  64   NNPKYGKYHPNARKMVTSCGMAIPNC  89



>emb|CDF66370.1| lipid transfer protein [Coffea arabica]
 emb|CDF66371.1| lipid transfer protein [Coffea arabica]
 emb|CDG03096.1| LTP (lipid transfer protein) [Coffea arabica]
 emb|CDG03098.1| LTP (lipid transfer protein) [Coffea arabica]
Length=98

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            GCN +AL+PC P+I+ GT P+ ECC   ++Q P CLC ++ K P Y       N +K   
Sbjct  31   GCNPQALSPCLPSIVNGTPPTKECCTNAKEQEP-CLCNFI-KDPAYGKIIKNPNTKKTLE  88

Query  279  ACGVPEPRC  305
            ACG+  P C
Sbjct  89   ACGLKWPTC  97



>ref|XP_009418385.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            CN   L+PC  A+L G  PS  CC  L++Q P C C+Y     L+ Y   + N +KA +A
Sbjct  26   CNPLELSPCSSAVLSGARPSAACCAKLKEQQP-CFCQYKKNPSLKDYVN-SDNGKKALKA  83

Query  282  CGVPEPRC  305
            CGVP P C
Sbjct  84   CGVPIPSC  91



>ref|XP_008240231.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=96

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +3

Query  69   GELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----  236
            G+ +++MA        CN   L+PC  AI   T PST CC  ++QQ P CLC+YL     
Sbjct  21   GKADVSMAV------TCNPTELSPCAGAITSSTPPSTICCTKIKQQKP-CLCQYLNNPNL  73

Query  237  KYPGYAANARKAFRACGVPEPRC  305
            K      NARK  R CG P P+C
Sbjct  74   KKFVNTPNARKVARTCGTPFPKC  96



>ref|XP_011076327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=96

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 19/94 (20%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            ++  +++GE+E+T A        CN   L+PC  AI   + PS  CC  +++Q P CLC+
Sbjct  14   VVLVLILGEVEVTNAV------TCNPLQLSPCASAITSSSKPSAACCAKIKEQRP-CLCQ  66

Query  228  YLR--------KYPGYAANARKAFRACGVPEPRC  305
            Y++        K PG    A+K   +CG P PRC
Sbjct  67   YMKNPNLQKFIKSPG----AKKVANSCGTPYPRC  96



>ref|XP_007211115.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
 gb|EMJ12314.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
Length=94

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +3

Query  69   GELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----  236
            G+ +++MA        CN   L+PC  AI   T PST CC  ++QQ P CLC+YL     
Sbjct  19   GKADVSMAV------TCNPTELSPCAGAITSSTPPSTICCTKIKQQKP-CLCQYLNNPNL  71

Query  237  KYPGYAANARKAFRACGVPEPRC  305
            K      NARK  R CG P P+C
Sbjct  72   KKFVNTPNARKVARTCGTPFPKC  94



>ref|XP_009113157.1| PREDICTED: probable non-specific lipid-transfer protein 2 [Brassica 
rapa]
 emb|CDY12875.1| BnaA09g13990D [Brassica napus]
Length=97

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 42/90 (47%), Gaps = 4/90 (4%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPP-PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I +  +L+  L+LT A         C    L PC  + + G  P  ECC  L+ Q   CL
Sbjct  9    IALVIVLVSSLDLTSAAVEEEIKVACVVTELIPCLESSIIGVHPYPECCVTLKAQ-QSCL  67

Query  222  CEYLRK--YPGYAANARKAFRACGVPEPRC  305
            C Y++   Y G+  NA   F  CGVP P C
Sbjct  68   CGYIQNPVYGGFFKNAHSVFTGCGVPYPTC  97



>emb|CDF66372.1| lipid transfer protein [Coffea arabica]
Length=98

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            GCN +AL+PC P+I+ GT PS ECC   ++Q P C C ++ K P Y       N +K   
Sbjct  31   GCNAQALSPCLPSIISGTPPSKECCTNAKEQEP-CFCNFI-KDPAYGKIIKNPNTKKTLE  88

Query  279  ACGVPEPRC  305
            ACG+  P C
Sbjct  89   ACGLKWPTC  97



>emb|CDG03099.1| LTP (lipid transfer protein) [Coffea arabica]
Length=98

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            GCN +AL+PC P+I+ GT PS ECC   ++Q P C C ++ K P Y       N +K   
Sbjct  31   GCNAQALSPCLPSIINGTPPSKECCTNAKEQEP-CFCNFI-KDPAYGKIIKNPNTKKTLE  88

Query  279  ACGVPEPRC  305
            ACG+  P C
Sbjct  89   ACGLKWPTC  97



>ref|NP_001065005.1| Os10g0504900 [Oryza sativa Japonica Group]
 gb|ABB47857.1| Nonspecific lipid-transfer protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26919.1| Os10g0504900 [Oryza sativa Japonica Group]
Length=82

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            C+   L+PC   I FGTAPS  CC  L+ Q   C C+Y +   Y  Y  + NARK   AC
Sbjct  16   CDPGLLSPCAAPIFFGTAPSASCCSSLKAQQ-GCFCQYAKDPTYASYINSTNARKMIAAC  74

Query  285  GVPEPRC  305
            G+P P C
Sbjct  75   GIPFPNC  81



>ref|XP_006395305.1| hypothetical protein EUTSA_v10005534mg [Eutrema salsugineum]
 gb|ESQ32591.1| hypothetical protein EUTSA_v10005534mg [Eutrema salsugineum]
Length=104

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 7/81 (9%)
 Frame = +3

Query  78   ELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGY--  251
            + ++ +P    P C +  +T CGPAI+ GT PS ECC  L+ Q P C C+++ K P +  
Sbjct  22   QSSVIKPHSTKPPCTDIEITGCGPAIIGGTKPSGECCEKLKAQEP-CFCDFI-KVPAFKQ  79

Query  252  ---AANARKAFRACGVPEPRC  305
               +  AR     CG+P P C
Sbjct  80   LITSQKARSLLADCGIPYPTC  100



>gb|EAY79134.1| hypothetical protein OsI_34241 [Oryza sativa Indica Group]
Length=93

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN   L  C  AI+ G+APS  CC  LR Q   C C+Y R   Y  Y  +ANARK   +C
Sbjct  28   CNAGQLAICAGAIISGSAPSASCCSNLRAQRG-CFCQYARNPAYASYINSANARKTLTSC  86

Query  285  GVPEPRC  305
            G+  PRC
Sbjct  87   GIAIPRC  93



>ref|XP_006365399.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=94

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            I+  ML+ E  +++A        C+   L+PC  AI   + PS  CC  ++QQ P CLC+
Sbjct  12   ILVLMLLAESHISLAA------TCSPVQLSPCLGAIRSSSPPSKLCCSKIKQQKP-CLCQ  64

Query  228  Y-----LRKYPGYAANARKAFRACGVPEPRC  305
            Y     L+KY   +  A+K  R+CGVP PRC
Sbjct  65   YLKNPTLKKYVN-SPGAKKVARSCGVPYPRC  94



>ref|XP_010440916.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=104

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C+   L+ C PA+  G APST+CC  L++Q P CLC Y++   Y  Y +  NARK   AC
Sbjct  39   CSATELSSCLPAMTSGGAPSTDCCTKLKEQEP-CLCFYIKNPLYSTYVSSPNARKTLEAC  97

Query  285  GVPEPRC  305
             VP P C
Sbjct  98   KVPYPTC  104



>ref|NP_001065007.1| Os10g0505500 [Oryza sativa Japonica Group]
 gb|AAP54517.1| nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|AAX95724.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 dbj|BAF26921.1| Os10g0505500 [Oryza sativa Japonica Group]
 gb|EAZ16618.1| hypothetical protein OsJ_32090 [Oryza sativa Japonica Group]
 dbj|BAG88356.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 7/69 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILR-QQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            C+   L+ C   I +GTAPS  CC  LR QQ   CLC+Y +  P YA+     NARK   
Sbjct  27   CDPEQLSACVSPIFYGTAPSESCCSNLRAQQKEGCLCQYAKD-PTYASYVNNTNARKTIA  85

Query  279  ACGVPEPRC  305
            ACG+P P C
Sbjct  86   ACGIPIPSC  94



>ref|XP_003552717.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Glycine max]
 gb|KHN17291.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
 gb|KHN33030.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   LTPC PAI  G+APS+ CC+ L++Q P C C YL+    K    + NA+K   +C
Sbjct  30   CNPTQLTPCLPAINSGSAPSSACCQKLKEQKP-CFCGYLKNPSLKQYVNSPNAKKTVSSC  88

Query  285  GVPEPRC  305
            G+  P C
Sbjct  89   GIAYPTC  95



>ref|XP_009388790.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=92

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 43/92 (47%), Gaps = 4/92 (4%)
 Frame = +3

Query  36   PSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPK  215
            PS+++   M I  L L           C+   L PC  A LF T PS+ CC  ++ Q P 
Sbjct  3    PSSVVFFCM-ISALLLLRTPTAVESVTCDPTLLNPCAAAFLFSTRPSSLCCSRIKSQVP-  60

Query  216  CLCEYLRK--YPGYAANARKAFRACGVPEPRC  305
            C C+YL      GY +  +K   ACGV  P C
Sbjct  61   CYCQYLNDPSLSGYISGGKKVAAACGVSLPSC  92



>ref|XP_006468752.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|KDO76904.1| hypothetical protein CISIN_1g035485mg [Citrus sinensis]
Length=93

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 12/91 (13%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            I+  +L+ E EL+M         CN   L+PC  AI    APS  CC  L++Q   CLC+
Sbjct  10   IVFVLLLSEAELSMGAMT-----CNPLELSPCASAITGANAPSAICCSKLKEQRI-CLCQ  63

Query  228  Y-----LRKYPGYAANARKAFRACGVPEPRC  305
            Y     LRK+   + NARK    CG P PRC
Sbjct  64   YMKDPNLRKFVN-SPNARKVATVCGSPFPRC  93



>ref|XP_006448406.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
 gb|ESR61646.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
Length=86

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 12/91 (13%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            I+  +L+ E EL+M         CN   L+PC  AI    APS  CC  L++Q   CLC+
Sbjct  3    IVFVLLLSEAELSMGAMT-----CNPLELSPCASAITGANAPSAICCSKLKEQRI-CLCQ  56

Query  228  Y-----LRKYPGYAANARKAFRACGVPEPRC  305
            Y     LRK+   + NARK    CG P PRC
Sbjct  57   YMKDPNLRKFVN-SPNARKVATVCGSPFPRC  86



>gb|AAX95718.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|EAY79131.1| hypothetical protein OsI_34238 [Oryza sativa Indica Group]
 gb|EAZ16616.1| hypothetical protein OsJ_32088 [Oryza sativa Japonica Group]
Length=101

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +3

Query  105  PPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKA  272
            PPP C+   L+PC   I FGTAPS  CC  L+ Q   C C+Y +   Y  Y  + NARK 
Sbjct  31   PPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQ-GCFCQYAKDPTYASYINSTNARKM  89

Query  273  FRACGVPEPRC  305
              ACG+P P C
Sbjct  90   IAACGIPFPNC  100



>ref|XP_010528501.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Tarenaya hassleriana]
Length=92

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 40/80 (50%), Gaps = 7/80 (9%)
 Frame = +3

Query  81   LTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-  257
            L +   P     C    L PC PAI  G  PS ECC  L++Q   CLC Y++  P +A  
Sbjct  15   LLIKTAPLTEAACVVTELAPCLPAITTGGNPSAECCGKLKEQ-ESCLCGYVKN-PAFAQY  72

Query  258  ----NARKAFRACGVPEPRC  305
                NARK   ACGVP P C
Sbjct  73   VSSPNARKVLSACGVPYPSC  92



>ref|XP_006286025.1| hypothetical protein CARUB_v10007556mg [Capsella rubella]
 gb|EOA18923.1| hypothetical protein CARUB_v10007556mg [Capsella rubella]
Length=92

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +3

Query  51   MTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY  230
             TA++     L    P      C+ + +  C PA+  GT PSTECC  L+     C CEY
Sbjct  3    FTALVFIAFVLFSLAPTKSEAACDVKDVRVCLPAVTGGTPPSTECCTTLKAHQ-SCFCEY  61

Query  231  LRK--YPGYAANARKAFRACGVPEPRC  305
            L+      Y  + ++   ACG+P P C
Sbjct  62   LKDPLVVPYKTSVKQVLEACGIPVPVC  88



>ref|XP_010528993.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 40/80 (50%), Gaps = 7/80 (9%)
 Frame = +3

Query  81   LTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-  257
            L +   P     C    L PC PAI  G  PS ECC  L++Q   CLC Y++  P +A  
Sbjct  15   LLIKTAPLTEAACVVAELAPCLPAITTGGNPSAECCGKLKEQ-ESCLCGYIKN-PAFAQY  72

Query  258  ----NARKAFRACGVPEPRC  305
                NARK   ACGVP P C
Sbjct  73   VSSPNARKVLSACGVPYPSC  92



>ref|XP_006391441.1| hypothetical protein EUTSA_v10019362mg [Eutrema salsugineum]
 gb|ESQ28727.1| hypothetical protein EUTSA_v10019362mg [Eutrema salsugineum]
Length=98

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 51/98 (52%), Gaps = 14/98 (14%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPG-------CNERALTPCGPAILFGTAPSTECCRILRQQ  206
            I+ ++L+  + L+ A P P           C+ + L PC  AI  G  PS +CC  L++Q
Sbjct  3    ILASILVVFVILSTAFPAPIKAAAADVGVVCDAKQLQPCLAAITGGGQPSGDCCAKLKEQ  62

Query  207  TPKCLCEYLRKYPGYA-----ANARKAFRACGVPEPRC  305
             P CLC +  K P +A     AN++K   ACGVP P C
Sbjct  63   QP-CLCGF-AKNPAFAQYINSANSQKVLAACGVPLPSC  98



>gb|AGT16134.1| hypothetical protein SHCRBa_127_N06_F_60 [Saccharum hybrid cultivar 
R570]
Length=98

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 6/93 (6%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            A ++  +++    L++  P      C    LTPC PAI+   AP+  CC  L+     C 
Sbjct  7    ASLVLFLVVASAVLSLLAPGAGAATCAPTQLTPCAPAIVGNAAPTAACCARLKAHPASCF  66

Query  222  CEY-----LRKYPGYAANARKAFRACGVPEPRC  305
            C+Y     +++Y   + NA+K F AC VP P+C
Sbjct  67   CQYKNNPNMQRYVN-SPNAKKVFAACKVPLPKC  98



>emb|CDG03100.1| LTP (lipid transfer protein) [Coffea canephora]
Length=98

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            GCN +AL+PC P+I+ GT PS +CC   ++Q P C C ++ K P Y       N +K   
Sbjct  31   GCNAQALSPCLPSIINGTPPSKQCCTNAKEQEP-CFCNFI-KDPAYGKIIKNPNTKKTLE  88

Query  279  ACGVPEPRC  305
            ACG+  P C
Sbjct  89   ACGLKWPTC  97



>ref|XP_010440915.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Camelina 
sativa]
Length=104

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C+   L+ C PA+  G APST+CC  L++Q   CLC Y++   Y  Y    NA K   AC
Sbjct  39   CSAMGLSSCLPAMRSGHAPSTDCCTKLKEQ-ETCLCSYIKTPLYGSYVRSPNAHKTLEAC  97

Query  285  GVPEPRC  305
            GVP P C
Sbjct  98   GVPYPSC  104



>ref|XP_010528502.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=97

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C    L PC PAI  G APS ECC  L++Q P CLC Y++      Y +  NARK   AC
Sbjct  32   CVVTELRPCLPAITTGGAPSAECCGKLKEQQP-CLCGYIKNPALSQYVSSPNARKVLSAC  90

Query  285  GVPEPRC  305
            GVP P C
Sbjct  91   GVPYPSC  97



>ref|XP_006417775.1| hypothetical protein EUTSA_v10009190mg [Eutrema salsugineum]
 gb|ESQ36128.1| hypothetical protein EUTSA_v10009190mg [Eutrema salsugineum]
Length=96

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I    +++     T A        C  + L+PC PA   G+ P+TECC+ L++Q   CLC
Sbjct  9    IAFVIVVVSSWAPTKAIVEEEKVICYAKELSPCEPAAQTGSKPTTECCKKLKEQ-ESCLC  67

Query  225  EYLRKYPGYAA--NARKAFRACGVPEPRC  305
             Y + Y  Y +   ARK   AC +P P C
Sbjct  68   GYAKTYRKYISYEGARKILEACAIPIPTC  96



>emb|CDG03097.1| LTP (lipid transfer protein) [Coffea arabica]
Length=98

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            GCN +AL+PC P+I+ G  P+ ECC   ++Q P CLC ++ K P Y       N +K   
Sbjct  31   GCNPQALSPCLPSIVNGAPPTKECCTNAKEQEP-CLCNFI-KDPAYGKIIKNPNTKKTLE  88

Query  279  ACGVPEPRC  305
            ACG+  P C
Sbjct  89   ACGLKWPTC  97



>ref|XP_008393327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 45/93 (48%), Gaps = 5/93 (5%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            S+ I  A+    + L    P      CN   L+PC  AI   T PST CC  +++Q P C
Sbjct  6    SSYIAIALCTVLVLLLAXAPVSTAVTCNAIQLSPCAGAITSSTPPSTLCCSKIKEQKP-C  64

Query  219  LCEYLR----KYPGYAANARKAFRACGVPEPRC  305
            LC+YL+    K      NARK    CG P P+C
Sbjct  65   LCQYLKNPNLKKLVNTPNARKVASTCGTPFPKC  97



>gb|KFK43095.1| hypothetical protein AALP_AA1G079200 [Arabis alpina]
Length=99

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 5/91 (5%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I    +++  L  T A        CN   L PC  A+  G  PS +CC  L++Q   CLC
Sbjct  9    IAFVVVVVSSLAPTKAVVGSEKVACNVMELQPCLAALQSGGNPSPDCCGKLKEQ-ESCLC  67

Query  225  EYLRK--YPGY--AANARKAFRACGVPEPRC  305
            EY++   +  Y  +ANA+K   ACGVP P C
Sbjct  68   EYIKNPLFGQYVSSANAQKILGACGVPLPTC  98



>ref|NP_001238401.1| uncharacterized protein LOC100306409 precursor [Glycine max]
 gb|ACU14566.1| unknown [Glycine max]
 gb|KHN47234.1| Putative non-specific lipid-transfer protein AKCS9-like protein 
[Glycine soja]
Length=95

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            C    L+PC PAI  G  PS  CC  L+QQ P CLC YL+    K    + NARK   +C
Sbjct  30   CTPTELSPCLPAITSGAKPSNACCTKLKQQKP-CLCGYLKNASLKQYVNSPNARKTVASC  88

Query  285  GVPEPRC  305
            G+P P C
Sbjct  89   GIPFPTC  95



>ref|XP_010528992.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 43/88 (49%), Gaps = 8/88 (9%)
 Frame = +3

Query  60   MLIGELELTMAQPPP-PPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR  236
            M +    L + Q  P     C    LTPC  AI  G  PS  CC  L++Q P CLC Y  
Sbjct  7    MFVTLATLLLIQTAPLTEAACVVTELTPCLTAITTGGKPSAACCSKLKEQQP-CLCGY-A  64

Query  237  KYPGYAA-----NARKAFRACGVPEPRC  305
            K P ++      NARK   ACGVP P+C
Sbjct  65   KNPAFSQYVNSPNARKVLSACGVPIPKC  92



>ref|XP_007139181.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
 gb|ESW11175.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
Length=98

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            ++ A+++  L L+   P      C+   LTPC  AI  G+APS  CC+ L++Q P CLC 
Sbjct  10   VVCAVVLMALVLSDVGPVAEAATCSPTQLTPCLSAITGGSAPSQACCQKLKEQKP-CLCS  68

Query  228  Y-----LRKYPGYAANARKAFRACGVPEPRC  305
            Y     L++Y   +  A+   + CGVP P C
Sbjct  69   YINNPALKQYVN-SPRAKAVLKTCGVPYPTC  98



>ref|XP_010450660.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=90

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 47/91 (52%), Gaps = 8/91 (9%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            +A++  A ++  L L+ A+       C+ + +  C PA++ G+ PSTECC  L      C
Sbjct  6    TALVFIAFVLLSLALSKAEA-----ACDIQDIKVCLPAVIGGSPPSTECCTKLNHNH-SC  59

Query  219  LCEYLRK--YPGYAANARKAFRACGVPEPRC  305
             C+YL+      Y  + ++   ACG+P P C
Sbjct  60   FCDYLKNPLVVPYKTSVKQVLEACGIPVPVC  90



>ref|XP_010108883.1| hypothetical protein L484_027077 [Morus notabilis]
 gb|EXC20523.1| hypothetical protein L484_027077 [Morus notabilis]
Length=98

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+  AL+PC  AI  GTAPS+ CC  LR+Q P CLC Y     LR+Y   + NA+K    
Sbjct  32   CSAVALSPCLSAITGGTAPSSVCCSRLREQRP-CLCGYLKDPNLRQYVN-SPNAKKVASV  89

Query  282  CGVPEPRC  305
            CGV  P+C
Sbjct  90   CGVSYPKC  97



>ref|XP_009111220.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Brassica rapa]
Length=82

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 5/68 (7%)
 Frame = +3

Query  120  NERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRACG  287
            N   LTPC PA   G+ PS ECC  L++Q   CLC+Y+ K  +P Y  +AN +K   ACG
Sbjct  16   NPTELTPCIPAGQTGSQPSAECCGKLKEQE-SCLCKYINKRLFPPYVSSANVQKVLAACG  74

Query  288  VPEPRC*N  311
            +P P C N
Sbjct  75   IPYPICTN  82



>ref|XP_009347476.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=98

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            S+ I  A+    L L    P      CN   L+PC  AI   T PS  CC  +++Q P C
Sbjct  7    SSYIAIALCTVVLLLLATAPVSMAVTCNAIQLSPCAGAITSSTPPSKLCCSKIKEQKP-C  65

Query  219  LCEYLR----KYPGYAANARKAFRACGVPEPRC  305
            LC+YL+    K      NAR   R CG P P+C
Sbjct  66   LCQYLKNPNLKKLVNTPNARNVARTCGTPFPKC  98



>ref|XP_007152725.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
 gb|ESW24719.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
Length=92

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 11/89 (12%)
 Frame = +3

Query  51   MTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY  230
            +  +L+ E++++MA        C+   L+ C  AI   T PS  CC  +++Q P CLC+Y
Sbjct  11   LVVLLVAEVQVSMAV------TCSPVQLSSCVSAITSSTPPSNLCCSKIKEQKP-CLCKY  63

Query  231  LR----KYPGYAANARKAFRACGVPEPRC  305
            L+    K    + NARK    CG P PRC
Sbjct  64   LKNPNLKKFVDSPNARKVASTCGTPFPRC  92



>ref|XP_004961318.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Setaria italica]
Length=101

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 6/68 (9%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C    LTPC PAI+   APS  CC  LR     C C+Y     +++Y   + N +K F A
Sbjct  35   CTPTQLTPCAPAIVGNAAPSAACCAKLRAHPASCFCQYKKDPNMKRYVN-SPNGKKVFAA  93

Query  282  CGVPEPRC  305
            C VP PRC
Sbjct  94   CKVPLPRC  101



>ref|NP_001068293.1| Os11g0620300 [Oryza sativa Japonica Group]
 gb|ABA94775.1| nonspecific lipid-transfer protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28656.1| Os11g0620300 [Oryza sativa Japonica Group]
 dbj|BAG98196.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52484.1| hypothetical protein OsJ_34667 [Oryza sativa Japonica Group]
Length=110

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 44/91 (48%), Gaps = 11/91 (12%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            +M AM  G +E  +     PP  CN   LTPC    LFG      CC  LR Q   CLC 
Sbjct  25   LMVAMGAGVVEAAVV----PPSRCNPTLLTPCAGPALFGGPVPPACCAQLRAQA-ACLCA  79

Query  228  YLRKYPGYAA-----NARKAFRACGVPEPRC  305
            Y R  P Y +     NAR+ F  CG+P P+C
Sbjct  80   YARS-PNYGSYIRSPNARRLFAVCGLPMPQC  109



>ref|XP_006405797.1| hypothetical protein EUTSA_v10028232mg [Eutrema salsugineum]
 gb|ESQ47250.1| hypothetical protein EUTSA_v10028232mg [Eutrema salsugineum]
Length=108

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFRA  281
            C    L+PC PA+  G  P+ +CC  L +Q P CLC Y++  P Y+      NA K F A
Sbjct  43   CVATELSPCLPAVTLGGTPTVDCCGKLNEQKP-CLCGYIKN-PAYSMYITSPNAHKVFTA  100

Query  282  CGVPEPRC  305
            C VP P C
Sbjct  101  CNVPYPSC  108



>ref|NP_973968.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAD94457.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31983.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=96

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 12/93 (13%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            L S  +   +++GE              C+      C P I+ G+ PS ECC  L++Q  
Sbjct  13   LSSVTLTKTLILGE---------EVKATCDFTKFQVCKPEIITGSPPSEECCEKLKEQ-Q  62

Query  213  KCLCEYLRK--YPGYAANARKAFRACGVPEPRC  305
             CLC YL       Y  NA++  RACG+P P C
Sbjct  63   SCLCAYLISPSISQYIGNAKRVIRACGIPFPNC  95



>ref|NP_198633.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAB11284.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42030.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAO50624.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AED94275.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=103

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGY--AANARKAFRAC  284
            C+   L+ C   +L G  PSTECC  L++Q P C C Y++  +Y  Y  +ANA+K    C
Sbjct  38   CDAVQLSSCATPMLTGVPPSTECCGKLKEQQP-CFCTYIKDPRYSQYVGSANAKKTLATC  96

Query  285  GVPEPRC  305
            GVP P C
Sbjct  97   GVPYPTC  103



>emb|CAG28936.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=110

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 44/91 (48%), Gaps = 11/91 (12%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            +M AM  G +E  +     PP  CN   LTPC    LFG      CC  LR Q   CLC 
Sbjct  25   LMVAMGAGVVEAAVV----PPSRCNPTPLTPCAGPALFGGPVPPACCAQLRAQA-ACLCA  79

Query  228  YLRKYPGYAA-----NARKAFRACGVPEPRC  305
            Y R  P Y +     NAR+ F  CG+P P+C
Sbjct  80   YARS-PNYGSYIRSPNARRLFAVCGLPMPQC  109



>ref|XP_006362363.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=100

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 47/92 (51%), Gaps = 14/92 (15%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERAL-TPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I   + +GEL +T AQ       CN   L +PC     F + PS+ CC  LR+Q P CLC
Sbjct  11   IFLVLFLGELLVTEAQ------TCNVNELVSPCFATFAFSSPPSSACCTKLREQQP-CLC  63

Query  225  EYLRKYPGYA-----ANARKAFRACGVPEPRC  305
            EY++  P YA     +   +   AC +P P+C
Sbjct  64   EYIKN-PAYAQYLNSSLISRVLIACKIPVPKC  94



>ref|XP_002889662.1| hypothetical protein ARALYDRAFT_887994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65921.1| hypothetical protein ARALYDRAFT_887994 [Arabidopsis lyrata subsp. 
lyrata]
Length=97

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAANARKAFRACG  287
             C E  L  C PA+   + PSTECC+ L+ Q   CLC+Y+       Y   ARK F ACG
Sbjct  33   ACIETDLQVCQPALETPSPPSTECCKNLKIQQ-SCLCDYMANPSIEKYLEPARKVFAACG  91

Query  288  VPEPRC  305
            +P PRC
Sbjct  92   MPYPRC  97



>ref|NP_849769.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAC43108.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42935.1| At1g43668 [Arabidopsis thaliana]
 gb|AEE31984.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=98

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGYAANARKAFRACG  287
             C    L PC P+++ G+ PST+CC  L++Q   C C+YL+  ++  Y   A++   AC 
Sbjct  34   ACTVTELQPCLPSVIDGSQPSTQCCEKLKEQN-SCFCDYLQNPQFSQYITAAKQILAACK  92

Query  288  VPEPRC  305
            +P P C
Sbjct  93   IPYPNC  98



>gb|AFK37583.1| unknown [Lotus japonicus]
Length=93

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 12/90 (13%)
 Frame = +3

Query  51   MTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY  230
            +  +L+ E+E++MA        C+   L+ C  AI   T P+  CC  +++Q P CLC+Y
Sbjct  11   LFVLLMAEVEMSMATV-----TCSPVQLSSCVSAITSSTPPTNLCCSKIKEQKP-CLCQY  64

Query  231  L-----RKYPGYAANARKAFRACGVPEPRC  305
            L     RK+   + NARK    CG P PRC
Sbjct  65   LKNPYLRKFVS-SPNARKVANTCGTPFPRC  93



>ref|XP_011035101.1| PREDICTED: non-specific lipid-transfer protein 2-like [Populus 
euphratica]
Length=94

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+PC PAI   + PST CC  L++Q P CLC YL+    K    +  +RK   AC
Sbjct  29   CNPGQLSPCLPAITSSSPPSTACCSKLKEQKP-CLCGYLKDPSLKQFVSSPGSRKVASAC  87

Query  285  GVPEPRC  305
            GVP P C
Sbjct  88   GVPYPSC  94



>emb|CDY52889.1| BnaC06g27820D [Brassica napus]
Length=96

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 9/94 (10%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPG--CNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            + +T M+   L  + A P     G  C+ + L PC  AI  G  PS +CC  L++Q P C
Sbjct  5    LALTLMVFVILSPSFAAPTEVALGAACDAKQLQPCLAAITGGGQPSGDCCAKLKEQQP-C  63

Query  219  LCEYLRKYPGYAA-----NARKAFRACGVPEPRC  305
            LC +  K P +A      N+RK   ACG+P P C
Sbjct  64   LCGF-AKNPAFAQYISSPNSRKVLSACGIPYPSC  96



>ref|XP_008374782.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=98

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            S+ I  A+    + L    P      CN   L+PC  AI   T PS  CC  +++Q P C
Sbjct  7    SSYIAIALCTVVVLLLATAPVSTAVTCNAIQLSPCAGAITSSTPPSKLCCSKIKEQKP-C  65

Query  219  LCEYLR----KYPGYAANARKAFRACGVPEPRC  305
            LC+YL+    K      NAR   R CG P P+C
Sbjct  66   LCQYLKNPNLKKLVNTPNARNVARTCGXPFPKC  98



>ref|NP_001065008.1| Os10g0505700 [Oryza sativa Japonica Group]
 gb|AAP54518.1| Nonspecific lipid-transfer protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 gb|AAX95725.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 dbj|BAF26922.1| Os10g0505700 [Oryza sativa Japonica Group]
 dbj|BAG88587.1| unnamed protein product [Oryza sativa Japonica Group]
Length=91

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN   L  C  AI+ G+ PS  CC  LR Q   C C+Y R   Y  Y  +ANARK   +C
Sbjct  26   CNAGQLAICAGAIIGGSTPSASCCSNLRAQRG-CFCQYARNPAYASYINSANARKTLTSC  84

Query  285  GVPEPRC  305
            G+  PRC
Sbjct  85   GIAIPRC  91



>ref|XP_009360132.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 43/90 (48%), Gaps = 5/90 (6%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            I  A+    + L    P      CN   L+PC  AI   T PST CC  +++Q P CLC+
Sbjct  9    IAIALCTVLVLLLATAPVSTAVTCNAIQLSPCAGAITSSTPPSTLCCSKIKEQKP-CLCQ  67

Query  228  YLR----KYPGYAANARKAFRACGVPEPRC  305
            YL+    K      NARK    CG P P+C
Sbjct  68   YLKNPNLKKLVNTPNARKVASTCGTPFPKC  97



>gb|KDP35032.1| hypothetical protein JCGZ_09320 [Jatropha curcas]
Length=94

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 12/93 (13%)
 Frame = +3

Query  39   SAIIMTAMLIGE-LELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPK  215
            +++I+  +L+GE L++ MA        CN   LTPC  AI   + PST CC  L++Q P 
Sbjct  7    ASLIVFLLLLGETLQVAMAV------TCNPVELTPCAKAITSSSPPSTICCSKLKEQKP-  59

Query  216  CLCEYLR----KYPGYAANARKAFRACGVPEPR  302
            CLC+YL+    +    + NA+K    CG P P 
Sbjct  60   CLCQYLKNPYLQKLVNSPNAKKVATTCGSPFPN  92



>ref|XP_002464407.1| hypothetical protein SORBIDRAFT_01g017700 [Sorghum bicolor]
 gb|EER91405.1| hypothetical protein SORBIDRAFT_01g017700 [Sorghum bicolor]
Length=98

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            CN   L  C PA++ G+AP+  CC  LR Q P C C+Y R   Y  Y +  NAR+   +C
Sbjct  33   CNVSLLAVCAPAVISGSAPTAPCCANLRAQQP-CFCQYARNPAYSSYISSPNARRTLTSC  91

Query  285  GVPEPRC  305
            G+  P C
Sbjct  92   GIAVPSC  98



>ref|XP_002889663.1| hypothetical protein ARALYDRAFT_887996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65922.1| hypothetical protein ARALYDRAFT_887996 [Arabidopsis lyrata subsp. 
lyrata]
Length=95

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 6/91 (7%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            + ++  A ++  L  T A+   P   C    L  C PA+  G+ PSTECC  L+++   C
Sbjct  6    TTLVFIAFVLSSLTPTKAEEKEP---CVVTDLIACLPAVQGGSPPSTECCTKLKEKQ-SC  61

Query  219  LCEYLRK--YPGYAANARKAFRACGVPEPRC  305
             CEY +      Y  +A++   ACGVP P C
Sbjct  62   FCEYWKSPLVAPYMTSAKQVLEACGVPVPVC  92



>ref|XP_007217198.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
 gb|EMJ18397.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
Length=98

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             ++M A+++ E E  MA+       C+   L+PC   I  G+ PST CC+ LR+Q P CL
Sbjct  13   VVVMVAVMLSE-EARMAEAV----TCSPVQLSPCLGPINSGSPPSTTCCQKLREQRP-CL  66

Query  222  CEY-----LRKYPGYAANARKAFRACGVPEPRC  305
            C Y     LR+Y   + NARK    CGVP P+C
Sbjct  67   CGYLKNPSLRQYVN-SPNARKLASNCGVPVPQC  98



>gb|EEC68552.1| hypothetical protein OsI_36865 [Oryza sativa Indica Group]
Length=109

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 45/92 (49%), Gaps = 11/92 (12%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            + + AM +G +E  +     PP  CN   LTPC    LFG      CC  LR Q   CLC
Sbjct  23   MYLMAMGVGVVEAAVL----PPSRCNPTLLTPCAGPTLFGGPVPPACCAQLRAQA-ACLC  77

Query  225  EYLRKYPGYAA-----NARKAFRACGVPEPRC  305
             Y R  P Y +     NA++ F  CG+P PRC
Sbjct  78   AYARS-PNYGSYIRSPNAKRLFTVCGLPIPRC  108



>ref|XP_010435719.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=104

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C+   L+ C PAI  G APST+CC  L++Q P CL  Y+    Y  Y +  NARK   AC
Sbjct  39   CSPTELSSCLPAITSGGAPSTQCCTKLKEQEP-CLSSYITNPLYSTYVSSPNARKTLAAC  97

Query  285  GVPEPRC  305
             VP P C
Sbjct  98   NVPYPTC  104



>ref|XP_010475550.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=99

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 47/98 (48%), Gaps = 12/98 (12%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPG---------CNERALTPCGPAILFGTAPSTECCRIL  197
             I+T ++I  +  ++A       G         C    L  C PA+  G  PSTECCR L
Sbjct  3    FIITLLVIAFVMSSLASTKAMDVGVSREDEKVACVVTDLQVCLPALETGRPPSTECCRNL  62

Query  198  RQQTPKCLCEYLRK--YPGYAANARKAFRACGVPEPRC  305
            ++Q   CLC+Y++      Y   ARK F ACG+  P C
Sbjct  63   KKQQS-CLCDYMKNPSIDKYLKPARKVFHACGMLYPSC  99



>ref|XP_006430726.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
 gb|ESR43966.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
Length=99

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+PC PAI     PS  CC  +RQQ P CLC +LR    K    + NA++    C
Sbjct  34   CNPTELSPCAPAITSSAPPSRACCNKMRQQRP-CLCGFLRDPNLKQYVNSPNAKRVIATC  92

Query  285  GVPEPRC  305
            G+P PRC
Sbjct  93   GIPYPRC  99



>gb|AAB47967.1| nonspecific lipid transfer protein [Hordeum vulgare]
 dbj|BAJ91523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=96

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 46/92 (50%), Gaps = 7/92 (8%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +++  +    + L +A        CN   LTPC  AI+   AP+  CC  +R+Q P C+C
Sbjct  7    LVVALLAFSAVVLMVAPAGAEAATCNALQLTPCAGAIMGNAAPTASCCSKMREQQP-CMC  65

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     L++Y   + N +K   AC VP P C
Sbjct  66   QYARDPNLKQYVD-SPNGKKVMAACKVPVPSC  96



>ref|XP_009804140.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 49/92 (53%), Gaps = 13/92 (14%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
             I+ A+L+ E  +++A        C+   L+PC  AI   + PS  CC  +R+Q P CLC
Sbjct  10   FIVLALLLAESHISVAV------TCSAIQLSPCLGAITSKSPPSILCCSKIREQKP-CLC  62

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     LR Y   +  A+K  R CGVP P+C
Sbjct  63   QYLKNPNLRNYVN-SPGAKKVARTCGVPYPKC  93



>ref|NP_001235108.1| uncharacterized protein LOC100306442 precursor [Glycine max]
 gb|ACU14623.1| unknown [Glycine max]
 gb|KHN23756.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 11/90 (12%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            ++   L+ E++++MA        C+   L+ C  AI   T PS  CC  +++Q P CLC+
Sbjct  11   LVVVFLVAEVQVSMAV------TCSPVQLSACVSAITSSTPPSNLCCSKIKEQKP-CLCQ  63

Query  228  YLR----KYPGYAANARKAFRACGVPEPRC  305
            YL+    K    + NAR+    CG P PRC
Sbjct  64   YLKNPNLKKFVDSPNARRVASTCGTPFPRC  93



>ref|XP_002889661.1| hypothetical protein ARALYDRAFT_887993 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65920.1| hypothetical protein ARALYDRAFT_887993 [Arabidopsis lyrata subsp. 
lyrata]
Length=96

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = +3

Query  39   SAIIMTAMLIGELELT--MAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            + ++  A ++  L LT  M         C+      C PAI+ G+ PS ECC  L++Q  
Sbjct  4    TTLVFIAFVLSSLVLTKTMISGKEVKAACDFAKFQICKPAIIAGSPPSEECCGKLKEQQS  63

Query  213  KCLCEYLR--KYPGYAANARKAFRACGVPEPRC  305
             CLC Y+       Y  NA++   ACG+P   C
Sbjct  64   -CLCAYVISPSISQYIGNAKRLIAACGIPFSNC  95



>ref|XP_009781752.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 13/96 (14%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            L    ++T +L+GEL+ + A        CN   L+ C  A+     PS+ CC  +R+Q P
Sbjct  7    LAMIFVVTLVLLGELQASEAVT------CNASQLSECVGAVTSSQPPSSACCSKMREQQP  60

Query  213  KCLCEY-----LRKYPGYAANARKAFRACGVPEPRC  305
             CLC Y     LR+Y   + NAR+   ACGV  P C
Sbjct  61   -CLCGYMKDPSLRQYVN-SPNARRVANACGVAVPSC  94



>gb|AFP49331.1| non-specific lipid-transfer protein type 2, partial [Olea europaea]
Length=82

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 13/89 (15%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYL  233
              +L+GEL ++ A        CN   L+PC  AI  G  PS  CC+ L++Q P CLC Y+
Sbjct  2    VVLLLGELHVSEAVT------CNPLQLSPCLGAITSGQPPSAACCKKLQEQKP-CLCGYI  54

Query  234  R-----KYPGYAANARKAFRACGVPEPRC  305
            +     KY   + NA+K   +CGV  P C
Sbjct  55   KDPNLGKYVN-SPNAKKVASSCGVAVPNC  82



>ref|XP_008229267.1| PREDICTED: non-specific lipid-transfer protein 2 [Prunus mume]
Length=98

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 12/93 (13%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             ++M A+++ E E  MA+       C+   L+PC   I  G  PST CC+ LR+Q P CL
Sbjct  13   VVVMVAVMLSE-EARMAEAVT----CSPVQLSPCLGPINSGARPSTTCCQKLREQRP-CL  66

Query  222  CEY-----LRKYPGYAANARKAFRACGVPEPRC  305
            C Y     LR+Y   + NARK    CGVP P+C
Sbjct  67   CGYLKNPSLRQYVN-SPNARKLASNCGVPVPQC  98



>ref|NP_001065006.1| Os10g0505000 [Oryza sativa Japonica Group]
 gb|AAP54512.1| Nonspecific lipid-transfer protein 2G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|AAX95719.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 dbj|BAF26920.1| Os10g0505000 [Oryza sativa Japonica Group]
 gb|EAZ16617.1| hypothetical protein OsJ_32089 [Oryza sativa Japonica Group]
Length=100

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILR-QQTPKCLCEYLRK--YPGY--AANARKAFRA  281
            C+   L+ C   I FGTAPS  CC  LR Q+   C C+Y R   Y  Y  + NAR    A
Sbjct  33   CDPGKLSACAVPIFFGTAPSKSCCSNLRAQEKDGCFCQYARDPMYASYINSTNARNTIAA  92

Query  282  CGVPEPRC  305
            CG+  P C
Sbjct  93   CGIAFPSC  100



>gb|AAS68185.1| lipid transfer-like protein [Brassica napus var. napus]
Length=102

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 44/99 (44%), Gaps = 16/99 (16%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPP-----------PPPGCNERALTPCGPAILFGTAPSTECCRILR  200
            T MLI  + + M+ P P               C    L PC PA+     P+TECC  L 
Sbjct  5    TLMLITFVIIAMSSPVPIRATRVESFGEVAQSCVVTELAPCLPAMTLTGDPTTECCDKLV  64

Query  201  QQTPKCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            +Q P CLC Y+R   Y  Y    NARK    C VP P C
Sbjct  65   EQKP-CLCGYIRNPAYSMYVTSPNARKVLDFCKVPFPSC  102



>gb|ACG48207.1| nonspecific lipid-transfer protein precursor [Zea mays]
Length=101

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFR  278
             C+   LTPC  AI+ G +PS  CC  L++Q P CLC Y     L++Y   + N +KA  
Sbjct  35   ACDATQLTPCAGAIIIGRSPSAACCSRLKEQQP-CLCTYARDPNLQRYVN-SPNGKKAMA  92

Query  279  ACGVPEPRC  305
            AC VP P C
Sbjct  93   ACKVPVPSC  101



>ref|XP_004299573.1| PREDICTED: non-specific lipid-transfer protein 2-like [Fragaria 
vesca subsp. vesca]
Length=96

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 12/90 (13%)
 Frame = +3

Query  51   MTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY  230
            +  +++   E++MA        C+   L+ C  AI   T PS+ CC  LR+Q P CLC+Y
Sbjct  13   VVVVMLATAEVSMA-----AVTCSPVQLSSCASAISSNTPPSSLCCTKLREQKP-CLCQY  66

Query  231  -----LRKYPGYAANARKAFRACGVPEPRC  305
                 L+K+     NARK  R CG P PRC
Sbjct  67   LNNPNLKKFVN-TPNARKVARTCGTPFPRC  95



>ref|XP_008229268.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=98

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             ++M AM++GE E  M +       C+   L+ C   I  GT PST CC+ LR+Q P CL
Sbjct  13   VVVMMAMVLGE-EARMTEAVT----CSPLELSSCLEPIRSGTPPSTTCCQKLREQKP-CL  66

Query  222  CEYLRK--YPGYAAN--ARKAFRACGVPEPRC  305
            C YL+      Y ++  ARK    CGVP P+C
Sbjct  67   CGYLKDPALKQYVSSPTARKVASTCGVPFPQC  98



>gb|EAY79135.1| hypothetical protein OsI_34242 [Oryza sativa Indica Group]
Length=99

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILR-QQTPKCLCEYLRK--YPGY--AANARKAFRA  281
            C+   L+ C   I FGTAPS  CC  LR Q+   C C+Y R   Y  Y  + NAR    A
Sbjct  32   CDPGKLSACAVPIFFGTAPSKSCCSNLRAQEKDGCFCQYARDPMYASYINSTNARNTIAA  91

Query  282  CGVPEPRC  305
            CG+  P C
Sbjct  92   CGIAFPSC  99



>ref|XP_008444076.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=94

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 45/92 (49%), Gaps = 16/92 (17%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            AI +T + +GE              CN   L+PC  AI   TAP+  CC+ LRQQ P C 
Sbjct  15   AIFLTGVRLGE-----------AASCNPTELSPCVSAITSSTAPTAACCQKLRQQEP-CY  62

Query  222  CEYLR--KYPGYAAN--ARKAFRACGVPEPRC  305
            C YL+  KY  YA +   R     C VP P+C
Sbjct  63   CGYLKDPKYKAYAESPRVRAIASQCRVPIPKC  94



>emb|CDM81734.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 46/92 (50%), Gaps = 7/92 (8%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +++  +    + L +A        CN   LTPC  AI+   AP+  CC  +++Q P C+C
Sbjct  7    VVVALLAFSAVVLMVAPAGAEAATCNALQLTPCAGAIIGSAAPTASCCSKMKEQQP-CMC  65

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     L++Y   + N +K   AC VP P C
Sbjct  66   QYARDPNLKQYVD-SPNGKKVMAACKVPVPSC  96



>emb|CDP02752.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 48/95 (51%), Gaps = 11/95 (12%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            L S +++  M++GE++++ A        C+   L+PC  A +    PS  CC  LR+Q P
Sbjct  3    LCSVLLLVVMIVGEVQVSRAII------CSPTELSPCVAAFISQQPPSGACCSKLREQRP  56

Query  213  KCLCEYLR----KYPGYAANARKAFRACGVPEPRC  305
             C C YLR    +      N R+    CGVP PRC
Sbjct  57   -CFCGYLRDPYLRQYVNTPNGRREASFCGVPSPRC  90



>emb|CDY01688.1| BnaC04g30640D [Brassica napus]
Length=132

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 44/99 (44%), Gaps = 16/99 (16%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPP-----------PPPGCNERALTPCGPAILFGTAPSTECCRILR  200
            T MLI  + + M+ P P               C    L PC PA+     P+TECC  L 
Sbjct  35   TLMLITFVIIAMSSPVPIRATRVESFGEVAQSCVVTELAPCLPAMTLTGDPTTECCDKLV  94

Query  201  QQTPKCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            +Q P CLC Y+R   Y  Y    NARK    C VP P C
Sbjct  95   EQKP-CLCGYIRNPAYSMYVTSPNARKVLDFCKVPFPSC  132



>gb|KEH44195.1| Lipid transfer protein [Medicago truncatula]
Length=92

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 11/90 (12%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            IM  +L+ + EL+M         CN   L+ C  AI+    PS  CC  L++Q P CLC+
Sbjct  10   IMLTVLLAKTELSM------EITCNALQLSACANAIISSNPPSAICCSKLKEQKP-CLCQ  62

Query  228  YLR----KYPGYAANARKAFRACGVPEPRC  305
            YL+    K    + NA K   ACG P P C
Sbjct  63   YLKDPNLKKFVNSPNAIKVSDACGSPFPIC  92



>ref|XP_003558992.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Brachypodium 
distachyon]
Length=95

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGYAAN--ARKAFRA  281
            GCN   L+ C  AI  G+ PS ECC  LR Q   CLC+Y +   Y  Y ++  AR+   +
Sbjct  29   GCNAGQLSVCAVAITSGSPPSAECCSNLRAQQ-GCLCQYAKDPNYGRYISSPYARQTVAS  87

Query  282  CGVPEPRC  305
            CG+P P+C
Sbjct  88   CGIPVPKC  95



>ref|XP_006405794.1| hypothetical protein EUTSA_v10028094mg [Eutrema salsugineum]
 gb|ESQ47247.1| hypothetical protein EUTSA_v10028094mg [Eutrema salsugineum]
Length=102

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 36/68 (53%), Gaps = 5/68 (7%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRA  281
             C    L PC PAI  G  P+ +CC  L++Q P C C+Y++   Y  Y    NARK   A
Sbjct  36   SCVPTELLPCLPAITIGGEPAKDCCDKLKEQQP-CFCDYIKNPMYSMYVTSPNARKVLDA  94

Query  282  CGVPEPRC  305
            C +P P C
Sbjct  95   CKIPFPSC  102



>ref|XP_004234577.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=92

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            C+   L PC  AIL    PS ECC  L++Q P CLC YL+    K    + NA+K  + C
Sbjct  27   CSVTELVPCAAAILSSQPPSKECCNKLKEQKP-CLCGYLKNPSLKQYVNSPNAKKVAKTC  85

Query  285  GVPEPRC  305
            GV  P C
Sbjct  86   GVSTPSC  92



>ref|XP_009613748.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=94

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 8/92 (9%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            AI    +LI   E  +A+       CN   L+PC  AI+  T PS  CC  L++Q P CL
Sbjct  7    AIFAMVLLILGQETKIAKADV---TCNPLMLSPCANAIMSSTTPSAMCCSKLKEQRP-CL  62

Query  222  CEYLR----KYPGYAANARKAFRACGVPEPRC  305
            C+Y++    +    + NA+K    CG P P+C
Sbjct  63   CQYMKDPRLQKMISSPNAKKVASTCGSPFPKC  94



>ref|XP_004288629.1| PREDICTED: non-specific lipid-transfer protein 2-like [Fragaria 
vesca subsp. vesca]
Length=103

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 8/91 (9%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            II T+    +L L  A+       C+   L+ C   I +G+ PS+ CC+ L+ Q P CLC
Sbjct  17   IIFTSSATADLVLVAAEVDTT---CSPVELSSCLDPIQYGSKPSSICCQKLKGQVP-CLC  72

Query  225  EYLRK--YPGYAA--NARKAFRACGVPEPRC  305
             Y++   +  Y    NA+K    CGVP PRC
Sbjct  73   GYIKNPAFKKYVTGPNAQKLSSNCGVPFPRC  103



>ref|XP_002440196.1| hypothetical protein SORBIDRAFT_09g027600 [Sorghum bicolor]
 gb|EES18626.1| hypothetical protein SORBIDRAFT_09g027600 [Sorghum bicolor]
Length=104

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (46%), Gaps = 6/92 (7%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            ++ T+ ++  +             C    LTPC PAI+   AP+  CC  L+     C C
Sbjct  14   VVATSAVVASMLAVAPGAGAATTACVPTQLTPCAPAIVGNAAPTAACCARLKAHPASCFC  73

Query  225  EYLRKYPGY-----AANARKAFRACGVPEPRC  305
            +Y +K P       + N +K F AC VP P+C
Sbjct  74   QY-KKNPNMQRYVNSPNGKKVFAACKVPLPKC  104



>ref|XP_002875492.1| hypothetical protein ARALYDRAFT_905202 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51751.1| hypothetical protein ARALYDRAFT_905202 [Arabidopsis lyrata subsp. 
lyrata]
Length=94

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +3

Query  111  PGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAAN--ARKAFR  278
            P C++  +T C PAIL+G  P+ +CC  ++ Q P C C++++   +  Y  +  AR   +
Sbjct  27   PACDKIEITGCIPAILYGDKPTAQCCGKMKAQQP-CFCDFIKNPVFNKYVTSPQARAILK  85

Query  279  ACGVPEPRC  305
             CG+P P C
Sbjct  86   FCGIPYPTC  94



>ref|XP_010320740.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=95

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 10/92 (11%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            AI++  + + E ++T A        CN   L+ C  AI   T PS+ CC  L++Q P CL
Sbjct  10   AIVLFLVFVQETKVTKANV-----SCNPLQLSACANAITSSTTPSSICCSKLKEQRP-CL  63

Query  222  CEYLR----KYPGYAANARKAFRACGVPEPRC  305
            C+Y++    +    + NA+K    CG P P C
Sbjct  64   CKYMKDPRLQKMISSPNAKKVATTCGSPFPNC  95



>ref|XP_009599113.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 13/92 (14%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +++T +L GE + + A        C+   L+ C  A+    APS+ CC  +R+Q P CLC
Sbjct  11   LVLTLVLQGEFQASEA------VTCSASQLSECVGAVTSSQAPSSACCSKMREQQP-CLC  63

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
             Y     LR+Y   + NAR+   ACGV  P C
Sbjct  64   GYMKDPSLRQYVN-SPNARRVANACGVAVPSC  94



>ref|XP_009626576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=97

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 46/92 (50%), Gaps = 13/92 (14%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            ++   + +GE   T A        C+   L+PC  AI     PS+ CC  LR+Q P CLC
Sbjct  14   VVTLVLFLGEFRATEAVT------CSAVELSPCVGAITSSQPPSSACCAKLREQKP-CLC  66

Query  225  EYLRKYPGY-----AANARKAFRACGVPEPRC  305
             YL K P       + NA++  R+CGVP P C
Sbjct  67   GYL-KNPNLRPYVNSPNAKRVARSCGVPTPSC  97



>ref|XP_010227440.1| PREDICTED: probable non-specific lipid-transfer protein 2 [Brachypodium 
distachyon]
Length=92

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAAN--ARKAFRAC  284
            C+  AL+PC  AI+ G A +  CC  L+ Q   CLC+Y R   Y GY  +  A+   +AC
Sbjct  27   CDATALSPCVGAIMLGGAVTPGCCARLKAQQ-GCLCQYARNPSYAGYVGSPRAQGVVQAC  85

Query  285  GVPEPRC  305
            G+P+P+C
Sbjct  86   GLPKPKC  92



>ref|XP_006855789.1| hypothetical protein AMTR_s00044p00213430 [Amborella trichopoda]
 gb|ERN17256.1| hypothetical protein AMTR_s00044p00213430 [Amborella trichopoda]
Length=92

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   AMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECC-RILRQQTPKCLCEYL  233
            ++L+  + L  +  P     C+   LTPCG A      P+  CC R+L QQ+  C C+YL
Sbjct  7    SVLLSFVLLVSSGLPSANGACDISTLTPCGSAFYNSQPPTPTCCSRLLDQQS--CYCQYL  64

Query  234  R--KYPGY--AANARKAFRACGVPEPRC  305
            +  +Y G   + N +   RAC VP PRC
Sbjct  65   KDPRYSGIINSPNGKSILRACKVPIPRC  92



>gb|KGN53813.1| hypothetical protein Csa_4G141210 [Cucumis sativus]
Length=95

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 11/91 (12%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +++ A+ +  + L  A        CN   L+PC  AI   TAP+  CC+ LRQQ P C C
Sbjct  12   LVVVAIFLSSVRLGEA------VSCNPTELSPCVSAITSSTAPTAACCQKLRQQEP-CYC  64

Query  225  EYLR--KYPGYAAN--ARKAFRACGVPEPRC  305
             YL+  KY  YA +   R     C VP P+C
Sbjct  65   GYLKDPKYKAYAESPRVRAIASQCRVPIPKC  95



>ref|XP_006367505.1| PREDICTED: uncharacterized protein LOC102587705 [Solanum tuberosum]
Length=174

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 43/80 (54%), Gaps = 13/80 (16%)
 Frame = +3

Query  63   LIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY----  230
            L+GEL +  +        CN   L PC PAI+ G  PS  CC  L++Q P CLC Y    
Sbjct  19   LLGELLVVES------ATCNVMELVPCSPAIISGQPPSEVCCAKLKEQVP-CLCGYFNDP  71

Query  231  -LRKYPGYAANARKAFRACG  287
             L+ Y G + NA+K F+ CG
Sbjct  72   TLKPYVG-SPNAQKVFQTCG  90



>ref|XP_006482208.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=99

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            C+   L+PC PAI     PS  CC  +RQQ P CLC +LR    K    + NA++    C
Sbjct  34   CSPTELSPCAPAITSSAPPSGACCNKMRQQRP-CLCGFLRDPNLKQYVNSPNAKRVIATC  92

Query  285  GVPEPRC  305
            G+P PRC
Sbjct  93   GIPYPRC  99



>ref|NP_001058516.1| Os06g0705400 [Oryza sativa Japonica Group]
 dbj|BAD53591.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53804.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20430.1| Os06g0705400 [Oryza sativa Japonica Group]
 dbj|BAG88404.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            CN  AL+PC  AI+ G APS  CC  LR Q P CLC+Y R   Y  Y    +A++A +AC
Sbjct  30   CNPSALSPCMSAIMLGAAPSPGCCVQLRAQQP-CLCQYARDPSYRSYVTSPSAQRAVKAC  88

Query  285  GV  290
             V
Sbjct  89   NV  90



>gb|AGT16137.1| hypothetical protein SHCRBa_127_N06_F_390 [Saccharum hybrid cultivar 
R570]
Length=100

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 6/63 (10%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRACGVPE  296
            LTPC PAI+   AP+  CC  L+     C C+Y     +++Y   + NA K F AC VP 
Sbjct  39   LTPCAPAIVGNAAPTAACCARLKAHPASCFCQYKNNPNMQRYVN-SPNANKVFSACKVPL  97

Query  297  PRC  305
            P+C
Sbjct  98   PKC  100



>ref|NP_001146849.1| LOC100280457 precursor [Zea mays]
 gb|ACG23937.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|AFW65060.1| nonspecific lipid-transfer protein [Zea mays]
Length=97

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 42/94 (45%), Gaps = 11/94 (12%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPPPPPG------CNERALTPCGPAILFGTAPSTECCRILRQQTPK  215
            TAM +  L L +        G      C+ + L  C PA + G  P+  CC  LR Q   
Sbjct  5    TAMFVAALALVVVMATTSTGGGRAAAACDPKPLVVCDPAFMDGAKPAAACCSTLRAQ-EA  63

Query  216  CLCEYLR--KYPGYAA--NARKAFRACGVPEPRC  305
            CLC Y +  K+  Y    N  K F +CG+  P+C
Sbjct  64   CLCVYAKDPKFAKYINNPNTAKTFTSCGIAIPKC  97



>ref|XP_009589151.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI   T PS  CC  ++QQ P CLC+Y     L+KY    A A+K  R 
Sbjct  28   CSPVQLSPCLGAIRSSTPPSKLCCSKIKQQKP-CLCQYLKNPNLKKYVNSPA-AKKVART  85

Query  282  CGVPEPRC  305
            CGVP PRC
Sbjct  86   CGVPYPRC  93



>ref|XP_002889660.1| hypothetical protein ARALYDRAFT_887992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65919.1| hypothetical protein ARALYDRAFT_887992 [Arabidopsis lyrata subsp. 
lyrata]
Length=98

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGYAANARKAFRACG  287
             C    L PC PA+   + PSTECCR L++Q   C C+YL+  ++  Y    +K   AC 
Sbjct  34   ACIVTKLQPCLPAVTNESPPSTECCRKLKEQH-SCFCDYLQNPQFSPYITAGKKVLAACK  92

Query  288  VPEPRC  305
            +P P+C
Sbjct  93   IPYPKC  98



>ref|NP_001275625.1| probable non-specific lipid-transfer protein AKCS9-like precursor 
[Solanum tuberosum]
 dbj|BAC23052.1| putative lipid transfer protein [Solanum tuberosum]
Length=93

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAAN--ARKAFRAC  284
            C+   L+PC  AI   +APST CC  +R+Q P CLC YL+      Y  +  A+K  R C
Sbjct  28   CSAIQLSPCLGAITSNSAPSTLCCSRIREQKP-CLCTYLKNPTLRNYVNSPGAKKVARTC  86

Query  285  GVPEPRC  305
            GVP P+C
Sbjct  87   GVPYPKC  93



>ref|XP_009792617.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI   T PS  CC  ++QQ P CLC+Y     L+KY    A A+K  R 
Sbjct  28   CSPVQLSPCLGAIRSSTPPSKLCCSKIKQQKP-CLCQYLKNPNLKKYVNSPA-AKKVART  85

Query  282  CGVPEPRC  305
            CGVP PRC
Sbjct  86   CGVPYPRC  93



>gb|AAA33933.1| lipid transfer protein, partial [Senecio odorus]
Length=89

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 44/93 (47%), Gaps = 8/93 (9%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            SAI + A+L+    +           C+   L PC  A     AP+ +CC  L++Q+P C
Sbjct  1    SAIYIVALLV---MIVAGSKVATAATCSVTELMPCSSAFTSSAAPTAQCCTKLKEQSP-C  56

Query  219  LCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            LC YL+      Y    NA+K    CGVP P C
Sbjct  57   LCGYLKNPTLKQYITNPNAKKVTSTCGVPIPNC  89



>ref|XP_009127492.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
 emb|CDY12591.1| BnaA02g12590D [Brassica napus]
Length=98

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = +3

Query  45   IIMTAMLIGELELTM------AQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQ  206
            I++  +++  + LT+      A        C+ + L PC  AI  G  PS +CC  L++Q
Sbjct  3    IMVLTLMVFVILLTLFPAPNEAADTNVEAACDPKQLQPCLAAITGGGQPSGDCCAKLKEQ  62

Query  207  TPKCLCEYLRKYPGYAA-----NARKAFRACGVPEPRC  305
             P CLC +  K P +A      N+RK   ACG+P P C
Sbjct  63   QP-CLCGF-SKNPAFAQYISSPNSRKVLTACGIPYPSC  98



>emb|CDY47738.1| BnaA02g16570D [Brassica napus]
Length=98

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 13/94 (14%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            SAI++  ++  E  +   Q       C+   L PC  AIL G+ PS  CC  L QQ   C
Sbjct  13   SAILLLLIVAQENRVVAGQ------SCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQ-HC  65

Query  219  LCEYLRKYPGYAA-----NARKAFRACGVPEPRC  305
            +C+Y+ K P + +     NA+K    C  P+P+C
Sbjct  66   VCQYM-KNPNFKSFLDSPNAKKIATDCHCPKPKC  98



>gb|KGN53816.1| hypothetical protein Csa_4G141240 [Cucumis sativus]
Length=96

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN   L+PC  A+     PST CC  LR+Q P C C+Y++     GY  +A A+    +C
Sbjct  31   CNTMGLSPCIGAMTSTAPPSTTCCSKLREQQP-CFCQYMKNPSLGGYVKSARAKAIISSC  89

Query  285  GVPEPRC  305
            GVP P+C
Sbjct  90   GVPYPKC  96



>ref|XP_006405795.1| hypothetical protein EUTSA_v10028000mg [Eutrema salsugineum]
 gb|ESQ47248.1| hypothetical protein EUTSA_v10028000mg [Eutrema salsugineum]
Length=102

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 7/70 (10%)
 Frame = +3

Query  111  PGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAF  275
            P C    L PC PAI  G  P+ +CC  L++Q  +CLC Y+ K P Y+      NARK  
Sbjct  35   PSCVSMELLPCLPAISMGGEPTKDCCDNLKEQ-KQCLCGYI-KNPDYSLFVTSPNARKII  92

Query  276  RACGVPEPRC  305
             AC VP   C
Sbjct  93   DACKVPVTSC  102



>ref|XP_002284213.1| PREDICTED: non-specific lipid-transfer protein 2-like [Vitis 
vinifera]
Length=92

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 13/91 (14%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            ++  +L+ E  LT A        C+   L+ C  AI     PS+ CC  LR+Q P CLC 
Sbjct  10   VIMVVLLSEAHLTKAV------TCSPLELSSCFAAITSSAPPSSMCCSKLREQRP-CLCG  62

Query  228  YLR-----KYPGYAANARKAFRACGVPEPRC  305
            Y+R     +Y   +ANAR+    CGVP P C
Sbjct  63   YIRDPNLSQYVN-SANARRVASTCGVPFPNC  92



>gb|KGN53818.1| hypothetical protein Csa_4G146250 [Cucumis sativus]
Length=96

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN   L+PC  A+     PST CC  LR+Q P C C+Y++     GY  +A A+    +C
Sbjct  31   CNTMGLSPCIGAMTSTAPPSTTCCSKLREQQP-CFCQYMKNPSLGGYVKSARAKAIISSC  89

Query  285  GVPEPRC  305
            GVP P+C
Sbjct  90   GVPYPKC  96



>ref|XP_003571950.1| PREDICTED: uncharacterized protein LOC100829407 [Brachypodium 
distachyon]
Length=406

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPK-CLCEYLRK--YPGY--AANARKAFRA  281
            C+   L  C PAIL G  P+  CC  LR+Q  + C CEYLR   Y GY  +  AR A  A
Sbjct  32   CDAGQLVVCAPAILGGAMPTASCCSKLREQEQQGCFCEYLRNPAYAGYINSQTARGAIAA  91

Query  282  CGVPEPR  302
            C V  P+
Sbjct  92   CNVTLPQ  98



>ref|XP_010279350.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=93

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR-----KYPGYAANARKAFRA  281
            CN   L+PC  A++  + PS  CC  LR+Q P C C+YLR     +Y   + NA+K   +
Sbjct  28   CNFSQLSPCSNALVNNSPPSKLCCDKLREQRP-CFCQYLRDPSLGQYVN-SPNAKKVVSS  85

Query  282  CGVPEPRC  305
            CGV  P C
Sbjct  86   CGVSIPNC  93



>ref|XP_009804692.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 38/68 (56%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI  GT PS  CC  LR Q P CLC Y     LR+Y   ++NARK   +
Sbjct  29   CSATQLSPCLGAITSGTPPSQACCARLRAQQP-CLCGYMRDPNLRQYVN-SSNARKVASS  86

Query  282  CGVPEPRC  305
            CGV  P C
Sbjct  87   CGVSIPSC  94



>ref|XP_002449439.1| hypothetical protein SORBIDRAFT_05g011660 [Sorghum bicolor]
 ref|XP_002449440.1| hypothetical protein SORBIDRAFT_05g011670 [Sorghum bicolor]
 gb|EES08427.1| hypothetical protein SORBIDRAFT_05g011660 [Sorghum bicolor]
 gb|EES08428.1| hypothetical protein SORBIDRAFT_05g011670 [Sorghum bicolor]
Length=91

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 39/86 (45%), Gaps = 6/86 (7%)
 Frame = +3

Query  63   LIGELELTMAQPPPP---PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYL  233
            ++  L L M            CN   L  C  A++ G  P+  CC ILR Q   CLC+Y 
Sbjct  7    IVVALALAMVVAMSVGRVSANCNIALLAVCKTAVIGGLKPTVTCCSILRAQ-EACLCKYQ  65

Query  234  R--KYPGYAANARKAFRACGVPEPRC  305
            +  KY  Y   ARK   +CG+  P C
Sbjct  66   KDPKYGMYINPARKMITSCGMAIPNC  91



>ref|XP_009386356.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYP---GY--AANARKAFRA  281
            CN   L+ C  AIL    P+  CC  L++Q P CLCEY RK P   GY  + N++K  ++
Sbjct  26   CNPSELSSCAGAILTSAPPTAACCAKLKEQRP-CLCEY-RKNPNLKGYINSDNSKKVSKS  83

Query  282  CGVPEPRC  305
            CGVP P C
Sbjct  84   CGVPIPSC  91



>gb|ACJ68107.1| lipid transfer-like protein [Brassica napus]
Length=102

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 44/101 (44%), Gaps = 16/101 (16%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPP-----------PPPGCNERALTPCGPAILFGTAPSTECCRI  194
            + T MLI  + + M+ P P               C    L PC PA+     P+TECC  
Sbjct  3    LTTLMLITFVIIAMSSPVPIRATRVESFGEVAQSCVVTELAPCLPAMTLTGDPTTECCDK  62

Query  195  LRQQTPKCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            L +Q P CLC Y+R   Y  Y    NARK    C VP   C
Sbjct  63   LVEQKP-CLCGYIRNPAYSMYVTSPNARKVLDFCKVPFXSC  102



>ref|XP_008782311.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=94

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN   L+PC  AIL  + P++ CC  L+ Q P C C+Y +     GY  + N+RK   AC
Sbjct  29   CNPSELSPCAGAILRSSPPTSACCAKLKAQQP-CFCQYTKNPSLRGYINSPNSRKVVAAC  87

Query  285  GVPEPRC  305
            GV  PRC
Sbjct  88   GVSIPRC  94



>ref|XP_006292537.1| hypothetical protein CARUB_v10018768mg [Capsella rubella]
 gb|EOA25435.1| hypothetical protein CARUB_v10018768mg [Capsella rubella]
Length=101

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             +++ + L+            PP  CN+  +T C  AIL+G  P+ +CC  ++ Q P C 
Sbjct  13   VLVLMSFLVPIKSYVFENSVKPP--CNQIEITDCISAILYGDKPTAKCCGEMKAQQP-CF  69

Query  222  CEYLRK--YPGYAAN--ARKAFRACGVPEPRC  305
            C++++   +  Y  +  AR   ++CG+P P C
Sbjct  70   CDFIKNPVFNKYVTSPQARAILQSCGIPYPIC  101



>gb|ACM78620.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=94

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 13/88 (15%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            A+++   L+GE E+  A        C+   L+PC  AI     PS  CC  LR+QTP CL
Sbjct  11   AVVVATTLLGEAEIAEAVT------CSPLQLSPCAGAITGSGPPSATCCSRLREQTP-CL  63

Query  222  CEY-----LRKYPGYAANARKAFRACGV  290
            C Y     LR+Y   + NA+K  R CGV
Sbjct  64   CGYYRDPNLRQYVN-SPNAQKVARTCGV  90



>gb|AAS79106.1| probable lipid transfer protein family protein [Tamarix androssowii]
Length=94

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 13/88 (15%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            A+++   L+GE E+  A        C+   L+PC  AI     PS  CC  LR+QTP CL
Sbjct  11   AVVVATTLLGEAEIAEAVT------CSPLQLSPCAGAITGSGPPSATCCSRLREQTP-CL  63

Query  222  CEY-----LRKYPGYAANARKAFRACGV  290
            C Y     LR+Y   + NA+K  R CGV
Sbjct  64   CGYYRDPNLRQYVN-SPNAQKVARTCGV  90



>ref|XP_008453433.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=100

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 6/91 (7%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I+   +LI      M +       CN   ++ C  +I+ GT PS++CC  +++Q P CLC
Sbjct  12   IVGAILLISNSNEVMVEGADQV-ACNPMQMSSCMNSIVSGTPPSSQCCSKIKEQKP-CLC  69

Query  225  EYLR----KYPGYAANARKAFRACGVPEPRC  305
             YL+    K    + NARK    CG P P C
Sbjct  70   GYLKNPFLKSFVSSPNARKVANDCGTPFPNC  100



>ref|XP_009357787.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   LTPC   I  G+APS  CC+ LR+Q P CLC Y     LR Y   + NARK   A
Sbjct  32   CSPVELTPCMGPIRSGSAPSGTCCQKLREQRP-CLCGYIKNPALRTYV-TSPNARKLASA  89

Query  282  CGVPEPRC  305
            CGVP P+C
Sbjct  90   CGVPIPQC  97



>ref|XP_004241634.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=94

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +3

Query  69   GELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----L  233
            GE  +++A        C+   L+PC  AI   + PS  CC  ++QQ P CLC+Y     L
Sbjct  19   GESHISLAA------TCSPVQLSPCLGAIRSSSPPSKLCCTKIKQQKP-CLCQYLKNPTL  71

Query  234  RKYPGYAANARKAFRACGVPEPRC  305
            +KY   +  A+K  R+CGVP PRC
Sbjct  72   KKYVN-SPGAKKVARSCGVPYPRC  94



>ref|XP_010926507.1| PREDICTED: non-specific lipid-transfer protein 2-like [Elaeis 
guineensis]
Length=92

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 44/93 (47%), Gaps = 8/93 (9%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            S + +  +L G L      P      CN   L+PC  AIL  + P++ CC  L+ Q P C
Sbjct  4    SFLFLCVVLFGLLS---QAPTAMAVTCNPSELSPCAGAILGSSPPTSACCAKLKAQQP-C  59

Query  219  LCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
             C+Y +     GY    N+RK   ACGV  P C
Sbjct  60   FCQYAKNPSLKGYINSPNSRKVLAACGVSTPSC  92



>dbj|BAA25680.1| Lipid transfer protein [Brassica rapa]
Length=86

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
             C+ + L PC  AI  G  PS +CC  L++Q P CLC +  K P +A      N+RK   
Sbjct  20   ACDPKQLQPCLAAITGGGQPSGDCCAKLKEQQP-CLCGF-SKNPAFAQYISSPNSRKVLT  77

Query  279  ACGVPEPRC  305
            ACG+P P C
Sbjct  78   ACGIPYPSC  86



>ref|NP_001148293.1| LOC100281901 precursor [Zea mays]
 gb|ACG30429.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACN28858.1| unknown [Zea mays]
 gb|AFW77366.1| nonspecific lipid-transfer protein [Zea mays]
Length=101

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 7/63 (11%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRACGVPE  296
            LTPC  AI+ G +PS  CC  L++Q P CLC Y     L++Y   + N +KA  AC VP 
Sbjct  41   LTPCAGAIIIGRSPSAACCSRLKEQQP-CLCTYARDPNLQRYVN-SPNGKKAMAACKVPV  98

Query  297  PRC  305
            P C
Sbjct  99   PSC  101



>gb|AFK45248.1| unknown [Lotus japonicus]
Length=104

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYA-----ANARKAFRA  281
            C+  AL+PC  AI   T PS  CC+ LR+Q P CLC YLR  P  A       AR     
Sbjct  39   CSPVALSPCLGAISSSTPPSAACCQKLREQKP-CLCGYLRN-PSLAPYVNSPGARAVAST  96

Query  282  CGVPEPRC  305
            CG+P PRC
Sbjct  97   CGIPYPRC  104



>ref|XP_010036906.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW48562.1| hypothetical protein EUGRSUZ_K02234 [Eucalyptus grandis]
Length=92

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 11/83 (13%)
 Frame = +3

Query  69   GELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----  236
             E+++TMA        C    L+ C  +I+  T PS  CC  +++Q P CLC+YL+    
Sbjct  17   AEMQITMAV------TCKPTELSSCANSIVSSTPPSRLCCTKIKEQKP-CLCQYLKNPSL  69

Query  237  KYPGYAANARKAFRACGVPEPRC  305
            K    + NARK    CG P P+C
Sbjct  70   KKFVNSPNARKVASTCGTPFPKC  92



>gb|KGN63840.1| hypothetical protein Csa_1G024245 [Cucumis sativus]
Length=100

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 6/91 (7%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I+   +LI      M +       CN   L+ C  +I+ G  PST+CC  +++Q P CLC
Sbjct  12   IVGLILLISNSNEVMVEGADGV-ACNPMQLSSCMNSIISGAPPSTQCCSKIKEQKP-CLC  69

Query  225  EYLR----KYPGYAANARKAFRACGVPEPRC  305
             YL+    K    + NARK    CG P P C
Sbjct  70   GYLKNPILKSFVSSPNARKVANDCGTPFPNC  100



>ref|NP_001268090.1| alcohol dehydrogenase 7 [Vitis vinifera]
 gb|AAF44336.1|AF195867_1 alcohol dehydrogenase 7 [Vitis vinifera]
Length=363

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 35/63 (56%), Gaps = 5/63 (8%)
 Frame = -2

Query  292  GTPQALKAFLALAAYPGYLR----RYSQRHLGVCCLRIRQHSVDGAVPNRIAGPHGVRAL  125
            G PQ L  FLAL     +LR    RY QRH G C L + QHS+DG V + IA    + ++
Sbjct  2    GVPQVLATFLALGELTNFLRLGFLRYWQRH-GFCSLILLQHSLDGGVDDVIAPTQELSSV  60

Query  124  SLH  116
             LH
Sbjct  61   GLH  63



>gb|KDP32977.1| hypothetical protein JCGZ_13008 [Jatropha curcas]
Length=96

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAAN--ARKAFRAC  284
            C+  AL+PC PAI   + PS +CC  LR+Q P CLC YL+      Y ++  AR+   +C
Sbjct  31   CSPLALSPCLPAINSSSPPSNDCCVKLREQKP-CLCGYLKNPSLKQYVSSPGARRVANSC  89

Query  285  GVPEPRC  305
            GVP P C
Sbjct  90   GVPIPTC  96



>ref|XP_008810040.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=92

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (52%), Gaps = 11/91 (12%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
              +TA+L+     T++        C+   L+PC  AIL    P+  CC  L++QTP C C
Sbjct  9    FFITALLLRRAPTTLSV------TCDPMELSPCAGAILSSAPPTAACCAKLKEQTP-CFC  61

Query  225  EYLR--KYPGY--AANARKAFRACGVPEPRC  305
            +Y +  K   Y  + N+++   ACGVP P C
Sbjct  62   QYKKNPKLQNYINSKNSKRVASACGVPMPNC  92



>emb|CDX95131.1| BnaC05g05400D [Brassica napus]
Length=99

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 6/92 (7%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPG-CNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I    + +  L  T A       G C    L PC PA+  G+ P+TECC +L++Q   CL
Sbjct  9    IAFVILFVSSLARTNAVVEEGTNGVCVPGELKPCIPAVQTGSKPTTECCGVLKKQ-QSCL  67

Query  222  CEYLR--KYPGYAAN--ARKAFRACGVPEPRC  305
            C Y++  ++  Y  +  A      CGVP P+C
Sbjct  68   CGYIKDPRFGQYVKSKYAHMVLSTCGVPYPKC  99



>ref|NP_001236829.1| uncharacterized protein LOC100500614 precursor [Glycine max]
 gb|ACU15740.1| unknown [Glycine max]
Length=95

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+ C  AI   T PS  CC  L++Q P CLC+YL+    K    + NAR A  AC
Sbjct  30   CNALQLSACASAITSSTPPSALCCSKLKEQRP-CLCQYLKDPNLKKLVNSPNARMAANAC  88

Query  285  GVPEPRC  305
            G P P C
Sbjct  89   GSPFPTC  95



>emb|CDY50600.1| BnaC02g16970D [Brassica napus]
Length=98

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
             C+ + L PC  AI  G  PS +CC  L++Q P CLC +  K P +A      N+RK   
Sbjct  32   ACDPKQLQPCLAAITGGGQPSGDCCAKLKEQQP-CLCGF-AKNPAFAQYISSPNSRKVLT  89

Query  279  ACGVPEPRC  305
            ACG+P P C
Sbjct  90   ACGIPYPSC  98



>ref|XP_004972106.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Setaria italica]
Length=101

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +3

Query  108  PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYP-GYAANARKAFRAC  284
            PP C+  AL PC PA+++G  PS ECC  LR Q P CLC Y +    G   N+R+  R  
Sbjct  33   PPTCDPLALRPCAPAVIYGARPSGECCAKLRGQMP-CLCRYSKNLDLGRYINSREGRRIA  91

Query  285  GV  290
             V
Sbjct  92   AV  93



>dbj|BAJ86749.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=91

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFRA  281
            CN  +LT C   I+ GT PS  CC  L+ Q   C C++ R  P Y+      NARK   +
Sbjct  26   CNAGSLTVCAGPIISGTMPSQTCCANLKNQR-GCFCQFARN-PAYSTYINSPNARKTLAS  83

Query  282  CGVPEPRC  305
            CGV  PRC
Sbjct  84   CGVAVPRC  91



>ref|XP_009139763.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=102

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 43/99 (43%), Gaps = 16/99 (16%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPP-----------PPPGCNERALTPCGPAILFGTAPSTECCRILR  200
            T M+I  + + M+ P P               C    L PC PA+     P+TECC  L 
Sbjct  5    TLMVITLVIIAMSSPVPIRATSVESFGEVAQSCVVTELAPCLPAMTTAGDPTTECCDKLV  64

Query  201  QQTPKCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            +Q P CLC Y+R   Y  Y    N RK    C VP P C
Sbjct  65   EQKP-CLCGYIRNPAYSMYVTSPNGRKVLDFCKVPFPSC  102



>ref|XP_008444077.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=102

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 47/95 (49%), Gaps = 8/95 (8%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTP  212
            L ++++ T M++    L           CN   + PC PA+     P+ ECC  L++Q P
Sbjct  12   LSASMMATVMVVA---LITGARLADAVNCNPTEMRPCLPALESSVPPTAECCEKLKEQEP  68

Query  213  KCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
             C CEYL+   +  Y    NA+K   +CG+P P C
Sbjct  69   -CFCEYLKSPIFKRYLESPNAKKIASSCGIPIPTC  102



>gb|EMT28561.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=96

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (49%), Gaps = 7/92 (8%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +++  +    + L +A        CN   LTPC  AI+   AP+  CC  +++Q   C+C
Sbjct  7    LVVALLAFSAVVLMVAPAGAEAATCNALQLTPCAGAIIGNAAPTASCCSKMKEQQ-TCMC  65

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     L++Y   + N +K   AC VP P C
Sbjct  66   QYARDPNLKQYVD-SPNGKKVMAACKVPVPSC  96



>gb|AAP37973.1| seed specific protein Bn15D80B [Brassica napus]
Length=102

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 43/99 (43%), Gaps = 16/99 (16%)
 Frame = +3

Query  54   TAMLIGELELTMAQPPP-----------PPPGCNERALTPCGPAILFGTAPSTECCRILR  200
            T M+I  + + M+ P P               C    L PC PA+     P+TECC  L 
Sbjct  5    TLMVITLVIIAMSSPVPIRATTVESFGEVAQSCVVTELAPCLPAMTTAGDPTTECCDKLV  64

Query  201  QQTPKCLCEYLRK--YPGYAA--NARKAFRACGVPEPRC  305
            +Q P CLC Y+R   Y  Y    N RK    C VP P C
Sbjct  65   EQKP-CLCGYIRNPAYSMYVTSPNGRKVLDFCKVPFPSC  102



>ref|XP_002458343.1| hypothetical protein SORBIDRAFT_03g031716 [Sorghum bicolor]
 gb|EES03463.1| hypothetical protein SORBIDRAFT_03g031716 [Sorghum bicolor]
Length=89

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 6/66 (9%)
 Frame = +3

Query  108  PPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKA  272
            P  C+  AL PC PA +   APS ECC  LR+Q P CLC Y     LR+Y   + + ++ 
Sbjct  23   PARCDPLALRPCVPAFILAAAPSDECCAKLREQKP-CLCRYSKNPELRRYIISSRDGKRI  81

Query  273  FRACGV  290
              AC V
Sbjct  82   AHACRV  87



>ref|XP_002449441.1| hypothetical protein SORBIDRAFT_05g011680 [Sorghum bicolor]
 gb|EES08429.1| hypothetical protein SORBIDRAFT_05g011680 [Sorghum bicolor]
Length=91

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGYAANARKAFRACGV  290
            CN   L  C  A++ G  P+  CC ILR Q   C+C+Y +  KY  Y   ARK   +CG+
Sbjct  28   CNIALLAVCKTAVIGGLKPTVTCCSILRAQ-EACMCKYQKDPKYGMYINPARKMITSCGM  86

Query  291  PEPRC  305
              P C
Sbjct  87   AIPNC  91



>sp|P20145.1|NLTP2_HORVU RecName: Full=Probable non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Aleurone-specific 10 kDa protein; AltName: 
Full=B-FABP; Flags: Precursor [Hordeum vulgare]
 emb|CAA33329.1| aleurone specific protein [Hordeum vulgare]
 emb|CAA49448.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 emb|CAA40542.1| putative phospholipid transfer protein [Hordeum vulgare subsp. 
vulgare]
 prf||1807328A aleurone-specific protein
Length=102

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGYAA--NARKAFRAC  284
            C    L  C  AIL GT PS ECC  LR Q   CLC+Y++   Y  Y +  +AR     C
Sbjct  37   CEPAQLAVCASAILGGTKPSGECCGNLRAQQ-GCLCQYVKDPNYGHYVSSPHARDTLNLC  95

Query  285  GVPEPRC  305
            G+P P C
Sbjct  96   GIPVPHC  102



>emb|CDX93626.1| BnaA06g04220D [Brassica napus]
Length=99

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 6/92 (7%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPG-CNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            I    + +  L  T A       G C    L PC PA+  G+ P+TECC +L++Q   CL
Sbjct  9    IAFVLIFVSSLARTNAVVEEGTNGVCVPGELKPCIPAVQTGSKPTTECCGVLKKQ-QSCL  67

Query  222  CEYLR--KYPGYAAN--ARKAFRACGVPEPRC  305
            C Y++  ++  Y  +  A      CGVP P+C
Sbjct  68   CGYIKDPRFGQYVKSKYAHMVLSTCGVPYPKC  99



>ref|XP_009596861.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=97

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 12/92 (13%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            ++  A++IGEL +T A+       C+ + L+PC PA      P+ +CC  L +Q P CLC
Sbjct  13   VLTLALIIGELLVTEAKV-----KCDVKELSPCAPAFTSSQPPTAKCCDKLNEQKP-CLC  66

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     LR Y   + NA+   R C +  P C
Sbjct  67   KYVKDPNLRPYVK-SPNAKNVARRCRILTPIC  97



>dbj|BAB01987.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=94

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 42/85 (49%), Gaps = 5/85 (6%)
 Frame = +3

Query  63   LIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK-  239
             I  L   MA        CN+  +T C PAIL+G  P+T+CC  ++ Q P C   +++  
Sbjct  11   FIVVLVSFMAPINSVNQACNKIEITGCVPAILYGDKPTTQCCEKMKAQEP-CFFYFIKNP  69

Query  240  -YPGYAAN--ARKAFRACGVPEPRC  305
             +  Y  +  AR   + CG+P P C
Sbjct  70   VFNKYVTSPQARAILKCCGIPYPTC  94



>ref|XP_004235834.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=93

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI   +APS  CC  +RQQ P CLC Y     LR Y   +  A+K    
Sbjct  28   CSAIQLSPCLSAITSKSAPSKLCCSRIRQQKP-CLCTYLKNPTLRNYVN-SPGAKKVANT  85

Query  282  CGVPEPRC  305
            CGVP P+C
Sbjct  86   CGVPYPKC  93



>ref|XP_002887008.1| hypothetical protein ARALYDRAFT_894246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63267.1| hypothetical protein ARALYDRAFT_894246 [Arabidopsis lyrata subsp. 
lyrata]
Length=92

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (46%), Gaps = 5/90 (6%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
             ++  A  +  L L   +       C    L  C  A+  G  PSTECC  L++Q   C 
Sbjct  5    TLVFIAFFLSSLVLIKGEEENA--SCVLEDLQICKTAVTTGKPPSTECCDKLKEQ-QTCF  61

Query  222  CEYLR--KYPGYAANARKAFRACGVPEPRC  305
            C+YL+  +   Y   A++   ACG+P P C
Sbjct  62   CDYLKDPRVSRYITVAKQILAACGIPFPSC  91



>ref|XP_004512892.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 13/87 (15%)
 Frame = +3

Query  60   MLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYL--  233
            +L+ E++++MA        C+   L+ C  AI   T PS  CC  +++Q P CLC+YL  
Sbjct  14   LLLIEVQVSMA------VTCSPLQLSSCVSAITSSTPPSNLCCSKIKEQRP-CLCQYLKN  66

Query  234  ---RKYPGYAANARKAFRACGVPEPRC  305
               RK+   + NA+K    CG P P+C
Sbjct  67   PNLRKFVN-SPNAKKVASTCGTPYPKC  92



>ref|NP_001148304.1| LOC100281913 precursor [Zea mays]
 gb|ACG26594.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG27443.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG29399.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG29400.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG29407.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG30473.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG30477.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG30536.1| nonspecific lipid-transfer protein precursor [Zea mays]
Length=98

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 34/67 (51%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            CN   L  C PAI  G  PS  CC  L+ Q   C C++++   Y  Y    NARK   +C
Sbjct  33   CNAGQLAACAPAITAGATPSASCCSNLKAQ-QGCFCQFVKNPTYGRYINSPNARKVVASC  91

Query  285  GVPEPRC  305
            GV  PRC
Sbjct  92   GVSVPRC  98



>ref|XP_009105236.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 46/94 (49%), Gaps = 9/94 (10%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPG--CNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            + +T M+   L  + A P     G  C+ + L PC  AI  G   S  CC  L++Q P C
Sbjct  5    LALTLMVFVILSPSFAAPTKVALGAACDAKQLQPCLAAITGGGHRSVCCCANLKEQQP-C  63

Query  219  LCEYLRKYPGYAA-----NARKAFRACGVPEPRC  305
            LC +  K P +A      N+RK   ACGVP P C
Sbjct  64   LCGF-SKNPAFAQYVSSPNSRKVVSACGVPYPSC  96



>ref|XP_006368152.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like, 
partial [Solanum tuberosum]
Length=93

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 13/96 (14%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            S +++ A+ +GEL +  A        CN R L  C  +I     PS+ CC  LR+Q P C
Sbjct  6    SIVVIFAIFLGELLVAEAM------TCNIRELDSCVDSIKKLKLPSSICCAKLREQKP-C  58

Query  219  LCEYLRKYPGY-----AANARKAFRACGVPEPRC*N  311
            +CEY+   P +     + NA K F AC +  P C N
Sbjct  59   ICEYITN-PKFGPLLKSPNAPKVFAACAIIFPICHN  93



>ref|XP_009589620.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 11/93 (12%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            +   +  +L+ E  +++A        C+   L+PC  AI   + PS  CC  +R+Q P C
Sbjct  8    AVFTVLVLLLAEAHISVAVT------CSAIQLSPCLGAITSNSPPSGLCCSKIREQKP-C  60

Query  219  LCEYLR--KYPGYAAN--ARKAFRACGVPEPRC  305
            LC+YL+      Y  +  A+K  R CGVP P+C
Sbjct  61   LCQYLKNPNLRNYVNSPGAKKVARTCGVPYPKC  93



>gb|EMT31755.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=98

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 6/68 (9%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   LTPC PAI+   APS  CC  L+     CLC+Y     L++Y   + N +K F A
Sbjct  32   CSPTQLTPCAPAIIGNAAPSAACCGKLKAHPASCLCKYKKDPHLQRYVN-SPNGKKVFAA  90

Query  282  CGVPEPRC  305
            C +  PRC
Sbjct  91   CKLRLPRC  98



>ref|NP_001056241.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|AAT39264.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF18155.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|EAY98926.1| hypothetical protein OsI_20881 [Oryza sativa Indica Group]
 dbj|BAG88327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI+   +PS  CC  +++Q P CLC+Y     L++Y   + N +K   A
Sbjct  29   CDALQLSPCASAIIGNASPSASCCSRMKEQQP-CLCQYARDPNLQRYVN-SPNGKKVLAA  86

Query  282  CGVPEPRC  305
            C VP P C
Sbjct  87   CHVPVPSC  94



>ref|XP_008444080.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=96

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            CN   L+PC  AI     PST CC  LR+Q P C C Y++     GY  +A A+     C
Sbjct  31   CNTMQLSPCIGAITSTAPPSTTCCSKLREQQP-CFCGYMKNPSLGGYVKSARAKAIISTC  89

Query  285  GVPEPRC  305
            GVP P+C
Sbjct  90   GVPLPKC  96



>gb|AAD27634.1|AF128457_8 hypothetical protein [Oryza sativa Indica Group]
Length=241

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 44/91 (48%), Gaps = 11/91 (12%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            + + AM +G +E  +     PP  CN   LTPC    LFG      CC  LR Q   CLC
Sbjct  21   MYLMAMGVGVVEAAVL----PPSRCNPTLLTPCAGPTLFGGPVPPACCAQLRAQA-ACLC  75

Query  225  EYLRKYPGYAA-----NARKAFRACGVPEPR  302
             Y R  P Y +     NA++ F  CG+P PR
Sbjct  76   AYARS-PNYGSYIRSPNAKRLFTVCGLPIPR  105



>gb|EMS65238.1| Non-specific lipid-transfer protein 2 [Triticum urartu]
Length=95

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 45/94 (48%), Gaps = 10/94 (11%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPP-PPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPK  215
            +A+ M A+L     L +  PP      C+   L  C  AI+ G  PS  CC  L+ Q   
Sbjct  5    AAVAMCALL----ALVVVGPPSVAAQDCDAGKLIVCAAAIIGGAEPSASCCTNLKAQR-G  59

Query  216  CLCEYLRK--YPGYAAN--ARKAFRACGVPEPRC  305
            CLC+Y     Y GY  +  ARK   +CG+P P C
Sbjct  60   CLCKYASNPAYSGYINSPTARKTLASCGIPIPTC  93



>ref|XP_006397095.1| hypothetical protein EUTSA_v10029435mg [Eutrema salsugineum]
 gb|ESQ38548.1| hypothetical protein EUTSA_v10029435mg [Eutrema salsugineum]
Length=98

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 43/92 (47%), Gaps = 7/92 (8%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I    + +  L  T A        CN + L  C PA   G+ PSTECC  L++Q   CLC
Sbjct  9    IAFVIIAVSSLTPTKAVMEDEKVTCNPKELLICMPAAKTGSQPSTECCGKLKEQQ-SCLC  67

Query  225  EYLRKYPGY-----AANARKAFRACGVPEPRC  305
             Y  K P +     +  A+K   AC +P P+C
Sbjct  68   GY-SKDPSFSQYITSGAAKKILEACDIPIPKC  98



>emb|CBI33621.3| unnamed protein product [Vitis vinifera]
Length=81

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 44/88 (50%), Gaps = 13/88 (15%)
 Frame = +3

Query  57   AMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR  236
             +L+ E  LT A        C+   L+ C  AI     PS+ CC  LR+Q P CLC Y+R
Sbjct  2    VVLLSEAHLTKAV------TCSPLELSSCFAAITSSAPPSSMCCSKLREQRP-CLCGYIR  54

Query  237  -----KYPGYAANARKAFRACGVPEPRC  305
                 +Y   +ANAR+    CGVP P C
Sbjct  55   DPNLSQYVN-SANARRVASTCGVPFPNC  81



>ref|XP_006482207.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=100

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+PC  A+     PS  CC  LRQQ P CLC YLR    K    + NA++    C
Sbjct  35   CNPTELSPCLAALTSSAPPSGPCCNKLRQQRP-CLCGYLRDPNLKQYVNSPNAKRVVATC  93

Query  285  GVPEPRC  305
            G+P PRC
Sbjct  94   GIPYPRC  100



>gb|KDP32978.1| hypothetical protein JCGZ_13009 [Jatropha curcas]
Length=99

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 7/69 (10%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFR  278
             C+   L+PC PAI   + PS +CC  LR+Q P C C Y     LR+Y   +  AR+  +
Sbjct  33   NCSPAQLSPCLPAIKSSSPPSNDCCVKLREQRP-CFCGYVKNPSLRQYVS-SPRAREVVK  90

Query  279  ACGVPEPRC  305
            +CGVP P C
Sbjct  91   SCGVPFPTC  99



>ref|XP_009357786.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=95

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC   I  G+APS  CC+ LR+Q P CLC Y     LR Y   + NARK   A
Sbjct  30   CSPVELSPCLGPIRSGSAPSGTCCQKLREQRP-CLCGYIKNPALRTYV-TSPNARKLASA  87

Query  282  CGVPEPRC  305
            CGVP P+C
Sbjct  88   CGVPTPQC  95



>ref|NP_001077480.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AEE28175.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
Length=95

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 6/91 (7%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            + ++  A ++  +  T A+       C    L  C P I+  T PST+CC  L+ +   C
Sbjct  6    TTLVFVAFVLSSMAPTKAEEKA---ACVVTDLKACLPDIIGETPPSTKCCTKLKDK-KSC  61

Query  219  LCEYLRK--YPGYAANARKAFRACGVPEPRC  305
             CEYL+      Y  +A++   ACGVP P C
Sbjct  62   FCEYLKNPLIAPYMTSAKQVLEACGVPVPVC  92



>tpg|DAA42889.1| TPA: nonspecific lipid-transfer protein [Zea mays]
Length=98

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 34/68 (50%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFRA  281
            CN   L  C PAI  G  PS  CC  L+ Q   C C+++ K P Y       NARK   +
Sbjct  33   CNAGQLAACAPAITAGARPSASCCSNLKAQQ-GCFCQFV-KNPTYGRYINSPNARKVVAS  90

Query  282  CGVPEPRC  305
            CGV  PRC
Sbjct  91   CGVSVPRC  98



>ref|XP_009777694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=97

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 13/92 (14%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            ++   + +GE  +T A        C+   L+PC  AI     PS+ CC  L++Q P CLC
Sbjct  14   VVTLVLFLGEFLVTEAV------TCSVVELSPCAGAISSPQPPSSACCAKLKEQKP-CLC  66

Query  225  EYLRKYPGY-----AANARKAFRACGVPEPRC  305
             YL K P       + NA++  ++CGVP P C
Sbjct  67   GYL-KNPNLRPYVNSPNAKRVAKSCGVPTPSC  97



>ref|XP_006417774.1| hypothetical protein EUTSA_v10009184mg [Eutrema salsugineum]
 gb|ESQ36127.1| hypothetical protein EUTSA_v10009184mg [Eutrema salsugineum]
Length=98

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 5/91 (5%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I +  +++  L  T A        C+   L PC PA   G+ P+TECC  L++Q   CLC
Sbjct  9    IAIVIIVVSSLAPTKAVAEEEKVTCDILQLQPCLPAAQTGSKPTTECCGKLKEQ-ESCLC  67

Query  225  EYLRK---YPGYAAN-ARKAFRACGVPEPRC  305
             Y +     P ++A+ A +   AC +P P C
Sbjct  68   GYTKNPAYSPYFSADIAHRILEACAIPYPTC  98



>ref|NP_001056242.1| Os05g0550600 [Oryza sativa Japonica Group]
 gb|AAT39266.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 gb|AAT85180.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF18156.1| Os05g0550600 [Oryza sativa Japonica Group]
 gb|EAY98929.1| hypothetical protein OsI_20884 [Oryza sativa Indica Group]
 dbj|BAG88844.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99747.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64602.1| hypothetical protein OsJ_19454 [Oryza sativa Japonica Group]
Length=96

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 35/68 (51%), Gaps = 6/68 (9%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C    LTPC PAI+  + P+  CC  L+     C C+Y     ++KY   + N +K F  
Sbjct  30   CTPTQLTPCAPAIVGNSPPTAACCGKLKAHPASCFCQYKKDPNMKKYVN-SPNGKKVFAT  88

Query  282  CGVPEPRC  305
            C VP P+C
Sbjct  89   CKVPLPKC  96



>ref|XP_004982670.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=95

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 34/78 (44%), Gaps = 5/78 (6%)
 Frame = +3

Query  87   MAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILR-QQTPKCLCEYLR--KYPGY--  251
            M         C+   L  C PA LFG  PS  CC  LR ++   CLC Y    +Y G+  
Sbjct  18   MGSGGASAQDCDSSRLADCAPAFLFGVTPSQSCCDKLRLEEQRGCLCVYAHDPQYSGFLN  77

Query  252  AANARKAFRACGVPEPRC  305
            +  AR A   C V  P C
Sbjct  78   STKARDALAYCQVAYPSC  95



>ref|XP_004982669.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=100

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 5/68 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGY---AANARKAFRA  281
            C+   L  C  A LFGT P   CC  LR++   CLC Y R  +Y G+   +   R A   
Sbjct  33   CDATRLADCAFAFLFGTTPLKSCCDSLREEQKGCLCVYARDPQYSGFLTTSTTVRNALAY  92

Query  282  CGVPEPRC  305
            C V  P C
Sbjct  93   CKVAYPSC  100



>ref|XP_006406624.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
 gb|ESQ48077.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
Length=97

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 10/97 (10%)
 Frame = +3

Query  42   AIIMTAMLIGELELT-----MAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQ  206
            A+I+ A  +    LT     +  P      C+   L+PC  AI   + PS  CC  L++Q
Sbjct  2    AMIIKATWVSVFALTAVLLVILVPAGEAVTCSPMQLSPCASAITSSSPPSALCCAKLKEQ  61

Query  207  TPKCLCEYLR----KYPGYAANARKAFRACGVPEPRC  305
             P CLC Y+R    +    ++NARK    C +P PRC
Sbjct  62   KP-CLCGYMRNPSLRRFVSSSNARKVSNRCKLPIPRC  97



>dbj|BAJ25798.1| putative non-specific lipid-transfer protein type 2 subfamily 
[Nicotiana tabacum]
Length=97

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 13/92 (14%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            ++   + +GE  +T A        C+   L+PC  AI     PS+ CC  L++Q P CLC
Sbjct  14   VVTLVLFLGEFLVTEAVT------CSVVELSPCAGAISSPQPPSSACCAKLKEQKP-CLC  66

Query  225  EYLRKYPGY-----AANARKAFRACGVPEPRC  305
             YL K P       + NA++  ++CGVP P C
Sbjct  67   GYL-KNPNLRPYVNSPNAKRVAKSCGVPTPSC  97



>ref|XP_003620406.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|ACJ85882.1| unknown [Medicago truncatula]
 gb|AES76624.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=92

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 13/88 (15%)
 Frame = +3

Query  57   AMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY--  230
             +L+  ++++MA        C+   L+ C  AI   T PS  CC  +++Q P CLC+Y  
Sbjct  13   VLLLINVQVSMA------VTCSPVQLSSCVSAITSSTPPSNLCCSKIKEQRP-CLCQYMK  65

Query  231  ---LRKYPGYAANARKAFRACGVPEPRC  305
               LRK+     NARK    CG P PRC
Sbjct  66   NPNLRKFVN-TPNARKVANTCGTPFPRC  92



>ref|XP_008381283.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=95

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC   I  G+APS  CC+ LR+Q P CLC Y     LR Y   + NARK   A
Sbjct  30   CSPVELSPCLGPIRSGSAPSGTCCQKLREQRP-CLCGYIKNPALRTYV-TSPNARKLASA  87

Query  282  CGVPEPRC  305
            CGVP P+C
Sbjct  88   CGVPTPQC  95



>ref|XP_002878145.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54404.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=103

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            I+MT++      +           C    L  C PAIL G+ P   CC +L++Q   CLC
Sbjct  14   IVMTSLAPTRASVVGGWGIEEKAACIVTDLMSCLPAILKGSQPPAYCCEMLKEQQ-SCLC  72

Query  225  EYLRK--YPGYAA--NARKAFRACGVPEPRC  305
             Y++   +  Y    NA K   ACG+P P+C
Sbjct  73   GYIKTPAFGHYVIPKNAHKLLAACGIPYPKC  103



>gb|EYU41301.1| hypothetical protein MIMGU_mgv1a021579mg [Erythranthe guttata]
Length=96

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 5/68 (7%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRA  281
             CN   L+PC  AI+    PS ECC+ L++Q P C C YL+    +    + NA+K   A
Sbjct  30   NCNPLELSPCLGAIMGSGQPSAECCQKLKEQVP-CFCTYLKDPTLRQFIDSPNAKKVAAA  88

Query  282  CGVPEPRC  305
            CG+ +P C
Sbjct  89   CGLQQPSC  96



>ref|XP_009151803.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
 emb|CDX86387.1| BnaA06g31040D [Brassica napus]
Length=94

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 14/98 (14%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCG-PAILFGTAPSTECCRILRQQTPK  215
            +AI + AM+   ++L+      P   C+ + L+PC  P  +F  +P+  CC+ LR Q P 
Sbjct  4    TAIGLVAMVTIVVQLS------PTMACDVKDLSPCLLPIAVFPESPTAACCQTLRDQGP-  56

Query  216  CLCEYLRKYPGYAA------NARKAFRACGVPEPRC*N  311
            CLC ++     +        N  K F AC VP P C N
Sbjct  57   CLCVFINNSWIWIGPTLTSPNGHKLFAACQVPFPSCGN  94



>ref|XP_010034442.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Eucalyptus 
grandis]
 gb|KCW52082.1| hypothetical protein EUGRSUZ_J01517 [Eucalyptus grandis]
Length=98

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGT---APSTECCRILRQQTPKC  218
            ++T++L+  L L+    P     C+   L PC PA  FG+    P+ ECC  L++Q P C
Sbjct  9    LVTSLLVTALILSSQLAPRVEAVCDASRLLPCLPA--FGSPYVQPTAECCGRLKEQQP-C  65

Query  219  LCEYLR--KYPGYAAN--ARKAFRACGVPEPRC  305
            LC++++  +Y  Y  +  A++  + C +P PRC
Sbjct  66   LCDFMKDPRYRKYVDSPRAKEILQTCQIPYPRC  98



>ref|XP_009613979.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI  GT PS  CC  LR Q P CLC Y     LR+Y   + NARK   +
Sbjct  29   CSATQLSPCLGAITSGTPPSQACCARLRGQQP-CLCGYMRDPNLRQYVN-SPNARKVASS  86

Query  282  CGVPEPRC  305
            CGV  P C
Sbjct  87   CGVSIPSC  94



>sp|Q43681.1|NLTP_VIGUN RecName: Full=Probable non-specific lipid-transfer protein AKCS9; 
Short=LTP; Flags: Precursor [Vigna unguiculata]
 emb|CAA56113.1| lipid transfer like protein [Vigna unguiculata]
Length=99

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+ C PAI  G+ PS+ CC  L+ Q P CLC Y++    K    +  A+K    C
Sbjct  34   CNPTELSSCVPAITGGSKPSSTCCSKLKVQEP-CLCNYIKNPSLKQYVNSPGAKKVLSNC  92

Query  285  GVPEPRC  305
            GV  P C
Sbjct  93   GVTYPNC  99



>gb|KHN42434.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+ C  AI   T PS  CC  L++Q P CLC+YL+    K    + NAR    AC
Sbjct  30   CNALQLSACASAITSSTPPSALCCSKLKEQRP-CLCQYLKDPNLKKLVNSPNARMVANAC  88

Query  285  GVPEPRC  305
            G P P C
Sbjct  89   GSPFPTC  95



>ref|XP_004986022.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=93

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 34/68 (50%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFRA  281
            CN   LTPC  A+  G  PS  CC  L+ Q   C C Y  K P YA      NA+K   +
Sbjct  28   CNVGQLTPCASALATGATPSASCCSSLKAQ-QGCFCTY-AKNPTYARYINSPNAKKVVAS  85

Query  282  CGVPEPRC  305
            CG+  PRC
Sbjct  86   CGLTVPRC  93



>gb|EMT21725.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=97

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 35/63 (56%), Gaps = 6/63 (10%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRACGVPE  296
            LTPC PAI+   APS  CC  L+     CLC+Y     L++Y   + N +K F AC +  
Sbjct  36   LTPCAPAIIGNAAPSAACCGKLKAHPASCLCKYKKDPNLQRYVN-SPNGKKVFAACKLRL  94

Query  297  PRC  305
            PRC
Sbjct  95   PRC  97



>ref|XP_006292190.1| hypothetical protein CARUB_v10018396mg [Capsella rubella]
 gb|EOA25088.1| hypothetical protein CARUB_v10018396mg [Capsella rubella]
Length=100

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C    L  C PAIL G+ P   CC +L++Q   CLC Y++   +  Y    NA K   AC
Sbjct  35   CVVTELMSCLPAILKGSQPPAYCCEMLKEQH-SCLCGYIKTPAFGHYVIPKNAHKLLAAC  93

Query  285  GVPEPRC  305
            G+P P+C
Sbjct  94   GIPYPKC  100



>emb|CDM81735.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (49%), Gaps = 7/92 (8%)
 Frame = +3

Query  45   IIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLC  224
            +++  +    + L MA        C+   L+PC  AI+   AP+  CC  ++ Q P C+C
Sbjct  7    LVVALLAFWAVVLMMAPAGVDAATCDALQLSPCAGAIVGNAAPTAVCCSRMKAQRP-CMC  65

Query  225  EY-----LRKYPGYAANARKAFRACGVPEPRC  305
            +Y     L++Y   + N +K   AC VP P C
Sbjct  66   QYAHDPNLKQYVN-SPNGKKVLAACKVPVPSC  96



>ref|XP_007033193.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY04119.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=118

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 36/68 (53%), Gaps = 5/68 (7%)
 Frame = +3

Query  114  GCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRA  281
             C+   LT C PAI   + PST CC  LR+Q P CLC YL+    K      NARK    
Sbjct  52   NCSPSELTSCLPAITSSSPPSTTCCSKLREQKP-CLCGYLQNPNLKQFVNNPNARKVAST  110

Query  282  CGVPEPRC  305
            CGV  P+C
Sbjct  111  CGVTYPQC  118



>emb|CDP00664.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+PC  AI   ++P+  CC  +++Q P CLC Y+R    K    + NARK    C
Sbjct  25   CNPLQLSPCANAITSSSSPTAICCSKIKEQRP-CLCSYMRNPNLKKFISSPNARKVANTC  83

Query  285  GVPEPRC  305
            G P P+C
Sbjct  84   GTPFPQC  90



>ref|XP_006362367.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=92

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 44/90 (49%), Gaps = 11/90 (12%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            I   + + EL +T A        C+   L PC  AI+    PS+ CC  LR+Q P CLC 
Sbjct  10   IFLVLFLSELLVTEA------VTCSVTELFPCAGAIMSSQPPSSACCIKLREQKP-CLCG  62

Query  228  YLR----KYPGYAANARKAFRACGVPEPRC  305
            YL+    K    + NA++  + CGV  P C
Sbjct  63   YLKNPSLKQYVNSPNAQRVAKTCGVSTPSC  92



>emb|CDX77289.1| BnaC08g03340D [Brassica napus]
Length=97

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C+   LT C PA +  + PS  CC  LR+Q P CLC YLR      Y    NA+K   +C
Sbjct  32   CSPTELTSCSPAFMSASPPSATCCAKLREQKP-CLCGYLRNPTLSQYVNSPNAKKVASSC  90

Query  285  GVPEPRC  305
             V  P+C
Sbjct  91   NVATPKC  97



>ref|XP_006656462.1| PREDICTED: probable non-specific lipid-transfer protein-like 
[Oryza brachyantha]
Length=92

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (60%), Gaps = 5/57 (9%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRACGV  290
            L+PC  AI+ G AP+  CC  LR Q P CLC+Y R   Y  Y    +A++A RAC V
Sbjct  33   LSPCTSAIMLGMAPTQGCCVQLRAQQP-CLCQYARDPSYSSYVTSPSAQRAVRACNV  88



>gb|KFK26688.1| hypothetical protein AALP_AA8G280300 [Arabis alpina]
Length=97

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+  AL PC  A+   + PS  CC  LR+Q P CLC Y     LR+Y   + NA+K   +
Sbjct  32   CSPMALAPCAAAMTSSSPPSATCCTRLREQQP-CLCGYMRNPSLRQYVS-SPNAKKVSNS  89

Query  282  CGVPEPRC  305
            C +P P C
Sbjct  90   CRIPSPNC  97



>ref|XP_010450960.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=104

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 35/63 (56%), Gaps = 5/63 (8%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            C+   L+ C PA+  G APST+CC  L++Q   CLC Y++      Y    NA K   AC
Sbjct  39   CSAMGLSSCLPAMTSGHAPSTDCCTKLKEQ-KTCLCSYIKNPLCGSYVRSPNAHKTLEAC  97

Query  285  GVP  293
            GVP
Sbjct  98   GVP  100



>ref|XP_007044235.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY00067.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=95

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L+PC  AI   T PS  CC  L++Q P CLC Y++    +    + NARK    C
Sbjct  30   CNALQLSPCASAITSSTPPSPLCCSKLKEQRP-CLCNYVKDPNLQKLVNSPNARKVASIC  88

Query  285  GVPEPRC  305
            G P P C
Sbjct  89   GSPFPNC  95



>ref|XP_009145909.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 5/92 (5%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            A  ++   I  + L +  P      C+   L+PC  AI   + PS  CC  L++Q P CL
Sbjct  6    ATWVSIFAIAAVLLVILAPAAEAVTCSPMQLSPCAQAITSSSPPSALCCAKLKEQKP-CL  64

Query  222  CEYLR----KYPGYAANARKAFRACGVPEPRC  305
            C Y+R    +    + NARK    C +P PRC
Sbjct  65   CGYMRNPSLRRFVSSPNARKVSNRCKLPIPRC  96



>ref|XP_009357223.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=99

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            CN   L PC  AI+   +P+  CC  L++Q+P CLC+Y++    +    + NA+K    C
Sbjct  34   CNPMELAPCAAAIMSSNSPTAVCCGKLKEQSP-CLCQYVKNPNLQKLVNSPNAKKVADTC  92

Query  285  GVPEPRC  305
            G P P C
Sbjct  93   GSPFPTC  99



>ref|XP_004961319.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=95

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   LTPC  AI+  + P+  CC  +R+Q P C+C Y     L++Y   + N +KA  A
Sbjct  30   CDATQLTPCAGAIIGNSPPTAACCSKMREQQP-CMCTYARDPNLQRYVS-SPNGKKAMAA  87

Query  282  CGVPEPRC  305
            C VP P C
Sbjct  88   CKVPVPSC  95



>ref|XP_008444079.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Cucumis 
melo]
Length=104

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 44/96 (46%), Gaps = 9/96 (9%)
 Frame = +3

Query  33   LPSAIIMTAMLIGELELTMAQPPPPPPG--CNERALTPCGPAILFGTAPSTECCRILRQQ  206
             P  +++   ++      +  PPP      C+   L+ C PA LFG  P+ ECC  LR +
Sbjct  4    FPITLVVCIFVVATTVALLNGPPPVAAQTVCDASQLSSCAPAFLFGGNPNQECCTKLRAE  63

Query  207  TPKCLCEY-----LRKYPGYAANARKAFRACGVPEP  299
             P C CEY     L+ +    A AR+   AC +  P
Sbjct  64   QP-CYCEYFGDPNLQNFVNSDA-ARRVAEACNITFP  97



>ref|XP_009148020.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Brassica rapa]
 emb|CDX93624.1| BnaA06g04240D [Brassica napus]
Length=99

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 34/63 (54%), Gaps = 7/63 (11%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFRACGVPE  296
            L PC PA L G+ PSTECC  L++Q   CLC Y++  P +       NA K   AC V  
Sbjct  39   LKPCTPAGLTGSNPSTECCGKLKEQ-ESCLCSYMKN-PAFGHCFKTPNAHKVIAACSVAY  96

Query  297  PRC  305
            P C
Sbjct  97   PAC  99



>ref|XP_006300368.1| hypothetical protein CARUB_v10022343mg [Capsella rubella]
 gb|EOA33266.1| hypothetical protein CARUB_v10022343mg [Capsella rubella]
Length=102

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 37/69 (54%), Gaps = 9/69 (13%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECC-RILRQQTPKCLCEYLRKYPGYAA-----NARKAFR  278
            C+ R L PC PAI  G  PS  CC ++  QQT  CLC +  K P +A      N+RK   
Sbjct  37   CDARQLQPCLPAITGGGQPSGACCAKLTEQQT--CLCGF-SKNPAFAQYISSPNSRKVLS  93

Query  279  ACGVPEPRC  305
            ACGV  P C
Sbjct  94   ACGVAYPTC  102



>ref|XP_009128011.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=98

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 13/93 (14%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            AI++  ++  E  +   Q       C+   L PC  AIL G+ PS  CC  L QQ   C+
Sbjct  14   AILLLLIVAQENRVVAGQ------SCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQ-HCV  66

Query  222  CEYLRKYPGYAA-----NARKAFRACGVPEPRC  305
            C+Y+ K P + +     NA+K    C  P+P+C
Sbjct  67   CQYM-KNPNFKSFLDSPNAKKIATDCHCPKPKC  98



>ref|XP_004982671.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=93

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 34/67 (51%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAAN--ARKAFRAC  284
            CN   L  C PAI+ G AP+  CC  LR Q P C C+Y     Y  Y  +  AR A  +C
Sbjct  28   CNAGELAVCAPAIIGGAAPTAPCCASLRSQEP-CFCQYAHNPAYSRYINSPAARSALTSC  86

Query  285  GVPEPRC  305
            G+  P C
Sbjct  87   GITIPSC  93



>emb|CDX92224.1| BnaA05g21830D [Brassica napus]
Length=96

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 41/84 (49%), Gaps = 5/84 (6%)
 Frame = +3

Query  66   IGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR---  236
            I  + L +  P      C+   L+PC  AI   + PS  CC  L++Q P CLC Y+R   
Sbjct  14   IAAVLLVILAPAAEAVTCSPMQLSPCAQAITSSSPPSALCCAKLKEQKP-CLCGYMRNPS  72

Query  237  -KYPGYAANARKAFRACGVPEPRC  305
             +    + NARK    C +P PRC
Sbjct  73   LRRFVSSPNARKVSNRCKLPIPRC  96



>ref|XP_006395306.1| hypothetical protein EUTSA_v10005391mg [Eutrema salsugineum]
 gb|ESQ32592.1| hypothetical protein EUTSA_v10005391mg [Eutrema salsugineum]
Length=105

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 13/100 (13%)
 Frame = +3

Query  42   AIIMTAMLIGELEL------TMAQPPPPPPGCNERALTPCGPAIL--FGTAPSTECCRIL  197
             II+ A ++  L        ++ +P    P C +  +T CGPAI+   GT PS ECC  L
Sbjct  7    VIIIIAFVVTVLSSPAPINSSVIKPHSTKPPCTDLKITGCGPAIIGGIGTKPSAECCGGL  66

Query  198  RQQTPKCLCEYLR----KYPGYAANARKAFRACGVPEPRC  305
            +   P C C++++    K    +  +     ACGV  P C
Sbjct  67   KATQP-CFCDFIKIPFFKSFITSLKSHLVLAACGVTYPTC  105



>ref|XP_010062206.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69298.1| hypothetical protein EUGRSUZ_F02789 [Eucalyptus grandis]
Length=103

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR----KYPGYAANARKAFRAC  284
            C+   L+PC PAI    APS  CC  LR+Q P CLC Y++    K    + NA++    C
Sbjct  38   CSATELSPCLPAITSSAAPSALCCSKLREQRP-CLCGYIKDPNLKQYFTSPNAKRVASTC  96

Query  285  GVPEPRC  305
            GV  P C
Sbjct  97   GVASPTC  103



>emb|CAH69201.1| type 2 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|EMT06943.1| Non-specific lipid-transfer protein 2P [Aegilops tauschii]
Length=96

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 34/67 (51%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGY--AANARKAFRAC  284
            C    L  C  AIL G  PS ECC  LR Q P C C+Y +   Y  Y  + +AR   ++C
Sbjct  31   CQASQLAVCASAILSGAKPSGECCGNLRAQQP-CFCQYAKDPTYGQYIRSPHARDTLQSC  89

Query  285  GVPEPRC  305
            G+  P C
Sbjct  90   GLAVPHC  96



>gb|KFK33268.1| hypothetical protein AALP_AA6G352500 [Arabis alpina]
Length=105

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAA--NARKAFRAC  284
            CN   L PC  A+  G  P+T+CC  L +Q P CLC Y++   +  Y    NARK   AC
Sbjct  40   CNPLELFPCYTAVTTGVPPTTDCCAKLNEQKP-CLCGYIQNPVFMVYVTSPNARKTLEAC  98

Query  285  GVPEPRC  305
             V  P C
Sbjct  99   NVMYPTC  105



>ref|XP_003567950.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=100

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            CN   L+PC  AI+   AP+  CC  ++ Q P CLC+Y     L++Y   + N +K   A
Sbjct  35   CNALQLSPCAGAIIGNAAPTAACCSRMKAQQP-CLCQYAKDPNLQRYVS-SPNGKKVMAA  92

Query  282  CGVPEPRC  305
            C VP P C
Sbjct  93   CKVPVPSC  100



>emb|CDY45874.1| BnaC02g22460D [Brassica napus]
Length=98

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 13/93 (14%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            AI++  ++  E  +   Q       C+   L PC  AIL G+ PS  CC  L QQ   C+
Sbjct  14   AILLLLIVAQENRVVAGQ------SCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQ-HCV  66

Query  222  CEYLRKYPGYAA-----NARKAFRACGVPEPRC  305
            C+Y+ K P + +     NA+K    C  P+P+C
Sbjct  67   CQYM-KNPNFKSFLDSPNAKKIATDCHCPKPKC  98



>ref|XP_002437557.1| hypothetical protein SORBIDRAFT_10g029330 [Sorghum bicolor]
 gb|EER88924.1| hypothetical protein SORBIDRAFT_10g029330 [Sorghum bicolor]
Length=96

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 6/67 (9%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRK--YPGYAAN--ARKAFRAC  284
            CN  AL+ C  A LFG A +  CC  LR Q P CLC+Y R   Y GY     A+   RAC
Sbjct  32   CNPSALSACSGA-LFGGAVTQGCCASLRAQQP-CLCQYKRDPAYRGYVNGPVAQSVTRAC  89

Query  285  GVPEPRC  305
            G+P  +C
Sbjct  90   GLPMMKC  96



>ref|XP_002870865.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47124.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 5/65 (8%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR--KYPGYAA--NARKAFRAC  284
            C+   L+ C      G +PST CC  L++Q P C C Y++  KY  Y    NA+K    C
Sbjct  38   CDANELSSCLLPFTTGVSPSTTCCTKLKEQQP-CFCTYIKDPKYSQYVGTPNAKKTLATC  96

Query  285  GVPEP  299
            GVP P
Sbjct  97   GVPYP  101



>emb|CDY51937.1| BnaAnng11140D [Brassica napus]
Length=96

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 7/93 (8%)
 Frame = +3

Query  42   AIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCL  221
            A  ++ + +    L +  P      C+   L+PC  AI   + PS  CC  L++Q P C+
Sbjct  6    ATWVSILALAAFLLVVLVPAAEAVTCSPMQLSPCAAAITSSSPPSALCCAKLKEQKP-CI  64

Query  222  CEY-----LRKYPGYAANARKAFRACGVPEPRC  305
            C Y     LR+Y   + NARK    C  P PRC
Sbjct  65   CGYMRNPSLRRYIS-SPNARKVSNTCKFPMPRC  96



>gb|KHN44569.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 11/90 (12%)
 Frame = +3

Query  48   IMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCE  227
            ++  + + E++++ A        C+   L+ C  AI   T PS  CC  +++Q P CLC+
Sbjct  11   LVVLLFVAEVQVSKA------VTCSPVQLSACVSAITSSTPPSNLCCSKIKEQKP-CLCQ  63

Query  228  YLR----KYPGYAANARKAFRACGVPEPRC  305
            YL+    K    + NAR+    CG P PRC
Sbjct  64   YLKNPNLKKFVDSPNARRVANTCGTPFPRC  93



>ref|NP_001152008.1| nonspecific lipid-transfer protein AKCS9 precursor [Zea mays]
 gb|ACG45377.1| nonspecific lipid-transfer protein AKCS9 precursor [Zea mays]
 gb|AFW79029.1| nonspecific lipid-transfer protein AKCS9 [Zea mays]
Length=98

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 6/63 (10%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR-----KYPGYAANARKAFRACGVPE  296
            LTPC PAI+   AP+  CC  L+     C C+Y R     +Y   + N +K F AC V  
Sbjct  37   LTPCAPAIVGNAAPTAACCARLKAHPATCFCQYKRNPSMQRYVN-SPNGKKVFAACKVSL  95

Query  297  PRC  305
            PRC
Sbjct  96   PRC  98



>ref|NP_001152727.1| nonspecific lipid-transfer protein AKCS9 precursor [Zea mays]
 gb|ACG49168.1| nonspecific lipid-transfer protein AKCS9 precursor [Zea mays]
Length=100

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 6/63 (10%)
 Frame = +3

Query  132  LTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR-----KYPGYAANARKAFRACGVPE  296
            LTPC PAI+   AP+  CC  L+     C C+Y R     +Y   + N +K F AC V  
Sbjct  39   LTPCAPAIVGNAAPTAACCARLKAHPATCFCQYKRNPSMQRYVN-SPNGKKVFAACKVSL  97

Query  297  PRC  305
            PRC
Sbjct  98   PRC  100



>ref|XP_006293217.1| hypothetical protein CARUB_v10019541mg [Capsella rubella]
 gb|EOA26115.1| hypothetical protein CARUB_v10019541mg [Capsella rubella]
Length=100

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 7/70 (10%)
 Frame = +3

Query  111  PGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGY-----AANARKAF  275
            P C +  +T C PAI+ GT P+ ECC  L+ Q P C C++++  P +     +  A  A 
Sbjct  33   PPCTDIEITGCVPAIILGTPPTAECCGKLKAQQP-CYCDFIKN-PAFRPLVTSPQAHAAL  90

Query  276  RACGVPEPRC  305
              CG+P P C
Sbjct  91   GFCGIPYPSC  100



>gb|AFK34114.1| unknown [Medicago truncatula]
Length=92

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 13/88 (15%)
 Frame = +3

Query  57   AMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR  236
             +L+  ++++MA        C+   L+ C  AI   T PS  CC  +++Q P CLC+Y+ 
Sbjct  13   VLLLINVQVSMA------VTCSPVQLSSCVSAITSSTPPSNLCCSKIKEQRP-CLCQYM-  64

Query  237  KYPGYAA-----NARKAFRACGVPEPRC  305
            K P         NARK    CG P PRC
Sbjct  65   KNPNLTKFVNTPNARKVANTCGTPFPRC  92



>ref|XP_010419026.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 35/68 (51%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLRKYPGYAA-----NARKAFRA  281
            C+ R L PC  AI  G  PS ECC  L +Q   CLC +  K P +A      N+RK   A
Sbjct  37   CDARQLQPCLAAITGGGQPSGECCAKLTEQ-QSCLCGF-AKNPAFAQYISSPNSRKVLAA  94

Query  282  CGVPEPRC  305
            CGV  P C
Sbjct  95   CGVAYPTC  102



>ref|XP_004232333.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=96

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 7/68 (10%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEY-----LRKYPGYAANARKAFRA  281
            C+   L+PC  AI  GTAPS +CC  L+ Q P C+C +     LR+Y   + NARK    
Sbjct  31   CSASQLSPCLGAIQGGTAPSQDCCARLKNQQP-CICGFMKDPNLRQYVN-SPNARKVAGQ  88

Query  282  CGVPEPRC  305
            CGV  P C
Sbjct  89   CGVSIPSC  96



>ref|XP_003535202.1| PREDICTED: non-specific lipid-transfer protein 2-like [Glycine 
max]
Length=107

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 35/66 (53%), Gaps = 6/66 (9%)
 Frame = +3

Query  117  CNERALTPCGPAILFGTAPSTECCRILRQQTPKCLCEYLR-----KYPGYAANARKAFRA  281
            CN   L PC  A    T PS ECC+ LR+Q   C+C+Y++     K+    +NA+    +
Sbjct  40   CNVMELVPCAAAFTTSTPPSPECCQRLREQPRSCICQYMKDPTLEKFIN-TSNAKMVSDS  98

Query  282  CGVPEP  299
            CG P P
Sbjct  99   CGSPMP  104



>ref|XP_004234627.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=104

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 42/90 (47%), Gaps = 11/90 (12%)
 Frame = +3

Query  39   SAIIMTAMLIGELELTMAQPPPPPPGCNERALTPCGPAILFGTAPSTECCRILRQQTPKC  218
            + II   + + EL +T A        CN   L  C  +I+   +PST CC I  ++   C
Sbjct  8    ATIIFLVLFLSELLVTEA------VTCNVMELILCVTSIMISQSPSTRCC-IKLKKLKSC  60

Query  219  LCEYLR--KYPGYAA--NARKAFRACGVPE  296
            L  YL    Y  Y    NA++  + CGVP+
Sbjct  61   LSMYLMNPNYKSYVKYPNAKRILKTCGVPD  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522986485888