BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32610_g1_i1 len=646 path=[1:0-645]

Length=646
                                                                      Score     E

ref|XP_009627018.1|  PREDICTED: protein FANTASTIC FOUR 2-like           106   4e-24   
ref|XP_009623353.1|  PREDICTED: protein FANTASTIC FOUR 3-like           100   1e-21   
ref|XP_009798452.1|  PREDICTED: protein FANTASTIC FOUR 3-like         94.7    9e-20   
ref|XP_009789905.1|  PREDICTED: protein FANTASTIC FOUR 3-like         91.7    1e-18   
emb|CDP03625.1|  unnamed protein product                              90.1    5e-18   
gb|KEH23755.1|  DUF3049 family protein                                87.4    5e-17   
ref|XP_007050627.1|  Uncharacterized protein TCM_004392               85.1    3e-16   
ref|XP_006604433.1|  PREDICTED: protein FANTASTIC FOUR 4-like         84.7    3e-16   
gb|KHN19892.1|  Protein FANTASTIC FOUR 1                              84.3    5e-16   
ref|XP_004493666.1|  PREDICTED: protein FANTASTIC FOUR 4-like         82.0    6e-16   
ref|XP_002307579.1|  hypothetical protein POPTR_0005s23070g           83.2    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010652119.1|  PREDICTED: protein FANTASTIC FOUR 3-like         82.8    2e-15   
ref|XP_010684260.1|  PREDICTED: protein FANTASTIC FOUR 3              82.0    3e-15   
ref|XP_009355474.1|  PREDICTED: protein FANTASTIC FOUR 1-like         80.1    2e-14   
ref|XP_009367693.1|  PREDICTED: protein FANTASTIC FOUR 1-like         80.1    2e-14   
ref|XP_010026221.1|  PREDICTED: protein FANTASTIC FOUR 2-like         79.0    3e-14   
ref|XP_010026223.1|  PREDICTED: protein FANTASTIC FOUR 1-like         77.8    7e-14   
ref|XP_007034674.1|  Uncharacterized protein isoform 1                78.6    7e-14   
ref|XP_010277946.1|  PREDICTED: protein FANTASTIC FOUR 1              78.6    8e-14   
gb|KCW58855.1|  hypothetical protein EUGRSUZ_H01483                   77.8    8e-14   
ref|XP_002520750.1|  conserved hypothetical protein                   77.8    9e-14   Ricinus communis
ref|XP_004247322.1|  PREDICTED: protein FANTASTIC FOUR 3-like         77.0    1e-13   
ref|XP_010090398.1|  hypothetical protein L484_025063                 77.0    1e-13   
gb|KDP21465.1|  hypothetical protein JCGZ_21936                       76.6    2e-13   
ref|XP_008345179.1|  PREDICTED: protein FANTASTIC FOUR 1-like         77.4    2e-13   
ref|XP_011032789.1|  PREDICTED: protein FANTASTIC FOUR 2              76.6    2e-13   
ref|XP_006575073.1|  PREDICTED: protein FANTASTIC FOUR 2-like         76.3    2e-13   
ref|XP_007144633.1|  hypothetical protein PHAVU_007G171900g           75.5    4e-13   
emb|CAN75990.1|  hypothetical protein VITISV_012195                   75.5    1e-12   Vitis vinifera
emb|CBI26596.3|  unnamed protein product                              75.5    2e-12   
emb|CBI26209.3|  unnamed protein product                              75.1    2e-12   
ref|XP_002277799.3|  PREDICTED: protein FANTASTIC FOUR 3-like         75.1    2e-12   Vitis vinifera
ref|XP_007162422.1|  hypothetical protein PHAVU_001G150800g           73.9    2e-12   
gb|KDO68746.1|  hypothetical protein CISIN_1g048327mg                 73.6    2e-12   
ref|XP_006444080.1|  hypothetical protein CICLE_v10021186mg           73.6    3e-12   
emb|CAJ34820.1|  hypothetical protein 12                              71.2    8e-12   Plantago major [cart-track plant]
ref|XP_004240642.1|  PREDICTED: protein FANTASTIC FOUR 3-like         70.5    1e-11   
ref|XP_008235278.1|  PREDICTED: protein FANTASTIC FOUR 1-like         72.0    2e-11   
ref|XP_002312517.1|  hypothetical protein POPTR_0008s14890g           71.2    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007199877.1|  hypothetical protein PRUPE_ppa007155mg           71.2    3e-11   
ref|XP_010256213.1|  PREDICTED: protein FANTASTIC FOUR 1              70.1    6e-11   
ref|XP_010093987.1|  hypothetical protein L484_007333                 68.9    1e-10   
ref|XP_002517200.1|  conserved hypothetical protein                   68.2    2e-10   Ricinus communis
ref|XP_006355849.1|  PREDICTED: protein FANTASTIC FOUR 3-like         67.0    2e-10   
gb|KDP40138.1|  hypothetical protein JCGZ_02136                       67.4    6e-10   
emb|CAN84026.1|  hypothetical protein VITISV_042565                   66.6    9e-10   Vitis vinifera
gb|KHN45355.1|  Protein FANTASTIC FOUR 3                              65.5    1e-09   
ref|XP_009338457.1|  PREDICTED: protein FANTASTIC FOUR 1-like iso...  66.6    1e-09   
ref|XP_006419861.1|  hypothetical protein CICLE_v10005417mg           66.6    1e-09   
ref|XP_009338456.1|  PREDICTED: protein FANTASTIC FOUR 1-like iso...  66.6    1e-09   
ref|XP_009364264.1|  PREDICTED: protein FANTASTIC FOUR 1-like         66.2    1e-09   
ref|XP_010662167.1|  PREDICTED: protein FANTASTIC FOUR 1-like         66.2    2e-09   
ref|XP_011026040.1|  PREDICTED: protein FANTASTIC FOUR 3-like         65.9    2e-09   
ref|XP_006418259.1|  hypothetical protein EUTSA_v10008552mg           64.7    2e-09   
ref|XP_006489332.1|  PREDICTED: protein FANTASTIC FOUR 3-like         65.5    2e-09   
gb|KDO74737.1|  hypothetical protein CISIN_1g020519mg                 65.5    3e-09   
emb|CDY18155.1|  BnaC05g01780D                                        63.9    3e-09   
ref|XP_008390964.1|  PREDICTED: protein FANTASTIC FOUR 1-like         65.1    4e-09   
emb|CDO99018.1|  unnamed protein product                              64.3    5e-09   
ref|XP_002314717.1|  hypothetical protein POPTR_0010s10190g           64.3    5e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011021579.1|  PREDICTED: protein FANTASTIC FOUR 3              63.9    8e-09   
ref|XP_002889441.1|  hypothetical protein ARALYDRAFT_887469           62.8    9e-09   
ref|XP_003592472.1|  hypothetical protein MTR_1g105360                63.9    9e-09   
gb|EYU25966.1|  hypothetical protein MIMGU_mgv1a021532mg              63.2    1e-08   
gb|AFK46160.1|  unknown                                               59.7    1e-08   
gb|EYU20532.1|  hypothetical protein MIMGU_mgv1a026483mg              62.4    2e-08   
ref|NP_563678.1|  protein FANTASTIC FOUR 2                            61.6    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607604.1|  PREDICTED: protein FANTASTIC FOUR 3              61.2    3e-08   
ref|XP_008801051.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAF-...  62.4    3e-08   
ref|XP_009786867.1|  PREDICTED: protein FANTASTIC FOUR 3-like         61.6    5e-08   
ref|XP_009111163.1|  PREDICTED: protein FANTASTIC FOUR 2-like         60.5    7e-08   
gb|KGN47898.1|  hypothetical protein Csa_6G410040                     60.8    7e-08   
gb|AAC72118.1|  F15K9.22                                              60.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009591870.1|  PREDICTED: protein FANTASTIC FOUR 4-like         61.2    8e-08   
emb|CDY15453.1|  BnaA08g27370D                                        59.7    1e-07   
ref|XP_010667002.1|  PREDICTED: protein FANTASTIC FOUR 1-like         60.5    1e-07   
ref|XP_008449938.1|  PREDICTED: protein FANTASTIC FOUR 3              59.7    1e-07   
emb|CDX89908.1|  BnaA10g01740D                                        59.3    1e-07   
ref|XP_011044595.1|  PREDICTED: protein FAF-like, chloroplastic       60.5    2e-07   
emb|CDX86688.1|  BnaC08g00150D                                        59.3    2e-07   
ref|XP_007015661.1|  Chaperone DnaJ-domain superfamily protein        60.8    2e-07   
gb|KDP42960.1|  hypothetical protein JCGZ_23902                       60.5    2e-07   
ref|XP_010685446.1|  PREDICTED: protein FAF-like, chloroplastic       60.5    2e-07   
emb|CDP15569.1|  unnamed protein product                              60.5    2e-07   
ref|XP_011008645.1|  PREDICTED: protein FAF-like, chloroplastic       60.5    2e-07   
ref|XP_010247410.1|  PREDICTED: protein FAF-like, chloroplastic       60.1    2e-07   
ref|XP_009413641.1|  PREDICTED: protein FAF-like, chloroplastic       59.7    3e-07   
gb|KEH43902.1|  fantastic four-like protein                           59.7    3e-07   
gb|KGN48025.1|  hypothetical protein Csa_6G425130                     58.9    3e-07   
ref|XP_002465519.1|  hypothetical protein SORBIDRAFT_01g040410        59.3    3e-07   Sorghum bicolor [broomcorn]
gb|KCW50926.1|  hypothetical protein EUGRSUZ_J00576                   59.7    3e-07   
ref|XP_002874894.1|  hypothetical protein ARALYDRAFT_911920           58.9    3e-07   
ref|XP_010481668.1|  PREDICTED: protein FANTASTIC FOUR 2-like         58.5    3e-07   
ref|XP_010031568.1|  PREDICTED: protein FAF-like, chloroplastic       59.3    4e-07   
ref|XP_004496767.1|  PREDICTED: protein FANTASTIC FOUR 3-like         59.3    4e-07   
ref|XP_010546856.1|  PREDICTED: protein FANTASTIC FOUR 3 isoform X1   58.5    4e-07   
ref|XP_004511343.1|  PREDICTED: protein FANTASTIC FOUR 3-like         58.9    5e-07   
ref|XP_002314255.2|  hypothetical protein POPTR_0009s02170g           58.9    6e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002466598.1|  hypothetical protein SORBIDRAFT_01g010700        58.9    6e-07   Sorghum bicolor [broomcorn]
ref|XP_010522714.1|  PREDICTED: protein FANTASTIC FOUR 1-like         58.2    6e-07   
ref|XP_011008749.1|  PREDICTED: protein FAF-like, chloroplastic       58.5    7e-07   
ref|XP_010552820.1|  PREDICTED: protein FANTASTIC FOUR 1-like         57.4    7e-07   
ref|XP_002513735.1|  conserved hypothetical protein                   58.5    7e-07   Ricinus communis
gb|KGN57007.1|  hypothetical protein Csa_3G149380                     58.2    7e-07   
ref|NP_001051027.2|  Os03g0705800                                     58.5    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011088985.1|  PREDICTED: protein FAF-like, chloroplastic       58.5    8e-07   
ref|XP_010031354.1|  PREDICTED: protein FAF-like, chloroplastic       58.5    8e-07   
gb|EAZ28302.1|  hypothetical protein OsJ_12276                        58.2    8e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY91570.1|  hypothetical protein OsI_13205                        58.2    8e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_009591159.1|  PREDICTED: protein FAF-like, chloroplastic       58.5    8e-07   
gb|ACU17609.1|  unknown                                               56.6    8e-07   Glycine max [soybeans]
ref|XP_010263029.1|  PREDICTED: protein FAF-like, chloroplastic       58.5    8e-07   
ref|XP_009119569.1|  PREDICTED: protein FANTASTIC FOUR 2-like         57.4    9e-07   
ref|XP_007227323.1|  hypothetical protein PRUPE_ppa016319mg           58.2    9e-07   
ref|XP_010535716.1|  PREDICTED: protein FAF-like, chloroplastic       57.8    1e-06   
ref|XP_006588628.1|  PREDICTED: protein FANTASTIC FOUR 2-like         57.4    1e-06   
ref|XP_010474936.1|  PREDICTED: protein FANTASTIC FOUR 2-like         57.0    1e-06   
ref|XP_006592358.1|  PREDICTED: protein FAF-like, chloroplastic-like  57.8    1e-06   
ref|XP_009381827.1|  PREDICTED: uncharacterized protein LOC103969916  57.8    1e-06   
ref|XP_010552818.1|  PREDICTED: protein FANTASTIC FOUR 2-like         56.6    1e-06   
ref|XP_010457322.1|  PREDICTED: protein FANTASTIC FOUR 2-like         57.0    1e-06   
ref|XP_010916536.1|  PREDICTED: protein FAF-like, chloroplastic i...  57.8    1e-06   
ref|XP_010916535.1|  PREDICTED: protein FAF-like, chloroplastic i...  57.8    1e-06   
gb|KHN21197.1|  Protein FAF-like, chloroplastic                       57.8    1e-06   
ref|XP_006424085.1|  hypothetical protein CICLE_v10028116mg           57.8    1e-06   
gb|KHN19928.1|  Protein FAF-like, chloroplastic                       57.4    2e-06   
ref|XP_009786342.1|  PREDICTED: protein FAF-like, chloroplastic       57.4    2e-06   
gb|KHG29078.1|  hypothetical protein F383_03861                       57.4    2e-06   
ref|XP_008449447.1|  PREDICTED: protein FANTASTIC FOUR 2-like         56.6    2e-06   
ref|XP_009126523.1|  PREDICTED: protein FAF-like, chloroplastic       57.4    2e-06   
ref|XP_004982036.1|  PREDICTED: protein FAF-like, chloroplastic-like  57.0    2e-06   
ref|XP_006290238.1|  hypothetical protein CARUB_v100036780mg          56.2    2e-06   
emb|CDY09119.1|  BnaA02g05450D                                        57.0    2e-06   
ref|XP_003596894.1|  hypothetical protein MTR_2g087390                56.6    3e-06   
ref|XP_004984714.1|  PREDICTED: uncharacterized protein LOC101755002  56.6    3e-06   
ref|XP_003596901.1|  hypothetical protein MTR_2g087460                56.6    3e-06   
tpg|DAA44496.1|  TPA: hypothetical protein ZEAMMB73_040803            56.6    3e-06   
ref|XP_008653896.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAF-...  56.6    3e-06   
ref|XP_008222964.1|  PREDICTED: protein FANTASTIC FOUR 3-like         56.6    3e-06   
ref|XP_010926465.1|  PREDICTED: protein FAF-like, chloroplastic       56.6    3e-06   
gb|KHN17984.1|  Protein FAF-like, chloroplastic                       56.6    3e-06   
ref|XP_003541957.1|  PREDICTED: protein FAF-like, chloroplastic-like  56.6    3e-06   
gb|KHN36503.1|  Protein FAF-like, chloroplastic                       56.6    3e-06   
gb|EYU40575.1|  hypothetical protein MIMGU_mgv1a004589mg              56.6    4e-06   
ref|XP_011026181.1|  PREDICTED: protein FANTASTIC FOUR 2              55.8    4e-06   
ref|XP_003610672.1|  hypothetical protein MTR_5g005770                55.8    5e-06   
ref|XP_011079845.1|  PREDICTED: protein FANTASTIC FOUR 2              55.8    5e-06   
gb|AAT06460.1|  At4g02810                                             55.5    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192190.1|  FAF family protein                                  55.5    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42677.1|  hypothetical protein AALP_AA1G025400                  55.1    6e-06   
ref|XP_002300849.2|  hypothetical protein POPTR_0002s05430g           55.5    6e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007150016.1|  hypothetical protein PHAVU_005G118900g           55.5    7e-06   
ref|XP_007208036.1|  hypothetical protein PRUPE_ppa002898mg           55.8    7e-06   
gb|KHG22819.1|  hypothetical protein F383_08710                       55.5    7e-06   
gb|KFK30886.1|  hypothetical protein AALP_AA6G038600                  55.1    7e-06   
ref|XP_007132501.1|  hypothetical protein PHAVU_011G099500g           55.5    8e-06   
ref|XP_004506225.1|  PREDICTED: protein FAF-like, chloroplastic-like  55.5    8e-06   
ref|XP_003605994.1|  hypothetical protein MTR_4g050590                55.5    8e-06   
ref|XP_004228872.1|  PREDICTED: protein FAF-like, chloroplastic       55.5    9e-06   
ref|XP_008782273.1|  PREDICTED: helicase SWR1-like                    55.1    1e-05   
ref|XP_008438701.1|  PREDICTED: protein FANTASTIC FOUR 4              55.1    1e-05   
ref|XP_006487862.1|  PREDICTED: protein FAF-like, chloroplastic-like  55.1    1e-05   
gb|KDO46581.1|  hypothetical protein CISIN_1g008798mg                 55.1    1e-05   
ref|XP_004139078.1|  PREDICTED: protein FAF-like, chloroplastic-like  55.1    1e-05   
ref|XP_004170966.1|  PREDICTED: protein FAF-like, chloroplastic-like  55.1    1e-05   
ref|XP_003539488.1|  PREDICTED: protein FAF-like, chloroplastic-l...  55.1    1e-05   
ref|XP_008230058.1|  PREDICTED: protein FAF-like, chloroplastic       55.1    1e-05   
ref|XP_008450286.1|  PREDICTED: protein FAF-like, chloroplastic       54.7    1e-05   
ref|XP_004241354.1|  PREDICTED: protein FAF-like, chloroplastic       54.7    1e-05   
ref|XP_010430400.1|  PREDICTED: protein FANTASTIC FOUR 1-like         53.9    2e-05   
ref|XP_010521625.1|  PREDICTED: protein FAF-like, chloroplastic       54.3    2e-05   
ref|XP_004291539.1|  PREDICTED: protein FAF-like, chloroplastic-like  54.3    2e-05   
ref|XP_006340442.1|  PREDICTED: protein FAF-like, chloroplastic-like  54.3    2e-05   
ref|XP_006361108.1|  PREDICTED: protein FAF-like, chloroplastic-like  54.3    2e-05   
ref|XP_009763490.1|  PREDICTED: protein FANTASTIC FOUR 3-like         53.9    2e-05   
ref|XP_008660317.1|  PREDICTED: protein FANTASTIC FOUR 4-like         53.9    2e-05   
ref|XP_008366383.1|  PREDICTED: protein FAF-like, chloroplastic       53.9    3e-05   
ref|XP_008385575.1|  PREDICTED: protein FAF-like, chloroplastic       53.9    3e-05   
ref|XP_010312347.1|  PREDICTED: protein FAF-like, chloroplastic       53.9    3e-05   
ref|XP_010101989.1|  hypothetical protein L484_016279                 53.9    3e-05   
ref|XP_009787268.1|  PREDICTED: adhesive plaque matrix protein-like   53.9    3e-05   
ref|XP_010455928.1|  PREDICTED: protein FANTASTIC FOUR 1-like         53.1    3e-05   
ref|XP_010422533.1|  PREDICTED: protein FANTASTIC FOUR 1              53.1    3e-05   
ref|XP_010026222.1|  PREDICTED: protein FANTASTIC FOUR 2-like         51.6    4e-05   
ref|XP_009336398.1|  PREDICTED: protein FAF-like, chloroplastic       53.1    5e-05   
ref|XP_009373888.1|  PREDICTED: protein FAF-like, chloroplastic       53.1    5e-05   
ref|XP_008361605.1|  PREDICTED: protein FAF-like, chloroplastic       52.8    6e-05   
ref|XP_009368373.1|  PREDICTED: protein FAF-like, chloroplastic       52.4    8e-05   
ref|XP_004487448.1|  PREDICTED: protein FAF-like, chloroplastic-like  52.0    1e-04   
ref|XP_006304801.1|  hypothetical protein CARUB_v10012407mg           51.6    1e-04   
gb|AES67149.2|  DUF3049 family protein                                51.6    1e-04   
ref|XP_008451366.1|  PREDICTED: protein FANTASTIC FOUR 3-like         51.6    1e-04   
ref|XP_003596898.1|  hypothetical protein MTR_2g087430                51.6    1e-04   
ref|XP_011090759.1|  PREDICTED: protein FANTASTIC FOUR 3              50.8    2e-04   
ref|XP_002874046.1|  hypothetical protein ARALYDRAFT_351234           51.2    2e-04   
dbj|BAC42736.1|  unknown protein                                      51.2    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAC34502.1|  putative protein                                     51.2    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_680195.2|  uncharacterized protein                             51.2    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544324.1|  PREDICTED: protein FAF-like, chloroplastic       50.8    3e-04   
ref|XP_009606299.1|  PREDICTED: protein FANTASTIC FOUR 3-like         50.8    3e-04   
ref|XP_008449599.1|  PREDICTED: protein FAF-like, chloroplastic       50.8    3e-04   
emb|CDX88810.1|  BnaA03g08390D                                        50.4    4e-04   
emb|CDX70983.1|  BnaC03g10670D                                        50.4    4e-04   
ref|XP_009131857.1|  PREDICTED: protein FAF-like, chloroplastic       50.1    5e-04   
ref|XP_004251227.1|  PREDICTED: protein FAF-like, chloroplastic       49.7    5e-04   
ref|XP_009604443.1|  PREDICTED: protein FAF-like, chloroplastic       50.1    5e-04   
ref|XP_004169382.1|  PREDICTED: protein FAF-like, chloroplastic-like  50.1    5e-04   
ref|XP_004140267.1|  PREDICTED: protein FAF-like, chloroplastic-like  50.1    5e-04   
ref|XP_009764935.1|  PREDICTED: protein FAF-like, chloroplastic       50.1    6e-04   
ref|XP_010456623.1|  PREDICTED: protein FAF-like, chloroplastic       49.7    7e-04   
ref|XP_006400714.1|  hypothetical protein EUTSA_v10013382mg           49.3    9e-04   
ref|XP_006287687.1|  hypothetical protein CARUB_v10000895mg           49.3    9e-04   
ref|XP_010495347.1|  PREDICTED: protein FAF-like, chloroplastic       49.7    9e-04   
ref|XP_009388789.1|  PREDICTED: protein FAF-like, chloroplastic       49.3    9e-04   
ref|XP_010421000.1|  PREDICTED: protein FAF-like, chloroplastic       49.3    0.001   



>ref|XP_009627018.1| PREDICTED: protein FANTASTIC FOUR 2-like [Nicotiana tomentosiformis]
Length=276

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 33/148 (22%)
 Frame = -2

Query  444  MSKTSSVCVGLPSCLEPR-----ILVHKM---------------------ESTKPPEEIS  343
            M+ T+ +C GL SC+EP+     +L++K+                     +  +P EEI 
Sbjct  1    MASTAVLCQGLQSCMEPQLPEKHVLINKLSPPTLIFSQSKFNMFSQETEAKGVEPNEEIC  60

Query  342  AETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCT  163
              + +L     G  WSF+Q+L + +R     + AE EVY+HP++ RS+STLS KSLEMCT
Sbjct  61   VRSNDLQTQICG--WSFLQSLDNAKR-----ENAENEVYIHPLMNRSSSTLSPKSLEMCT  113

Query  162  ESLGSETGSDISESVEEFSSLLPEKENS  79
            E+LGSETGSDISE +EE SS L EKENS
Sbjct  114  ENLGSETGSDISEGIEENSSFLSEKENS  141



>ref|XP_009623353.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana tomentosiformis]
Length=293

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 86/153 (56%), Gaps = 35/153 (23%)
 Frame = -2

Query  444  MSKTSSVCVGLPSCLEP-----RILVHKME---------------STKPPEEISAETKEL  325
            M+ TS++  GL SCLEP      +L++K+                S   P+E   E +  
Sbjct  1    MTSTSTLYQGLQSCLEPTLLEPHVLMNKLPPLISNYLQSTTLLQMSNTSPQEAETEEENE  60

Query  324  ING-------------DLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLST  184
            +NG             D+G GWSFIQ L +P +    G   +EEVYVHP+ K    TL+T
Sbjct  61   VNGLSFNELQNQHDNSDMGCGWSFIQELENPCQYPKKGYLEDEEVYVHPLEK--LCTLNT  118

Query  183  KSLEMCTESLGSETGSDISESVEEFSSLLPEKE  85
            KSLEMCTESLGSETGSDISES+EEFS  L EKE
Sbjct  119  KSLEMCTESLGSETGSDISESMEEFSPFLSEKE  151



>ref|XP_009798452.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana sylvestris]
Length=279

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (59%), Gaps = 35/143 (24%)
 Frame = -2

Query  444  MSKTSSVCVGLPSCLEP-----RILVHKME---------------STKPPEEISAETKEL  325
            M+ TS++  GL SCLEP     R+L++K+                S   P+E   E +  
Sbjct  1    MTSTSTLYQGLQSCLEPTLVEPRVLMNKLPPPISNFPQSTTLLQMSKISPQEAETEEENG  60

Query  324  I----------NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSL  175
            +          N D+  GWSFI  L +P  +    K+ +EEVYVHPMVK  +S+L+TKSL
Sbjct  61   LSFNELQNQHENSDVSRGWSFIHELENPCEHP---KKGDEEVYVHPMVK--SSSLNTKSL  115

Query  174  EMCTESLGSETGSDISESVEEFS  106
            EMCTESLGSETGSDISES+EEFS
Sbjct  116  EMCTESLGSETGSDISESMEEFS  138



>ref|XP_009789905.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana sylvestris]
Length=250

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 36/153 (24%)
 Frame = -2

Query  444  MSKTSSVCVGLPSCLEPR-----ILVHKM----------------------ESTKPPEEI  346
            M+  S +C G+ SC+E +     +L++K+                         +P EEI
Sbjct  1    MASASILCQGMQSCMEAQLPEKHVLINKLSPPTLIFSQSKFNMFSQEAEAKRGVEPNEEI  60

Query  345  SAETKELIN---GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKS-  178
               + +L N    D   GWSF++AL S +++      AE EVY+HP++KRS+S+  +   
Sbjct  61   CVRSNDLQNQHGNDNKGGWSFLEALDSAKKDN-----AENEVYIHPLMKRSSSSTLSPKS  115

Query  177  LEMCTESLGSETGSDISESVEEFSSLLPEKENS  79
            LEMCTE+LGSETGSDISES+EE S  L E+ENS
Sbjct  116  LEMCTENLGSETGSDISESIEENSCFLSERENS  148



>emb|CDP03625.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 82/156 (53%), Gaps = 47/156 (30%)
 Frame = -2

Query  435  TSSVCVGLPSC-----LEPRILVHKME------------STKP---PEEISAETKELI--  322
            +S+VC GL SC     +EPR+L+  +             + KP   P +   E  E+I  
Sbjct  2    SSNVCQGLQSCTEPGLVEPRVLIQNLAPPIHNSSQSNPWTQKPKNAPPQPQQEQNEMIIP  61

Query  321  -----------------------NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMV  211
                                   N D  S WS IQAL    +N+    EAE++VYVHP+V
Sbjct  62   NENDKNILIQRKHCYCDSVESKRNSD--SLWSSIQALTRTSQNRMQVSEAEQQVYVHPLV  119

Query  210  KRSASTLSTKSLEMCTESLGSETGSDISESVEEFSS  103
            KRS+S LSTKSLEMCTE+LGSETGS I +S+++F S
Sbjct  120  KRSSSGLSTKSLEMCTENLGSETGSSIDQSIDDFPS  155



>gb|KEH23755.1| DUF3049 family protein [Medicago truncatula]
Length=318

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 75/125 (60%), Gaps = 16/125 (13%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRILVHKMESTK--PP-----EEISAETKELING-----DLGSGWSF  292
            +SS+C GL SCLEPR++  ++ + K  PP       +  E   +IN      D  S WSF
Sbjct  2    SSSLCQGLQSCLEPRLIEPRILTLKLAPPGSNISPSLDQEKPIIINNECEKNDTKSSWSF  61

Query  291  IQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +QAL   E N+   + A   VYVHP VKRS+S LS KSLEMCTESLGSETGS+  ES + 
Sbjct  62   LQAL--TETNKI--ENANGNVYVHPTVKRSSSMLSEKSLEMCTESLGSETGSNAGESSDI  117

Query  111  FSSLL  97
              SL 
Sbjct  118  DVSLF  122



>ref|XP_007050627.1| Uncharacterized protein TCM_004392 [Theobroma cacao]
 gb|EOX94784.1| Uncharacterized protein TCM_004392 [Theobroma cacao]
Length=322

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 81/154 (53%), Gaps = 46/154 (30%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRILVHKMESTK--PPE---------------EISAETK--------  331
            +S+VC GL SCLEPR++  +    K  PP+                   ETK        
Sbjct  2    SSNVCQGLQSCLEPRLVESRFLRLKLAPPKTNFSGSIVPRPCFTNPALTETKPSPYNEEK  61

Query  330  --------------ELINGDLG---SGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRS  202
                          +LI G+      GWSF+Q+L +  ++ T      ++VYVHP+VKRS
Sbjct  62   NTSITHNESDTNDCKLIGGNQNVDRGGWSFLQSLAANAKDSTE----NDKVYVHPLVKRS  117

Query  201  ASTLSTKSLEMCTESLGSETGSDISESVEEFSSL  100
            AS LS KSLEMCTESLGSETGS++SES ++ S L
Sbjct  118  ASMLSEKSLEMCTESLGSETGSEVSESSDDISLL  151



>ref|XP_006604433.1| PREDICTED: protein FANTASTIC FOUR 4-like [Glycine max]
Length=325

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 74/142 (52%), Gaps = 41/142 (29%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRILVHKMESTK--------------------------------PPE  352
            +SSVC GL SCLEPR++  ++   K                                PP 
Sbjct  3    SSSVCQGLQSCLEPRVMEPRVLRLKLALQQGSNFPQPSPSPTTNTFSLSPLSDSEENPPT  62

Query  351  EISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLE  172
                +  +  +G+  SGWSF+Q L        +  + E++VYVHP VKRS+S LS KSLE
Sbjct  63   NCQCDKNDTKSGE-PSGWSFLQTL--------SQDKTEDQVYVHPTVKRSSSILSEKSLE  113

Query  171  MCTESLGSETGSDISESVEEFS  106
            MCTESLGSETGS+ SE+ ++ S
Sbjct  114  MCTESLGSETGSNASENGDDMS  135



>gb|KHN19892.1| Protein FANTASTIC FOUR 1 [Glycine soja]
Length=331

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 77/143 (54%), Gaps = 41/143 (29%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRILVHKM--------------ESTKPPEEIS----------AETKE  328
            +SSVC GL SCLEPR++  ++              +S+  P   +          +E   
Sbjct  3    SSSVCQGLQSCLEPRVMEPRILRLKLSLQQGSNFPQSSPSPTNNTNTISLSPLSDSEENP  62

Query  327  LIN---------GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSL  175
            L N          DL SGWS +Q L     N+T     E++VYVHP VKRS+S LS KSL
Sbjct  63   LTNHECDKNNTKSDLASGWSLVQTL---SHNKT-----EDQVYVHPTVKRSSSILSEKSL  114

Query  174  EMCTESLGSETGSDISESVEEFS  106
            EMCTESLGSETGS+ S+S ++ S
Sbjct  115  EMCTESLGSETGSNASDSGDDMS  137



>ref|XP_004493666.1| PREDICTED: protein FANTASTIC FOUR 4-like [Cicer arietinum]
Length=152

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 67/119 (56%), Gaps = 19/119 (16%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP-----RILVHKMESTKPPEEISAE------TKELINGDLGSGWSFI  289
            +S++C  L SCLEP     R+L  K+     P  I  E        E +  D    WSF+
Sbjct  3    SSNLCQALQSCLEPLVIEPRVLSLKLAPKGSPPSIEQEKALMKNNNECLKNDTKCDWSFL  62

Query  288  QALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +AL       T      E+VYVHP VKRS+S LS KSLEMCTESLGSETGS+ +E VE+
Sbjct  63   EAL-------TKSDNVNEKVYVHPTVKRSSSMLSEKSLEMCTESLGSETGSN-AECVEK  113



>ref|XP_002307579.1| hypothetical protein POPTR_0005s23070g [Populus trichocarpa]
 gb|EEE94575.1| hypothetical protein POPTR_0005s23070g [Populus trichocarpa]
Length=293

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 16/130 (12%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP------RILVHKMESTKPPEEISAE------TKELINGDLGSGWSF  292
            +SS C GL SCLEP      R+L  K+  +K  +  S+       T    N D+G GWSF
Sbjct  3    SSSSCPGLQSCLEPVSLVEPRVLRIKLAPSKSNDSCSSTSGKPFVTDSDKNADMG-GWSF  61

Query  291  IQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +Q++ +   N +   +  ++VYV P  KRS+S L+ KSLEMCTESLGSETGS++SES ++
Sbjct  62   LQSIAN---NTSQTTKENDKVYVPPNFKRSSSMLNEKSLEMCTESLGSETGSEMSESSDD  118

Query  111  FSSLLPEKEN  82
             + L  E  N
Sbjct  119  MAVLPLENVN  128



>ref|XP_010652119.1| PREDICTED: protein FANTASTIC FOUR 3-like [Vitis vinifera]
Length=353

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 82/167 (49%), Gaps = 54/167 (32%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRIL---VHKMESTKPPEEIS--------------------------  343
            +SSVC GL SCLEPR++   V +++ + P    S                          
Sbjct  2    SSSVCQGLQSCLEPRLVEQRVLRLKLSPPASSFSRSFGLAQRPGSSTSDSREAHEKSHTE  61

Query  342  -----------------AETKELINGDLGSGWSFIQALGSPERNQTAGKEA--EEEVYVH  220
                                K   NG+LG GWSFIQAL +      + KE    ++VYVH
Sbjct  62   ENNKNNKDKNNDKVVDDCNIKSQKNGELG-GWSFIQALSN---TSLSFKEVLDTDKVYVH  117

Query  219  PMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEKENS  79
            P+VKRS+S LS KSLEMCTESLGSE+G+ IS+S  E SS  P   NS
Sbjct  118  PLVKRSSSMLSAKSLEMCTESLGSESGTGISQSSHEVSS--PSWRNS  162



>ref|XP_010684260.1| PREDICTED: protein FANTASTIC FOUR 3 [Beta vulgaris subsp. vulgaris]
Length=305

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            NGD   GWSF+QAL +  R+ +  +   E+VYVHP+VK+ +S LS KSL+MCTESLGSET
Sbjct  73   NGDYLGGWSFLQALSNTTRS-SENENENEKVYVHPLVKKPSSILSEKSLQMCTESLGSET  131

Query  141  GSDISESVEEFSS  103
            GS +SES +E +S
Sbjct  132  GSTVSESGDELTS  144



>ref|XP_009355474.1| PREDICTED: protein FANTASTIC FOUR 1-like [Pyrus x bretschneideri]
Length=359

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 19/121 (16%)
 Frame = -2

Query  444  MSKTSS-VCVG-LPSCLEP--RILVHKMESTKPPE--EISAETKELINGDL---------  310
            MS TSS VC   L SCLEP  R+ ++   S   PE  E ++  +++ N DL         
Sbjct  1    MSSTSSTVCHQVLKSCLEPLVRLKLNPPGSNFLPESPEKTSHLEKIDNLDLINKKDNKEV  60

Query  309  -GSGWSFIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
              +GWSF+Q+L +P   QTA  E+E E+VYVHP+ KRSAS LS +SLEMCTESLG+ETGS
Sbjct  61   EVAGWSFLQSLANP--TQTAKSESEAEKVYVHPLAKRSASVLSPRSLEMCTESLGNETGS  118

Query  135  D  133
            +
Sbjct  119  E  119



>ref|XP_009367693.1| PREDICTED: protein FANTASTIC FOUR 1-like [Pyrus x bretschneideri]
Length=359

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 19/121 (16%)
 Frame = -2

Query  444  MSKTSS-VCVG-LPSCLEP--RILVHKMESTKPPE--EISAETKELINGDL---------  310
            MS TSS VC   L SCLEP  R+ ++   S   PE  E ++  +++ N DL         
Sbjct  1    MSSTSSTVCHQVLKSCLEPLVRLKLNPPGSNFLPESPEKTSHLEKIDNLDLINKKDNKEV  60

Query  309  -GSGWSFIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
              +GWSF+Q+L +P   QTA  E+E E+VYVHP+ KRSAS LS +SLEMCTESLG+ETGS
Sbjct  61   EVAGWSFLQSLANP--TQTAKSESEAEKVYVHPLAKRSASVLSPRSLEMCTESLGNETGS  118

Query  135  D  133
            +
Sbjct  119  E  119



>ref|XP_010026221.1| PREDICTED: protein FANTASTIC FOUR 2-like [Eucalyptus grandis]
Length=308

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 12/113 (11%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP-----RILVHKMESTKP----PEEISAETKELINGDLGSGWSFIQA  283
            +SSVC GL SCLEP     R+L  K+   +P          +T     G     WSF+QA
Sbjct  2    SSSVCQGLQSCLEPGLVEPRVLKLKLAPRRPSAGSDAAAKMKTAMAQPGTEAMDWSFLQA  61

Query  282  LGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
              +P   ++ G++A   VYVHP++K S+S LS +SLEMCTESLGSETGSD+ +
Sbjct  62   F-APAEEKSKGEQAA--VYVHPLLKCSSSFLSDQSLEMCTESLGSETGSDVGD  111



>ref|XP_010026223.1| PREDICTED: protein FANTASTIC FOUR 1-like [Eucalyptus grandis]
 gb|KCW58856.1| hypothetical protein EUGRSUZ_H01485 [Eucalyptus grandis]
Length=294

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 12/113 (11%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPR-----ILVHKMESTKPPEEISAETKELIN----GDLGSGWSFIQA  283
            +SS+C GL +CLEPR     +L  K+    P  +  A  K  +     G   + WSF+ A
Sbjct  2    SSSLCHGLQTCLEPRQVGPRVLRLKLTPHGPTADSDAAGKMKMGTTQLGTDAADWSFLHA  61

Query  282  LGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
                E      + A   VYVHP++K SAS LS +SLEMCTESLGSETGSD+S+
Sbjct  62   FAYAEEKCEGEQGA---VYVHPLLKCSASFLSDRSLEMCTESLGSETGSDVSD  111



>ref|XP_007034674.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007034675.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05600.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05601.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=340

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 85/168 (51%), Gaps = 42/168 (25%)
 Frame = -2

Query  402  LEPRILVHKMESTKP----------------------------PEEISAETKELINGDLG  307
            +EPR L  K+ ST+P                             EE+S +T  L++    
Sbjct  19   VEPRALRLKLTSTRPHFSQPREFAIESCCFDSNIKEVEEKCCYDEEVSKKTDSLLDKHTS  78

Query  306  S-----GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            S     GWSF+QAL +  ++     E +E  YVHP+VKRS STLS KSLE+CTE+LG+ET
Sbjct  79   SSPDSGGWSFLQALATCSQSSKEIVE-KENTYVHPLVKRSLSTLSEKSLELCTENLGNET  137

Query  141  GSDISE-SVEEFSSLLPEKENSPaaaaaaATEKCYRYREAFCSSSSSS  1
            GSDI E S+   SS   E  NSP       T K Y+ R+   +  ++S
Sbjct  138  GSDILEDSIFVLSSSDSEGGNSP-------TRKHYKSRQPLGAKKATS  178



>ref|XP_010277946.1| PREDICTED: protein FANTASTIC FOUR 1 [Nelumbo nucifera]
Length=355

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            N DLG+ WSFIQAL          KE E   YVHP++KRS+STLS KSLE+CTESLGSET
Sbjct  93   NCDLGN-WSFIQALAHTSETTLEAKEKETH-YVHPLIKRSSSTLSEKSLELCTESLGSET  150

Query  141  GSDISE  124
            G+DI+E
Sbjct  151  GTDITE  156



>gb|KCW58855.1| hypothetical protein EUGRSUZ_H01483 [Eucalyptus grandis]
Length=293

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 12/113 (11%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP-----RILVHKMESTKP----PEEISAETKELINGDLGSGWSFIQA  283
            +SSVC GL SCLEP     R+L  K+   +P          +T     G     WSF+QA
Sbjct  2    SSSVCQGLQSCLEPGLVEPRVLKLKLAPRRPSAGSDAAAKMKTAMAQPGTEAMDWSFLQA  61

Query  282  LGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
              +P   ++ G++A   VYVHP++K S+S LS +SLEMCTESLGSETGSD+ +
Sbjct  62   F-APAEEKSKGEQAA--VYVHPLLKCSSSFLSDQSLEMCTESLGSETGSDVGD  111



>ref|XP_002520750.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41712.1| conserved hypothetical protein [Ricinus communis]
Length=302

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 73/140 (52%), Gaps = 33/140 (24%)
 Frame = -2

Query  432  SSVCVGLPSCLEP------RILVHKMESTKPPEEISA-------------------ETKE  328
            SS C GL SCLEP      R+L  K+    PPE  ++                   ++  
Sbjct  4    SSYCQGLQSCLEPARLAEPRVLRLKL---APPEYNTSRSSPAHSSNHVVPESVGDSKSNN  60

Query  327  LINGDLGSGWSFIQALGSPERNQTAGKE----AEEEVYVHPMVKRSASTLSTKSLEMCTE  160
              N D+G GWSF+Q L        A KE     + +VY+ P  KRS+S L+ KSLEMCTE
Sbjct  61   NDNVDMG-GWSFLQFLAIDNSTSQAKKEDVTEKDNKVYIPPNFKRSSSMLNEKSLEMCTE  119

Query  159  SLGSETGSDISESVEEFSSL  100
            SLGSETGSD SES +E + L
Sbjct  120  SLGSETGSDGSESSDEMALL  139



>ref|XP_004247322.1| PREDICTED: protein FANTASTIC FOUR 3-like [Solanum lycopersicum]
Length=246

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 9/105 (9%)
 Frame = -2

Query  411  PSCLEPRILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEE  232
            P+  +P  L  K +  +  +EI  E     N ++G G SFIQAL +P +    G E ++E
Sbjct  6    PNFSQPITLPQKSKICQHEDEIEQE-----NDNVG-GLSFIQALANPCQYSKKGDE-KDE  58

Query  231  VYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLL  97
            +YVHP+VK   S+L+T SL MCTESLGSETGSDISE+++E  ++ 
Sbjct  59   IYVHPLVK--LSSLNTNSLNMCTESLGSETGSDISENIDEKETIF  101



>ref|XP_010090398.1| hypothetical protein L484_025063 [Morus notabilis]
 gb|EXB39368.1| hypothetical protein L484_025063 [Morus notabilis]
Length=299

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 72/136 (53%), Gaps = 38/136 (28%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP-----RILVHKMESTKP---------PEEISAETKELIN-------  319
            ++S+C GL SCLEP     R+L  K+    P         PE+   +  +  N       
Sbjct  2    STSICQGLQSCLEPGLVEPRVLRLKLALPNPNLPRWNNSKPEQQQQQENDNTNEFHEVKK  61

Query  318  ---------GDLGSGWSFIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEM  169
                      D+ +G SF+QAL       TA  + E E VYVHPMVKRSAS LS KSLEM
Sbjct  62   KIKKDKNDDDDMKNGMSFLQAL-------TAKNDTETENVYVHPMVKRSASKLSAKSLEM  114

Query  168  CTESLGSETGSDISES  121
            CTE+LGSETGSD  +S
Sbjct  115  CTENLGSETGSDTGDS  130



>gb|KDP21465.1| hypothetical protein JCGZ_21936 [Jatropha curcas]
Length=287

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 66/124 (53%), Gaps = 22/124 (18%)
 Frame = -2

Query  417  GLPSCLEPRILVHKME---STKPPEEISAET-------------KELING--DLGSGWSF  292
            GL SCLEP  LV          PP+ I + T             K   N   D+G GWSF
Sbjct  8    GLQSCLEPARLVEPCVLRLKLAPPKSIVSRTSSSPVGNSFDYDSKNTTNNTVDMG-GWSF  66

Query  291  IQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +Q L    +N +   +  E++Y+ P  KRSA  LS KSLEMCTESLGSETGSD  ES +E
Sbjct  67   LQNLA---KNTSESNKGTEKIYIPPNCKRSACKLSEKSLEMCTESLGSETGSDGGESSDE  123

Query  111  FSSL  100
             + L
Sbjct  124  MALL  127



>ref|XP_008345179.1| PREDICTED: protein FANTASTIC FOUR 1-like [Malus domestica]
 ref|XP_008363676.1| PREDICTED: protein FANTASTIC FOUR 1-like [Malus domestica]
Length=353

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 83/144 (58%), Gaps = 30/144 (21%)
 Frame = -2

Query  444  MSKTSS-VC-VGLPSCLEPRILVHKMESTKPP--------EEISAETKELINGDLG----  307
            MS TSS VC  GL SCLEP +L        PP        +E +++ +++ N +L     
Sbjct  1    MSSTSSTVCHPGLKSCLEPLVL----PKLNPPGLTFLSQSQEKASQIEKIDNLNLNNKKD  56

Query  306  ------SGWSFIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEMCTESLGS  148
                  +GWSF+Q+L +P   Q    E+E E+VYVHP+ KRSAS LS  SLEMCTESLG+
Sbjct  57   KKEVEVAGWSFLQSLANP--IQPXKSESEXEKVYVHPLAKRSASALSPGSLEMCTESLGN  114

Query  147  ETGSDISESVEEFSSLLPEKENSP  76
            ETG   SE+  E  SLL  K  SP
Sbjct  115  ETG---SENGGEKLSLLLHKIESP  135



>ref|XP_011032789.1| PREDICTED: protein FANTASTIC FOUR 2 [Populus euphratica]
Length=291

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 16/130 (12%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP------RILVHKMESTKPPEEISAET-KELIN-----GDLGSGWSF  292
            +SS C GL SCLEP      R+L  K+  +K  +  S+ + K  +       D+G GWSF
Sbjct  3    SSSSCPGLQSCLEPVSLVEPRVLRIKLAPSKSNDSRSSTSGKPFVTDSDKIADMG-GWSF  61

Query  291  IQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +Q++ +     T   +  ++VYV P  KRS+S LS KSLEMCTESLGSETGS++ E+ ++
Sbjct  62   LQSIANSTSQTT---KENDKVYVPPNFKRSSSMLSEKSLEMCTESLGSETGSEMRENSDD  118

Query  111  FSSLLPEKEN  82
             + L  E  N
Sbjct  119  VAVLPLENVN  128



>ref|XP_006575073.1| PREDICTED: protein FANTASTIC FOUR 2-like [Glycine max]
 gb|KHN18883.1| Protein FANTASTIC FOUR 2 [Glycine soja]
Length=280

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 72/130 (55%), Gaps = 25/130 (19%)
 Frame = -2

Query  432  SSVCVGL-----PSCLEPRILVHKMES-------------TKPPEEISAETKELINGDLG  307
            SS+C GL     P  +EPR+L  K+               T PP   + E     + + G
Sbjct  4    SSICQGLQSSVEPWLMEPRVLKLKLAPPGSNSNTSTHSPVTPPPNNTNNEHGNKNHSEQG  63

Query  306  --SGWSFIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
              + WSF+Q+L     N +  KE + E VYVHP VKRS+S LS KSLE+CTESLG ETGS
Sbjct  64   GCNNWSFLQSLS----NISHCKEPQTENVYVHPSVKRSSSMLSAKSLELCTESLGCETGS  119

Query  135  DISESVEEFS  106
            + S++ ++ S
Sbjct  120  NASDNSDDLS  129



>ref|XP_007144633.1| hypothetical protein PHAVU_007G171900g [Phaseolus vulgaris]
 gb|ESW16627.1| hypothetical protein PHAVU_007G171900g [Phaseolus vulgaris]
Length=294

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 73/131 (56%), Gaps = 26/131 (20%)
 Frame = -2

Query  432  SSVCVGL-----PSCLEPRILVHKM------ESTKPPEEISAETKELI----NGDLGS--  304
            SSVC GL     P  LEPR+L  K+       +  PP +  + T E      +G+  S  
Sbjct  4    SSVCQGLQSSVEPCLLEPRVLKLKLAPPGSNSNHSPPSQCPSNTLEHTPSHEHGNKSSEP  63

Query  303  ----GWSFIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
                 WSF+Q+L     N +  K  E E+VYVHP VKRS+S LS KSLE+CTESLG ETG
Sbjct  64   VGCNNWSFLQSLS----NISHCKNPETEKVYVHPSVKRSSSMLSAKSLELCTESLGCETG  119

Query  138  SDISESVEEFS  106
            S+ S+  ++ S
Sbjct  120  SNASDDTDDMS  130



>emb|CAN75990.1| hypothetical protein VITISV_012195 [Vitis vinifera]
Length=411

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 6/67 (9%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTAGKEAEEEV--YVHPMVKRSASTLSTKSLEMCTESLGSET  142
            DLG GWSFI AL +  + Q   KEA E+   YVHP+VKRSASTLS KSLEMCTE LGSET
Sbjct  140  DLG-GWSFIHALSNGSQGQ---KEAMEKQCSYVHPLVKRSASTLSDKSLEMCTEDLGSET  195

Query  141  GSDISES  121
            G+ + E+
Sbjct  196  GTHVVEN  202



>emb|CBI26596.3| unnamed protein product [Vitis vinifera]
Length=422

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 69/125 (55%), Gaps = 21/125 (17%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRILVHKMESTK--PPEEISAETKEL------------INGDLGSGW  298
            +SSVC GL SCLEP I+  +    K  PP+   +E+                NG LG GW
Sbjct  116  SSSVCQGLQSCLEPLIIEPRASKLKLAPPKPNFSESFRFSKGVDDVDLEGHKNGKLG-GW  174

Query  297  SFIQALGSPERNQTAGKEA--EEEVYVHPMVKRSAS-TLSTKSLEMCTESLGSETGSDIS  127
             FIQAL          KEA   E+ YVHP++K S S  L+ K LEMCTESLGSETGS  S
Sbjct  175  DFIQAL---TNTSNTYKEAFDNEKAYVHPLMKSSTSMILNQKGLEMCTESLGSETGSYTS  231

Query  126  ESVEE  112
            +S +E
Sbjct  232  KSNDE  236



>emb|CBI26209.3| unnamed protein product [Vitis vinifera]
Length=380

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 6/67 (9%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTAGKEAEEEV--YVHPMVKRSASTLSTKSLEMCTESLGSET  142
            DLG GWSFI AL +  + Q   KEA E+   YVHP+VKRSASTLS KSLEMCTE LGSET
Sbjct  130  DLG-GWSFIHALSNGSQGQ---KEAMEKQCSYVHPLVKRSASTLSDKSLEMCTEDLGSET  185

Query  141  GSDISES  121
            G+ + E+
Sbjct  186  GTHVVEN  192



>ref|XP_002277799.3| PREDICTED: protein FANTASTIC FOUR 3-like [Vitis vinifera]
Length=399

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 6/67 (9%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTAGKEAEEEV--YVHPMVKRSASTLSTKSLEMCTESLGSET  142
            DLG GWSFI AL +  + Q   KEA E+   YVHP+VKRSASTLS KSLEMCTE LGSET
Sbjct  130  DLG-GWSFIHALSNGSQGQ---KEAMEKQCSYVHPLVKRSASTLSDKSLEMCTEDLGSET  185

Query  141  GSDISES  121
            G+ + E+
Sbjct  186  GTHVVEN  192



>ref|XP_007162422.1| hypothetical protein PHAVU_001G150800g [Phaseolus vulgaris]
 gb|ESW34416.1| hypothetical protein PHAVU_001G150800g [Phaseolus vulgaris]
Length=323

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -2

Query  309  GSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            GSGWS +Q    P ++     + EE VYVHP VKRS+S LS KSLEMCTESLGSETGS+ 
Sbjct  79   GSGWSVLQI---PSQSTDCHNKTEESVYVHPTVKRSSSFLSEKSLEMCTESLGSETGSNA  135

Query  129  SESVEEFS  106
             +S ++ S
Sbjct  136  GDSTDDIS  143



>gb|KDO68746.1| hypothetical protein CISIN_1g048327mg [Citrus sinensis]
Length=289

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 11/103 (11%)
 Frame = -2

Query  432  SSVCVGLPSCLEPRILVHKM----ESTKPPEEISAETKELINGDLGSGWSFIQALGSPER  265
            S +C  +P+  EPR   +K     E+     + S + K   + D G GWSF+Q L     
Sbjct  33   SIICPSIPASSEPRNKENKTNTIRETNNKNNDFSDDMKSDKSEDTG-GWSFLQCLSK---  88

Query  264  NQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
             +TA    +E  YVHP+VKRSAS LS KSLEMCTESLGSETGS
Sbjct  89   -ETAAAHKKE--YVHPLVKRSASMLSEKSLEMCTESLGSETGS  128



>ref|XP_006444080.1| hypothetical protein CICLE_v10021186mg [Citrus clementina]
 ref|XP_006479728.1| PREDICTED: protein FANTASTIC FOUR 1-like [Citrus sinensis]
 gb|ESR57320.1| hypothetical protein CICLE_v10021186mg [Citrus clementina]
Length=321

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 11/103 (11%)
 Frame = -2

Query  432  SSVCVGLPSCLEPRILVHKM----ESTKPPEEISAETKELINGDLGSGWSFIQALGSPER  265
            S +C  +P+  EPR   +K     E+     + S + K   + D G GWSF+Q L     
Sbjct  33   SIICPSIPASSEPRNKENKTNTIRETNNKNNDFSDDMKSDKSEDTG-GWSFLQCLSK---  88

Query  264  NQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
             +TA    +E  YVHP+VKRSAS LS KSLEMCTESLGSETGS
Sbjct  89   -ETAAAHKKE--YVHPLVKRSASMLSEKSLEMCTESLGSETGS  128



>emb|CAJ34820.1| hypothetical protein 12 [Plantago major]
Length=219

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISES  121
            W+FI    + + N       E++VYVHP+ KRS+  LS KSLEMCTESLG ETGS I+ +
Sbjct  10   WNFITNCPAKQSNN-----PEQQVYVHPLDKRSSCPLSPKSLEMCTESLGCETGSGIALT  64

Query  120  VEEFSSLLPEKE  85
            ++EF+SL  +K+
Sbjct  65   IDEFTSLSLQKQ  76



>ref|XP_004240642.1| PREDICTED: protein FANTASTIC FOUR 3-like [Solanum lycopersicum]
Length=201

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 2/65 (3%)
 Frame = -2

Query  300  WSFIQALGSPE--RNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDIS  127
            WSFIQ L +P    +Q   K+ + +VY+HP  K S+  +STKSLEMCTESLG+ETG   +
Sbjct  11   WSFIQILNNPSTYHHQIDYKKDDNDVYIHPSTKLSSLVMSTKSLEMCTESLGNETGCYFN  70

Query  126  ESVEE  112
            ES+EE
Sbjct  71   ESMEE  75



>ref|XP_008235278.1| PREDICTED: protein FANTASTIC FOUR 1-like [Prunus mume]
Length=379

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            GW+F+Q+LG+ +   T  +   E+VYVHP+VKRSA  LS KSLEMCTESLGSETGS+
Sbjct  76   GWNFLQSLGNQKNQTTKTETETEKVYVHPLVKRSALMLSPKSLEMCTESLGSETGSE  132



>ref|XP_002312517.1| hypothetical protein POPTR_0008s14890g [Populus trichocarpa]
 gb|EEE89884.1| hypothetical protein POPTR_0008s14890g [Populus trichocarpa]
Length=326

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 72/139 (52%), Gaps = 46/139 (33%)
 Frame = -2

Query  426  VCVGLPSCLEP-----RILVHKMESTKP-----------PEEISAETKELI---------  322
            VC GL SCLE      R L  ++ S  P           P  ++++TKE+          
Sbjct  5    VCQGLQSCLESPIVESRTLRLRLSSPNPNFSQSLELALKPFLLNSDTKEVSDKSHYEETS  64

Query  321  -------------NGDLGSGWSFIQALG-SPERNQTAGKEA--EEEVYVHPMVKRSASTL  190
                         N DLG GWSF+QAL  SPE      KE+  +E +YVHP+  RS+S L
Sbjct  65   HKSSFLHDKHTSSNPDLG-GWSFLQALSTSPE----GPKESMEKENIYVHPLFNRSSSVL  119

Query  189  STKSLEMCTESLGSETGSD  133
            S KSLE+CTE+LGSE+GSD
Sbjct  120  SEKSLELCTENLGSESGSD  138



>ref|XP_007199877.1| hypothetical protein PRUPE_ppa007155mg [Prunus persica]
 gb|EMJ01076.1| hypothetical protein PRUPE_ppa007155mg [Prunus persica]
Length=379

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            G SF+Q+LG+P+   T  +   E+VYVHP+VKRSA  LS KSLEMCTESLGSETGS+
Sbjct  76   GLSFLQSLGNPKNQTTKTETETEKVYVHPLVKRSALMLSPKSLEMCTESLGSETGSE  132



>ref|XP_010256213.1| PREDICTED: protein FANTASTIC FOUR 1 [Nelumbo nucifera]
Length=340

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            NGDLG+ WSFIQ L +  +      +  +  YV P++ RS+STL+ KSLE+CTE+LGSET
Sbjct  81   NGDLGN-WSFIQILSNTSQGPDQEAKDRDSHYVPPLIMRSSSTLNEKSLELCTENLGSET  139

Query  141  GSDISE  124
            G+DI+E
Sbjct  140  GTDITE  145



>ref|XP_010093987.1| hypothetical protein L484_007333 [Morus notabilis]
 gb|EXB55002.1| hypothetical protein L484_007333 [Morus notabilis]
Length=338

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 7/62 (11%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DIS  127
            GWSF+Q+L       TA  E E+  YVHP+VKRS+S LS KSLE+CTE+LG+ETGS D+ 
Sbjct  97   GWSFLQSL------PTAKSEKEKATYVHPLVKRSSSALSQKSLELCTENLGNETGSCDVI  150

Query  126  ES  121
            ES
Sbjct  151  ES  152



>ref|XP_002517200.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45363.1| conserved hypothetical protein [Ricinus communis]
Length=281

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 66/130 (51%), Gaps = 38/130 (29%)
 Frame = -2

Query  426  VCVGLPSCLEP-----RILVHKMESTKP-----------PEEISAETKELI---------  322
            VC GL SCLE      R L  ++ S KP           P  +   TKE+          
Sbjct  5    VCQGLQSCLESQLVESRTLRLRLSSPKPHFSQSLELALKPCPLDCNTKEVRERRHHDEDK  64

Query  321  --------NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMC  166
                      D+G GWSF+QAL     N +     +E VYVHP++KR++S LS KSLE+C
Sbjct  65   QTSSSSFQKPDMG-GWSFLQALP----NTSKESMEKENVYVHPLIKRNSSMLSEKSLELC  119

Query  165  TESLGSETGS  136
            TE+LGSE+G+
Sbjct  120  TENLGSESGT  129



>ref|XP_006355849.1| PREDICTED: protein FANTASTIC FOUR 3-like [Solanum tuberosum]
Length=211

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = -2

Query  306  SGWSFIQALGSPE--RNQTAGKEAEEE-VYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
            S WSFIQ L +P    +Q   KE + + VY+HP  K S+  +STKSLEMCTESLG+ETG 
Sbjct  9    SSWSFIQILNNPSTYHHQLDYKEDDNDNVYIHPSTKLSSLVMSTKSLEMCTESLGNETGC  68

Query  135  DISESVEE  112
              +ES+EE
Sbjct  69   YFNESMEE  76



>gb|KDP40138.1| hypothetical protein JCGZ_02136 [Jatropha curcas]
Length=336

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 66/127 (52%), Gaps = 27/127 (21%)
 Frame = -2

Query  426  VCVGLPSCLEP-----RILVHKMESTKPPEEISAE-----------TKEL---------I  322
            V  GL SCLE      R L  ++ S KP    S E           TKEL          
Sbjct  5    VYQGLQSCLESQLVESRTLRLRLSSPKPQFYESLELALKTCSLESNTKELSEKRHEEEKH  64

Query  321  NGDLGSGWSFIQALGSPERNQTAG-KEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSE  145
              D+G GWSF+Q L     ++     E E+  YVHP++KR  STLS KSLE+CTE+LGSE
Sbjct  65   KSDMG-GWSFLQVLSDTSVSKKEPLMEKEKNTYVHPLMKRYPSTLSEKSLELCTENLGSE  123

Query  144  TGSDISE  124
            +G+DI +
Sbjct  124  SGTDIVD  130



>emb|CAN84026.1| hypothetical protein VITISV_042565 [Vitis vinifera]
Length=335

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 70/150 (47%), Gaps = 48/150 (32%)
 Frame = -2

Query  429  SVCVGLPSCLEPRILVHKMESTK--PPEEISAETKEL-----------------------  325
            S C GL SCLEP I+  +    K  PP+   +E+  L                       
Sbjct  4    SACQGLQSCLEPLIIEPRASKLKLAPPKPNFSESFRLSPRHCLPYSDLQKPEEQPVNEEN  63

Query  324  ----------------INGDLGSGWSFIQALGSPERNQTAGKEA--EEEVYVHPMVKRSA  199
                             NG LG GW FIQAL +  +     KEA   E+ YVHP++KRS 
Sbjct  64   NNRSSKGVDDVDLEGHKNGKLG-GWDFIQALTNTSKTY---KEAFDNEKAYVHPLMKRST  119

Query  198  S-TLSTKSLEMCTESLGSETGSDISESVEE  112
            S  L+ K LEMCTESLGSETGS  S+S +E
Sbjct  120  SMILNQKGLEMCTESLGSETGSYTSKSNDE  149



>gb|KHN45355.1| Protein FANTASTIC FOUR 3, partial [Glycine soja]
Length=245

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  246  EAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFS  106
            + E++VYVHP VKRS+S LS KSLEMCTESLGSETGS+ SE+ ++ S
Sbjct  9    KTEDQVYVHPTVKRSSSILSEKSLEMCTESLGSETGSNASENGDDMS  55



>ref|XP_009338457.1| PREDICTED: protein FANTASTIC FOUR 1-like isoform X2 [Pyrus x 
bretschneideri]
 ref|XP_009338458.1| PREDICTED: protein FANTASTIC FOUR 1-like isoform X3 [Pyrus x 
bretschneideri]
Length=344

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 70/148 (47%), Gaps = 33/148 (22%)
 Frame = -2

Query  426  VCVGLPSCLE------PRILVHKME-------STKPPEEISAE---------TKELING-  316
            VC GL SCLE      PR L  K         S  P +E+  +           E IN  
Sbjct  5    VCQGLQSCLESHHLVEPRTLRLKFSAPVAHHISPIPTQELGIKGCFSEEKCNNYEEINNN  64

Query  315  -------DLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST--LSTKSLEMCT  163
                   DL  GWSF+QA+  P       +  EE  Y  P V RS+S   L+ KSLEMCT
Sbjct  65   KATSEKSDLVGGWSFLQAISKPSLENPTAEVDEENNYTPPRVYRSSSVTKLNEKSLEMCT  124

Query  162  ESLGSETGSDISESVEEFSSLLPEKENS  79
            E LG ETG+ I+ES   FS  +PE E++
Sbjct  125  EDLGCETGAIITESFSIFSP-MPESESN  151



>ref|XP_006419861.1| hypothetical protein CICLE_v10005417mg [Citrus clementina]
 gb|ESR33101.1| hypothetical protein CICLE_v10005417mg [Citrus clementina]
Length=326

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 59/118 (50%), Gaps = 19/118 (16%)
 Frame = -2

Query  426  VCVGLPS--------CLEPRILVHKM-----------ESTKPPEEISAETKELINGDLGS  304
            VC GL S         LEPR +  K+           +     ++IS+ T    +     
Sbjct  5    VCQGLQSRLESHQLQVLEPRTISLKLSCFVDEKRFHSDDDDDEKQISSATAAADDSSSLH  64

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
             WSF+QA+ +      A  +     YVHPM  RS STLS KSLE+CTE+LGSETG+DI
Sbjct  65   CWSFLQAISNNGSKLEATNKETTSTYVHPMDNRSKSTLSEKSLELCTENLGSETGTDI  122



>ref|XP_009338456.1| PREDICTED: protein FANTASTIC FOUR 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=354

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 70/148 (47%), Gaps = 33/148 (22%)
 Frame = -2

Query  426  VCVGLPSCLE------PRILVHKME-------STKPPEEISAE---------TKELING-  316
            VC GL SCLE      PR L  K         S  P +E+  +           E IN  
Sbjct  5    VCQGLQSCLESHHLVEPRTLRLKFSAPVAHHISPIPTQELGIKGCFSEEKCNNYEEINNN  64

Query  315  -------DLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST--LSTKSLEMCT  163
                   DL  GWSF+QA+  P       +  EE  Y  P V RS+S   L+ KSLEMCT
Sbjct  65   KATSEKSDLVGGWSFLQAISKPSLENPTAEVDEENNYTPPRVYRSSSVTKLNEKSLEMCT  124

Query  162  ESLGSETGSDISESVEEFSSLLPEKENS  79
            E LG ETG+ I+ES   FS  +PE E++
Sbjct  125  EDLGCETGAIITESFSIFSP-MPESESN  151



>ref|XP_009364264.1| PREDICTED: protein FANTASTIC FOUR 1-like [Pyrus x bretschneideri]
Length=355

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 61/133 (46%), Gaps = 24/133 (18%)
 Frame = -2

Query  426  VCVGLPSCLE------PRIL--------VHKMESTKPPE--------EISAETKELINGD  313
            VC GL SCLE      PR L         H      P E        E      E IN +
Sbjct  5    VCQGLQSCLESPHLVEPRTLRLKLSAPVAHHFSPITPQELGIKACFSEEKCNNYEEINSN  64

Query  312  LGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST--LSTKSLEMCTESLGSETG  139
              + WSF+QA+  P       +  +E  Y  P V RS+S   L+ KSLE+CTE LG ETG
Sbjct  65   KATSWSFLQAISKPSLENPTAEVDKENTYTPPRVYRSSSVTKLNEKSLELCTEDLGCETG  124

Query  138  SDISESVEEFSSL  100
            + I+ES   FS +
Sbjct  125  AIITESFSIFSPM  137



>ref|XP_010662167.1| PREDICTED: protein FANTASTIC FOUR 1-like [Vitis vinifera]
Length=335

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 70/152 (46%), Gaps = 48/152 (32%)
 Frame = -2

Query  435  TSSVCVGLPSCLEPRILVHKMESTK--PPEEISAETKEL---------------------  325
            +SSVC GL SCLEP I+  +    K  PP+   +E+  L                     
Sbjct  2    SSSVCQGLQSCLEPLIIEPRASKLKLAPPKPNFSESFRLSPRHCLPCSDLRKPEEQPVNE  61

Query  324  ------------------INGDLGSGWSFIQALGSPERNQTAGKEA--EEEVYVHPMVKR  205
                               NG LG GW FIQAL          KEA   E+ YVHP++K 
Sbjct  62   ENNNRSSKGVDDVDLEGHKNGKLG-GWDFIQAL---TNTSNTYKEAFDNEKAYVHPLMKS  117

Query  204  SAS-TLSTKSLEMCTESLGSETGSDISESVEE  112
            S S  L+ K LEMCTESLGSETGS  S+S +E
Sbjct  118  STSMILNQKGLEMCTESLGSETGSYTSKSNDE  149



>ref|XP_011026040.1| PREDICTED: protein FANTASTIC FOUR 3-like [Populus euphratica]
Length=326

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 71/139 (51%), Gaps = 46/139 (33%)
 Frame = -2

Query  426  VCVGLPSCLEP-----RILVHKMESTKP----PEEIS-------AETKELING-------  316
            VC GL SCLE      R L  ++ S  P    P E++       ++TKE+ +        
Sbjct  5    VCQGLQSCLESPIVESRTLRLRLSSPNPNFSQPLELALKSFLLDSDTKEVSDKSHYEETS  64

Query  315  ---------------DLGSGWSFIQALG-SPERNQTAGKEA--EEEVYVHPMVKRSASTL  190
                           DLG GWSF+Q L  SPE      KE+  +E +Y HP+  RS+S L
Sbjct  65   HKSSFLHDKHTSAKPDLG-GWSFLQVLSTSPE----GPKESMEKENIYAHPLFNRSSSVL  119

Query  189  STKSLEMCTESLGSETGSD  133
            S KSLE+CTESLGSE+GSD
Sbjct  120  SEKSLELCTESLGSESGSD  138



>ref|XP_006418259.1| hypothetical protein EUTSA_v10008552mg [Eutrema salsugineum]
 gb|ESQ36612.1| hypothetical protein EUTSA_v10008552mg [Eutrema salsugineum]
Length=253

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 9/82 (11%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTAG-KEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            GD+G G SF+Q++     + TA  +  E++ YVHP+ KRS S L+ KSLEMCTESLG+ET
Sbjct  21   GDMG-GLSFLQSMS----DITATVRNREDKAYVHPIEKRSVSKLNEKSLEMCTESLGTET  75

Query  141  GSDISESVEEFSSLLPEKENSP  76
            G   SES +E S L  E  N+P
Sbjct  76   G---SESGDELSFLAFEVTNTP  94



>ref|XP_006489332.1| PREDICTED: protein FANTASTIC FOUR 3-like [Citrus sinensis]
Length=325

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 58/117 (50%), Gaps = 18/117 (15%)
 Frame = -2

Query  426  VCVGLPS--------CLEPRILVHKME----------STKPPEEISAETKELINGDLGSG  301
            VC GL S         LEPR +  K+                ++IS+ T    +      
Sbjct  5    VCQGLQSRLESHQLQVLEPRTISLKLSCFVDEKRFHSDDDDEKQISSATAAADDSSSLHC  64

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            WSF+QA+ +      A  +     YVHPM  RS STLS KSLE+CTE+LGSETG+DI
Sbjct  65   WSFLQAISNNGSKLEATNKETTSTYVHPMDNRSKSTLSEKSLELCTENLGSETGTDI  121



>gb|KDO74737.1| hypothetical protein CISIN_1g020519mg [Citrus sinensis]
Length=325

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 58/117 (50%), Gaps = 18/117 (15%)
 Frame = -2

Query  426  VCVGLPS--------CLEPRILVHKME----------STKPPEEISAETKELINGDLGSG  301
            VC GL S         LEPR +  K+                ++IS+ T    +      
Sbjct  5    VCQGLQSRLESHQLQVLEPRTISLKLSCFVDEKRFHSDDDDEKQISSATAAADDSSSLHC  64

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            WSF+QA+ +      A  +     YVHPM  RS STLS KSLE+CTE+LGSETG+DI
Sbjct  65   WSFLQAISNNGSKLEATNKETTSTYVHPMDNRSKSTLSEKSLELCTENLGSETGTDI  121



>emb|CDY18155.1| BnaC05g01780D [Brassica napus]
Length=243

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            GD+G G SF+Q++       +  +  E++ YVHP+VKRS S L+ KSLEMCTESLG+ETG
Sbjct  21   GDMG-GLSFLQSMSDI---TSIVRTREDKAYVHPIVKRSVSQLNEKSLEMCTESLGAETG  76

Query  138  SD  133
            S+
Sbjct  77   SE  78



>ref|XP_008390964.1| PREDICTED: protein FANTASTIC FOUR 1-like [Malus domestica]
Length=353

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 66/147 (45%), Gaps = 31/147 (21%)
 Frame = -2

Query  426  VCVGLPSCL------EPRIL--------VHKMESTKPPE--------EISAETKELINGD  313
            VC GL SCL      EPR L         H      P E        E      E IN +
Sbjct  5    VCQGLQSCLDSPHLVEPRTLRLKLSAPVAHHFSPITPQELGIKACFSEEKCNNYEEINSN  64

Query  312  LGS-------GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKR--SASTLSTKSLEMCTE  160
             G+       GWSF+QA+  P       +  +E  Y  P V R  SA+ L+ KSLE+CTE
Sbjct  65   KGTSKKSDMGGWSFLQAISKPSLENPTAEVDKENTYTPPRVYRNSSATKLNEKSLELCTE  124

Query  159  SLGSETGSDISESVEEFSSLLPEKENS  79
             LG ETG+ I+ES   FS +   + N+
Sbjct  125  DLGCETGAIITESFSIFSPMYESESNA  151



>emb|CDO99018.1| unnamed protein product [Coffea canephora]
Length=300

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  363  KPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEA--EEEVYVHPMVKR-SAST  193
            +P E  S  T  + +     GWSF+Q L   +   +A KE   +E VYVHP+ K+ S+S 
Sbjct  39   RPTEVNSTATPNMSSNHDSRGWSFLQFL---DNVSSAPKETMEKENVYVHPLTKQYSSSR  95

Query  192  LSTKSLEMCTESLGSETGSDISE  124
            LS KSLE+CTE+LGSETGSDI +
Sbjct  96   LSEKSLELCTENLGSETGSDIMD  118



>ref|XP_002314717.1| hypothetical protein POPTR_0010s10190g [Populus trichocarpa]
 gb|EEF00888.1| hypothetical protein POPTR_0010s10190g [Populus trichocarpa]
Length=330

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 10/70 (14%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGS----PERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESL  154
            N DLG G SF+QAL +    P+ +   G      +YVHP++ RS+S LS KSLE+CTESL
Sbjct  78   NPDLG-GSSFLQALSTSTEGPKESMGKGN-----IYVHPLINRSSSMLSGKSLELCTESL  131

Query  153  GSETGSDISE  124
            GSE+GSD+ E
Sbjct  132  GSESGSDMIE  141



>ref|XP_011021579.1| PREDICTED: protein FANTASTIC FOUR 3 [Populus euphratica]
Length=330

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 10/70 (14%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGS----PERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESL  154
            N DLG G SF+Q L +    P+ +   G      +YVHP++ RS+S LS KSLE+CTESL
Sbjct  78   NPDLG-GLSFLQVLSTSTEGPKESMGKGN-----IYVHPLINRSSSMLSGKSLELCTESL  131

Query  153  GSETGSDISE  124
            GSE+GSD+ E
Sbjct  132  GSESGSDMIE  141



>ref|XP_002889441.1| hypothetical protein ARALYDRAFT_887469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65700.1| hypothetical protein ARALYDRAFT_887469 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 8/97 (8%)
 Frame = -2

Query  363  KPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEE-VYVHPMVKRSASTLS  187
            +P + I  + +     D   G SF+Q++     + TA  + +E+  YVHPM KRS S L+
Sbjct  7    QPQDNIVPKNQSFYQKDDMGGLSFLQSMS----DITAIVQTKEDKAYVHPMEKRSVSKLN  62

Query  186  TKSLEMCTESLGSETGSDISESVEEFSSLLPEKENSP  76
             KSLEMCTESLG+ETG   SES +E S L  E   +P
Sbjct  63   EKSLEMCTESLGTETG---SESGDELSLLAFEAATTP  96



>ref|XP_003592472.1| hypothetical protein MTR_1g105360 [Medicago truncatula]
 gb|AES62723.1| fantastic four-like protein [Medicago truncatula]
Length=336

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
            GW+F+  L +     T  KE     YVHP  KRS+  +S KSLE+CTE+LG+E+G+DI E
Sbjct  78   GWNFLDGLSNNIYQNTWKKETTTTTYVHPQQKRSSLAMSPKSLELCTENLGNESGTDIVE  137

Query  123  SVEEFSSL  100
            +    SS+
Sbjct  138  NDMLLSSM  145



>gb|EYU25966.1| hypothetical protein MIMGU_mgv1a021532mg [Erythranthe guttata]
Length=332

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 4/49 (8%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDI----SESVEEFSSLLP  94
            YVHP+VKRSASTLS KSLE+CTESLGSETGSD     +E  E+   +LP
Sbjct  139  YVHPLVKRSASTLSEKSLEICTESLGSETGSDCFSAETEDQEKLVVMLP  187



>gb|AFK46160.1| unknown [Lotus japonicus]
Length=100

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            GWSF+QAL  P  +    KE +++VYVHP VKRS+S LS KSLEMCTESLGSETG
Sbjct  5    GWSFLQALTKPT-SSNCNKEEDDKVYVHPTVKRSSSLLSEKSLEMCTESLGSETG  58



>gb|EYU20532.1| hypothetical protein MIMGU_mgv1a026483mg [Erythranthe guttata]
Length=267

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 12/80 (15%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            G+   GW F+QA   P  N T        VYVHP+ K S S +ST+SLEMCTE+LGSETG
Sbjct  61   GNNNGGWDFLQAPEKPTTNDT--------VYVHPLTK-SYSWMSTRSLEMCTETLGSETG  111

Query  138  SDISESVEEFSSLLPEKENS  79
            + I   ++E + L  EK +S
Sbjct  112  THI---MDEITYLAMEKRSS  128



>ref|NP_563678.1| protein FANTASTIC FOUR 2 [Arabidopsis thaliana]
 sp|Q8GXU9.1|FAF2_ARATH RecName: Full=Protein FANTASTIC FOUR 2 [Arabidopsis thaliana]
 dbj|BAC42659.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27539.1| protein FANTASTIC FOUR 2 [Arabidopsis thaliana]
Length=240

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
            D+G G SF+Q++       +  +  E++ YVHPM KRS S L+ KSLEMCTESLG+ETG 
Sbjct  19   DMG-GLSFLQSMSD---ITSIAQTKEDKAYVHPMEKRSVSKLNEKSLEMCTESLGTETG-  73

Query  135  DISESVEEFSSLLPEKENSP  76
              SES +E S L  E   +P
Sbjct  74   --SESGDELSLLAFEATTTP  91



>ref|XP_009607604.1| PREDICTED: protein FANTASTIC FOUR 3 [Nicotiana tomentosiformis]
Length=230

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 9/89 (10%)
 Frame = -2

Query  360  PPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST-LST  184
            PP+E+  E +++      S WSF+Q L +    Q    + +EEVY+H   K S+S+ ++T
Sbjct  3    PPQELVEENEDV------SNWSFMQMLNNSSSYQKNRSDTKEEVYIHLSTKLSSSSIMNT  56

Query  183  KSLEMCTESLGSETGSD-ISES-VEEFSS  103
             SLEMCTE LGSETGS  ISES ++EF S
Sbjct  57   GSLEMCTEILGSETGSIYISESNMDEFIS  85



>ref|XP_008801051.1| PREDICTED: LOW QUALITY PROTEIN: protein FAF-like, chloroplastic 
[Phoenix dactylifera]
Length=461

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 10/68 (15%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISES  121
            WS IQ+   P+   TAG  A    YVHP+V+RS+S +S KSLE+CTESLGSETGS     
Sbjct  62   WSSIQS-QKPKEAATAGPPAP---YVHPLVRRSSSLMSQKSLEICTESLGSETGS-----  112

Query  120  VEEFSSLL  97
              +FSSLL
Sbjct  113  -ADFSSLL  119



>ref|XP_009786867.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana sylvestris]
Length=333

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 10/69 (14%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSA--STLSTKSLEMCTESLGS  148
            N DLG GWS IQ L +  +        E  +YVHP+ KRS+  S LS KSLE+CTESLGS
Sbjct  67   NLDLGGGWSSIQTLSNISK-------EEGSIYVHPLSKRSSYSSRLSAKSLELCTESLGS  119

Query  147  ETGS-DISE  124
            ETGS DI +
Sbjct  120  ETGSCDIMD  128



>ref|XP_009111163.1| PREDICTED: protein FANTASTIC FOUR 2-like [Brassica rapa]
Length=244

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            G +G G SF+Q++  P+      +  E++ YVHP+ KRS S LS KSLEMCTESLGSETG
Sbjct  26   GKMG-GLSFLQSM--PDITAIV-RNVEDKAYVHPVEKRSVSKLSEKSLEMCTESLGSETG  81

Query  138  SD  133
            S+
Sbjct  82   SE  83



>gb|KGN47898.1| hypothetical protein Csa_6G410040 [Cucumis sativus]
Length=260

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 69/129 (53%), Gaps = 27/129 (21%)
 Frame = -2

Query  432  SSVCVGLPSCLEPRIL-------------VHKMESTKPPEEISAETKELINGDLGSGWSF  292
            SSVC GL S +E  +L              +++   K  +E+ A +K   N +    WSF
Sbjct  3    SSVCQGLQSHVESHVLSLQLFPQEASYPTTNRVSQRKYEKEVEANSK---NDENIKMWSF  59

Query  291  IQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +Q L S       G + E+E+Y+      S + LS KSLEMCTESLGSE+GS++ E+   
Sbjct  60   LQPLSS-------GHQEEDEMYI----THSFTRLSKKSLEMCTESLGSESGSNMGENDIS  108

Query  111  FSSLLPEKE  85
             S+L+ +++
Sbjct  109  LSTLISDED  117



>gb|AAC72118.1| F15K9.22 [Arabidopsis thaliana]
 gb|AAM65050.1| unknown [Arabidopsis thaliana]
Length=221

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
            G SF+Q++       +  +  E++ YVHPM KRS S L+ KSLEMCTESLG+ETG   SE
Sbjct  3    GLSFLQSMSD---ITSIAQTKEDKAYVHPMEKRSVSKLNEKSLEMCTESLGTETG---SE  56

Query  123  SVEEFSSLLPEKENSP  76
            S +E S L  E   +P
Sbjct  57   SGDELSLLAFEATTTP  72



>ref|XP_009591870.1| PREDICTED: protein FANTASTIC FOUR 4-like [Nicotiana tomentosiformis]
Length=341

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 8/64 (13%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSA--STLSTKSLEMCTESLGS  148
            N DLG  WS IQ L +        KE    +YVHP+ KRS+  S LS KSLE+CTESLGS
Sbjct  66   NLDLGGSWSSIQTLSN------ISKEEGSNIYVHPLSKRSSYSSRLSAKSLELCTESLGS  119

Query  147  ETGS  136
            ETGS
Sbjct  120  ETGS  123



>emb|CDY15453.1| BnaA08g27370D [Brassica napus]
Length=216

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 5/58 (9%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTA-GKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            G SF+Q++     + TA  +  E++ YVHP+V+RS S LS KSLEMCTESLGSETGS+
Sbjct  3    GLSFLQSMS----DITAIVRNVEDKAYVHPVVERSVSKLSEKSLEMCTESLGSETGSE  56



>ref|XP_010667002.1| PREDICTED: protein FANTASTIC FOUR 1-like [Beta vulgaris subsp. 
vulgaris]
Length=312

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -2

Query  312  LGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            +  GWS I+AL  P ++ +     +E  YVHP+VKRS+  LS KSLEMCTES+G+E+G
Sbjct  43   ISGGWSAIEAL--PSKSDSYKTSKDEPPYVHPLVKRSSFMLSEKSLEMCTESIGNESG  98



>ref|XP_008449938.1| PREDICTED: protein FANTASTIC FOUR 3 [Cucumis melo]
Length=250

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST-LSTKSLEMCTESLGSETGSDIS  127
            GW+F+Q+L +    QT   + E  VYVHP+ KR   T LS KSL++CTE+LG+ETGSDI 
Sbjct  64   GWTFLQSLDA---GQTPVSKPES-VYVHPLAKRFNPTGLSDKSLKLCTENLGNETGSDII  119

Query  126  ES  121
            E+
Sbjct  120  EN  121



>emb|CDX89908.1| BnaA10g01740D [Brassica napus]
Length=237

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 4/62 (6%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            GD+G G SF+Q++       +  +  E++ YVHP  KRS S L+ KSLEMCTESLG+ETG
Sbjct  21   GDMG-GLSFLQSMSDI---TSIVRTREDKAYVHPTEKRSVSQLNEKSLEMCTESLGAETG  76

Query  138  SD  133
            S+
Sbjct  77   SE  78



>ref|XP_011044595.1| PREDICTED: protein FAF-like, chloroplastic [Populus euphratica]
Length=529

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSLE+CTESLGSETGSD
Sbjct  148  YVHPLVKRSASSLSEKSLEICTESLGSETGSD  179



>emb|CDX86688.1| BnaC08g00150D [Brassica napus]
Length=244

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTA-GKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            G +G G SF+Q++     + TA  +  E++ YVHP+ KRS S LS KSLEMCTESLGSET
Sbjct  26   GKMG-GLSFLQSMS----DITAIVRNVEDKAYVHPVEKRSVSKLSEKSLEMCTESLGSET  80

Query  141  GSD  133
            GS+
Sbjct  81   GSE  83



>ref|XP_007015661.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
 gb|EOY33280.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
Length=753

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRSAS+LS KSLE+CTESLGSETGSD
Sbjct  149  YIHPLVKRSASSLSEKSLEICTESLGSETGSD  180



>gb|KDP42960.1| hypothetical protein JCGZ_23902 [Jatropha curcas]
Length=510

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSLE+CTESLGSETGSD
Sbjct  139  YVHPLVKRSASSLSEKSLEICTESLGSETGSD  170



>ref|XP_010685446.1| PREDICTED: protein FAF-like, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 13/70 (19%)
 Frame = -2

Query  300  WSFIQA-------LGSPERNQTAGKEAEEEV------YVHPMVKRSASTLSTKSLEMCTE  160
            WS IQA       + SP +N      +E  +      YVHP+ KR+AS+LS KSLE+CTE
Sbjct  117  WSTIQADKRSWGAILSPPKNNDGCSGSESGLGLVPAPYVHPLAKRTASSLSEKSLEICTE  176

Query  159  SLGSETGSDI  130
            SLGSETGSD+
Sbjct  177  SLGSETGSDV  186



>emb|CDP15569.1| unnamed protein product [Coffea canephora]
Length=568

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSLE+CTESLGSETGSD
Sbjct  145  YVHPLVKRSASSLSEKSLEICTESLGSETGSD  176



>ref|XP_011008645.1| PREDICTED: protein FAF-like, chloroplastic [Populus euphratica]
Length=526

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -2

Query  252  GKEAEEEV--YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
             KE  E+V  YVHP+VKRSAS+LS KSLE+CTESLGSETG D
Sbjct  136  AKEDSEDVQPYVHPLVKRSASSLSEKSLEICTESLGSETGCD  177



>ref|XP_010247410.1| PREDICTED: protein FAF-like, chloroplastic [Nelumbo nucifera]
Length=532

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSLE+CTESLGSETGSD
Sbjct  154  YVHPLVKRSASSLSEKSLEICTESLGSETGSD  185



>ref|XP_009413641.1| PREDICTED: protein FAF-like, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=422

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = -2

Query  360  PPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTK  181
            PP E S++ +     D+   WS IQ+    ++   A  +     YVHP+V+RS S LS +
Sbjct  36   PPVEESSDDERPGQFDI---WSAIQS----QKVADAAPDQPAAPYVHPLVRRSPSLLSQR  88

Query  180  SLEMCTESLGSETGS-DISESVEEFSSLLP  94
            SLE+CTESLGSETGS D S S+E+     P
Sbjct  89   SLEICTESLGSETGSDDFSSSLEDLDYYYP  118



>gb|KEH43902.1| fantastic four-like protein [Medicago truncatula]
Length=325

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 68/129 (53%), Gaps = 6/129 (5%)
 Frame = -2

Query  429  SVCVGLPSCL-EPRILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQTA  253
            SV +   SCL +  I  H  E      E + + K   NG    GW+F+ AL +     T+
Sbjct  39   SVDLAFKSCLFDSNIKTHHHEENINKTE-TFQNKSNNNG----GWNFLDALSNNIAQNTS  93

Query  252  GKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEKENSPa  73
             KE     Y+ P  K S+  LS KSLE+CTE+LG+E+G+DI E+    SS+   ++  P 
Sbjct  94   KKETTTATYLPPQQKCSSLVLSPKSLELCTENLGNESGTDIVENDLLLSSMGTMEQRQPC  153

Query  72   aaaaaATEK  46
            +   AAT+K
Sbjct  154  SQVLAATKK  162



>gb|KGN48025.1| hypothetical protein Csa_6G425130 [Cucumis sativus]
Length=257

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST-LSTKSLEMCTESLGSETGSDIS  127
            GW+F+Q+L +   + T   + E  VYVHP+ KR   T LS KSL++CTE+LG+ETGSDI 
Sbjct  67   GWNFLQSLDA---DHTPVSKPES-VYVHPLAKRFNPTGLSDKSLKLCTENLGNETGSDII  122

Query  126  ES  121
            E+
Sbjct  123  EN  124



>ref|XP_002465519.1| hypothetical protein SORBIDRAFT_01g040410 [Sorghum bicolor]
 gb|EER92517.1| hypothetical protein SORBIDRAFT_01g040410 [Sorghum bicolor]
Length=381

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            W+ IQA   P       +   +  YVHP+V+RS+S L+ KSLE+CTESLGSETGSD
Sbjct  63   WNMIQAQ-KPAPPAVPRQAQAQAPYVHPLVRRSSSLLTQKSLEICTESLGSETGSD  117



>gb|KCW50926.1| hypothetical protein EUGRSUZ_J00576 [Eucalyptus grandis]
Length=484

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RSAS+LS KSLE+CTESLGSETGSD
Sbjct  134  YVHPLVRRSASSLSEKSLEICTESLGSETGSD  165



>ref|XP_002874894.1| hypothetical protein ARALYDRAFT_911920 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51153.1| hypothetical protein ARALYDRAFT_911920 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 14/104 (13%)
 Frame = -2

Query  390  ILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPER-NQTAGKEAEEEVYVHPM  214
            I+V ++ +  P +++S       N D+G GWSF+Q    P+   Q    + ++  YVHP+
Sbjct  3    IVVGQVSTHLPKKQVSQ------NLDVG-GWSFLQYFSEPKGIVQNREDDTKKTAYVHPI  55

Query  213  VKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEKEN  82
             KRS + LS   LEMCTESLG+E GSD   S +E S L  E  N
Sbjct  56   EKRSVAKLS---LEMCTESLGTENGSD---SGDEMSLLALEATN  93



>ref|XP_010481668.1| PREDICTED: protein FANTASTIC FOUR 2-like [Camelina sativa]
Length=243

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 6/76 (8%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
            G SF+Q++          +  E++ YVHP+ KRS S L+ KSLEMCTESLG+ETG   SE
Sbjct  22   GLSFLQSMADI---TAIVQNKEDKTYVHPIEKRSVSKLNEKSLEMCTESLGTETG---SE  75

Query  123  SVEEFSSLLPEKENSP  76
            S +E S L  E   +P
Sbjct  76   SGDELSLLALEATTTP  91



>ref|XP_010031568.1| PREDICTED: protein FAF-like, chloroplastic [Eucalyptus grandis]
Length=514

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RSAS+LS KSLE+CTESLGSETGSD
Sbjct  134  YVHPLVRRSASSLSEKSLEICTESLGSETGSD  165



>ref|XP_004496767.1| PREDICTED: protein FANTASTIC FOUR 3-like [Cicer arietinum]
Length=331

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISES  121
            W+F+ +L +     T+ KE     YVHP  KRS+  LS KSLE+CTE+LG+E+G+DI E+
Sbjct  71   WNFLDSLSNNISQNTSKKET---TYVHPQQKRSSLVLSPKSLELCTENLGNESGTDIIEN  127



>ref|XP_010546856.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546857.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546858.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546859.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546860.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546861.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546862.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546863.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546864.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546865.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546866.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546867.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546868.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546869.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546870.1| PREDICTED: protein FANTASTIC FOUR 3 isoform X1 [Tarenaya hassleriana]
Length=284

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 71/130 (55%), Gaps = 24/130 (18%)
 Frame = -2

Query  426  VCVGLPSCLE------PRILVHKMESTKP----PEEISAETKELI----NGDLGSGWSFI  289
            V  G  SCLE      PR L  ++ +  P    P E++ ++  L     + DLG GWSF+
Sbjct  5    VYQGFQSCLESHQLSEPRALRLRLSAPNPHFCQPLELAFKSCSLNSPCPDPDLG-GWSFL  63

Query  288  QAL--GSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVE  115
            QAL  GSP  N ++ KE   + YV       + TLS KSL +CTE+LG+ETGSDI++  +
Sbjct  64   QALSLGSPLSNPSSEKE---KAYVQ---SSPSKTLSEKSLALCTENLGNETGSDITDD-D  116

Query  114  EFSSLLPEKE  85
             FS   P  E
Sbjct  117  VFSLTSPRAE  126



>ref|XP_004511343.1| PREDICTED: protein FANTASTIC FOUR 3-like [Cicer arietinum]
Length=331

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 66/135 (49%), Gaps = 29/135 (21%)
 Frame = -2

Query  426  VCVGLPSCL-----EPRILVHKMESTKP--PEEISAETK-------------ELIN--GD  313
            VC GL SCL     E RI   ++ S KP  P+ I    K             + IN    
Sbjct  5    VCHGLSSCLDSQLVESRIHNLRLPSPKPLTPQPIDLPFKSCFWESNNKPNCEDNINKSNT  64

Query  312  LGSG-----WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGS  148
            L S      WS IQAL      Q    + +E+ YV P VK S   LS KSLE+CTE+LG+
Sbjct  65   LKSNSNEDSWSSIQALSKSNVFQVT--KEKEQNYVDPNVKLSWLQLSPKSLELCTENLGN  122

Query  147  ETGSDISESVEEFSS  103
            ETG+DI ES  EF S
Sbjct  123  ETGTDIPESGFEFFS  137



>ref|XP_002314255.2| hypothetical protein POPTR_0009s02170g [Populus trichocarpa]
 gb|EEE88210.2| hypothetical protein POPTR_0009s02170g [Populus trichocarpa]
Length=528

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -2

Query  252  GKEAEEEV--YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
             KE  ++V  YVHP+VKRSAS+LS KSLE+CTESLGSETG D
Sbjct  138  AKEDSKDVQPYVHPLVKRSASSLSEKSLEICTESLGSETGCD  179



>ref|XP_002466598.1| hypothetical protein SORBIDRAFT_01g010700 [Sorghum bicolor]
 gb|AAL75990.1|AF466204_5 putative protein [Sorghum bicolor]
 gb|EER93596.1| hypothetical protein SORBIDRAFT_01g010700 [Sorghum bicolor]
Length=438

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 16/118 (14%)
 Frame = -2

Query  429  SVCVG--LPSCLEPRILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQT  256
            +VC G  +P+  E    +  +E  K P E+  + +     D+   W+ IQA    + ++ 
Sbjct  4    AVCRGPAVPA-FEAPCWLRPVEPYKQPAEVVVDDRP-AQVDV---WNAIQA----DVDKV  54

Query  255  AGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISESVEE---FSSLLP  94
            A K A  + YVHP+V+RS+S +S KSLE+CTESLG+ETGS D + S++    F S LP
Sbjct  55   APK-ASSKPYVHPLVRRSSSLMSQKSLEVCTESLGNETGSGDFTSSLDMASLFDSPLP  111



>ref|XP_010522714.1| PREDICTED: protein FANTASTIC FOUR 1-like [Tarenaya hassleriana]
Length=277

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 8/77 (10%)
 Frame = -2

Query  339  ETKELINGDLGSGWSFIQALG---SPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEM  169
            ++  L NG++G GWSF+++L       RN+  G    + VYVHP  KR    LS KSLEM
Sbjct  18   KSNSLKNGEVG-GWSFLRSLSEISGIARNR--GDTDTDTVYVHPSSKRPK--LSDKSLEM  72

Query  168  CTESLGSETGSDISESV  118
            CTE LGSETGS+  + +
Sbjct  73   CTERLGSETGSENGDDI  89



>ref|XP_011008749.1| PREDICTED: protein FAF-like, chloroplastic [Populus euphratica]
Length=526

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSLE+CTESLGSETG D
Sbjct  146  YVHPLVKRSASSLSEKSLEICTESLGSETGCD  177



>ref|XP_010552820.1| PREDICTED: protein FANTASTIC FOUR 1-like [Tarenaya hassleriana]
Length=216

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 26/134 (19%)
 Frame = -2

Query  444  MSKTSSVCVGLPSCLEPRILVH-------KMESTKPPEEISAETKELINGDLG-------  307
            M+ +S V  G+  C EP   V         ++ +  P +   E +E    D G       
Sbjct  1    MASSSVVVQGMQQCPEPGRFVAMAPWGFSGLQKSPSPSDPHPEEQEAFATDDGEAETQNA  60

Query  306  --SGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
               GWSF+Q++ S        K     VYVHP+   +++ LS +SLEMCTE LGSETG  
Sbjct  61   ENGGWSFLQSIIS--------KTDTNAVYVHPLA--NSAKLSKRSLEMCTEGLGSETGHC  110

Query  132  ISESVEEFSSLLPE  91
               S EE S   PE
Sbjct  111  PMGSSEEMSLFSPE  124



>ref|XP_002513735.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48682.1| conserved hypothetical protein [Ricinus communis]
Length=542

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSLE+CTESLGSE GSD
Sbjct  145  YVHPLVKRSASSLSEKSLEICTESLGSENGSD  176



>gb|KGN57007.1| hypothetical protein Csa_3G149380 [Cucumis sativus]
Length=332

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -2

Query  255  AGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEK  88
            A KE + + YVHP+VKRS S LS +SL +CTE+LG+ETG D  E V  FS L+ E+
Sbjct  99   ASKELQSD-YVHPLVKRSRSALSDESLALCTENLGNETGDDFVEDV-VFSDLINER  152



>ref|NP_001051027.2| Os03g0705800 [Oryza sativa Japonica Group]
 gb|AAM97150.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98457.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12941.2| Os03g0705800 [Oryza sativa Japonica Group]
Length=424

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISE  124
            W+ IQA    +   T  K+A  + YVHP+V+RS+S +S KSLE+CTESLGSETGS D + 
Sbjct  35   WNAIQADVVDKSATTGAKKAAAKPYVHPLVRRSSSLMSQKSLEVCTESLGSETGSGDFTA  94

Query  123  SVEEF  109
            S+++ 
Sbjct  95   SLDDV  99



>ref|XP_011088985.1| PREDICTED: protein FAF-like, chloroplastic [Sesamum indicum]
Length=480

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRS S+LS KSLE+CTESLGSETGSD
Sbjct  133  YVHPLVKRSTSSLSEKSLEICTESLGSETGSD  164



>ref|XP_010031354.1| PREDICTED: protein FAF-like, chloroplastic [Eucalyptus grandis]
 gb|KCW50618.1| hypothetical protein EUGRSUZ_J00324 [Eucalyptus grandis]
Length=529

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRSAS+LS KSL+ CTESLGSETGSD
Sbjct  141  YVHPLVKRSASSLSEKSLQTCTESLGSETGSD  172



>gb|EAZ28302.1| hypothetical protein OsJ_12276 [Oryza sativa Japonica Group]
Length=388

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISE  124
            W+ IQA    +   T  K+A  + YVHP+V+RS+S +S KSLE+CTESLGSETGS D + 
Sbjct  35   WNAIQADVVDKSATTGAKKAAAKPYVHPLVRRSSSLMSQKSLEVCTESLGSETGSGDFTA  94

Query  123  SVEEF  109
            S+++ 
Sbjct  95   SLDDV  99



>gb|EAY91570.1| hypothetical protein OsI_13205 [Oryza sativa Indica Group]
Length=424

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISE  124
            W+ IQA    +   T  K+A  + YVHP+V+RS+S +S KSLE+CTESLGSETGS D + 
Sbjct  35   WNAIQADVVDKSATTGAKKAAAKPYVHPLVRRSSSLMSQKSLEVCTESLGSETGSGDFTA  94

Query  123  SVEEF  109
            S+++ 
Sbjct  95   SLDDV  99



>ref|XP_009591159.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana tomentosiformis]
Length=533

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 6/48 (13%)
 Frame = -2

Query  237  EEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLP  94
            E  Y+HP+VKRS S+LS KSLE+CTESLGSETGSD       FSS  P
Sbjct  109  ETPYIHPLVKRSTSSLSEKSLEICTESLGSETGSD------SFSSYAP  150



>gb|ACU17609.1| unknown [Glycine max]
Length=189

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS S LS KSLE+CTESLGSETGSD
Sbjct  147  YVHPLVRRSKSCLSEKSLEICTESLGSETGSD  178



>ref|XP_010263029.1| PREDICTED: protein FAF-like, chloroplastic [Nelumbo nucifera]
Length=540

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRS S+LS KSLE+CTESLGSETGSD
Sbjct  155  YVHPLVKRSTSSLSEKSLEICTESLGSETGSD  186



>ref|XP_009119569.1| PREDICTED: protein FANTASTIC FOUR 2-like [Brassica rapa]
Length=237

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 6/63 (10%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTA-GKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSET  142
            GD+G G SF+Q++     + TA  +  E++ YVHP   RS S L+ KSLEMCTESLG+ET
Sbjct  21   GDMG-GLSFLQSMS----DITAIVRTREDKAYVHPTENRSVSKLNEKSLEMCTESLGAET  75

Query  141  GSD  133
            GS+
Sbjct  76   GSE  78



>ref|XP_007227323.1| hypothetical protein PRUPE_ppa016319mg [Prunus persica]
 gb|EMJ28522.1| hypothetical protein PRUPE_ppa016319mg [Prunus persica]
Length=355

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKR--SASTLSTKSLEMCTESLGSET  142
            DLG GWSF+QA+ +  + Q   KE +E +Y+ P V +  SA+ L+ KSLE+CTE LGSET
Sbjct  84   DLG-GWSFLQAVSNLSQ-QGPHKEDKENMYLPPQVYKTPSATKLTEKSLELCTEDLGSET  141

Query  141  GSDISES  121
            G+ I+E+
Sbjct  142  GTIITEA  148



>ref|XP_010535716.1| PREDICTED: protein FAF-like, chloroplastic [Tarenaya hassleriana]
Length=435

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            YVHP+VKR++S+L+ KSLE+CTESLGSETGSD+
Sbjct  133  YVHPIVKRASSSLNEKSLEICTESLGSETGSDV  165



>ref|XP_006588628.1| PREDICTED: protein FANTASTIC FOUR 2-like [Glycine max]
 gb|KHN03796.1| Protein FANTASTIC FOUR 2 [Glycine soja]
Length=280

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 67/127 (53%), Gaps = 22/127 (17%)
 Frame = -2

Query  432  SSVCVGL-----PSCLEPRILVHKMESTKPPEEISAETKEL---------INGDLGSGWS  295
            SSVC GL     P  +EPR+L  K+    PP   S  T             N   G  WS
Sbjct  4    SSVCQGLQSSVEPWLMEPRVLKLKL---APPGSKSNNTSTHSPVTPPPSNTNDAHGKNWS  60

Query  294  FIQALGSPERNQTAGKEAE-EEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESV  118
            F Q+L     N +  KE + E VYVHP VK S+S LS KSLE+CTESLG ETGS+ S++ 
Sbjct  61   FFQSLS----NISHCKEPQIENVYVHPSVKSSSSMLSAKSLELCTESLGCETGSNSSDNT  116

Query  117  EEFSSLL  97
            ++ S   
Sbjct  117  DDMSLFF  123



>ref|XP_010474936.1| PREDICTED: protein FANTASTIC FOUR 2-like [Camelina sativa]
Length=248

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISE  124
            G SF+Q++          +  E++ YVHP+ KRS S L+ KSLEMCTESLG+ETG   SE
Sbjct  22   GLSFLQSMSDI---TAIVQNKEDKAYVHPIEKRSVSKLNEKSLEMCTESLGTETG---SE  75

Query  123  SVEEFSSLLPEKENSP  76
            S +E S L  E    P
Sbjct  76   SGDELSLLALEATTIP  91



>ref|XP_006592358.1| PREDICTED: protein FAF-like, chloroplastic-like [Glycine max]
Length=525

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRS S LS KSLE+CTESLGSETGSD
Sbjct  141  YVHPLVKRSKSCLSGKSLEICTESLGSETGSD  172



>ref|XP_009381827.1| PREDICTED: uncharacterized protein LOC103969916 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 6/43 (14%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSL  100
            YVHP+ +RSAS+LS KSL++CTESLGSETGSD      EFSS 
Sbjct  67   YVHPLARRSASSLSQKSLQICTESLGSETGSD------EFSSF  103



>ref|XP_010552818.1| PREDICTED: protein FANTASTIC FOUR 2-like [Tarenaya hassleriana]
Length=215

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 62/134 (46%), Gaps = 26/134 (19%)
 Frame = -2

Query  444  MSKTSSVCVGLPSCLEPRILVH-------KMESTKPPEEISAETKELINGDLG-------  307
            M+ +S V  G+  C EP   V         ++ +  P +   E +E    D G       
Sbjct  1    MASSSVVVQGMQQCPEPGRFVAMAPWGFSGLQKSPSPSDPHPEEQEAFATDDGEAETQNA  60

Query  306  --SGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
               GWSF+Q++ S        K     VYVHP+   +++ LS +SLEMCTE LGSETG  
Sbjct  61   ENGGWSFLQSIIS--------KTDTNAVYVHPLA--NSAKLSKRSLEMCTEGLGSETGHC  110

Query  132  ISESVEEFSSLLPE  91
               S EE S   P+
Sbjct  111  PMGSSEEMSLFTPK  124



>ref|XP_010457322.1| PREDICTED: protein FANTASTIC FOUR 2-like [Camelina sativa]
Length=246

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTA-GKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            D   G SF+Q++     + TA     E++ YVHP+ KRS S L+ KSLEMCTESLG+ETG
Sbjct  18   DHMVGLSFLQSMS----DITAIVPNKEDKAYVHPIEKRSVSKLNEKSLEMCTESLGTETG  73

Query  138  SDISESVEEFSSLLPEKENSP  76
               SES +E S L  E   +P
Sbjct  74   ---SESGDELSLLALEATTTP  91



>ref|XP_010916536.1| PREDICTED: protein FAF-like, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=489

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 13/94 (14%)
 Frame = -2

Query  378  KMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSA  199
            + + T+PP E   +       D+   WS IQ+  + E   TA        YVHP+V+RS+
Sbjct  39   QYKPTEPPVEAEKDDDRPGQFDI---WSSIQSQKARE-TATADPMVP---YVHPLVRRSS  91

Query  198  STLSTKSLEMCTESLGSETGSDISESVEEFSSLL  97
            S +S KSLE+CTESLGSETGS       +FSSLL
Sbjct  92   SLMSQKSLEICTESLGSETGS------ADFSSLL  119



>ref|XP_010916535.1| PREDICTED: protein FAF-like, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=495

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 13/94 (14%)
 Frame = -2

Query  378  KMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSA  199
            + + T+PP E   +       D+   WS IQ+  + E   TA        YVHP+V+RS+
Sbjct  45   QYKPTEPPVEAEKDDDRPGQFDI---WSSIQSQKARE-TATADPMVP---YVHPLVRRSS  97

Query  198  STLSTKSLEMCTESLGSETGSDISESVEEFSSLL  97
            S +S KSLE+CTESLGSETGS       +FSSLL
Sbjct  98   SLMSQKSLEICTESLGSETGS------ADFSSLL  125



>gb|KHN21197.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=525

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRS S LS KSLE+CTESLGSETGSD
Sbjct  141  YVHPLVKRSKSCLSGKSLEICTESLGSETGSD  172



>ref|XP_006424085.1| hypothetical protein CICLE_v10028116mg [Citrus clementina]
 gb|ESR37325.1| hypothetical protein CICLE_v10028116mg [Citrus clementina]
Length=558

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRSAS+LS KSLE+CTESLGSETGS+
Sbjct  160  YIHPLVKRSASSLSEKSLEICTESLGSETGSE  191



>gb|KHN19928.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=552

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRS S LS KSLE+CTESLGSETGSD
Sbjct  156  YVHPLVKRSKSCLSEKSLEICTESLGSETGSD  187



>ref|XP_009786342.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana sylvestris]
Length=490

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 6/48 (13%)
 Frame = -2

Query  237  EEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLP  94
            E  Y+HP+VKRS S+LS KSLE+CTE+LGSETGSD       FSS  P
Sbjct  126  ETPYIHPLVKRSTSSLSEKSLEICTENLGSETGSDT------FSSYTP  167



>gb|KHG29078.1| hypothetical protein F383_03861 [Gossypium arboreum]
Length=499

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRS S LS KSLE+CTESLGSETGSD
Sbjct  140  YIHPLVKRSGSCLSEKSLEICTESLGSETGSD  171



>ref|XP_008449447.1| PREDICTED: protein FANTASTIC FOUR 2-like [Cucumis melo]
Length=262

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 68/129 (53%), Gaps = 27/129 (21%)
 Frame = -2

Query  432  SSVCVGLPSCLEPRIL-------------VHKMESTKPPEEISAETKELINGDLGSGWSF  292
            SSVC GL S +E  +L              +++   K  +E+ A +K   NG+    W F
Sbjct  3    SSVCQGLQSHVESHVLSLQLFPQEPSYPTTNRVSQRKYEKEVEANSK---NGENIERWRF  59

Query  291  IQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEE  112
            +Q L +       G + E+++Y+      S + LS KSLEMCTESLGSE+GS++ E+   
Sbjct  60   LQPLSN-------GHQEEDKMYI----THSFTKLSKKSLEMCTESLGSESGSNMGENDIS  108

Query  111  FSSLLPEKE  85
              +L+ +++
Sbjct  109  LLTLISDED  117



>ref|XP_009126523.1| PREDICTED: protein FAF-like, chloroplastic [Brassica rapa]
Length=439

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  354  EEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSL  175
            +E+  +TKE I  D    WS I    S ++   +  +A    YVHP+VKR AS+LS KSL
Sbjct  87   QEVKNQTKEEIEPDQTDVWSSIL---SDKKKAESSDDAVPPPYVHPLVKR-ASSLSEKSL  142

Query  174  EMCTESLGSETG  139
            E+CTESLGSETG
Sbjct  143  EICTESLGSETG  154



>ref|XP_004982036.1| PREDICTED: protein FAF-like, chloroplastic-like [Setaria italica]
Length=424

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 17/100 (17%)
 Frame = -2

Query  411  PSCLEPRILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEE  232
            PS L P      +E+ K PE +  +    ++      W+ IQA    +  + A K     
Sbjct  17   PSWLRP------VETYKKPEVVVDDRPAQLDV-----WNAIQAADVDKAAKKASKP----  61

Query  231  VYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISESVE  115
             YVHP+V+RS+S +S KSLE+CTESLG+ETGS D + S++
Sbjct  62   -YVHPLVRRSSSLMSQKSLEVCTESLGNETGSGDFTSSLD  100



>ref|XP_006290238.1| hypothetical protein CARUB_v100036780mg, partial [Capsella rubella]
 gb|EOA23136.1| hypothetical protein CARUB_v100036780mg, partial [Capsella rubella]
Length=245

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 15/105 (14%)
 Frame = -2

Query  390  ILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPER-NQTAGKEAEEE-VYVHP  217
            I+V +     P +++S       N DLG GWSF+Q L   +   Q  G +  ++  YVHP
Sbjct  3    IIVGQAYQNLPKKQVSP------NSDLG-GWSFLQCLSETKGIFQNRGDDVTKKTAYVHP  55

Query  216  MVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEKEN  82
            + KR  + LS   LEMCTESLG+E GSD   S +E S L  E  N
Sbjct  56   IEKRPVAKLS---LEMCTESLGTENGSD---SGDEISLLALEGTN  94



>emb|CDY09119.1| BnaA02g05450D [Brassica napus]
Length=446

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = -2

Query  354  EEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSL  175
            +E+  +TKE I  D    WS I  L   ++ +++G +A    YVHP++KR AS+LS KSL
Sbjct  87   QEVKNQTKEEIEPDQTDVWSSI--LSDKKKAESSG-DAVPPPYVHPLMKR-ASSLSEKSL  142

Query  174  EMCTESLGSETG  139
            E+CTESLGSETG
Sbjct  143  EICTESLGSETG  154



>ref|XP_003596894.1| hypothetical protein MTR_2g087390 [Medicago truncatula]
 gb|AES67145.1| FAF-like protein [Medicago truncatula]
Length=308

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  270  ERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            ++N+    +++   Y+HP+VK S + LS KSLE+CTESLGSETGSD
Sbjct  18   QKNKDEASQSKTPPYIHPLVKNSNNYLSAKSLEICTESLGSETGSD  63



>ref|XP_004984714.1| PREDICTED: uncharacterized protein LOC101755002 [Setaria italica]
Length=395

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS+S L+ KSLE+CTESLGSETGSD
Sbjct  85   YVHPLVRRSSSLLTQKSLEICTESLGSETGSD  116



>ref|XP_003596901.1| hypothetical protein MTR_2g087460 [Medicago truncatula]
 gb|AES67152.1| FAF-like protein [Medicago truncatula]
Length=303

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  270  ERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            ++N+    +++   Y+HP+VK S + LS KSLE+CTESLGSETGSD
Sbjct  23   QKNKDEASQSKTPPYIHPLVKNSNNYLSAKSLEICTESLGSETGSD  68



>tpg|DAA44496.1| TPA: hypothetical protein ZEAMMB73_040803 [Zea mays]
Length=321

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS+S L+ KSLE+CTESLGSETGSD
Sbjct  18   YVHPLVRRSSSLLTQKSLEICTESLGSETGSD  49



>ref|XP_008653896.1| PREDICTED: LOW QUALITY PROTEIN: protein FAF-like, chloroplastic 
[Zea mays]
Length=381

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS+S L+ KSLE+CTESLGSETGSD
Sbjct  78   YVHPLVRRSSSLLTQKSLEICTESLGSETGSD  109



>ref|XP_008222964.1| PREDICTED: protein FANTASTIC FOUR 3-like [Prunus mume]
Length=353

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = -2

Query  315  DLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKR--SASTLSTKSLEMCTESLGSET  142
            DLG GWSF+QA+ +  + Q   K  +E +Y+ P V +  SA+ L+ KSLE+CTE LGSET
Sbjct  84   DLG-GWSFLQAVSNISQ-QDPHKGDKENMYIPPQVYKTPSATKLTEKSLELCTEDLGSET  141

Query  141  GSDISES  121
            G+ I+E 
Sbjct  142  GTIITED  148



>ref|XP_010926465.1| PREDICTED: protein FAF-like, chloroplastic [Elaeis guineensis]
Length=482

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (6%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISE  124
            WS IQ+  + E    A        YVHP+V+RS+  +S KSLE+CTESLGSETGS D S 
Sbjct  62   WSSIQSQKTKE---AAAAAPPPAPYVHPLVRRSSRLMSQKSLEICTESLGSETGSADFSS  118

Query  123  SVEEFSS  103
             +++F S
Sbjct  119  LLDDFHS  125



>gb|KHN17984.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=434

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS S LS KSLE+CTESLGSETGSD
Sbjct  147  YVHPLVRRSKSCLSEKSLEICTESLGSETGSD  178



>ref|XP_003541957.1| PREDICTED: protein FAF-like, chloroplastic-like [Glycine max]
Length=424

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS S LS KSLE+CTESLGSETGSD
Sbjct  147  YVHPLVRRSKSCLSEKSLEICTESLGSETGSD  178



>gb|KHN36503.1| Protein FAF-like, chloroplastic [Glycine soja]
Length=425

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS S LS KSLE+CTESLGSETGSD
Sbjct  147  YVHPLVRRSKSCLSEKSLEICTESLGSETGSD  178



>gb|EYU40575.1| hypothetical protein MIMGU_mgv1a004589mg [Erythranthe guttata]
Length=519

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VK  ASTLS KSLE+CTESLGSETGSD
Sbjct  170  YVHPLVKILASTLSEKSLEICTESLGSETGSD  201



>ref|XP_011026181.1| PREDICTED: protein FANTASTIC FOUR 2 [Populus euphratica]
Length=299

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 71/130 (55%), Gaps = 21/130 (16%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP------RILVHKMESTKPPEE---------ISAETKEL---INGDL  310
            +SS C GL SCLEP      R+L  K+  +K             ++   ++L    N D 
Sbjct  3    SSSYCPGLQSCLEPIYLVEPRVLRLKLAPSKSNISLPSIICKPFVTNSDRDLESNKNADT  62

Query  309  GSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            G GWSF+Q++ +     T   E  ++VYV P  K S+S LS KSLEMCTE LGSETGS+ 
Sbjct  63   G-GWSFLQSIANNTSQNTT--EENDKVYVPPNFKSSSSMLSEKSLEMCTEGLGSETGSEG  119

Query  129  SESVEEFSSL  100
            SES +  + L
Sbjct  120  SESRDGMAFL  129



>ref|XP_003610672.1| hypothetical protein MTR_5g005770 [Medicago truncatula]
 gb|AES93630.1| fantastic four-like protein [Medicago truncatula]
Length=327

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 65/130 (50%), Gaps = 26/130 (20%)
 Frame = -2

Query  426  VCVGLPSC-----LEPRILVHKMESTKP----PEEISAET-----KELINGDLG------  307
            VC GLPSC     +E R    ++ S KP    P ++  +T     +  IN  +       
Sbjct  5    VCHGLPSCHDSHLVESRFHNIRLPSPKPLTTQPIDLPFKTCFWDFENNINKTITVDSNPK  64

Query  306  -SGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
               WS IQ+L        A K  +E  YV P VK     LS KSLE+CTE+LG+ETG+DI
Sbjct  65   EDSWSSIQSLFK----SNASKGLKETTYVDPNVKLPWHRLSPKSLELCTENLGNETGADI  120

Query  129  SE-SVEEFSS  103
             E S++  SS
Sbjct  121  PEFSIDLLSS  130



>ref|XP_011079845.1| PREDICTED: protein FANTASTIC FOUR 2 [Sesamum indicum]
Length=326

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 67/137 (49%), Gaps = 34/137 (25%)
 Frame = -2

Query  453  H*KMSKTSSVCVGLPSCLEPR-----ILVHKMESTKPP----------------------  355
            H      SSVC GL SCLEP      +L+H++  +KPP                      
Sbjct  31   HSTKQNMSSVCQGLQSCLEPLSLEPLVLLHQLAPSKPPLSFPWPQKQPDIPRPQSSNIFP  90

Query  354  -EEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKS  178
             E +  +T         + W+F         ++T      E+VYVHP++KRS S+LST+S
Sbjct  91   IENMWEKTDRNGQESTPTTWNFTYNCRLQSTDET------EQVYVHPLIKRSTSSLSTRS  144

Query  177  LEMCTESLGSETGSDIS  127
            LEMCTESLGSETG+ I 
Sbjct  145  LEMCTESLGSETGNCID  161



>gb|AAT06460.1| At4g02810 [Arabidopsis thaliana]
 dbj|BAD44084.1| unknown protein [Arabidopsis thaliana]
Length=271

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 54/102 (53%), Gaps = 11/102 (11%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPER-NQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSE  145
            N D+G GWSF+Q    P+   Q    + ++  YV+P+ KRS + LS   LEMCTESLG+E
Sbjct  19   NPDVG-GWSFLQYFSEPKGIVQNREDDTKKTAYVYPIEKRSVAKLS---LEMCTESLGTE  74

Query  144  TGSDISESVEEFSSLLPEKEN---SPaaaaaaATEKCYRYRE  28
             GSD   S +E S L  E  N   SP        E  +  RE
Sbjct  75   NGSD---SGDEMSLLALEATNISKSPRLTTKPQKETSFMTRE  113



>ref|NP_192190.1| FAF family protein [Arabidopsis thaliana]
 sp|Q9SY06.1|FAF1_ARATH RecName: Full=Protein FANTASTIC FOUR 1 [Arabidopsis thaliana]
 gb|AAD15352.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77766.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30511.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82232.1| FAF family protein [Arabidopsis thaliana]
Length=271

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 54/102 (53%), Gaps = 11/102 (11%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPER-NQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSE  145
            N D+G GWSF+Q    P+   Q    + ++  YV+P+ KRS + LS   LEMCTESLG+E
Sbjct  19   NPDVG-GWSFLQYFSEPKGIVQNREDDTKKTAYVYPIEKRSVAKLS---LEMCTESLGTE  74

Query  144  TGSDISESVEEFSSLLPEKEN---SPaaaaaaATEKCYRYRE  28
             GSD   S +E S L  E  N   SP        E  +  RE
Sbjct  75   NGSD---SGDEMSLLALEATNISKSPRLTTKPQKETSFMTRE  113



>gb|KFK42677.1| hypothetical protein AALP_AA1G025400 [Arabis alpina]
Length=236

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = -2

Query  318  GDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            G++G G SF+Q++     +       +++ YVHP  KRS S L+ KSLEMCTESLG+ETG
Sbjct  22   GNMG-GLSFLQSM-----SDITTIVQDDKAYVHPTEKRSVSKLNEKSLEMCTESLGTETG  75

Query  138  SDISESVEEFSSLLPEKENSP  76
               SES ++ S L  E   +P
Sbjct  76   ---SESGDDLSLLAFEAIITP  93



>ref|XP_002300849.2| hypothetical protein POPTR_0002s05430g [Populus trichocarpa]
 gb|EEE80122.2| hypothetical protein POPTR_0002s05430g [Populus trichocarpa]
Length=300

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 71/130 (55%), Gaps = 21/130 (16%)
 Frame = -2

Query  435  TSSVCVGLPSCLEP------RILVHKMESTKPPEE---------ISAETKEL---INGDL  310
            +SS C GL SCLEP      R+L  K+  +K             ++   ++L    N D 
Sbjct  3    SSSYCPGLQSCLEPVYLVEPRVLRLKLAPSKSNISRSSTICKPFVTNSDRDLENNKNADT  62

Query  309  GSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            G GWSF+Q++ +     T   E  ++VYV P  K S+S LS KSLEMCTE LGSETGS+ 
Sbjct  63   G-GWSFLQSIANNTSQTTT--EENDKVYVPPNFKSSSSILSEKSLEMCTEGLGSETGSEG  119

Query  129  SESVEEFSSL  100
            SES +  + L
Sbjct  120  SESRDGMAFL  129



>ref|XP_007150016.1| hypothetical protein PHAVU_005G118900g [Phaseolus vulgaris]
 gb|ESW22010.1| hypothetical protein PHAVU_005G118900g [Phaseolus vulgaris]
Length=423

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V+RS S LS KSL++CTESLGSETGSD
Sbjct  145  YVHPLVRRSKSCLSEKSLQICTESLGSETGSD  176



>ref|XP_007208036.1| hypothetical protein PRUPE_ppa002898mg [Prunus persica]
 gb|EMJ09235.1| hypothetical protein PRUPE_ppa002898mg [Prunus persica]
Length=623

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 11/61 (18%)
 Frame = -2

Query  261  QTAGKEAEEEV-----YVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLL  97
            Q A +EA + V     YVHP+VK+ +S+L+ KSLE+CTESLGSETGS      E FSS  
Sbjct  208  QKANEEANKAVDTAAPYVHPLVKKQSSSLTVKSLEVCTESLGSETGS------EGFSSYP  261

Query  96   P  94
            P
Sbjct  262  P  262



>gb|KHG22819.1| hypothetical protein F383_08710 [Gossypium arboreum]
Length=495

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRS S LS KSLE+CTE LGSETGSD
Sbjct  128  YIHPLVKRSTSCLSEKSLEICTERLGSETGSD  159



>gb|KFK30886.1| hypothetical protein AALP_AA6G038600 [Arabis alpina]
Length=247

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 14/105 (13%)
 Frame = -2

Query  390  ILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPER-NQTAGKEAEEEVYVHPM  214
            ++VH+     P  +++  T         SGWSF+Q L   +   QT  ++  +  Y+HP+
Sbjct  3    VIVHQAYEHLPKNQVTQNTNV-------SGWSFLQFLSETKHIVQTKEEDTNKTPYIHPI  55

Query  213  VKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEKENS  79
             KR  + LS   LEMCTESLG+E G   SES +E + L  E  N+
Sbjct  56   QKRPVAKLS---LEMCTESLGTENG---SESGDEITLLALEATNN  94



>ref|XP_007132501.1| hypothetical protein PHAVU_011G099500g [Phaseolus vulgaris]
 gb|ESW04495.1| hypothetical protein PHAVU_011G099500g [Phaseolus vulgaris]
Length=527

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VKRS S L+ KSL++CTESLGSETGSD
Sbjct  152  YVHPLVKRSKSCLNEKSLQICTESLGSETGSD  183



>ref|XP_004506225.1| PREDICTED: protein FAF-like, chloroplastic-like [Cicer arietinum]
Length=527

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+ KR+ S+LS KSLE+CTESLGSETGSD
Sbjct  131  YIHPLAKRTKSSLSRKSLEICTESLGSETGSD  162



>ref|XP_003605994.1| hypothetical protein MTR_4g050590 [Medicago truncatula]
 gb|AES88191.1| FAF-like protein [Medicago truncatula]
Length=566

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+ KR+ S+LS KSLE+CTESLGSETGSD
Sbjct  149  YIHPLAKRTKSSLSRKSLEICTESLGSETGSD  180



>ref|XP_004228872.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=471

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRS S+LS KSLE+CTE+LGSE GSD
Sbjct  111  YIHPLVKRSTSSLSEKSLEICTENLGSENGSD  142



>ref|XP_008782273.1| PREDICTED: helicase SWR1-like [Phoenix dactylifera]
Length=509

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGS-DISESVEEFSSL  100
            YVHP+V+RS+  +S KSLE+CTESLGSETGS D S  ++E   L
Sbjct  85   YVHPLVRRSSKLMSQKSLEICTESLGSETGSADFSSFLDELDCL  128



>ref|XP_008438701.1| PREDICTED: protein FANTASTIC FOUR 4 [Cucumis melo]
Length=344

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLPEK  88
            YVHP+VKRS S LS KSL +CTE+LG+ETG D  E    FS L  E+
Sbjct  115  YVHPLVKRSRSALSDKSLALCTENLGNETGVDFVEDA-VFSDLKNER  160



>ref|XP_006487862.1| PREDICTED: protein FAF-like, chloroplastic-like [Citrus sinensis]
Length=551

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRSA +L+ KSLE+CTESLGSETGS+
Sbjct  160  YIHPLVKRSARSLTEKSLEICTESLGSETGSE  191



>gb|KDO46581.1| hypothetical protein CISIN_1g008798mg [Citrus sinensis]
Length=553

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRSA +L+ KSLE+CTESLGSETGS+
Sbjct  160  YIHPLVKRSARSLTEKSLEICTESLGSETGSE  191



>ref|XP_004139078.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
 gb|KGN66592.1| hypothetical protein Csa_1G635920 [Cucumis sativus]
Length=387

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KRS   LS KSLE+CTESLGSETGSD
Sbjct  96   YVHPLLKRSGKCLSEKSLEICTESLGSETGSD  127



>ref|XP_004170966.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
Length=387

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KRS   LS KSLE+CTESLGSETGSD
Sbjct  96   YVHPLLKRSGKCLSEKSLEICTESLGSETGSD  127



>ref|XP_003539488.1| PREDICTED: protein FAF-like, chloroplastic-like isoform X1 [Glycine 
max]
 ref|XP_006592782.1| PREDICTED: protein FAF-like, chloroplastic-like isoform X2 [Glycine 
max]
Length=434

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+V++S S LS KSLE+CTESLGSETGSD
Sbjct  147  YVHPLVRKSKSCLSEKSLEICTESLGSETGSD  178



>ref|XP_008230058.1| PREDICTED: protein FAF-like, chloroplastic [Prunus mume]
Length=563

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 6/45 (13%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLP  94
            YVHP+VK+ +S L+ KSLE+CTESLGSETGS++      FSS  P
Sbjct  165  YVHPLVKKQSSALTVKSLEVCTESLGSETGSEV------FSSYPP  203



>ref|XP_008450286.1| PREDICTED: protein FAF-like, chloroplastic [Cucumis melo]
Length=387

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KRS   LS KSLE+CTESLGSETGSD
Sbjct  96   YVHPLLKRSGKCLSEKSLEICTESLGSETGSD  127



>ref|XP_004241354.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=433

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            Y+HP++K+S+S+L+ KSLE+CTESLGSETGS+I
Sbjct  124  YIHPLLKKSSSSLTDKSLEICTESLGSETGSEI  156



>ref|XP_010430400.1| PREDICTED: protein FANTASTIC FOUR 1-like [Camelina sativa]
Length=269

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 16/75 (21%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAG--KEAEEEV-----YVHPMVKRSASTLSTKSLEMCT  163
            N D G GWSF+Q L     ++T G  +  E++V     YVHP+ KRS + LS   LEMCT
Sbjct  20   NADSG-GWSFLQCL-----SETKGIFQNREDDVTKKTAYVHPIEKRSVAKLS---LEMCT  70

Query  162  ESLGSETGSDISESV  118
            ESLG+E GSD  + +
Sbjct  71   ESLGTENGSDSGDEI  85



>ref|XP_010521625.1| PREDICTED: protein FAF-like, chloroplastic [Tarenaya hassleriana]
Length=486

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 9/55 (16%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGS------DISESVEEFSSLLPEKEN  82
            YVHP+V+RS S+LS +SLE+CTESLGSETGS      ++SE  EE   +L EK++
Sbjct  142  YVHPLVRRSKSSLSERSLEICTESLGSETGSEGFSWYNLSEKSEE---VLEEKDD  193



>ref|XP_004291539.1| PREDICTED: protein FAF-like, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=552

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -2

Query  333  KELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESL  154
            KE+  G      S ++     E N++   EA    YVHP+VK+ +S+L  KSLE+CTESL
Sbjct  128  KEIAEGQFDIWSSLVKDGAKNEENKSVVPEAP---YVHPLVKKQSSSLKGKSLEVCTESL  184

Query  153  GSETGSD  133
            GSETGS+
Sbjct  185  GSETGSE  191



>ref|XP_006340442.1| PREDICTED: protein FAF-like, chloroplastic-like [Solanum tuberosum]
Length=443

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = -2

Query  300  WSFIQALGSPERNQ-TAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
            WS   ++ SP +N+ ++ K      YVHP+ KRS ++LS KSLE+CTESLGSETGS
Sbjct  34   WS---SILSPSKNEDSSNKLIPTNPYVHPLDKRSTNSLSEKSLEICTESLGSETGS  86



>ref|XP_006361108.1| PREDICTED: protein FAF-like, chloroplastic-like [Solanum tuberosum]
Length=440

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            Y+HP++K+S S+L+ KSLE+CTESLGSETGS+I
Sbjct  125  YIHPLLKKSTSSLTEKSLEICTESLGSETGSEI  157



>ref|XP_009763490.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana sylvestris]
Length=286

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPER-NQTAGKEAEEEVYVHPMVKR-SASTLSTKSLEMCTESLGS  148
            N DL  GWS +Q L +    N+    + +E  YVHP+ K+ S+S LS KSL +CTE+LG 
Sbjct  55   NADLA-GWSSLQNLPTINSLNRKLDSKEKENSYVHPLSKQHSSSRLSEKSLALCTENLGC  113

Query  147  ETGSD-ISE-SVEEFSS  103
            ETG+D I+E S+  FSS
Sbjct  114  ETGTDHITESSIFSFSS  130



>ref|XP_008660317.1| PREDICTED: protein FANTASTIC FOUR 4-like [Zea mays]
 ref|XP_008660318.1| PREDICTED: protein FANTASTIC FOUR 4-like [Zea mays]
 gb|AFW88911.1| hypothetical protein ZEAMMB73_618632 [Zea mays]
Length=402

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            WS IQA           +      YVHP+ +RS+  L+ KSLE CTESLGSETGSD
Sbjct  62   WSMIQA--QKPPPAAPRQAQAPAPYVHPLARRSSGLLTQKSLETCTESLGSETGSD  115



>ref|XP_008366383.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=529

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  255  AGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            A K A    YVHP+VK+ +S L+ KSLE+CTESLGSETGS+
Sbjct  136  ASKVATAAPYVHPLVKKQSSALTKKSLEVCTESLGSETGSE  176



>ref|XP_008385575.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=529

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  255  AGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            A K A    YVHP+VK+ +S L+ KSLE+CTESLGSETGS+
Sbjct  136  ASKVATAAPYVHPLVKKQSSALTKKSLEVCTESLGSETGSE  176



>ref|XP_010312347.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=481

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VKRS S+LS KSLE CTE+LGSE GSD
Sbjct  122  YIHPLVKRSTSSLSEKSLETCTENLGSENGSD  153



>ref|XP_010101989.1| hypothetical protein L484_016279 [Morus notabilis]
 gb|EXB91209.1| hypothetical protein L484_016279 [Morus notabilis]
Length=568

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSET  142
            Y+HP+VKRSAS+LS KSLE+CTESLGSET
Sbjct  170  YIHPLVKRSASSLSEKSLEVCTESLGSET  198



>ref|XP_009787268.1| PREDICTED: adhesive plaque matrix protein-like [Nicotiana sylvestris]
Length=1318

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = -2

Query  390   ILVHKMESTKPPEEISAETKELINGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMV  211
             ILV       PP    +  + +   +  S WSF+Q L +    Q    +  EE+ V P  
Sbjct  1071  ILVQNNTKMSPPISNFSPQELIEENENVSNWSFMQILNNSSSYQNNQSDTTEEIDVQPST  1130

Query  210   KR-SASTLSTKSLEMCTESLGSETGSD-ISES-VEEFSS  103
             K+ S+S ++T+SL+MCTE LGSETGS+ ISES ++EF S
Sbjct  1131  KQCSSSIMNTRSLDMCTEILGSETGSNYISESNMDEFFS  1169



>ref|XP_010455928.1| PREDICTED: protein FANTASTIC FOUR 1-like [Camelina sativa]
Length=269

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 52/88 (59%), Gaps = 19/88 (22%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAG--KEAEEEV-----YVHPMVKRSASTLSTKSLEMCT  163
            N DLG GWSF+Q L     ++T G  +  E++V     YVHP+ KRS + LS   LE CT
Sbjct  20   NHDLG-GWSFLQYL-----SETKGIFQNKEDDVIKKTAYVHPIEKRSVAKLS---LETCT  70

Query  162  ESLGSETGSDISESVEEFSSLLPEKENS  79
            ESLG+E GSD   S +E S L  E  N+
Sbjct  71   ESLGTENGSD---SGDEISLLALEGTNT  95



>ref|XP_010422533.1| PREDICTED: protein FANTASTIC FOUR 1 [Camelina sativa]
Length=272

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 7/76 (9%)
 Frame = -2

Query  303  GWSFIQALGSPER-NQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDIS  127
            GWSF+Q L   +   Q    + ++  YVHP+ KRS + LS   LEMCTESLG+E GSD  
Sbjct  25   GWSFLQYLSETKGIFQNREDDTKKTAYVHPIEKRSVAKLS---LEMCTESLGTENGSD--  79

Query  126  ESVEEFSSLLPEKENS  79
             S +E S L  E  N+
Sbjct  80   -SGDEISLLALEGTNT  94



>ref|XP_010026222.1| PREDICTED: protein FANTASTIC FOUR 2-like [Eucalyptus grandis]
Length=181

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = -2

Query  231  VYVHPMVKRSASTLSTKSLEMCTESLGSETGSDISESVEEFSSLLP  94
            VYV+P++K S S LS +SL+MC ESLG+ETGSD+ +S     +LLP
Sbjct  52   VYVNPILKCSTSCLSNRSLKMCIESLGNETGSDVGDS----KALLP  93



>ref|XP_009336398.1| PREDICTED: protein FAF-like, chloroplastic [Pyrus x bretschneideri]
Length=559

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VK+ +S+L+ KSLE+CTESLGSETGS+
Sbjct  157  YVHPLVKKQSSSLTKKSLEVCTESLGSETGSE  188



>ref|XP_009373888.1| PREDICTED: protein FAF-like, chloroplastic [Pyrus x bretschneideri]
Length=558

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VK+ +S+L+ KSLE+CTESLGSETGS+
Sbjct  157  YVHPLVKKQSSSLTKKSLEVCTESLGSETGSE  188



>ref|XP_008361605.1| PREDICTED: protein FAF-like, chloroplastic [Malus domestica]
Length=560

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP+VK+ +S+L+ KSLE+CTESLGSETGS+
Sbjct  157  YVHPLVKKQSSSLTKKSLEVCTESLGSETGSE  188



>ref|XP_009368373.1| PREDICTED: protein FAF-like, chloroplastic [Pyrus x bretschneideri]
Length=564

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  255  AGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            A K A    Y+HP+VK+ +S L+ KSL++CTESLGSETGS+
Sbjct  151  ASKVATAAPYIHPLVKKQSSALTKKSLQVCTESLGSETGSE  191



>ref|XP_004487448.1| PREDICTED: protein FAF-like, chloroplastic-like [Cicer arietinum]
Length=348

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+ K+S S LS KSL++CTESLGSETGSD
Sbjct  47   YIHPLEKKSKSFLSEKSLQICTESLGSETGSD  78



>ref|XP_006304801.1| hypothetical protein CARUB_v10012407mg [Capsella rubella]
 gb|EOA37699.1| hypothetical protein CARUB_v10012407mg [Capsella rubella]
Length=276

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 8/77 (10%)
 Frame = -2

Query  303  GWSFIQALGSPERNQTA-GKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSDIS  127
            G SF+Q++     + TA     E++ YVHP  K S S L+ KSLEMCTESLG+ETG   S
Sbjct  55   GLSFLQSMS----DITAIVPNKEDKAYVHPNEKCSVSKLNEKSLEMCTESLGTETG---S  107

Query  126  ESVEEFSSLLPEKENSP  76
            ES +E S L  E   +P
Sbjct  108  ESGDELSLLALEATTTP  124



>gb|AES67149.2| DUF3049 family protein [Medicago truncatula]
Length=283

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VK S + LS KSLEMCTE LGSE GSD
Sbjct  58   YIHPLVKNSQNYLSEKSLEMCTEILGSENGSD  89



>ref|XP_008451366.1| PREDICTED: protein FANTASTIC FOUR 3-like [Cucumis melo]
Length=286

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 53/110 (48%), Gaps = 20/110 (18%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSAST--LSTKSLEMCTESLGS  148
            +G+   GWSF+QA                 V  HP  KR A T  LS KSLEMCTESLGS
Sbjct  81   HGNGVGGWSFLQA--------------PSGVDGHPPAKRYAPTMALSPKSLEMCTESLGS  126

Query  147  ETGSDISESV---EEFSSLLP-EKENSPaaaaaaATEKCYRYREAFCSSS  10
            ETGSD    +   E+ S   P E E SP+ A+   + K  R  +     S
Sbjct  127  ETGSDGGSEIGSDEKMSLFSPDETETSPSLASGRKSVKLSRLAKKLAKPS  176



>ref|XP_003596898.1| hypothetical protein MTR_2g087430 [Medicago truncatula]
Length=296

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y+HP+VK S + LS KSLEMCTE LGSE GSD
Sbjct  58   YIHPLVKNSQNYLSEKSLEMCTEILGSENGSD  89



>ref|XP_011090759.1| PREDICTED: protein FANTASTIC FOUR 3 [Sesamum indicum]
Length=309

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 20/112 (18%)
 Frame = -2

Query  426  VCVGLPSCLE---PRILVHKMESTKPP---------EEISAETKELINGDLGSGWSFIQA  283
            VC  L SC E      L  K+ +  PP         +   AE K     + G+ W F+Q 
Sbjct  5    VCQNLVSCFEMETTTTLKLKVAALPPPGSDLCGSDDDHAPAEVKSKTIPEFGN-WGFLQT  63

Query  282  LGSPERNQTAGKEAEEEVYVHPMVKRSA-STLSTKSLEMCTESLGSETGSDI  130
            +  P+ +     + E  +Y  P+ ++S+ S LS KSLE+CTE+LGSETGSDI
Sbjct  64   V--PKES----GDKESCIYTPPLARKSSFSRLSAKSLELCTENLGSETGSDI  109



>ref|XP_002874046.1| hypothetical protein ARALYDRAFT_351234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50305.1| hypothetical protein ARALYDRAFT_351234 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KR AS+LS KSLE+CTESLGSETG D
Sbjct  130  YVHPLMKR-ASSLSEKSLEICTESLGSETGCD  160



>dbj|BAC42736.1| unknown protein [Arabidopsis thaliana]
Length=463

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KR AS+LS KSLE+CTESLGSETG D
Sbjct  133  YVHPLMKR-ASSLSEKSLEICTESLGSETGCD  163



>emb|CAC34502.1| putative protein [Arabidopsis thaliana]
Length=462

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KR AS+LS KSLE+CTESLGSETG D
Sbjct  132  YVHPLMKR-ASSLSEKSLEICTESLGSETGCD  162



>ref|NP_680195.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190360.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q0V865.1|FAFL_ARATH RecName: Full=Protein FAF-like, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABH04462.1| At5g22090 [Arabidopsis thaliana]
 gb|AED92981.1| uncharacterized protein AT5G22090 [Arabidopsis thaliana]
 gb|AED92982.1| uncharacterized protein AT5G22090 [Arabidopsis thaliana]
Length=463

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++KR AS+LS KSLE+CTESLGSETG D
Sbjct  133  YVHPLMKR-ASSLSEKSLEICTESLGSETGCD  163



>ref|XP_010544324.1| PREDICTED: protein FAF-like, chloroplastic [Tarenaya hassleriana]
Length=477

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            Y HP+V+RS S+LS +SLE+CTESLGSETGS+
Sbjct  137  YEHPLVRRSKSSLSERSLEICTESLGSETGSE  168



>ref|XP_009606299.1| PREDICTED: protein FANTASTIC FOUR 3-like [Nicotiana tomentosiformis]
Length=340

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = -2

Query  321  NGDLGSGWSFIQALGSPER-NQTAGKEAEEEVYVHPMVKR-SASTLSTKSLEMCTESLGS  148
            N DL +GWS +Q L +    N     + +E  YVHP+ K+ S+S LS KSL +CTE+LG 
Sbjct  63   NADL-AGWSSLQNLPTVNSLNPKLDSKEKENSYVHPLSKQPSSSRLSEKSLALCTENLGC  121

Query  147  ETGSD  133
            ETG+D
Sbjct  122  ETGTD  126



>ref|XP_008449599.1| PREDICTED: protein FAF-like, chloroplastic [Cucumis melo]
Length=449

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  273  PERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            P ++           YVHP++K+++ +LS  SL++CTESLGSETGSD
Sbjct  102  PPKSSVVAAPPPPPPYVHPLLKKTSHSLSDISLQICTESLGSETGSD  148



>emb|CDX88810.1| BnaA03g08390D [Brassica napus]
Length=520

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP+VKR AS+LS KSLE+CTESLGSETG
Sbjct  134  YVHPLVKR-ASSLSEKSLEICTESLGSETG  162



>emb|CDX70983.1| BnaC03g10670D [Brassica napus]
Length=451

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP+VKR AS+LS KSLE+CTESLGSETG
Sbjct  134  YVHPLVKR-ASSLSEKSLEICTESLGSETG  162



>ref|XP_009131857.1| PREDICTED: protein FAF-like, chloroplastic [Brassica rapa]
Length=451

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP+VKR AS+LS KSLE+CTESLGSETG
Sbjct  134  YVHPLVKR-ASSLSEKSLEICTESLGSETG  162



>ref|XP_004251227.1| PREDICTED: protein FAF-like, chloroplastic [Solanum lycopersicum]
Length=248

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  231  VYVHPMVKRSASTLSTKSLEMCTESLGSETGS  136
            +YVHP+ K S ++LS KSLE+CTESLGSETGS
Sbjct  56   LYVHPLDKSSRNSLSEKSLEICTESLGSETGS  87



>ref|XP_009604443.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana tomentosiformis]
Length=503

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDISES  121
            Y+HP++K+S+S L+ KSLE+CTESLGSETGS+I+ S
Sbjct  138  YIHPLLKKSSS-LTEKSLEICTESLGSETGSEINLS  172



>ref|XP_004169382.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
Length=433

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++K+++ +LS  SL++CTESLGSETGSD
Sbjct  105  YVHPLLKKTSHSLSDISLQICTESLGSETGSD  136



>ref|XP_004140267.1| PREDICTED: protein FAF-like, chloroplastic-like [Cucumis sativus]
 gb|KGN48052.1| hypothetical protein Csa_6G426380 [Cucumis sativus]
Length=433

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSD  133
            YVHP++K+++ +LS  SL++CTESLGSETGSD
Sbjct  105  YVHPLLKKTSHSLSDISLQICTESLGSETGSD  136



>ref|XP_009764935.1| PREDICTED: protein FAF-like, chloroplastic [Nicotiana sylvestris]
Length=493

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETGSDISES  121
            Y+HP++K+S+S L+ KSLE+CTESLGSETGS+I+ S
Sbjct  134  YIHPLLKKSSS-LTEKSLEICTESLGSETGSEINLS  168



>ref|XP_010456623.1| PREDICTED: protein FAF-like, chloroplastic [Camelina sativa]
Length=719

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP++KR AS+LS KSLE+CTESLGSETG
Sbjct  136  YVHPLMKR-ASSLSEKSLEICTESLGSETG  164



>ref|XP_006400714.1| hypothetical protein EUTSA_v10013382mg [Eutrema salsugineum]
 gb|ESQ42167.1| hypothetical protein EUTSA_v10013382mg [Eutrema salsugineum]
Length=488

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEVYVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            WS I  L   ++ +++ +      YVHP++KR AS+LS KSLE+CTESLGSETG
Sbjct  122  WSSI--LSDKKKTESSNETVPPPPYVHPLMKR-ASSLSEKSLEICTESLGSETG  172



>ref|XP_006287687.1| hypothetical protein CARUB_v10000895mg [Capsella rubella]
 gb|EOA20585.1| hypothetical protein CARUB_v10000895mg [Capsella rubella]
Length=465

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP++KR AS+LS KSLE+CTESLGSETG
Sbjct  135  YVHPLMKR-ASSLSEKSLEICTESLGSETG  163



>ref|XP_010495347.1| PREDICTED: protein FAF-like, chloroplastic [Camelina sativa]
Length=718

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP++KR AS+LS KSLE+CTESLGSETG
Sbjct  137  YVHPLMKR-ASSLSEKSLEICTESLGSETG  165



>ref|XP_009388789.1| PREDICTED: protein FAF-like, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=454

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 47/76 (62%), Gaps = 16/76 (21%)
 Frame = -2

Query  300  WSFIQALGSPERNQTAGKEAEEEV---YVHPMVKRSASTLSTKSLEMCTESLGSETGSDI  130
            WS IQA       Q A      +    YVHP+V+RS+S+LS KSLE+CTESLGSETGSD 
Sbjct  50   WSAIQA-------QKAANPVAADAPAPYVHPLVRRSSSSLSQKSLEICTESLGSETGSD-  101

Query  129  SESVEEFSSLLPEKEN  82
                 +FSS L E ++
Sbjct  102  -----DFSSFLDELDH  112



>ref|XP_010421000.1| PREDICTED: protein FAF-like, chloroplastic [Camelina sativa]
Length=471

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = -2

Query  228  YVHPMVKRSASTLSTKSLEMCTESLGSETG  139
            YVHP++KR AS+LS KSLE+CTESLGSETG
Sbjct  137  YVHPLMKR-ASSLSEKSLEICTESLGSETG  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048