BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32588_g1_i1 len=1428 path=[1406:0-1427]

Length=1428
                                                                      Score     E

ref|XP_009785883.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    383   5e-125   
ref|XP_011093623.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       370   6e-120   
ref|XP_006338153.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    367   8e-120   
ref|XP_009610478.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       366   2e-118   
emb|CDP03287.1|  unnamed protein product                                364   3e-117   
ref|XP_002280643.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       352   5e-113   Vitis vinifera
ref|XP_006451246.1|  hypothetical protein CICLE_v10010254mg             350   1e-112   
ref|XP_006494326.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    351   2e-112   
ref|XP_009612404.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    340   7e-109   
gb|KDP33719.1|  hypothetical protein JCGZ_07290                         341   9e-109   
ref|XP_002325015.2|  hypothetical protein POPTR_0018s09200g             339   5e-108   Populus trichocarpa [western balsam poplar]
ref|XP_007204494.1|  hypothetical protein PRUPE_ppa019638mg             338   1e-107   
ref|XP_004287451.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    338   1e-107   
ref|XP_008242555.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       338   2e-107   
ref|XP_009798264.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    336   3e-107   
ref|XP_007203534.1|  hypothetical protein PRUPE_ppa026744mg             336   3e-107   
gb|EYU32309.1|  hypothetical protein MIMGU_mgv1a025282mg                337   7e-107   
ref|XP_010047719.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    336   8e-107   
ref|XP_007013082.1|  RING/U-box superfamily protein, putative           336   1e-106   
ref|XP_011048352.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    334   4e-106   
ref|XP_011016224.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    334   4e-106   
ref|XP_008242556.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    332   7e-105   
ref|XP_010107387.1|  E3 ubiquitin-protein ligase ATL42                  328   9e-104   
ref|XP_004513025.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    328   1e-103   
ref|XP_006353480.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    323   2e-102   
emb|CBI28025.3|  unnamed protein product                                324   3e-102   
ref|XP_008387095.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       321   3e-101   
ref|XP_004251624.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       320   8e-101   
ref|XP_006587536.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    318   6e-100   
ref|XP_010092022.1|  E3 ubiquitin-protein ligase ATL42                  316   5e-99    
ref|XP_010113232.1|  E3 ubiquitin-protein ligase ATL42                  314   1e-98    
ref|XP_010321060.1|  PREDICTED: putative RING-H2 finger protein A...    310   3e-98    
ref|XP_003517066.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    311   5e-97    
ref|XP_004151734.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    308   2e-96    
gb|ACU21036.1|  unknown                                                 308   3e-96    Glycine max [soybeans]
ref|XP_010540971.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    307   1e-95    
ref|XP_007152896.1|  hypothetical protein PHAVU_004G169200g             306   2e-95    
ref|XP_009352520.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       307   2e-95    
ref|XP_008390580.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    306   3e-95    
ref|XP_009352521.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       306   5e-95    
ref|XP_008462695.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    305   2e-94    
ref|XP_010249608.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       304   5e-94    
ref|XP_008337508.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    301   4e-93    
gb|KCW82386.1|  hypothetical protein EUGRSUZ_C03790                     297   5e-92    
ref|XP_010049646.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    296   2e-91    
ref|XP_009416728.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    294   1e-90    
ref|XP_009415751.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    295   2e-90    
ref|XP_010254027.1|  PREDICTED: putative RING-H2 finger protein A...    293   6e-90    
ref|XP_010917719.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    291   1e-89    
ref|XP_008337507.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    291   2e-89    
gb|AES76795.2|  RING-H2 finger protein ATL4J                            287   2e-88    
ref|XP_010548699.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    289   2e-88    
ref|XP_008801472.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    286   1e-87    
ref|XP_011081799.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    285   2e-87    
ref|XP_009406216.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    286   4e-87    
ref|XP_010433156.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    284   1e-86    
ref|XP_010049645.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    284   1e-86    
ref|XP_006282599.1|  hypothetical protein CARUB_v10004771mg             285   1e-86    
ref|XP_010447908.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       284   1e-86    
ref|XP_003620577.1|  RING finger family protein                         281   2e-86    
ref|XP_010438372.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    283   3e-86    
gb|KDP34182.1|  hypothetical protein JCGZ_07753                         279   5e-85    
ref|XP_010688281.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       279   2e-84    
gb|KCW79664.1|  hypothetical protein EUGRSUZ_C01015                     272   3e-84    
ref|XP_009137814.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    277   4e-84    
ref|XP_002867435.1|  ring-H2 finger protein ATL4J precursor             276   1e-83    
emb|CDX92900.1|  BnaC07g41580D                                          275   3e-83    
ref|XP_006476134.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    274   5e-83    
ref|XP_011011910.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    273   7e-83    
ref|XP_006412899.1|  hypothetical protein EUTSA_v10025235mg             273   1e-82    
ref|NP_194618.3|  E3 ubiquitin-protein ligase ATL42                     273   1e-82    Arabidopsis thaliana [mouse-ear cress]
gb|EYU20442.1|  hypothetical protein MIMGU_mgv1a025601mg                271   3e-82    
ref|XP_006450676.1|  hypothetical protein CICLE_v10010263mg             271   5e-82    
gb|KCW81558.1|  hypothetical protein EUGRSUZ_C02915                     271   5e-82    
ref|XP_002516536.1|  ring finger protein, putative                      271   6e-82    Ricinus communis
ref|XP_010416391.1|  PREDICTED: putative RING-H2 finger protein A...    270   2e-81    
ref|XP_009129172.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42       266   4e-80    
ref|XP_004151366.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    265   2e-79    
ref|XP_004172921.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    264   5e-79    
emb|CDX97460.1|  BnaC08g13250D                                          263   5e-79    
emb|CDY06859.1|  BnaC01g09580D                                          263   6e-79    
ref|XP_009109068.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    264   6e-79    
ref|XP_002886004.1|  zinc finger family protein                         262   1e-78    
ref|XP_010489106.1|  PREDICTED: putative RING-H2 finger protein A...    261   2e-78    
emb|CDY35230.1|  BnaA01g08010D                                          262   3e-78    
ref|XP_006408917.1|  hypothetical protein EUTSA_v10001998mg             260   9e-78    
ref|XP_006853596.1|  hypothetical protein AMTR_s00056p00027410          261   3e-77    
ref|NP_179593.1|  putative RING-H2 finger protein ATL12                 258   3e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CDY66475.1|  BnaA08g30720D                                          256   4e-76    
ref|XP_006300042.1|  hypothetical protein CARUB_v10016268mg             254   2e-75    
gb|AAU84668.1|  At4g28890                                               253   3e-75    Arabidopsis thaliana [mouse-ear cress]
gb|KFK29441.1|  hypothetical protein AALP_AA7G134800                    253   7e-75    
emb|CAN66948.1|  hypothetical protein VITISV_020095                     264   7e-75    Vitis vinifera
ref|XP_009396630.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    250   6e-74    
ref|XP_009117511.1|  PREDICTED: putative RING-H2 finger protein A...    248   2e-73    
gb|EYU30731.1|  hypothetical protein MIMGU_mgv1a025117mg                247   5e-73    
ref|XP_006371702.1|  hypothetical protein POPTR_0018s00370g             245   8e-73    
emb|CDY13888.1|  BnaA09g43900D                                          245   1e-72    
ref|XP_006655665.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    245   4e-72    
ref|XP_002308607.1|  hypothetical protein POPTR_0006s25600g             244   1e-71    Populus trichocarpa [western balsam poplar]
gb|KEH36058.1|  RING-H2 finger protein ATL4J                            241   3e-71    
ref|XP_007137212.1|  hypothetical protein PHAVU_009G109000g             243   4e-71    
ref|XP_011019810.1|  PREDICTED: putative RING-H2 finger protein A...    242   7e-71    
emb|CDY35921.1|  BnaA07g00660D                                          239   3e-70    
ref|XP_009123853.1|  PREDICTED: putative RING-H2 finger protein A...    239   4e-70    
ref|XP_010049100.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    239   5e-70    
ref|XP_006581445.1|  PREDICTED: putative RING-H2 finger protein A...    239   1e-69    
ref|XP_004501166.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    235   2e-68    
emb|CDX81954.1|  BnaC08g36470D                                          234   6e-68    
ref|XP_007161492.1|  hypothetical protein PHAVU_001G073600g             224   7e-64    
ref|XP_004960965.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    223   2e-63    
ref|XP_007012113.1|  RING/U-box superfamily protein, putative           221   5e-63    
ref|NP_001056520.1|  Os05g0596500                                       221   6e-63    Oryza sativa Japonica Group [Japonica rice]
gb|KHN48455.1|  Putative RING-H2 finger protein ATL12                   220   9e-63    
ref|XP_003545611.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    220   1e-62    
ref|XP_008462696.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    217   1e-61    
ref|XP_008650101.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    202   4e-56    
ref|XP_006389460.1|  hypothetical protein POPTR_0024s00470g             194   2e-53    
ref|XP_002440385.1|  hypothetical protein SORBIDRAFT_09g030900          196   4e-53    Sorghum bicolor [broomcorn]
ref|XP_003565801.1|  PREDICTED: LOW QUALITY PROTEIN: putative RIN...    191   1e-51    
gb|EPS66214.1|  hypothetical protein M569_08563                         183   2e-51    
gb|AFW81364.1|  putative RING zinc finger domain superfamily protein    185   5e-50    
ref|XP_008223826.1|  PREDICTED: RING-H2 finger protein ATL43            187   8e-50    
ref|XP_008453535.1|  PREDICTED: RING-H2 finger protein ATL43            184   3e-49    
ref|XP_007225077.1|  hypothetical protein PRUPE_ppa017787mg             184   5e-49    
ref|XP_004162811.1|  PREDICTED: RING-H2 finger protein ATL43-like       182   2e-48    
ref|XP_010648505.1|  PREDICTED: putative RING-H2 finger protein A...    174   4e-48    
ref|XP_009391100.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    181   1e-47    
ref|XP_010265393.1|  PREDICTED: RING-H2 finger protein ATL43            178   4e-46    
ref|XP_010656869.1|  PREDICTED: RING-H2 finger protein ATL43            176   7e-46    
ref|XP_002511366.1|  ring finger protein, putative                      177   1e-45    Ricinus communis
ref|XP_011069943.1|  PREDICTED: RING-H2 finger protein ATL43-like       175   1e-45    
ref|XP_006474307.1|  PREDICTED: RING-H2 finger protein ATL43-like       175   2e-45    
ref|XP_006453207.1|  hypothetical protein CICLE_v10010271mg             175   4e-45    
emb|CBI17870.3|  unnamed protein product                                174   4e-45    
ref|XP_006374391.1|  hypothetical protein POPTR_0015s06750g             173   5e-45    
ref|XP_004150747.1|  PREDICTED: RING-H2 finger protein ATL43-like       171   5e-45    
ref|XP_006399040.1|  hypothetical protein EUTSA_v10013693mg             173   5e-45    
ref|XP_006359505.1|  PREDICTED: RING-H2 finger protein ATL43-like       173   6e-45    
gb|KDP31067.1|  hypothetical protein JCGZ_11443                         174   1e-44    
ref|XP_010552862.1|  PREDICTED: RING-H2 finger protein ATL43            172   2e-44    
ref|XP_006845712.1|  hypothetical protein AMTR_s00019p00242060          173   2e-44    
emb|CDX70126.1|  BnaA10g24750D                                          170   4e-44    
ref|XP_011007280.1|  PREDICTED: RING-H2 finger protein ATL43            171   4e-44    
ref|XP_009359989.1|  PREDICTED: RING-H2 finger protein ATL43-like       171   9e-44    
ref|XP_008799433.1|  PREDICTED: RING-H2 finger protein ATL43            169   2e-43    
ref|XP_009349243.1|  PREDICTED: RING-H2 finger protein ATL43-like       170   2e-43    
gb|KDO61983.1|  hypothetical protein CISIN_1g016846mg                   167   3e-43    
emb|CDP03011.1|  unnamed protein product                                169   3e-43    
ref|XP_010929293.1|  PREDICTED: RING-H2 finger protein ATL43-like       167   6e-43    
ref|XP_011079276.1|  PREDICTED: RING-H2 finger protein ATL43-like       166   2e-42    
ref|XP_004242728.1|  PREDICTED: RING-H2 finger protein ATL43            166   2e-42    
ref|XP_009417798.1|  PREDICTED: RING-H2 finger protein ATL43-like       166   2e-42    
ref|XP_009602368.1|  PREDICTED: RING-H2 finger protein ATL43            166   4e-42    
ref|XP_009349090.1|  PREDICTED: RING-H2 finger protein ATL43-like       165   1e-41    
ref|XP_009346037.1|  PREDICTED: RING-H2 finger protein ATL43-like       165   1e-41    
gb|KCW80841.1|  hypothetical protein EUGRSUZ_C02205                     163   2e-41    
ref|XP_010927112.1|  PREDICTED: RING-H2 finger protein ATL43-like       164   2e-41    
ref|XP_009785271.1|  PREDICTED: RING-H2 finger protein ATL43            164   2e-41    
ref|XP_001775043.1|  predicted protein                                  168   3e-41    
ref|XP_010048561.1|  PREDICTED: RING-H2 finger protein ATL43            162   5e-41    
ref|XP_010227400.1|  PREDICTED: RING-H2 finger protein ATL43            161   1e-40    
ref|XP_004490488.1|  PREDICTED: RING-H2 finger protein ATL43-like       161   1e-40    
ref|XP_002438934.1|  hypothetical protein SORBIDRAFT_10g028540          161   1e-40    Sorghum bicolor [broomcorn]
ref|XP_004966142.1|  PREDICTED: RING-H2 finger protein ATL43-like       160   2e-40    
ref|XP_008645000.1|  PREDICTED: RING-H2 finger protein ATL43            160   3e-40    
gb|EAZ02219.1|  hypothetical protein OsI_24313                          159   3e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_009122181.1|  PREDICTED: RING-H2 finger protein ATL43            159   5e-40    
ref|XP_004501635.1|  PREDICTED: RING-H2 finger protein ATL43-like       159   6e-40    
gb|KFK25007.1|  hypothetical protein AALP_AA8G054400                    159   6e-40    
emb|CDX98867.1|  BnaC09g49680D                                          157   7e-40    
ref|NP_001058454.2|  Os06g0695900                                       159   7e-40    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97088.1|  predicted protein                                      159   1e-39    
gb|ADK92879.1|  ring H2 finger protein                                  160   1e-39    
dbj|BAD53905.1|  RING zinc finger protein-like                          159   1e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405737.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    154   1e-39    
ref|XP_010558086.1|  PREDICTED: RING-H2 finger protein ATL43-like...    158   1e-39    
ref|XP_010688440.1|  PREDICTED: RING-H2 finger protein ATL43            156   5e-39    
ref|XP_002871181.1|  hypothetical protein ARALYDRAFT_908496             154   1e-38    
gb|ABK24933.1|  unknown                                                 154   4e-38    Picea sitchensis
ref|XP_010107048.1|  RING-H2 finger protein ATL43                       153   8e-38    
ref|XP_006657288.1|  PREDICTED: RING-H2 finger protein ATL43-like       151   1e-37    
ref|XP_010491126.1|  PREDICTED: RING-H2 finger protein ATL43-like       152   2e-37    
ref|XP_006338154.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...    148   2e-37    
ref|XP_010452489.1|  PREDICTED: RING-H2 finger protein ATL43-like       148   3e-36    
ref|XP_006287867.1|  hypothetical protein CARUB_v10001094mg             148   4e-36    
ref|XP_003615295.1|  RING zinc finger protein-like protein              148   4e-36    
ref|XP_010423421.1|  PREDICTED: RING-H2 finger protein ATL43-like       147   6e-36    
ref|XP_003602920.1|  RING zinc finger protein-like protein              147   1e-35    
gb|AES73171.2|  anaphase-promoting complex subunit 11 RING-H2 fin...    147   1e-35    
gb|EYU37302.1|  hypothetical protein MIMGU_mgv1a009321mg                144   5e-35    
ref|XP_007137653.1|  hypothetical protein PHAVU_009G144600g             144   1e-34    
ref|XP_003523773.1|  PREDICTED: RING-H2 finger protein ATL43-like       140   1e-33    
sp|Q5EAE9.2|ATL43_ARATH  RecName: Full=RING-H2 finger protein ATL...    138   1e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301413.1|  PREDICTED: RING-H2 finger protein ATL43-like       137   2e-32    
ref|NP_196200.2|  RING-H2 finger protein ATL43                          135   8e-32    Arabidopsis thaliana [mouse-ear cress]
gb|EPS66471.1|  hypothetical protein M569_08311                         128   5e-31    
emb|CDY05713.1|  BnaC07g00900D                                          126   8e-31    
ref|XP_007047832.1|  RING/U-box superfamily protein, putative           128   2e-29    
ref|XP_002514252.1|  RING-H2 finger protein ATL4J precursor, puta...    123   2e-28    Ricinus communis
emb|CDX74219.1|  BnaA03g28280D                                          123   2e-28    
ref|XP_009134730.1|  PREDICTED: RING-H2 finger protein ATL51-like       123   3e-28    
ref|XP_010056545.1|  PREDICTED: RING-H2 finger protein ATL52-like       124   7e-28    
ref|XP_006287967.1|  hypothetical protein CARUB_v10001202mg             122   2e-27    
emb|CDX92043.1|  BnaC03g33450D                                          120   5e-27    
ref|XP_008232120.1|  PREDICTED: RING-H2 finger protein ATL52-like       121   5e-27    
gb|KHN08798.1|  RING-H2 finger protein ATL51                            118   5e-27    
ref|XP_010266641.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    121   7e-27    
ref|XP_004307157.1|  PREDICTED: RING-H2 finger protein ATL51-like       120   9e-27    
ref|XP_006578406.1|  PREDICTED: RING-H2 finger protein ATL52-like       117   1e-26    
ref|XP_007218185.1|  hypothetical protein PRUPE_ppa007682mg             119   2e-26    
ref|XP_007148807.1|  hypothetical protein PHAVU_005G016000g             117   2e-26    
ref|XP_007029812.1|  RING/U-box superfamily protein, putative           119   3e-26    
ref|XP_008345229.1|  PREDICTED: RING-H2 finger protein ATL51-like       117   9e-26    
ref|XP_010694616.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    117   1e-25    
ref|XP_006466567.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    115   1e-25    
gb|KDO60644.1|  hypothetical protein CISIN_1g014794mg                   117   1e-25    
ref|XP_004957082.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    117   2e-25    
ref|NP_568080.2|  RING-H2 finger protein ATL32                          115   3e-25    Arabidopsis thaliana [mouse-ear cress]
emb|CAB38920.2|  putative protein                                       115   3e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006426309.1|  hypothetical protein CICLE_v10027093mg             118   3e-25    
ref|XP_004138996.1|  PREDICTED: RING-H2 finger protein ATL51-like       115   3e-25    
ref|XP_002866907.1|  predicted protein                                  113   3e-25    
ref|XP_004501681.1|  PREDICTED: RING-H2 finger protein ATL11-like       115   5e-25    
ref|XP_008457172.1|  PREDICTED: RING-H2 finger protein ATL52-like       115   6e-25    
gb|EPS71380.1|  hypothetical protein M569_03379                         111   6e-25    
ref|XP_010549745.1|  PREDICTED: RING-H2 finger protein ATL52-like       114   7e-25    
ref|XP_006484722.1|  PREDICTED: RING-H2 finger protein ATL52-like       114   7e-25    
ref|XP_011014076.1|  PREDICTED: RING-H2 finger protein ATL11-like       115   7e-25    
ref|XP_006437376.1|  hypothetical protein CICLE_v10031956mg             114   7e-25    
ref|XP_010094662.1|  E3 ubiquitin-protein ligase ATL6                   114   7e-25    
ref|XP_011093432.1|  PREDICTED: RING-H2 finger protein ATL52-like...    113   9e-25    
ref|XP_002319229.2|  hypothetical protein POPTR_0013s07100g             114   1e-24    Populus trichocarpa [western balsam poplar]
ref|XP_011093431.1|  PREDICTED: RING-H2 finger protein ATL52-like...    113   1e-24    
gb|KDO46830.1|  hypothetical protein CISIN_1g036833mg                   114   1e-24    
gb|KFK37786.1|  hypothetical protein AALP_AA3G029000                    114   1e-24    
ref|XP_010511717.1|  PREDICTED: RING-H2 finger protein ATL51-like       113   1e-24    
ref|XP_009361402.1|  PREDICTED: RING-H2 finger protein ATL52            113   2e-24    
ref|XP_002884394.1|  zinc finger family protein                         113   2e-24    
gb|ACN37076.1|  unknown                                                 110   2e-24    Zea mays [maize]
gb|KDP41433.1|  hypothetical protein JCGZ_15840                         114   2e-24    
gb|EYU24462.1|  hypothetical protein MIMGU_mgv1a019339mg                112   2e-24    
gb|KFK41641.1|  hypothetical protein AALP_AA2G154100                    113   2e-24    
ref|XP_004494634.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    113   2e-24    
ref|XP_010420490.1|  PREDICTED: RING-H2 finger protein ATL52-like       113   3e-24    
ref|XP_010485695.1|  PREDICTED: RING-H2 finger protein ATL51-like       112   3e-24    
gb|KDO36222.1|  hypothetical protein CISIN_1g045417mg                   109   3e-24    
gb|KHN10200.1|  Putative RING-H2 finger protein ATL12                   111   3e-24    
emb|CDP09319.1|  unnamed protein product                                112   3e-24    
ref|XP_006408292.1|  hypothetical protein EUTSA_v10022279mg             112   4e-24    
ref|XP_010463804.1|  PREDICTED: RING-H2 finger protein ATL51-like       112   5e-24    
ref|XP_010446567.1|  PREDICTED: RING-H2 finger protein ATL32-like       111   5e-24    
ref|XP_002266511.1|  PREDICTED: RING-H2 finger protein ATL51            111   6e-24    Vitis vinifera
gb|EYU20999.1|  hypothetical protein MIMGU_mgv1a008144mg                112   6e-24    
ref|XP_008238231.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    110   6e-24    
ref|XP_010933477.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    112   7e-24    
ref|XP_002319561.2|  hypothetical protein POPTR_0013s02670g             112   7e-24    Populus trichocarpa [western balsam poplar]
ref|XP_010492720.1|  PREDICTED: RING-H2 finger protein ATL52-like       111   8e-24    
ref|XP_007206808.1|  hypothetical protein PRUPE_ppa025826mg             111   8e-24    
gb|KDO59548.1|  hypothetical protein CISIN_1g048010mg                   110   8e-24    
ref|XP_011011235.1|  PREDICTED: RING-H2 finger protein ATL52            111   9e-24    
ref|XP_009131602.1|  PREDICTED: RING-H2 finger protein ATL52            110   1e-23    
ref|XP_002888862.1|  zinc finger family protein                         111   1e-23    
ref|XP_002866909.1|  ring-H2 finger protein ATL4O precursor             110   1e-23    
ref|XP_006433262.1|  hypothetical protein CICLE_v10001478mg             111   1e-23    
ref|XP_006660721.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    111   2e-23    
ref|XP_003530562.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    110   2e-23    
ref|XP_006582382.1|  PREDICTED: RING-H2 finger protein ATL52-like       108   2e-23    
ref|XP_008786322.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    110   2e-23    
ref|XP_003518243.1|  PREDICTED: RING-H2 finger protein ATL11-like       110   2e-23    
ref|XP_006390687.1|  hypothetical protein EUTSA_v10019648mg             110   2e-23    
ref|XP_002873838.1|  hypothetical protein ARALYDRAFT_488627             110   2e-23    
ref|NP_001142103.1|  uncharacterized LOC100274267 precursor             110   2e-23    Zea mays [maize]
ref|XP_008796281.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    108   2e-23    
ref|XP_011012829.1|  PREDICTED: RING-H2 finger protein ATL52-like       108   2e-23    
gb|ABK25333.1|  unknown                                                 111   2e-23    Picea sitchensis
ref|XP_009401256.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    110   2e-23    
ref|XP_003591073.1|  RING finger family protein                         110   3e-23    
emb|CDX78755.1|  BnaA03g06670D                                          109   3e-23    
ref|XP_010097704.1|  RING-H2 finger protein ATL51                       110   3e-23    
ref|XP_004246183.1|  PREDICTED: RING-H2 finger protein ATL52            109   3e-23    
gb|AFK44686.1|  unknown                                                 108   3e-23    
ref|XP_009340178.1|  PREDICTED: RING-H2 finger protein ATL52-like       110   3e-23    
emb|CDY70284.1|  BnaCnng67590D                                          110   3e-23    
gb|EYU42290.1|  hypothetical protein MIMGU_mgv1a009624mg                109   3e-23    
ref|XP_009600267.1|  PREDICTED: RING-H2 finger protein ATL52-like       109   4e-23    
ref|XP_006352946.1|  PREDICTED: RING-H2 finger protein ATL52-like       109   4e-23    
gb|ABR17075.1|  unknown                                                 110   5e-23    
ref|NP_177365.1|  RING-H2 finger protein ATL11                          110   5e-23    
gb|AAO42269.1|  putative RING-H2 zinc finger protein ATL3               110   5e-23    
gb|ABR18008.1|  unknown                                                 109   5e-23    
ref|XP_006471949.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    110   5e-23    
emb|CDX82179.1|  BnaC02g21110D                                          109   5e-23    
gb|EEE69879.1|  hypothetical protein OsJ_29694                          108   6e-23    
ref|XP_007208877.1|  hypothetical protein PRUPE_ppa026237mg             108   6e-23    
ref|XP_010106303.1|  E3 ubiquitin-protein ligase ATL6                   108   6e-23    
ref|XP_008246510.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    109   6e-23    
dbj|BAJ85025.1|  predicted protein                                      109   6e-23    
ref|XP_007018124.1|  RING/U-box superfamily protein, putative           109   7e-23    
gb|EPS64630.1|  hypothetical protein M569_10153                         106   7e-23    
ref|NP_001175877.1|  Os09g0468300                                       109   7e-23    
ref|XP_008347060.1|  PREDICTED: RING-H2 finger protein ATL51-like       107   7e-23    
ref|XP_010654003.1|  PREDICTED: RING-H2 finger protein ATL52-like       107   8e-23    
gb|EAZ09435.1|  hypothetical protein OsI_31707                          109   8e-23    
ref|XP_010942634.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...    110   9e-23    
gb|KHN26109.1|  RING-H2 finger protein ATL11                            108   1e-22    
ref|XP_010919941.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    108   1e-22    
dbj|BAE98353.1|  RING-H2 zinc finger protein-like                       108   1e-22    
ref|XP_004302451.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    108   1e-22    
ref|XP_002284899.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6        108   1e-22    
ref|XP_007156421.1|  hypothetical protein PHAVU_003G284600g             108   1e-22    
ref|NP_197262.1|  RING-H2 finger protein ATL52                          108   1e-22    
ref|XP_002307356.1|  zinc finger family protein                         109   1e-22    
ref|XP_010531590.1|  PREDICTED: RING-H2 finger protein ATL32-like       107   1e-22    
ref|XP_010453960.1|  PREDICTED: RING-H2 finger protein ATL52-like       108   1e-22    
ref|XP_010528863.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...    107   1e-22    
ref|XP_008465985.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    108   1e-22    
ref|XP_010437141.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    107   1e-22    
emb|CAN65773.1|  hypothetical protein VITISV_030410                     106   2e-22    
ref|XP_003602852.1|  RING-H2 finger protein ATL1N                       108   2e-22    
ref|XP_009127908.1|  PREDICTED: RING-H2 finger protein ATL11-like       108   2e-22    
ref|XP_009373974.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    107   2e-22    
ref|XP_009104864.1|  PREDICTED: RING-H2 finger protein ATL11-like       108   2e-22    
ref|XP_002462520.1|  hypothetical protein SORBIDRAFT_02g027200          108   2e-22    
ref|XP_008383650.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    107   2e-22    
gb|KDO40240.1|  hypothetical protein CISIN_1g044619mg                   106   2e-22    
emb|CDX90377.1|  BnaA08g16070D                                          106   2e-22    
ref|XP_007205554.1|  hypothetical protein PRUPE_ppa008615mg             106   3e-22    
ref|XP_008235322.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...    107   3e-22    
ref|XP_006301256.1|  hypothetical protein CARUB_v10021656mg             107   3e-22    
gb|KHN10162.1|  E3 ubiquitin-protein ligase                             107   3e-22    
ref|XP_002882402.1|  hypothetical protein ARALYDRAFT_477807             107   3e-22    
dbj|BAK03766.1|  predicted protein                                      107   3e-22    
ref|XP_007039473.1|  RING/U-box superfamily protein, putative           107   4e-22    
ref|XP_002527667.1|  ring finger protein, putative                      107   4e-22    
ref|XP_004136192.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    107   4e-22    
emb|CBI36742.3|  unnamed protein product                                108   4e-22    
ref|NP_566249.1|  E3 ubiquitin-protein ligase ATL6                      107   4e-22    
ref|XP_004512518.1|  PREDICTED: RING-H2 finger protein ATL52-like       107   4e-22    
gb|AAL86301.1|  putative RING-H2 zinc finger protein ATL6               107   4e-22    
ref|XP_009109425.1|  PREDICTED: RING-H2 finger protein ATL32            105   4e-22    
gb|AAF27026.1|AC009177_16  putative RING-H2 zinc finger protein ATL6    107   4e-22    
ref|XP_003626315.1|  RING finger protein                                106   4e-22    
ref|XP_007136289.1|  hypothetical protein PHAVU_009G033900g             106   4e-22    
emb|CAN78205.1|  hypothetical protein VITISV_014334                     109   5e-22    
ref|XP_004289484.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    106   5e-22    
ref|XP_002310500.2|  hypothetical protein POPTR_0007s03610g             105   5e-22    
emb|CDY21202.1|  BnaA01g34330D                                          106   5e-22    
ref|XP_007147071.1|  hypothetical protein PHAVU_006G093800g             107   5e-22    
ref|XP_010273154.1|  PREDICTED: RING-H2 finger protein ATL52-like       106   5e-22    
ref|XP_010681031.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...    105   5e-22    
ref|XP_010538288.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...    106   5e-22    
ref|XP_004241959.1|  PREDICTED: RING-H2 finger protein ATL51-like       106   5e-22    
ref|XP_010424603.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    107   6e-22    
ref|XP_008373581.1|  PREDICTED: RING-H2 finger protein ATL51-like       106   6e-22    
ref|XP_009119307.1|  PREDICTED: RING-H2 finger protein ATL51-like       105   6e-22    
ref|XP_011023551.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6        106   6e-22    
ref|XP_009373830.1|  PREDICTED: RING-H2 finger protein ATL52-like       105   7e-22    
ref|XP_009801626.1|  PREDICTED: RING-H2 finger protein ATL52-like       104   7e-22    
emb|CDX70770.1|  BnaC03g08540D                                          105   7e-22    
ref|XP_002325888.2|  hypothetical protein POPTR_0019s06070g             105   8e-22    
ref|XP_006428433.1|  hypothetical protein CICLE_v10013874mg             104   8e-22    
ref|XP_006382625.1|  hypothetical protein POPTR_0005s03900g             106   8e-22    
ref|XP_010096552.1|  RING-H2 finger protein ATL51                       105   9e-22    
emb|CDY39477.1|  BnaC03g60870D                                          105   9e-22    
ref|XP_010550113.1|  PREDICTED: RING-H2 finger protein ATL46-like       105   9e-22    
emb|CDX82175.1|  BnaC02g21150D                                          103   9e-22    
ref|XP_010485951.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6        106   9e-22    
ref|XP_007158291.1|  hypothetical protein PHAVU_002G140300g             105   9e-22    
emb|CDP01523.1|  unnamed protein product                                106   1e-21    
ref|XP_006284157.1|  hypothetical protein CARUB_v10005290mg             104   1e-21    
gb|AAO45753.1|  RING/c3HC4/PHD zinc finger-like protein                 105   1e-21    
ref|XP_009787127.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    105   1e-21    
ref|XP_006299622.1|  hypothetical protein CARUB_v10015801mg             105   1e-21    
ref|XP_008775202.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31       106   1e-21    
ref|XP_003615195.1|  RING finger-like protein                           105   1e-21    
ref|XP_003523802.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...    105   1e-21    
gb|AES98153.2|  RING-H2 zinc finger protein                             105   1e-21    
ref|XP_011092013.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...    105   1e-21    
ref|XP_003527893.1|  PREDICTED: RING-H2 finger protein ATL11-like       104   1e-21    
ref|NP_001131506.1|  uncharacterized protein LOC100192844 precursor     105   1e-21    
ref|XP_009396850.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    105   1e-21    
ref|XP_010525015.1|  PREDICTED: RING-H2 finger protein ATL52-like       105   2e-21    
tpg|DAA47756.1|  TPA: putative RING zinc finger domain superfamil...    105   2e-21    
gb|KHN04013.1|  E3 ubiquitin-protein ligase ATL6                        102   2e-21    
ref|XP_010428084.1|  PREDICTED: RING-H2 finger protein ATL11-like...    105   2e-21    
ref|XP_010471239.1|  PREDICTED: RING-H2 finger protein ATL11-like...    105   2e-21    
ref|XP_010428085.1|  PREDICTED: RING-H2 finger protein ATL11-like...    105   2e-21    
ref|XP_008652817.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31       105   2e-21    
ref|XP_006411811.1|  hypothetical protein EUTSA_v10025687mg             104   2e-21    
ref|XP_008355676.1|  PREDICTED: RING-H2 finger protein ATL52-like       105   2e-21    
ref|XP_010068825.1|  PREDICTED: RING-H2 finger protein ATL74-like       102   2e-21    
emb|CDP15547.1|  unnamed protein product                                105   2e-21    
ref|XP_009371215.1|  PREDICTED: RING-H2 finger protein ATL52-like       105   2e-21    
ref|XP_011086388.1|  PREDICTED: RING-H2 finger protein ATL52-like       104   2e-21    
ref|XP_004152750.1|  PREDICTED: RING-H2 finger protein ATL11-like       104   2e-21    
ref|XP_003520817.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    104   2e-21    
emb|CDX82176.1|  BnaC02g21140D                                          104   3e-21    
ref|XP_007141223.1|  hypothetical protein PHAVU_008G177600g             104   3e-21    
ref|XP_004139190.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    104   3e-21    
ref|XP_008454907.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6        105   3e-21    
gb|ABR16339.1|  unknown                                                 105   4e-21    
ref|XP_010414840.1|  PREDICTED: RING-H2 finger protein ATL11-like       104   4e-21    
ref|XP_001771439.1|  predicted protein                                99.8    4e-21    
emb|CDY18787.1|  BnaAnng02520D                                          104   4e-21    
emb|CDY53236.1|  BnaCnng24690D                                          103   5e-21    
ref|XP_006297819.1|  hypothetical protein CARUB_v10013853mg             104   5e-21    
ref|XP_010460006.1|  PREDICTED: E3 ubiquitin-protein ligase ATL15...    103   5e-21    
emb|CDY49949.1|  BnaCnng18590D                                          103   5e-21    
gb|KFK30397.1|  hypothetical protein AALP_AA7G255900                    102   5e-21    
ref|XP_002303424.2|  hypothetical protein POPTR_0003s09190g             103   5e-21    
gb|KFK25988.1|  ring-h2 zinc finger                                     102   6e-21    
ref|XP_003578264.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    103   6e-21    
ref|XP_010929214.1|  PREDICTED: RING-H2 finger protein ATL13-like       104   6e-21    
ref|XP_010060061.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6        103   7e-21    
ref|XP_006828605.1|  hypothetical protein AMTR_s00129p00065710          102   7e-21    
ref|XP_006838539.1|  hypothetical protein AMTR_s00002p00198340          103   7e-21    
ref|XP_009124070.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    103   7e-21    
ref|XP_010464039.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    103   7e-21    
ref|XP_003554663.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    103   7e-21    
emb|CDY34972.1|  BnaA01g27620D                                          102   7e-21    
ref|XP_009384705.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    103   7e-21    
ref|XP_002870193.1|  hypothetical protein ARALYDRAFT_329916             101   7e-21    
emb|CBI19213.3|  unnamed protein product                                102   8e-21    
gb|AES95832.2|  RING-H2 zinc finger protein                             103   8e-21    
ref|XP_010421832.1|  PREDICTED: putative RING-H2 finger protein A...    102   9e-21    
ref|XP_009128545.1|  PREDICTED: RING-H2 finger protein ATL11-like       103   9e-21    
ref|XP_009403056.1|  PREDICTED: RING-H2 finger protein ATL13-like       103   9e-21    
gb|KDP23544.1|  hypothetical protein JCGZ_23377                         103   1e-20    
ref|XP_003517915.1|  PREDICTED: RING-H2 finger protein ATL51-like       102   1e-20    
gb|EAY87141.1|  hypothetical protein OsI_08541                          102   1e-20    
ref|XP_011094561.1|  PREDICTED: RING-H2 finger protein ATL52-like       101   1e-20    
ref|XP_002284024.1|  PREDICTED: RING-H2 finger protein ATL11            103   1e-20    
ref|XP_004964951.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...    103   1e-20    
gb|KDP29597.1|  hypothetical protein JCGZ_19124                         102   1e-20    
gb|KGN60885.1|  hypothetical protein Csa_2G021560                       103   1e-20    
ref|XP_010554009.1|  PREDICTED: RING-H2 finger protein ATL46 isof...    102   1e-20    
ref|XP_006355967.1|  PREDICTED: RING-H2 finger protein ATL46-like       102   1e-20    
ref|XP_010554007.1|  PREDICTED: RING-H2 finger protein ATL46 isof...    102   1e-20    
ref|XP_008438300.1|  PREDICTED: RING-H2 finger protein ATL52-like       102   1e-20    
ref|XP_009114556.1|  PREDICTED: RING-H2 finger protein ATL2-like        100   1e-20    
ref|XP_004973712.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    103   1e-20    
ref|XP_011078748.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    102   1e-20    
ref|XP_007030911.1|  RING/U-box superfamily protein, putative iso...    102   2e-20    
gb|AAD33584.1|AF132016_1  RING-H2 zinc finger protein ATL6              102   2e-20    
emb|CDP15314.1|  unnamed protein product                                101   2e-20    
ref|XP_011028171.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    102   2e-20    
ref|XP_010504990.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...    102   2e-20    
ref|XP_010535271.1|  PREDICTED: RING-H2 finger protein ATL11-like       102   2e-20    
ref|XP_010043099.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    102   2e-20    
gb|KCW72235.1|  hypothetical protein EUGRSUZ_E00679                     102   2e-20    
emb|CDX84269.1|  BnaC04g10310D                                          102   2e-20    
ref|XP_010055725.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...    102   2e-20    
gb|ABF19017.1|  At4g33565                                             99.4    2e-20    
gb|EYU46743.1|  hypothetical protein MIMGU_mgv1a017988mg                100   2e-20    
dbj|BAG50068.1|  transcription factor C3H                               102   2e-20    
ref|XP_003570138.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    102   2e-20    
ref|XP_010039058.1|  PREDICTED: RING-H2 finger protein ATL52-like       100   2e-20    
ref|NP_181045.1|  E3 ubiquitin-protein ligase ATL9                      102   3e-20    
ref|XP_003544226.1|  PREDICTED: RING-H2 finger protein ATL11-like       102   3e-20    
gb|KHN35479.1|  RING-H2 finger protein ATL11                            102   3e-20    
ref|XP_006416193.1|  hypothetical protein EUTSA_v10007970mg             101   3e-20    
ref|XP_004489862.1|  PREDICTED: RING-H2 finger protein ATL47-like       101   3e-20    
ref|XP_003612874.1|  RING-H2 finger protein ATL3A                       103   3e-20    
ref|XP_011085813.1|  PREDICTED: RING-H2 finger protein ATL46            101   3e-20    
ref|XP_009373423.1|  PREDICTED: RING-H2 finger protein ATL54-like       101   3e-20    
ref|NP_199155.1|  RING-H2 finger protein                                101   3e-20    
ref|XP_010477511.1|  PREDICTED: E3 ubiquitin-protein ligase ATL15       101   3e-20    
ref|XP_006403239.1|  hypothetical protein EUTSA_v10003389mg             101   3e-20    
ref|XP_004487181.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  99.4    4e-20    
gb|KDP29738.1|  hypothetical protein JCGZ_18673                         101   4e-20    
ref|XP_004134368.1|  PREDICTED: RING-H2 finger protein ATL51-like       101   4e-20    
ref|XP_002452716.1|  hypothetical protein SORBIDRAFT_04g031240          101   4e-20    
ref|XP_009123117.1|  PREDICTED: E3 ubiquitin-protein ligase ATL15...    101   4e-20    
gb|KFK37923.1|  hypothetical protein AALP_AA3G048000                    101   4e-20    
ref|XP_009123118.1|  PREDICTED: E3 ubiquitin-protein ligase ATL15...    100   4e-20    
ref|XP_007215560.1|  hypothetical protein PRUPE_ppa007393mg             100   4e-20    
ref|XP_009388408.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    100   4e-20    
ref|XP_009143716.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9        100   5e-20    
ref|XP_006408102.1|  hypothetical protein EUTSA_v10020868mg             101   5e-20    
ref|NP_001047796.1|  Os02g0692000                                       101   5e-20    
gb|KHN38932.1|  E3 ubiquitin-protein ligase                             100   5e-20    
emb|CDY31657.1|  BnaA05g08900D                                          100   5e-20    
emb|CDX86162.1|  BnaA06g28790D                                        99.8    5e-20    
gb|EAZ24248.1|  hypothetical protein OsJ_07998                          100   5e-20    
ref|XP_006587595.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    100   6e-20    
ref|XP_010516668.1|  PREDICTED: E3 ubiquitin-protein ligase ATL9-...    100   6e-20    
ref|XP_004301345.1|  PREDICTED: RING-H2 finger protein ATL11-like       100   6e-20    
ref|XP_007048259.1|  RING/U-box superfamily protein, putative         97.8    6e-20    
ref|XP_010533077.1|  PREDICTED: RING-H2 finger protein ATL47-like       100   6e-20    
ref|XP_003534279.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...    100   6e-20    
ref|XP_006282187.1|  hypothetical protein CARUB_v10028453mg             100   7e-20    
ref|XP_010055314.1|  PREDICTED: RING-H2 finger protein ATL51-like...    100   7e-20    
ref|XP_002865424.1|  hypothetical protein ARALYDRAFT_494656             100   7e-20    
ref|XP_008230634.1|  PREDICTED: RING-H2 finger protein ATL46-like       100   7e-20    
ref|XP_002521028.1|  ring finger protein, putative                      100   7e-20    
ref|XP_006476747.1|  PREDICTED: RING-H2 finger protein ATL46-like       100   8e-20    
ref|XP_011012736.1|  PREDICTED: RING-H2 finger protein ATL54-like       100   8e-20    
emb|CDY11679.1|  BnaC06g12870D                                          100   8e-20    
ref|XP_010053619.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    100   8e-20    



>ref|XP_009785883.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Nicotiana 
sylvestris]
Length=423

 Score =   383 bits (983),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 276/388 (71%), Gaps = 37/388 (10%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS--ILNTT  1096
             VKAQ P    P++     ++FQPSL VVIG+L+IMFSLTF LLLYAKFCH AS  + N+T
Sbjct  28    VKAQVP----PSEDEDVVSSFQPSLAVVIGVLSIMFSLTFLLLLYAKFCHMASSSVRNST  83

Query  1095  --LQIPDALLGSWRR-SSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
               + I D L+ S    SSGIDKTVVESLPFFRFS ++GS++GLEC VCLS+FEDIEILRL
Sbjct  84    NIMHIQDGLVRSVLSCSSGIDKTVVESLPFFRFSFIRGSKQGLECVVCLSKFEDIEILRL  143

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCS--DSREESSLG  751
             LPKCKHAFHI CID+WLEKHS+CPLCRHKV+A+DLSL+ +S SLRFL +  + REES+L 
Sbjct  144   LPKCKHAFHIDCIDKWLEKHSTCPLCRHKVSAQDLSLLTYSDSLRFLWNQPELREESNLE  203

Query  750   LYIQRQES----FKFGSRKIKKDEKLPI--------QNDQSLQKPLHHLNHRIIVSDVVL  607
             LYIQR E+    F  GS   KK+E+LPI        Q D   QK LH  NHRIIVSDVV 
Sbjct  204   LYIQRGENGSSRFSIGS-SFKKEEELPIQENNIDNQQTDYQNQKALHRFNHRIIVSDVVF  262

Query  606   KNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMER  427
             KNRWS+V+SSDLI LNSE++     +S+   +    S    +K   +E Q ++IK+EMER
Sbjct  263   KNRWSTVTSSDLIFLNSEMLNS--MASNRFSSMDRISEQSTAKRVIEEDQRVNIKDEMER  320

Query  426   KRLFEIKVNKNNPS-FPIPTT--YAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC----  268
             KRLFE K+ +N+ S FP  +      +K+LSQ EK+ MSEI+VHPRF + N ++      
Sbjct  321   KRLFESKIQQNDLSQFPEASESRTNSSKSLSQNEKKCMSEIIVHPRFIDFNNKNIGNRKL  380

Query  267   ----DVVSDERRRKLWLPIARRTVQWFA  196
                 + V++ERRRKLWLPIARRTV+WFA
Sbjct  381   LVPQNNVNEERRRKLWLPIARRTVKWFA  408



>ref|XP_011093623.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Sesamum indicum]
Length=433

 Score =   370 bits (950),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 220/409 (54%), Positives = 279/409 (68%), Gaps = 57/409 (14%)
 Frame = -1

Query  1272  NVKAQHPST---IIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI--  1108
             +VKAQ+PS    ++P      +N FQPSL VVIG+L+IMF+LTF LLLYAKFCHRAS   
Sbjct  17    DVKAQNPSESTEVMPPQDDSISNNFQPSLAVVIGMLSIMFALTFILLLYAKFCHRASSSG  76

Query  1107  LNTTL-QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEIL  931
              NTT  QI D LL S   +SG+DKTVVESLPFFRFSSLKGSR+GLECSVCL+++ED+EIL
Sbjct  77    YNTTSHQIQDGLLRSRSAASGLDKTVVESLPFFRFSSLKGSRDGLECSVCLAKYEDVEIL  136

Query  930   RLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCS--DSREESS  757
             RLLPKC+HAFHI CIDQWLEKHS+CPLCR K++A+DL+    S+SLRFL S  ++REES+
Sbjct  137   RLLPKCRHAFHIGCIDQWLEKHSTCPLCRRKLSADDLTC---STSLRFLWSQAEAREESN  193

Query  756   LGLYIQRQES------FKFGS------RKIKKDEKLPIQ------NDQSLQKPLHHLNHR  631
             L LY+QR+ES      F  GS      R   K+E+LPIQ      ++   Q PLH  NH+
Sbjct  194   LELYVQREESRYGSSRFSIGSSFRKADRGSNKEEELPIQQGMDSDDENHKQPPLHRFNHK  253

Query  630   I-IVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQS  454
             I ++SDVVLK+RWS+VSSSDL+ LNSE++ D  S+  S L           +   ++   
Sbjct  254   INVMSDVVLKHRWSNVSSSDLMFLNSEMLNDVSSARFSCL----------DEEIREDDGI  303

Query  453   MSIKEEMERKRLFEIKV------NKNNPSFPIPTTYAE---------TKNLSQKEKRSMS  319
             M++K+EM RKR  E KV      ++ + SFP PT+            +K L+  EKRSMS
Sbjct  304   MNVKQEMGRKRELESKVREIRQADQAHNSFPFPTSSDSKQLPNPGFGSKALNPSEKRSMS  363

Query  318   EIVVHPRFRNGNV--QDYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
             EI+VHPRF    V  +  C  V +ER+R+LWLPIAR+TVQWFA RE R+
Sbjct  364   EIIVHPRFSTELVRSEASCVDVREERKRRLWLPIARKTVQWFANREGRA  412



>ref|XP_006338153.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like isoform X1 
[Solanum tuberosum]
Length=350

 Score =   367 bits (941),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 213/369 (58%), Positives = 258/369 (70%), Gaps = 48/369 (13%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT  1096
             NVKA+     +P   S D  ++FQPSL VVIG+L IMFSLTFFLLLYAKFCH AS   + 
Sbjct  14    NVKAED----LPTSSSQDVVSSFQPSLAVVIGVLFIMFSLTFFLLLYAKFCHTAS---SH  66

Query  1095  LQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPK  916
             +Q    L+ S  RSSGIDKTVVESLPFFRFS L+GS++GLEC VCLS+FEDIEILRL+P 
Sbjct  67    IQNDGGLVRSVSRSSGIDKTVVESLPFFRFSLLRGSKQGLECCVCLSKFEDIEILRLIPM  126

Query  915   CKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSRE-----ESSLG  751
             CKHAFHI+CIDQWLEKHS+CPLCRHK++ EDLSL+ +S SLRFL S S E     ES+L 
Sbjct  127   CKHAFHINCIDQWLEKHSTCPLCRHKISCEDLSLLTYSDSLRFLWSQSEELVRDDESNLE  186

Query  750   LYIQRQESFKFGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
             +YI+R+E+           E+LPIQ     +K LH  NHRIIVSDVV KNRWS+V+SSDL
Sbjct  187   IYIEREEN---------GTEELPIQ-----EKELHRFNHRIIVSDVVFKNRWSNVTSSDL  232

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN  391
             I LNSE++    S+  SS+      S+       +E QS++IK+EMERKRLF+ K+ K  
Sbjct  233   IFLNSEMLNGMTSNRFSSMDRNAEQSTVI-----EEEQSINIKDEMERKRLFDSKLIK--  285

Query  390   PSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRT  211
                        +K L   EKRSMSEI+++ RF N N +     V DERRRKLWLPIARRT
Sbjct  286   -----------SKCLVADEKRSMSEIILYSRFNNRNRELS---VRDERRRKLWLPIARRT  331

Query  210   VQWFAKRER  184
             V+WFA RER
Sbjct  332   VKWFANRER  340



>ref|XP_009610478.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Nicotiana tomentosiformis]
Length=432

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 267/387 (69%), Gaps = 49/387 (13%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS--ILNTT--LQIPDALLGSWRRSS  1051
              ++FQPSL VVIG+L+IMFSLTF LLLYAKFCHRAS  + N+T  + I D L+ S    S
Sbjct  44    VSSFQPSLAVVIGVLSIMFSLTFLLLLYAKFCHRASSSVHNSTNIMHIQDGLVRSVL--S  101

Query  1050  GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLE  871
             GIDKTVVESLPFFRFS ++GS++GLEC+VCLS+FEDIEILRLLPKCKHAFHI CID+WLE
Sbjct  102   GIDKTVVESLPFFRFSFIRGSKQGLECAVCLSKFEDIEILRLLPKCKHAFHIDCIDKWLE  161

Query  870   KHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQES------------  727
              HS+CPLCRHKV+A+DLSL+  S SLRFL S+ R ES+L LYIQR+ES            
Sbjct  162   NHSTCPLCRHKVSAQDLSLLTSSESLRFL-SELRGESNLELYIQREESNLELYIQREENG  220

Query  726   ---FKFG-----SRKIKKDEKLPI---------QNDQSLQKPLHHLNHRIIVSDVVLKNR  598
                F  G     S K  K+E+LPI         Q D   QK LH LNHRIIVSDVV KNR
Sbjct  221   SSRFSIGSSFKKSEKGNKEEELPIQENNIDNQQQTDYQNQKALHRLNHRIIVSDVVFKNR  280

Query  597   WSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRL  418
             WS+V+SSDLI LNSE++         S  +     S   +   +E Q M+IK+EMERKRL
Sbjct  281   WSNVTSSDLIFLNSEMLNSN----RFSSMDRITEQSTAKRVIEEEGQRMNIKDEMERKRL  336

Query  417   FEIKVNK---NNPS-FPIPTT--YAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVS  256
             FE K +K   N+ S FP  +      +K+LSQ EKR MSEI+VHPRF + N+ +      
Sbjct  337   FESKFSKFQQNDLSQFPEASESRTNSSKSLSQNEKRCMSEIIVHPRFNSNNIGNR---KL  393

Query  255   DERRRKLWLPIARRTVQWFAKRERRSA  175
              ERRRKLW+PIARRTV+WFA RER+S+
Sbjct  394   SERRRKLWVPIARRTVKWFANRERKSS  420



>emb|CDP03287.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   364 bits (934),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 218/395 (55%), Positives = 269/395 (68%), Gaps = 44/395 (11%)
 Frame = -1

Query  1227  SPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI--LNTTLQIPDALLGSWRR  1057
             SPD  T FQPSL VVIGILAIMFSLTF LLLYAKFC   S   + T LQI D L  S  R
Sbjct  57    SPDAVTNFQPSLAVVIGILAIMFSLTFILLLYAKFCRSTSSNSVRTNLQITDGLPRSRSR  116

Query  1056  SSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
              SGIDKTV+ESLPFFRFSSLKGSREGLEC++CLS+FEDIE+LRLLPKCKHAFHI+C+D+W
Sbjct  117   FSGIDKTVIESLPFFRFSSLKGSREGLECAICLSKFEDIEVLRLLPKCKHAFHINCLDEW  176

Query  876   LEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQRQES------FK  721
             LEKHSSCPLCRHK++A+DLS   +S+SLRF+ +++  +EES++ LY+QR+ES      F 
Sbjct  177   LEKHSSCPLCRHKISADDLSSFTYSNSLRFMWNEAELKEESNMELYVQREESCLGSSRFS  236

Query  720   FGS--RKIKKD---EKLPIQNDQSLQ---KPLHHLNHRIIVSDVVL-KNRWSSVSSSDLI  568
               S  RK  KD   ++LPIQ +       K  H  NH+I+VSDVVL KNRWS+VSSSDL+
Sbjct  237   IASSYRKTGKDVKEDELPIQLNGDADENGKIFHKFNHKIVVSDVVLMKNRWSNVSSSDLM  296

Query  567   ALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK--N  394
              LNSE++    S   S+L +     S  ++   D  + M+IK+EM+RKR FEIK +K  +
Sbjct  297   FLNSEMLNHVSSDRFSALESGITGQSTPTRVIGDG-ELMNIKQEMDRKREFEIKFSKIQH  355

Query  393   NPSFPIPTTYA-------------ETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCD----  265
             N SFP    +A             E+  L+  EKRSMSEI+V PRFR  N ++  D    
Sbjct  356   NDSFPPLPNFARASSGSKGDSRINESNVLNPSEKRSMSEIIVRPRFREFNTRNNDDREPS  415

Query  264   ----VVSDERRRKLWLPIARRTVQWFAKRERRSAH  172
                  V +E+ R+LWLPIARRT QWFA RER S  
Sbjct  416   NPENSVKEEKIRRLWLPIARRTAQWFANRERGSTQ  450



>ref|XP_002280643.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Vitis vinifera]
Length=423

 Score =   352 bits (903),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 210/399 (53%), Positives = 268/399 (67%), Gaps = 45/399 (11%)
 Frame = -1

Query  1236  NDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWR  1060
             N  S D  T F+PSL VVIGILA+MF LTF LL+YAK CHRAS  N+  +    L  S  
Sbjct  29    NFSSQDAVTAFKPSLAVVIGILAVMFLLTFILLVYAKLCHRAS--NSDRENQQGLTRSES  86

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R SGIDKTV+ESLPFFRF SLKGS+EGLEC+VCLS+FEDIEILRLLPKCKHAFHI C+DQ
Sbjct  87    RFSGIDKTVIESLPFFRFCSLKGSKEGLECAVCLSKFEDIEILRLLPKCKHAFHIDCVDQ  146

Query  879   WLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQRQES------F  724
             WLEKHSSCPLCRHKV+AEDL+++ +S+SLRFL + S  RE S+L L++QR+E       F
Sbjct  147   WLEKHSSCPLCRHKVSAEDLAILTYSNSLRFLWNQSELRENSNLELFVQREEDHHGSSRF  206

Query  723   KFGS------RKIKKDEKLPIQ---NDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
               GS      + +K++E + IQ   +D   +K LH +NH+IIVSDVVLKNRWSSVSSSDL
Sbjct  207   SIGSSFRKVEKGVKEEESVLIQEEEDDNDDEKILHKINHKIIVSDVVLKNRWSSVSSSDL  266

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN  391
             + LNSEL+     + SS       S++     P ++ + M IKEE+ERKR+FE +V++ N
Sbjct  267   MYLNSELVH----AMSSDRFASLDSNNSAMGRPIEDWEVMKIKEEIERKRIFESRVSRIN  322

Query  390   PSFPI-----PTTYAETKN-------LSQKEKRSMSEIVVHPRFRNGNVQDYC-------  268
              S P+     P+T     N       L   EKRSMSEI    R+ + + ++         
Sbjct  323   HSNPVSSSGLPSTSKTEANSGHASRFLHPTEKRSMSEITACSRYADFSTKNRIRESSLAQ  382

Query  267   DVVSDERRRKLWLPIARRTVQWFAKRE--RRSAHESQIP  157
             + + +ER R+LWLPIARRTV+WFA RE  ++S +  Q P
Sbjct  383   NNIKEERMRRLWLPIARRTVEWFANREGSQQSQNTKQAP  421



>ref|XP_006451246.1| hypothetical protein CICLE_v10010254mg [Citrus clementina]
 gb|ESR64486.1| hypothetical protein CICLE_v10010254mg [Citrus clementina]
 gb|KDO66492.1| hypothetical protein CISIN_1g041871mg [Citrus sinensis]
Length=415

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 275/407 (68%), Gaps = 43/407 (11%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V+AQ   +I  +  SPDT + F+PSL VVIGIL +MF LTF LLLYAKFCHRAS L    
Sbjct  5     VEAQ---SIADDSPSPDTVSNFKPSLAVVIGILCVMFILTFILLLYAKFCHRASSLFANT  61

Query  1092  QIPD-ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPK  916
             QI + AL+ S  R SGIDK V+ESLPFFRFSSLKGS++GLEC+VCLS+FED EILRLLPK
Sbjct  62    QIHNPALIRSTSRFSGIDKAVIESLPFFRFSSLKGSKQGLECAVCLSKFEDTEILRLLPK  121

Query  915   CKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYI  742
             CKHAFHI CIDQWLEKHSSCPLCR KV AED ++  +S+S+RF+ ++S  RE+S++ L+I
Sbjct  122   CKHAFHISCIDQWLEKHSSCPLCRLKVNAEDPTIFAYSNSMRFMFNNSERREDSNIELFI  181

Query  741   QRQES------FKFGS--RKIK---KDEKLPIQ----NDQSLQKPLHHLNHRIIVSDVVL  607
             QR+E       F  GS  RK K   K+E+L IQ    +    ++ LH  NH+IIVSDV+ 
Sbjct  182   QREEEHRGSSRFSIGSSFRKNKEPNKEEELLIQEEAVDGDDDERILHKHNHKIIVSDVIF  241

Query  606   KNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMER  427
             KNRWSS SSSDL+ LNSELI D  S+  S+  +    S+  +   +++I  + IKEEME 
Sbjct  242   KNRWSSASSSDLMLLNSELINDMSSNRFSNPNDFGQFSTKRAIENNEQI--LKIKEEMEM  299

Query  426   KRLFEIK---VNKNNPSF---PIPTTYAETKNLSQ----------KEKRSMSEIVVHPRF  295
             KRLFE K   ++K +P      +P++    K +S            +++SMSEI    RF
Sbjct  300   KRLFENKFSTISKTSPGVLVPNVPSSSGSNKIISSLNTSRTINPTTDRKSMSEITAVSRF  359

Query  294   RNGNVQDY---CDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
             ++  +++      +  +ER R+LWLPIARRTVQWFA RERRS  +SQ
Sbjct  360   QDLGMKNRIRESSIDGNERTRRLWLPIARRTVQWFADRERRSRQQSQ  406



>ref|XP_006494326.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Citrus sinensis]
Length=428

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 275/407 (68%), Gaps = 43/407 (11%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V+AQ   +I  +  SPDT + F+PSL VVIGIL +MF LTF LLLYAKFCHRAS L    
Sbjct  18    VEAQ---SIADDSPSPDTVSNFKPSLAVVIGILCVMFILTFILLLYAKFCHRASSLFANT  74

Query  1092  QIPD-ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPK  916
             QI + AL+ S  R SGIDK V+ESLPFFRFSSLKGS++GLEC+VCLS+FED EILRLLPK
Sbjct  75    QIHNPALIRSTSRFSGIDKAVIESLPFFRFSSLKGSKQGLECAVCLSKFEDTEILRLLPK  134

Query  915   CKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYI  742
             CKHAFHI CIDQWLEKHSSCPLCR KV AED ++  +S+S+RF+ ++S  RE+S++ L+I
Sbjct  135   CKHAFHISCIDQWLEKHSSCPLCRLKVNAEDPTIFAYSNSMRFMFNNSERREDSNIELFI  194

Query  741   QRQES------FKFGS--RKIK---KDEKLPIQND----QSLQKPLHHLNHRIIVSDVVL  607
             QR+E       F  GS  RK K   K+E+L IQ +       ++ LH  NH+IIVSDV+ 
Sbjct  195   QREEEHRGSSRFSIGSSFRKNKEPNKEEELLIQEEAVDGDDDERILHKHNHKIIVSDVIF  254

Query  606   KNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMER  427
             KNRWSS SSSDL+ LNSELI D  S+  S+  +    S+  +   +++I  + IKEEME 
Sbjct  255   KNRWSSASSSDLMLLNSELINDMSSNRFSNPNDFGQFSTKRAIENNEQI--LKIKEEMEM  312

Query  426   KRLFEIK---VNKNNPSF---PIPTTYAETKNLSQ----------KEKRSMSEIVVHPRF  295
             KRLFE K   ++K +P      +P++    K +S            +++SMSEI    RF
Sbjct  313   KRLFENKFSTISKTSPGVLVPNVPSSSGSNKIISSLNTSRTINPTTDRKSMSEITAVSRF  372

Query  294   RNGNVQDY---CDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
             ++  +++      +  +ER R+LWLPIARRTVQWFA RERRS  +SQ
Sbjct  373   QDLGMKNRIRESSIDGNERTRRLWLPIARRTVQWFADRERRSRQQSQ  419



>ref|XP_009612404.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Nicotiana 
tomentosiformis]
Length=405

 Score =   340 bits (873),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 198/384 (52%), Positives = 243/384 (63%), Gaps = 74/384 (19%)
 Frame = -1

Query  1242  IPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDAL-LGS  1066
             +P+ Q+   N FQPS+ VVIG+L++MF LTF LLLYAKFC R+     T QI D L L  
Sbjct  31    MPSSQNAAANNFQPSIAVVIGVLSLMFCLTFLLLLYAKFCRRSPPPVHTTQIQDGLILPV  90

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R SSGIDKT++ESLPFFRFS LKGS++GLEC+VCLSRFED+EILRLLPKCKHAFHI+CI
Sbjct  91    TRSSSGIDKTIIESLPFFRFSLLKGSKDGLECAVCLSRFEDVEILRLLPKCKHAFHINCI  150

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQRQES-----  727
             DQWLEKHSSCPLCRHKV+AED SL+ +S+S RFL + S  RE+S+L LY+QR+E+     
Sbjct  151   DQWLEKHSSCPLCRHKVSAEDHSLLTYSNSFRFLRNQSELREDSNLELYVQREENGMNRS  210

Query  726   --FKFGSRKIKKDEK------LPIQN----DQSLQKP---LHHLNHRIIVSDVVLKNRWS  592
               F  GS   KK EK      LPIQ     DQ+ ++    LH  NHRI+VSDVVLK+RWS
Sbjct  211   SRFSIGSISFKKSEKGVKEEELPIQENNIFDQTEEQDRVLLHKFNHRIVVSDVVLKHRWS  270

Query  591   SVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFE  412
             +VSSSDL+ LN+E+I D                                           
Sbjct  271   NVSSSDLMFLNTEMIND-------------------------------------------  287

Query  411   IKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDV--------VS  256
             +  N+ + S       + +K L Q EKR+MSEI+V PRF N      C+         V 
Sbjct  288   MTSNRFSSSESRTNLESTSKVLRQNEKRAMSEILVCPRFENQFNTRNCNRENCGRSNNVK  347

Query  255   DERRRKLWLPIARRTVQWFAKRER  184
             +ERR+K+WLPIARRTVQWFA RER
Sbjct  348   EERRKKIWLPIARRTVQWFANRER  371



>gb|KDP33719.1| hypothetical protein JCGZ_07290 [Jatropha curcas]
Length=425

 Score =   341 bits (874),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 204/385 (53%), Positives = 256/385 (66%), Gaps = 43/385 (11%)
 Frame = -1

Query  1224  PDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGI  1045
             P +N FQPSL +VIGIL IMFS+TF LL+Y KFCHR     +  Q    L+ S  R SG+
Sbjct  34    PSSN-FQPSLAIVIGILCIMFSVTFILLVYVKFCHRGVSFPSLTQNNPMLVRSGSRYSGV  92

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             DKTV+ESLPFFRFSSLKGS+ GLEC+VCLS+FED+E+LRLLPKCKHAFHI+C+DQWLEKH
Sbjct  93    DKTVIESLPFFRFSSLKGSKGGLECAVCLSKFEDVEVLRLLPKCKHAFHINCVDQWLEKH  152

Query  864   SSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQES------------FK  721
             SSCPLCR K++AED +L  +S+S+RFL    R++S++ L++QR+ES            F 
Sbjct  153   SSCPLCRCKISAEDPTLFTYSASMRFL---GRDDSNMELFVQREESNRQASSSFSSSRFC  209

Query  720   FGS--RKIKK-----DEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIAL  562
              GS  RKI K     +E + IQ  +S  K LH  NH+IIVSD VLKNRWSSVSSSDL+ L
Sbjct  210   IGSSFRKIDKKDDNDEEAILIQ--ESEIKDLHKFNHKIIVSDFVLKNRWSSVSSSDLMFL  267

Query  561   NSELIRDRfsssssslanpefsssFGSKHPHD-EIQSMSIKEEMERKRLFEIKV---NKN  394
             NSE+++D  S+  SSL       S       D   Q M IKEEME KRLFE KV   NK 
Sbjct  268   NSEMLQDFSSNRFSSLDLNNEQFSNARTMEDDNNNQIMKIKEEMEIKRLFESKVSSINKY  327

Query  393   NPSFPIPTTYAETK--------NLSQKEKRSMSEIVVHPRFRNGNVQDYC-----DVVSD  253
             N  +  P + +++K        N S   +RS+SEI    RFRN N ++       +  ++
Sbjct  328   N-HYSDPCSSSDSKEKTGSSIMNNSSTGRRSVSEITAFSRFRNFNFKNSLRESGGNNKNE  386

Query  252   ERRRKLWLPIARRTVQWFAKRERRS  178
             ER+R++WLPIARRTVQWF  RER S
Sbjct  387   ERQRRVWLPIARRTVQWFVNRERTS  411



>ref|XP_002325015.2| hypothetical protein POPTR_0018s09200g [Populus trichocarpa]
 gb|EEF03580.2| hypothetical protein POPTR_0018s09200g [Populus trichocarpa]
Length=427

 Score =   339 bits (870),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 200/402 (50%), Positives = 270/402 (67%), Gaps = 44/402 (11%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V+AQ+ + I  N+ S D  + F+PSL VVIGIL ++FSLTF LL+YAKFCHR  +++   
Sbjct  18    VQAQN-TFIQGNEPSQDAVSNFRPSLAVVIGILFLIFSLTFILLIYAKFCHRGGLVHGGS  76

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
             +   AL  S  R SGIDKTV+ESLPFFRF+SLKGSREGLEC+VCLS+FEDIEILRLLPKC
Sbjct  77    ENGPALTRSASRFSGIDKTVIESLPFFRFTSLKGSREGLECAVCLSKFEDIEILRLLPKC  136

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQ  739
             KHAFHI+C+DQWLEKHSSCPLCR KV  ED ++  +S+S+R+L + S  RE+S++ L++Q
Sbjct  137   KHAFHINCVDQWLEKHSSCPLCRRKVNPEDPTIFTYSNSMRYLGNQSELREDSNVELFVQ  196

Query  738   RQESFKFGSR-----------KIKKDEKL----PIQNDQSLQKPLHHLNHRIIVSDVVLK  604
             R+E+ +  SR           K+ K+E+L     ++   + QK  +   H+IIVSDVVLK
Sbjct  197   REENRQGSSRFSVGSSFRTSGKVSKEEELWIKEEVEGSDNDQKIFNKFKHKIIVSDVVLK  256

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             NRWSS SSSDL+ LNSE++ D   SS+          S  ++   DE + + IKEE+E K
Sbjct  257   NRWSSASSSDLMFLNSEMLHD--MSSNRFHTPDLDEESTANRGIEDE-KFLKIKEEIEMK  313

Query  423   RLFEIKVNKNNPSFPI-----PTTYAETKNLSQK--------EKRSMSEIVVHPRFRNGN  283
             RL E KV+  N +  I     P+T +++K +S +        ++RS+SEI    RFR+  
Sbjct  314   RLLESKVSPVNKNSQISIQGQPST-SDSKGISGQTSRIINSTDRRSVSEITAFSRFRSFG  372

Query  282   VQDYCDVVSDE--------RRRKLWLPIARRTVQWFAKRERR  181
             +++  + VS +        R+R+LWLPIARRTVQWFA RERR
Sbjct  373   LKNTINRVSSQDGSNVQADRQRQLWLPIARRTVQWFANRERR  414



>ref|XP_007204494.1| hypothetical protein PRUPE_ppa019638mg [Prunus persica]
 gb|EMJ05693.1| hypothetical protein PRUPE_ppa019638mg [Prunus persica]
Length=418

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 193/404 (48%), Positives = 265/404 (66%), Gaps = 47/404 (12%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             +V+AQ   +  P+D+  +   F+PS+ VVIGILAIMF+LTF LL+YAKFCHR + +    
Sbjct  17    HVEAQISGSNFPSDEQSN---FEPSVAVVIGILAIMFALTFVLLVYAKFCHRRAYVGGNN  73

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
                  ++ +  R SGIDKTV+E+LP+FRFSSL+GS+EGLECSVCLS+FEDIE+LRLLPKC
Sbjct  74    HRRTEVISTSSRFSGIDKTVIEALPYFRFSSLRGSKEGLECSVCLSKFEDIEVLRLLPKC  133

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYI  742
             KHAFHI CID WLEKHSSCPLCRH++++EDL+ + +S S+R      S+ R++S++ L++
Sbjct  134   KHAFHISCIDHWLEKHSSCPLCRHRISSEDLTFITYSDSMRVFWNSQSEHRQDSNIELFV  193

Query  741   QRQESFKFGSR-----KIKKDEKL------------PIQNDQSLQKPLHHLNHRIIVSDV  613
             QR+E  +  SR       +K EK                  +  QK LH   H+I+VSD+
Sbjct  194   QREEDRRGSSRFSIGSSFRKTEKAVDKEEELLILEEGADMSKEDQKILHKHKHKIVVSDL  253

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEM  433
               KNRWS+VSSSDL+ LNSE++    + SS+  ++   +    +   ++EI  M I+EEM
Sbjct  254   EFKNRWSNVSSSDLMFLNSEMLN---TMSSNRFSSARLNHEPATATGNEEI--MKIREEM  308

Query  432   ERKRLFEIKV---NKN----NPSFP-----IPTTYAETKNLSQKEKRSMSEIVVHPRFRN  289
             E KRLFE KV   NKN    +P+FP     I T+   +++++Q EKRSMSEI    RF N
Sbjct  309   EMKRLFENKVSTMNKNASASSPTFPSTSDYIATSAHASRSMNQGEKRSMSEITALSRFGN  368

Query  288   GNVQDYC-------DVVSDERRRKLWLPIARRTVQWFAKRERRS  178
                ++         + V +ER R+LWLPIARRTVQWFA RE+R+
Sbjct  369   LGFKNRNKEPSLLENNVKEERMRRLWLPIARRTVQWFANREKRT  412



>ref|XP_004287451.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 202/390 (52%), Positives = 258/390 (66%), Gaps = 37/390 (9%)
 Frame = -1

Query  1227  SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-ASILNTTLQIPDALLGSWRRSS  1051
             S   + FQPS+ VVIGILAIMF+LTF LL+YAKFCHR  S       +    +G+  R S
Sbjct  43    SETQSNFQPSVAVVIGILAIMFALTFVLLVYAKFCHRRISAHGNNHHLEGRRIGTSSRFS  102

Query  1050  GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLE  871
             GIDKTV+E+LPFFRFS+LKGS+EGLECSVCLS+FEDIE+LRLLPKCKHAFHI CID WLE
Sbjct  103   GIDKTVIEALPFFRFSTLKGSKEGLECSVCLSKFEDIEVLRLLPKCKHAFHIDCIDHWLE  162

Query  870   KHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYIQRQES------FKF  718
             KHSSCPLCRHKV++EDL+ + +S+S+R L    S+ RE+S++ L++QR+E       F  
Sbjct  163   KHSSCPLCRHKVSSEDLTFIAYSNSMRILWDSQSERREDSNIELFVQREEDHRGSSRFSV  222

Query  717   GS--RKIKKD----------EKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSD  574
             GS  RK++K           E+  I N++   K LH   H+I+VSD V +NRWS+VSSSD
Sbjct  223   GSSFRKMEKGVGIEEELLIQEEGGILNEEDDDKVLHKHKHKIVVSDFVFQNRWSNVSSSD  282

Query  573   LIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKV---  403
             LI LNSE++    SS  SS A          +   +E + M I+EEME KRLFE KV   
Sbjct  283   LIFLNSEMLNTMSSSRFSSSARSNNEQLSPREATGNE-EIMKIREEMEMKRLFENKVSST  341

Query  402   -NKN--NPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC-------DVVSD  253
              NKN  +P+     T+A + +++Q EKRSMSEI    RF N  +++           V +
Sbjct  342   MNKNSTSPARSTLPTHA-SSSMNQGEKRSMSEITGLSRFGNWGIKNRTKEPSLLDSNVKE  400

Query  252   ERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
             ER R+LWLPIARRTVQWFA RE+R+    Q
Sbjct  401   ERTRRLWLPIARRTVQWFANREKRTEQPPQ  430



>ref|XP_008242555.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Prunus mume]
Length=447

 Score =   338 bits (867),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 264/404 (65%), Gaps = 47/404 (12%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             +V+AQ   +  P+D+  +   F+PS+ VVIGILAIMF+LTF LL+YAKFCHR   +    
Sbjct  46    HVEAQISGSNFPSDEQSN---FEPSVAVVIGILAIMFTLTFVLLVYAKFCHRRDYVGGNN  102

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
                  ++ +  R SGIDK V+E+LP+FRFSSL+GS+EGLECSVCLS+FEDIE+LRLLPKC
Sbjct  103   HQRTGVISTSSRFSGIDKKVIEALPYFRFSSLRGSKEGLECSVCLSKFEDIEVLRLLPKC  162

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYI  742
             KHAFHI CID WLEKHSSCPLCRH+V++EDL+ + +S S+R L    S+ R++S++ L++
Sbjct  163   KHAFHISCIDHWLEKHSSCPLCRHRVSSEDLTFITYSDSMRVLWNSQSEHRQDSNIHLFV  222

Query  741   QRQESFKFGSR-----KIKKDEKL------------PIQNDQSLQKPLHHLNHRIIVSDV  613
             QR+E  +  SR       +K EK                  +  QK LH   H+I+VSD+
Sbjct  223   QREEDHRGSSRFSIGSSFRKTEKAVDKEEELLILEEGADMSKEDQKILHKHKHKIVVSDL  282

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEM  433
               KNRWS+VSSSDL+ LNSE++    + SS+  ++   +    +   ++EI  M I+EEM
Sbjct  283   EFKNRWSNVSSSDLMFLNSEMLN---TMSSNRFSSAHLNHEPAAATGNEEI--MKIREEM  337

Query  432   ERKRLFEIKV---NKN----NPSFP-----IPTTYAETKNLSQKEKRSMSEIVVHPRFRN  289
             E KRLFE KV   NKN    +P+FP     I T+   +++++Q EKRSMSEI    RF N
Sbjct  338   EMKRLFETKVSTMNKNASASSPTFPSTSDYIATSAHASRSMNQGEKRSMSEITALSRFGN  397

Query  288   GNVQDYC-------DVVSDERRRKLWLPIARRTVQWFAKRERRS  178
                ++         + V +ER R+LWLPIARRTVQWFA RE+R+
Sbjct  398   LGFKNRNKEPSLLENNVKEERMRRLWLPIARRTVQWFANREKRT  441



>ref|XP_009798264.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Nicotiana 
sylvestris]
Length=387

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 246/386 (64%), Gaps = 78/386 (20%)
 Frame = -1

Query  1242  IPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDAL-LGS  1066
             +P+ Q+   N FQPS+ VVIG+L+IMF LTFFLLLYAKFC R+       Q+ D L L  
Sbjct  30    MPSSQNA-ANNFQPSIAVVIGVLSIMFCLTFFLLLYAKFCRRSPPPVHVTQVQDGLILPV  88

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R SSGIDKT++ESLPFFRFS LKGS+ GLEC+VCLSRFED+EILRLLPKCKHAFHI+CI
Sbjct  89    TRSSSGIDKTIIESLPFFRFSLLKGSKNGLECAVCLSRFEDVEILRLLPKCKHAFHINCI  148

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQRQES-----  727
             DQWLEKHSSCPLCRHKV+AED  L+ +S+S RFL + S  RE+S+L LY+QR+E+     
Sbjct  149   DQWLEKHSSCPLCRHKVSAEDHLLLTYSNSFRFLRNQSELREDSNLELYVQREENDINRS  208

Query  726   --FKFGSRKIKKDEK------LPIQN----DQSLQK----PLHHLNHRIIVSDVVLKNRW  595
               F  GS   KK EK      LPIQ     DQ+ ++     LH  NHRI+VSDVVLK+RW
Sbjct  209   SRFSIGSISFKKSEKGVKEEELPIQENNIFDQTEEQDRVLELHKFNHRIVVSDVVLKHRW  268

Query  594   SSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLF  415
             S+VSSSDL+ LN+E+I D                                          
Sbjct  269   SNVSSSDLMFLNTEMIND------------------------------------------  286

Query  414   EIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRF------RNGNVQDYCDV---  262
              +  N+ + S       + +K L Q EKR+MSEI++ PRF      RN N+++ C +   
Sbjct  287   -MTSNRFSSSESRTNLESTSKVLRQNEKRAMSEILICPRFEDHFNTRNCNIEN-CGISNN  344

Query  261   VSDERRRKLWLPIARRTVQWFAKRER  184
             V +ERR+++WLPIARRTVQWFA RER
Sbjct  345   VKEERRKRIWLPIARRTVQWFANRER  370



>ref|XP_007203534.1| hypothetical protein PRUPE_ppa026744mg, partial [Prunus persica]
 gb|EMJ04733.1| hypothetical protein PRUPE_ppa026744mg, partial [Prunus persica]
Length=408

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 256/388 (66%), Gaps = 41/388 (11%)
 Frame = -1

Query  1227  SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSG  1048
             S + ++FQP + +VIG+L+IMF+LTF LL+YAK CHR + +         L+ +  R SG
Sbjct  16    SEEQSSFQPGVHMVIGVLSIMFALTFALLVYAKHCHREAPVYGNNHTGTRLISTSSRFSG  75

Query  1047  IDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             IDKTV+E+LPFFRFSSLKGS+EGLECSVCLS+FEDIE+LRLLPKCKHAFHI CID WLEK
Sbjct  76    IDKTVIEALPFFRFSSLKGSKEGLECSVCLSKFEDIEVLRLLPKCKHAFHISCIDHWLEK  135

Query  867   HSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYIQRQE-----------  730
             HSSCPLCRHKV++EDL+ + +S+S+RFL    S+ R++S++ L+++R+E           
Sbjct  136   HSSCPLCRHKVSSEDLTFITYSNSMRFLWNNQSEHRQDSNIELFVRREEEHRGSSRFSIG  195

Query  729   -SFKFGSRKIKKDEKLPIQND-----QSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLI  568
              SF+   + + K+E++ IQ +     +  QK LH   H+I+VSD   KNRWS+VSSSDL+
Sbjct  196   GSFRKSEKVVDKEEEMLIQEEAADETEEGQKILHKHKHKIVVSDFEFKNRWSNVSSSDLM  255

Query  567   ALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKV---NK  397
              LNSE++    S+  SS        S      +++I  M I+EEM  KRLFE KV   NK
Sbjct  256   FLNSEMLNTMSSNRFSSAHFINEQFSTAETTGNEDI--MKIREEMGMKRLFENKVSTMNK  313

Query  396   N----NPSFP-----IPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC-------D  265
             N    NP  P     I T+   + +++  EKRSMSEI    RF N   ++         +
Sbjct  314   NSTASNPILPSTSDGIATSADASSSMNPGEKRSMSEITALSRFGNLGFKNRTREPSLLEN  373

Query  264   VVSDERRRKLWLPIARRTVQWFAKRERR  181
              + +ERRR+LWLPIARRTV+WFA RE+R
Sbjct  374   NLKEERRRRLWLPIARRTVRWFANREKR  401



>gb|EYU32309.1| hypothetical protein MIMGU_mgv1a025282mg [Erythranthe guttata]
Length=458

 Score =   337 bits (865),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 218/434 (50%), Positives = 268/434 (62%), Gaps = 85/434 (20%)
 Frame = -1

Query  1242  IPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-ASILNTT----LQIPDA  1078
             IP+  S   + FQPSL VVIG+L+IMFS+TF LLLYAKFCHR +S ++TT    L I D 
Sbjct  12    IPSQDS--ISNFQPSLAVVIGMLSIMFSVTFILLLYAKFCHRTSSSVHTTNGGRLIIRDG  69

Query  1077  LLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
             LL S   +SG+DKTVVESLPFFRFSSLKGSR+GLECSVCL++FED+EILRLLPKCKHAFH
Sbjct  70    LLRSTSTASGVDKTVVESLPFFRFSSLKGSRQGLECSVCLAKFEDVEILRLLPKCKHAFH  129

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSL-MNFSSSLRFLCS----DSREESSLGLYIQRQ  733
             I CID+WLEKHS+CPLCR +V+A+DLS  + +S SLRFL        REES+L LY+QR+
Sbjct  130   IDCIDRWLEKHSTCPLCRRRVSADDLSQELPYSDSLRFLSEHHQLSMREESNLELYVQRE  189

Query  732   ESFK----------------------FGS--RKIKKDEKLPIQNDQSL------------  661
             E+                         GS  RK  K+E LPI+ D+S             
Sbjct  190   ENSNNSNSNSYSNSNNNNGSSSRFSIIGSSFRKANKEEGLPIKEDESKLLTGSCSELDDG  249

Query  660   --QKPLHHLNHRI----IVSD-----VVLKNRWSSVSSSDLIALNSELIRDRfssssssl  514
                  LH  NH+I     VS+     VVLK+RWS+VSSSDL+ LNSE+I D  S+  S  
Sbjct  250   NESAELHRFNHKINYVNYVSNHNHEAVVLKSRWSNVSSSDLLFLNSEMINDVSSARFSPE  309

Query  513   anpefsssFGSKHPHDEIQSMS---IKEEMERKRLFE-------IKVNKNNP-------S  385
                       +    D  + M+   IK+EMERKR FE       I + KNN        +
Sbjct  310   ETKSVDLIINTDQNDDHKKKMTMMVIKQEMERKRAFESKMLISGITIEKNNNDDEGRRVN  369

Query  384   FPI--PTTYAETKNLS---QKEKRSMSEIVVHPRFRNGNVQDYCDVVSD---ERRRKLWL  229
             FP+  PTT + + + +     EKRSMSEIVVHPRF N N  D  D +SD   ER R+LWL
Sbjct  370   FPVAFPTTSSSSSSKALNPNNEKRSMSEIVVHPRFINNN-NDNGDSISDVKEERMRRLWL  428

Query  228   PIARRTVQWFAKRE  187
             PIAR+TV+WFA RE
Sbjct  429   PIARKTVKWFANRE  442



>ref|XP_010047719.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Eucalyptus 
grandis]
Length=434

 Score =   336 bits (862),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 203/394 (52%), Positives = 262/394 (66%), Gaps = 42/394 (11%)
 Frame = -1

Query  1215  NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL-----QIPDALLGSWRRSS  1051
             + FQPSL VVIGIL++MFS+TF LL+YAKFCHRA   +TT      + P AL  S  R S
Sbjct  40    SNFQPSLAVVIGILSVMFSVTFVLLVYAKFCHRAG--STTAGSGDQENPAALTRSRSRFS  97

Query  1050  GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLE  871
             GIDKTV+ESLPFFRFSSLKGS++GLEC+VCLS+FEDIEILRLLPKC+HAFHI CID WLE
Sbjct  98    GIDKTVIESLPFFRFSSLKGSKQGLECAVCLSKFEDIEILRLLPKCRHAFHIDCIDYWLE  157

Query  870   KHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQESFK---------  721
             KHSSCPLCRHKV+AED +   +++S+R +  SD R++S+L L++QR+   +         
Sbjct  158   KHSSCPLCRHKVSAEDPANFTYTNSMRLMSQSDMRQDSNLELFVQREAGIQGSSSRFSIG  217

Query  720   FGSRKI-KKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIR  544
                RKI K +++  IQ +   QK LH  NHRII SDVVLKNRWS++SSSDL+ LNSE++ 
Sbjct  218   SSFRKIFKSNKEEEIQEEAEKQKILHKFNHRIIASDVVLKNRWSNLSSSDLMFLNSEMLN  277

Query  543   D-RfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIK---VNKNN----P  388
             D   +  SS        ++  +    +  + M IKEEM+RKRLFE K   ++KN+    P
Sbjct  278   DLSSNRFSSLELEGTGQATTTAARTFESGEIMKIKEEMDRKRLFESKLSSIDKNSLVSVP  337

Query  387   SFPIPTTYAETKNLSQ------KEKRSMSEIVVHPRFRNGNVQDYCDVVS--------DE  250
               P  T   E+ ++ Q       +KRSMSEI    RF + + ++    +S        DE
Sbjct  338   GHP-STAPVESGSVQQSKIMLPADKRSMSEITGVSRFGDSSARNRHREMSLIEGGDFKDE  396

Query  249   RRRKLWLPIARRTVQWFAKRERRSAH-ESQIPST  151
             R R++WLPIARRTVQWFA RERRS +  SQ  +T
Sbjct  397   RMRQIWLPIARRTVQWFANRERRSQNTHSQTQTT  430



>ref|XP_007013082.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY30701.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=426

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 201/398 (51%), Positives = 260/398 (65%), Gaps = 38/398 (10%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             NV AQ PS+          + F+PSL VVIG+L +MFSLT FLL+YAKFCHR + ++   
Sbjct  17    NVDAQSPSSESDATSGDAVSNFRPSLAVVIGVLCVMFSLTLFLLVYAKFCHRGATVHGDR  76

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
               P  L  +  + SGIDK V+ESLPFF+FSSLKGS++GLEC+VCLS+FEDIEILRLLPKC
Sbjct  77    H-PGILHRTRSQFSGIDKKVIESLPFFKFSSLKGSKQGLECAVCLSKFEDIEILRLLPKC  135

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQ  739
             KHAFHI CID+WLE+HSSCPLCR K+  ED ++  +S+S+RFL + S  RE+S++ LYIQ
Sbjct  136   KHAFHIGCIDRWLERHSSCPLCRQKINTEDPTIFTYSNSMRFLWNQSELREDSNMELYIQ  195

Query  738   R-QES----FKFGSRKIKKDEKLPIQNDQSLQ----------KPLHHLNHRIIVSDVVLK  604
             R QES            +K EK  I+N+  +Q          +  H   H+IIVSDVVLK
Sbjct  196   REQESHGSSRFSIGSSSRKIEKGNIENEVLIQEEAADEDDDGRVFHKFKHKIIVSDVVLK  255

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             NRWSSVSSSDL+ LNSE++ +  S+  SSL   +   S  ++ P +  Q M IKEE+E K
Sbjct  256   NRWSSVSSSDLMFLNSEMLNEMSSNRFSSLETNDHGQSTITR-PIENKQIMKIKEELEIK  314

Query  423   RLFEIKV---NKNN----PSFPIPTTYAETKN-----LSQKEKRSMSEIVVHPRFRNGNV  280
             RLFE KV   NKNN    P+ P  + ++ T +     ++Q EKRSMSEI    RFR+ + 
Sbjct  315   RLFESKVSSINKNNPVSAPALPSTSNFSATSSHTSMIVNQAEKRSMSEITALSRFRDVSP  374

Query  279   QDYCDV-------VSDERRRKLWLPIARRTVQWFAKRE  187
             ++             +ER R+LWLPIAR+TVQWFA RE
Sbjct  375   RNRTSQSLLSETNTKEERIRRLWLPIARKTVQWFANRE  412



>ref|XP_011048352.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 isoform X1 [Populus 
euphratica]
 ref|XP_011048353.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 isoform X2 [Populus 
euphratica]
Length=427

 Score =   334 bits (857),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 261/401 (65%), Gaps = 42/401 (10%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V+AQ+ + I  N  S D  + F+PSL VVIG+L ++FSLTF LLLYAKFCHR  +++   
Sbjct  18    VQAQN-TFIQGNGPSQDAVSNFRPSLAVVIGVLFLIFSLTFILLLYAKFCHRGGLVHGGS  76

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
             +   AL  S  R SGIDKTV+ESLPFFRF+SLKGSREGLEC+VCLS+FEDIEILRLLPKC
Sbjct  77    ENGPALTRSASRFSGIDKTVIESLPFFRFTSLKGSREGLECAVCLSKFEDIEILRLLPKC  136

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQ  739
             KHAFHI+C+D+WLEKHSSCPLCR KV+ ED ++  +S+S+R+L + S  RE+S++ L++Q
Sbjct  137   KHAFHINCVDEWLEKHSSCPLCRRKVSPEDPTIFTYSNSMRYLGNQSELREDSNVELFVQ  196

Query  738   RQESFKFGSR-----KIKKDEKLP----------IQNDQSLQKPLHHLNHRIIVSDVVLK  604
             R+E+ +  SR       +K  K+           ++   + QK  +   H+IIVSDVVLK
Sbjct  197   REENRQGSSRFSVGSSFRKSGKVSKEEEIWIKEEVEGSDNDQKMFNKFKHKIIVSDVVLK  256

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             NRWSS SSSDL+ LNSE++ D   SS+          S  ++   DE + + IKEE+E K
Sbjct  257   NRWSSASSSDLMFLNSEMLHD--MSSNRFHTLDLDEESTANRDTEDE-KVLKIKEEIEMK  313

Query  423   RLFEIKVNKNNPSFPI-----PTTYAETKNLSQ-------KEKRSMSEIVVHPRFRNGNV  280
             RL E KV+  N   PI     P+T      L Q        ++RS+SEI    R R+  +
Sbjct  314   RLLESKVSPVNKKSPISIQCQPSTSESKGILGQTSRIINSTDRRSVSEITAFSRIRSFGL  373

Query  279   QDYCDVVSDE--------RRRKLWLPIARRTVQWFAKRERR  181
             +D  + VS +        R+R+LWLPIARRTVQWFA RERR
Sbjct  374   KDTINRVSSQAGSNAQADRQRQLWLPIARRTVQWFANRERR  414



>ref|XP_011016224.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like, partial [Populus 
euphratica]
Length=412

 Score =   334 bits (856),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 260/401 (65%), Gaps = 42/401 (10%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V+AQ+ + I  N  S D  + F+PSL VVIG+L ++FSLTF LLLYAKFCHR  +++   
Sbjct  3     VQAQN-TFIQGNGPSQDAVSNFRPSLAVVIGVLFLIFSLTFILLLYAKFCHRGGLVHGGS  61

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
             +   AL  S  R SGIDKTV+ESLPFFRF+SLKGSREGLEC+VCLS+FEDIEILRLLPKC
Sbjct  62    ENGPALTRSASRFSGIDKTVIESLPFFRFTSLKGSREGLECAVCLSKFEDIEILRLLPKC  121

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQ  739
             KHAFHI+C+D+WLEKHSSCPLCR KV  ED ++  +S+S+R+L + S  RE+S++ L++Q
Sbjct  122   KHAFHINCVDEWLEKHSSCPLCRRKVNPEDPTIFTYSNSMRYLGNQSELREDSNVELFVQ  181

Query  738   RQESFKFGSR-----KIKKDEKLP----------IQNDQSLQKPLHHLNHRIIVSDVVLK  604
             R+E+ +  SR       +K  K+           ++   + QK  +   H+IIVSDVVLK
Sbjct  182   REENRQGSSRFSVGSSFRKSGKVSKEEEIWIKEEVEGSDNDQKMFNKFKHKIIVSDVVLK  241

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             NRWSS SSSDL+ LNSE++ D   SS+          S  ++   DE + + IKEE+E K
Sbjct  242   NRWSSASSSDLMFLNSEMLHD--MSSNRFHTLDLDEESTANRDTEDE-KVLKIKEEIEMK  298

Query  423   RLFEIKVNKNNPSFPI-----PTTYAETKNLSQ-------KEKRSMSEIVVHPRFRNGNV  280
             RL E KV+  N   PI     P+T      L Q        ++RS+SEI    R R+  +
Sbjct  299   RLLESKVSPVNKKSPISIQGQPSTSESKGILGQTSRIINSTDRRSVSEITAFSRIRSFGL  358

Query  279   QDYCDVVSDE--------RRRKLWLPIARRTVQWFAKRERR  181
             +D  + VS +        R+R+LWLPIARRTVQWFA RERR
Sbjct  359   KDTINRVSSQAGSNAQADRQRQLWLPIARRTVQWFANRERR  399



>ref|XP_008242556.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Prunus mume]
Length=441

 Score =   332 bits (850),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 256/388 (66%), Gaps = 41/388 (11%)
 Frame = -1

Query  1227  SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSG  1048
             S + +++QP + +VIG+L+IMF+LTF LL+YAK CHR + +         L+ +  R SG
Sbjct  49    SEEQSSYQPGVHMVIGVLSIMFALTFALLVYAKHCHREAPVYGNNHTGTRLISTSSRFSG  108

Query  1047  IDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             IDKTV+E+LPFFRFSSLKGS+EGLECSVCLS+FEDIE+LRLLPKCKHAFHI CID WLEK
Sbjct  109   IDKTVIEALPFFRFSSLKGSKEGLECSVCLSKFEDIEVLRLLPKCKHAFHISCIDHWLEK  168

Query  867   HSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYIQRQE-----------  730
             HSSCPLCRHKV++EDL+ + +S+S+RFL    S+ R++S++ L+++R+E           
Sbjct  169   HSSCPLCRHKVSSEDLTFITYSNSMRFLWNNQSEHRQDSNIELFVRREEEHRGSSRFSIG  228

Query  729   -SFKFGSRKIKKDEKLPIQND-----QSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLI  568
              SF+   + + K+E++ IQ +     +  QK LH   H+I+VSD   KNRWS+VSSSDL+
Sbjct  229   GSFRKSEKVVDKEEEMLIQEEAADETEEGQKILHKHKHKIVVSDFEFKNRWSNVSSSDLM  288

Query  567   ALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKV---NK  397
              LNSE++    S+  SS        S      +++I  M I+EE+  KRLFE K+   NK
Sbjct  289   FLNSEMLNTMSSNRFSSEHFINEQFSTVETTGNEDI--MKIREEIGMKRLFENKISTMNK  346

Query  396   N----NPSFP-----IPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC-------D  265
             N    NP  P     I T+   + +++  EKR+MSEI    RF N   ++         +
Sbjct  347   NSTASNPILPSTSDGIATSADASSSMNPGEKRAMSEITGLSRFGNLGFKNRTREPSLLEN  406

Query  264   VVSDERRRKLWLPIARRTVQWFAKRERR  181
              V +ERRR+LWLPIARRTVQWFA RE+R
Sbjct  407   NVKEERRRRLWLPIARRTVQWFANREKR  434



>ref|XP_010107387.1| E3 ubiquitin-protein ligase ATL42 [Morus notabilis]
 gb|EXC15876.1| E3 ubiquitin-protein ligase ATL42 [Morus notabilis]
Length=441

 Score =   328 bits (842),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 254/386 (66%), Gaps = 41/386 (11%)
 Frame = -1

Query  1221  DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGID  1042
             D  + +PSL +V+G+L++MF LTF LL YAKFCHR    N   Q    ++ + RR SGID
Sbjct  46    DYESLKPSLAIVLGVLSVMFVLTFLLLAYAKFCHRRVSANRNPQ-QTGIISASRRFSGID  104

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             KTV+ESLPFFRFSSLKGS+EGLEC+VCLS+FEDIE+LRLLPKC HAFHI+CID WLEKHS
Sbjct  105   KTVIESLPFFRFSSLKGSKEGLECAVCLSKFEDIEVLRLLPKCNHAFHINCIDHWLEKHS  164

Query  861   SCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREES-SLGLYIQRQES------FKFGS  712
             SCPLCRH+V++EDL L+ +S S RFL    S+ RE+S ++ L++QR+ES      F  GS
Sbjct  165   SCPLCRHRVSSEDLKLITYSDSARFLWNNQSEMREDSNNMELFVQREESHRGSSRFSIGS  224

Query  711   --RKI-----KKDEKLPIQND-QSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNS  556
               RKI      K+E+L IQ + ++ QK  H  NH+I+VSD V KNRWS+VSSSDLI L+S
Sbjct  225   SFRKIHEKGHHKEEELLIQQETEADQKVFHKHNHKILVSDFVFKNRWSNVSSSDLIFLSS  284

Query  555   ELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVN--KNNPSF  382
             E++ D+ S   +S       +S      + E+  M  KEEME K+ FE KV     + S 
Sbjct  285   EMLNDKSSGRFASTDWNNDPTSTRKAVENGEM--MKTKEEMEMKKSFESKVGTISTSVSN  342

Query  381   PIPTTYAETKN----------LSQKEKRSMSEIVVHPRFRNGNVQD--------YCDVVS  256
             P+P++  E +           ++  E+RS+SEI    R+ +   ++        + + V 
Sbjct  343   PVPSSAFEDEASTSSHTSRSVMNSGEQRSVSEITAFSRYGDLGGKNRIGESSSLFENNVK  402

Query  255   DERRRKLWLPIARRTVQWFAKRERRS  178
             +ER R+ WLPIARRTVQWFA RE+RS
Sbjct  403   EERMRRAWLPIARRTVQWFANREKRS  428



>ref|XP_004513025.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like isoform X1 
[Cicer arietinum]
 ref|XP_004513026.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like isoform X2 
[Cicer arietinum]
Length=424

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 192/396 (48%), Positives = 255/396 (64%), Gaps = 44/396 (11%)
 Frame = -1

Query  1230  QSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSS  1051
             Q    + FQPSLVVVIGIL +MF+LTF LL++AK CH  + L +T   P  L+ S  R S
Sbjct  29    QDDGVSNFQPSLVVVIGILGLMFALTFVLLIFAKVCH-MNPLASTNNHPTTLMRSRSRFS  87

Query  1050  GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLE  871
             GIDKT +ESLPFFRFSSLKGS+EGLEC++CLS+FEDIEILRLLPKCKH FHI CID WLE
Sbjct  88    GIDKTAIESLPFFRFSSLKGSKEGLECAICLSKFEDIEILRLLPKCKHGFHIDCIDHWLE  147

Query  870   KHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS---REESSLGLYIQRQESFKFGS----  712
             KHSSCP+CRHKV  +D ++  +S+SLR +  +S    +ES++ +++QR+E  ++GS    
Sbjct  148   KHSSCPICRHKVNPQDETIFAYSNSLRMMIENSGLEGDESNIEIFVQREEENQYGSSRFS  207

Query  711   --------RKIK-----KDEKLPIQNDQSLQKPLHH-LNHRIIVSDVVLKNRWSSVSSSD  574
                     RKI      K+E+L IQ  +     ++H  NH+I +SDVV K+RWS+VSSSD
Sbjct  208   SSTIGSSFRKIGKSTFVKEEELLIQKSECDNNKVYHKYNHKITISDVVFKHRWSNVSSSD  267

Query  573   LIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK-  397
             L+ LNSE+I    S+         F     +++  +  + M+IKEEMERK  FE KVN  
Sbjct  268   LMFLNSEMINSTSSNMFKFNNMESF-----TRNVVENEKIMNIKEEMERKISFESKVNAI  322

Query  396   NNPSFPI-----PTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV-----QDYCDV---VS  256
             N   F           +E  ++++ EKRS+SEIV   RFR+ +      +D C V   V 
Sbjct  323   NKIKFKSVLDSDGNLSSEVNHVNRGEKRSVSEIVGVSRFRDFDTKKRVFEDCCLVGNNVK  382

Query  255   DERRRKLWLPIARRTVQWFAKRERRS---AHESQIP  157
             +ER RKLW PIARRT +WF  RERRS   +H +++P
Sbjct  383   EERMRKLWFPIARRTAEWFVNRERRSQEQSHNNKVP  418



>ref|XP_006353480.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Solanum tuberosum]
Length=370

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 197/385 (51%), Positives = 240/385 (62%), Gaps = 62/385 (16%)
 Frame = -1

Query  1269  VKAQHPSTI--IPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA-SILNT  1099
             VKA   +T   +P+ Q  + N F+PS+ VVIGIL+IMFSLTF LLLYAKFC R+   L+ 
Sbjct  28    VKANDYNTFQELPSTQD-EANNFRPSIAVVIGILSIMFSLTFLLLLYAKFCRRSPQALHN  86

Query  1098  TLQIP-DAL--LGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILR  928
              +QI  D L  L   R SSGIDKT++ESLPFFRFS LKGSR+GLEC+VCLSRFED+E+LR
Sbjct  87    AMQIDQDGLTTLPMARVSSGIDKTIIESLPFFRFSLLKGSRQGLECAVCLSRFEDVEVLR  146

Query  927   LLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGL  748
             LLPKCKHAFH  CIDQWLEKHSSCPLCRHKV  ED SL+ +S+S RFL    R +S+L L
Sbjct  147   LLPKCKHAFHTKCIDQWLEKHSSCPLCRHKVCIEDNSLLTYSNSFRFL----RNDSNLEL  202

Query  747   YIQRQE-----SFKFGSRKI--KKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSS  589
             Y+QR+E     SFK        K +EK  I +D      LH  NH+IIVSDVVLK+RWS+
Sbjct  203   YVQREENCGSMSFKKNEDSFFDKTEEKQNIIDDDD-HDMLHKFNHKIIVSDVVLKHRWSN  261

Query  588   VSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEI  409
             VSSSD + LN+E+I D                                   M   R F  
Sbjct  262   VSSSDFMFLNTEMIND-----------------------------------MTNNR-FNS  285

Query  408   KVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV----QDYCDVVSDERRR  241
              +   N +  I +T   +  L Q EKRSMSEI++ PRF + N     +D      +E+R 
Sbjct  286   SLESRNYNNNIVST---SNVLRQNEKRSMSEILICPRFDDFNTRNCNRDNSITCVEEKRM  342

Query  240   KLWLPIARRTVQWFAKRERRSAHES  166
             KLWLPIARRTVQWF  RE+R A +S
Sbjct  343   KLWLPIARRTVQWFENREKRYARQS  367



>emb|CBI28025.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   324 bits (830),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 194/371 (52%), Positives = 248/371 (67%), Gaps = 45/371 (12%)
 Frame = -1

Query  1236  NDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWR  1060
             N  S D  T F+PSL VVIGILA+MF LTF LL+YAK CHRAS  N+  +    L  S  
Sbjct  75    NFSSQDAVTAFKPSLAVVIGILAVMFLLTFILLVYAKLCHRAS--NSDRENQQGLTRSES  132

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R SGIDKTV+ESLPFFRF SLKGS+EGLEC+VCLS+FEDIEILRLLPKCKHAFHI C+DQ
Sbjct  133   RFSGIDKTVIESLPFFRFCSLKGSKEGLECAVCLSKFEDIEILRLLPKCKHAFHIDCVDQ  192

Query  879   WLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQRQESFKFGSRK  706
             WLEKHSSCPLCRHKV+AEDL+++ +S+SLRFL + S  RE S+L L+             
Sbjct  193   WLEKHSSCPLCRHKVSAEDLAILTYSNSLRFLWNQSELRENSNLELF------------G  240

Query  705   IKKDEKLPIQ---NDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRf  535
             +K++E + IQ   +D   +K LH +NH+IIVSDVVLKNRWSSVSSSDL+ LNSEL+    
Sbjct  241   VKEEESVLIQEEEDDNDDEKILHKINHKIIVSDVVLKNRWSSVSSSDLMYLNSELVH---  297

Query  534   sssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAET  355
              + SS       S++     P ++ + M IKEE+ERKR+FE +V++ N S P+ ++   +
Sbjct  298   -AMSSDRFASLDSNNSAMGRPIEDWEVMKIKEEIERKRIFESRVSRINHSNPVSSSGLPS  356

Query  354   KNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERR---RKLWLPIARRTVQWFAKRE-  187
              + ++      S   +HP                E+R   R+LWLPIARRTV+WFA RE 
Sbjct  357   TSKTEANSGHASRF-LHP---------------TEKRSIMRRLWLPIARRTVEWFANREG  400

Query  186   -RRSAHESQIP  157
              ++S +  Q P
Sbjct  401   SQQSQNTKQAP  411



>ref|XP_008387095.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Malus domestica]
 ref|XP_008343995.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Malus domestica]
Length=404

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 252/380 (66%), Gaps = 42/380 (11%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-ASILNTTLQIPDALLGSWRRSSGIDKTV  1033
             FQPS+ +VIG+LAI F LTF LL+Y KFCHR A ++         L+ +  R SGIDKTV
Sbjct  22    FQPSVALVIGVLAIFFLLTFVLLVYVKFCHRSAYVVGNNHLRSTGLVTASARFSGIDKTV  81

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             +E+LPFF+FSSLKGS+EGLEC+VCLS+FEDIEILRLLPKCKHAFHI CID WLEKHSSCP
Sbjct  82    IEALPFFKFSSLKGSKEGLECAVCLSKFEDIEILRLLPKCKHAFHISCIDYWLEKHSSCP  141

Query  852   LCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES------FKFGS--RKIK  700
             LCRH+V++EDL+ + +S+S+R++  S+ R++S++ L++QR+E       F  GS  RK++
Sbjct  142   LCRHRVSSEDLTSITYSNSMRWINQSERRQDSNIELFVQREEDHSGSSRFSVGSSFRKVE  201

Query  699   K--DEKLPIQN----DQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIR--  544
                D++L IQ      +  QK LH   H+I+VSD+  KNRWS+VSS+DL+ LNSE++   
Sbjct  202   NVIDDELLIQEVADVTEEGQKVLHKHKHKIVVSDLEFKNRWSNVSSADLLFLNSEMLNTM  261

Query  543   --DRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKN--------  394
               DRFS    +      + + G++      + + I+EEME KRLFE K +          
Sbjct  262   SSDRFSFRDLNDEQFSPTKATGNQ------EIVKIREEMEMKRLFEDKFSTMSEHSSALV  315

Query  393   -NPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVS-------DERRRK  238
              + S  I T+   + +++Q EKRSMSEI    RF N   ++    +S       +ER R+
Sbjct  316   PSASVSIETSAHASSSVNQGEKRSMSEITGLSRFGNLGSKNRTRELSLLENNAKEERMRR  375

Query  237   LWLPIARRTVQWFAKRERRS  178
             LWLPIARRTV WFA RE+RS
Sbjct  376   LWLPIARRTVHWFANREKRS  395



>ref|XP_004251624.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Solanum lycopersicum]
Length=421

 Score =   320 bits (821),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 184/394 (47%), Positives = 240/394 (61%), Gaps = 69/394 (18%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI-LNTTL  1093
             VKA   +T      + D   F+PS+ VVIGIL+IMFSLTF LLLYAKFC R+S+ L+  +
Sbjct  68    VKAHDYNTFQELPSTQDEANFRPSIAVVIGILSIMFSLTFLLLLYAKFCRRSSLPLHNAM  127

Query  1092  QIPDALLGSW---RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLL  922
             Q+    L +    R SSGIDKT++ESLPFFRFS LKGSR+GLEC+VCLS+FED+E+LRLL
Sbjct  128   QMDQDRLTTLPMARVSSGIDKTIIESLPFFRFSLLKGSRQGLECAVCLSKFEDVEVLRLL  187

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYI  742
             PKCKHAFHI+CIDQWLEKHSSCPLCRHKV  ED SL+ +S+S RFL    RE+S+  LY+
Sbjct  188   PKCKHAFHINCIDQWLEKHSSCPLCRHKVRVEDNSLLTYSNSFRFL----REDSNFELYV  243

Query  741   QRQES----------FKFGSRKIKKDEKLPIQNDQSLQKPLHH--------LNHRIIVSD  616
             QR+ +          F  G+  +K +E   +   +  Q  +HH         NH+I+VSD
Sbjct  244   QRESNSQNGVNRSSRFSIGNMSLKINEDSFLDQTEENQNIIHHDHDDMLHKFNHKIVVSD  303

Query  615   VVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEE  436
             VVLK+RWS+VSSSD + LN+++I D                          + +      
Sbjct  304   VVLKHRWSNVSSSDFMFLNTQMIND--------------------------MTNNRFNSS  337

Query  435   MERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV----QDYC  268
             +E +       NKN          + +  L Q EKRSMSEI++ PRF + N     +D  
Sbjct  338   LESR-----NCNKN--------IVSSSNVLRQNEKRSMSEILICPRFDDYNTRNCNRDNS  384

Query  267   DVVSDERRRKLWLPIARRTVQWFAKRERRSAHES  166
                 +E+R KLWLPIA+RTVQWF  RE+R A +S
Sbjct  385   ITCVEEKRMKLWLPIAKRTVQWFENREKRYARQS  418



>ref|XP_006587536.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Glycine max]
 gb|KHN45609.1| E3 ubiquitin-protein ligase ATL42 [Glycine soja]
Length=419

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 197/409 (48%), Positives = 258/409 (63%), Gaps = 59/409 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASIL  1105
             V+AQ   T  P+     +N FQPSL VVIGIL +MF LTFFLL+YAKFCHR     +++ 
Sbjct  21    VRAQ---TSAPSSGDAVSN-FQPSLAVVIGILGVMFLLTFFLLMYAKFCHRRHGGASAVG  76

Query  1104  NTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
             ++  Q+    + S  R SGIDKTV+ESLPFFRFS+LKG +EGLEC+VCLS+FED+EILRL
Sbjct  77    DSENQL--TFVRSRSRFSGIDKTVIESLPFFRFSALKGLKEGLECAVCLSKFEDVEILRL  134

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLY  745
             +PKCKHAFHI CID WLEKHS+CP+CRH+V  ED +   +S+SLR L     EES++ + 
Sbjct  135   VPKCKHAFHIDCIDHWLEKHSTCPICRHRVNPEDHTTFTYSNSLRMLAG---EESNIEIL  191

Query  744   IQRQESFKFGS-----------RKIKKDEKLPIQ----NDQSLQKPLHHLNHRIIVSDVV  610
             +QR+E    GS           RK  K+E+L IQ    +    QK  H  NHRI +SDVV
Sbjct  192   VQREEEEHHGSSRFSVIGSSSFRKTVKEEELLIQKGAEDSDGNQKGYHKHNHRITISDVV  251

Query  609   LKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEME  430
              K+RWS+VSSSDL+ LNSE++ D   +SS+  ++   S + G    +++I  M+IKEEME
Sbjct  252   FKHRWSNVSSSDLMFLNSEMLND---TSSNRFSSNLESITRGVVVENEQI--MNIKEEME  306

Query  429   RKRLFEIKV----------NKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV  280
             RK  FE KV          +K +P F   T+ +  K ++  EKRSMSEI    RF  G++
Sbjct  307   RKISFENKVVGALNNIVSDHKEDPPF---TSDSAPKYVNPGEKRSMSEITAVSRF--GDL  361

Query  279   QDYCDVVSD----------ERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
                  V+ D          ER R++W PIARRT QWF  RE R + +SQ
Sbjct  362   GMKMRVLKDSDSLQNNLKEERMRQIWFPIARRTAQWFVNREERRSLQSQ  410



>ref|XP_010092022.1| E3 ubiquitin-protein ligase ATL42 [Morus notabilis]
 gb|EXC37516.1| E3 ubiquitin-protein ligase ATL42 [Morus notabilis]
Length=432

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 190/397 (48%), Positives = 256/397 (64%), Gaps = 34/397 (9%)
 Frame = -1

Query  1248  TIIPNDQSPD-TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH-RASILNTTLQIPDAL  1075
             TI P+  + D +N FQPSL+VVIGIL +MF  TF +L+YAK CH R  +   ++Q    L
Sbjct  36    TIGPDFSTQDNSNNFQPSLLVVIGILGVMFVFTFLILVYAKVCHSREPVGRNSIQNRTGL  95

Query  1074  LGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
             + S  R SGIDKTV+ESLPFFRFSSLKGS+EGLEC VCLS+FEDIE+LR+LPKC+HAFHI
Sbjct  96    ISSSGRFSGIDKTVIESLPFFRFSSLKGSKEGLECVVCLSKFEDIEVLRMLPKCRHAFHI  155

Query  894   HCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREES-SLGLYIQRQES  727
             +CID WLEKHSSCPLCRHKV++EDL L+ +S+S+RFL    S+ RE+S +  L+++R+ S
Sbjct  156   NCIDHWLEKHSSCPLCRHKVSSEDLKLITYSNSMRFLWNNQSERREDSNNKELFVEREGS  215

Query  726   ------FKFGS--RKI------KKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSS  589
                   F  G   RKI      K++E L +Q ++  Q  LH  NH+I+ SD V  NRWS+
Sbjct  216   HRGSSRFSIGGSFRKIHEKGHNKEEELLILQENEEDQNVLHKHNHKILASDFVFNNRWSN  275

Query  588   VSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEI  409
             + SSDL+ LNSE++ +  S   SS       SS G+   ++EI      +E E K+ FE 
Sbjct  276   LRSSDLMFLNSEMLNEVSSGRFSSTDWNIDMSSTGNAAENEEIMKA---KETEMKKSFES  332

Query  408   KVNKNNPSFPIPTTYAETKN--LSQKEKRSMSEIVVHPRF-------RNGNVQDYC-DVV  259
             K  + + S    +T + T    ++  E+RS+SEI    R+       RN +   +  + V
Sbjct  333   KDGRISTSDGRASTSSHTSRSMMNSGEQRSVSEITSFSRYGSLSVKNRNTDSSSWSENNV  392

Query  258   SDERRRKLWLPIARRTVQWFAKRERRSAHESQIPSTQ  148
              +ER R++WLPIARRTVQWFA  E+RS   S  P +Q
Sbjct  393   KEERIRRVWLPIARRTVQWFANGEKRS-QSSNNPQSQ  428



>ref|XP_010113232.1| E3 ubiquitin-protein ligase ATL42 [Morus notabilis]
 gb|EXC75523.1| E3 ubiquitin-protein ligase ATL42 [Morus notabilis]
Length=405

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 189/382 (49%), Positives = 252/382 (66%), Gaps = 37/382 (10%)
 Frame = -1

Query  1227  SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL--QIPDALLGSWRRS  1054
             S +  T QPSL VVIG+L +M  +TF LL+Y KFC+  +    T   Q    L+ S  R 
Sbjct  30    SSENPTLQPSLAVVIGLLGVMSVITFLLLVYVKFCNTTTESAGTNPPQNNIGLISSSNRF  89

Query  1053  SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWL  874
             SGIDKTVVESLPFFRFSSLKGS+EGLEC VCLS+FED+E+LRLLP CKHAFH++CID WL
Sbjct  90    SGIDKTVVESLPFFRFSSLKGSKEGLECVVCLSKFEDVEVLRLLPNCKHAFHVNCIDNWL  149

Query  873   EKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREES-SLGLYIQRQES------F  724
             EKHSSCPLCR KV++EDL L+ +S+S+RFL    S+ RE+S ++ L+++R+ES      F
Sbjct  150   EKHSSCPLCRQKVSSEDLKLITYSNSMRFLSNKQSELREDSNNMELFVEREESHGGSSRF  209

Query  723   KFGS--RKI-----KKDEKLPIQND-QSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLI  568
               GS  R I      K+E+L IQ + ++ QK  H  NH+I VSD +  +RWS++SSSDLI
Sbjct  210   SIGSSFRTIHEKGHHKEEELLIQQETEADQKVFHKHNHKITVSDFLFNSRWSNLSSSDLI  269

Query  567   ALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNP  388
              LNSE++ D  SS  SS    +  SS G    ++EI  M +K+E+E ++ F+ KV     
Sbjct  270   FLNSEMLNDMSSSRFSSTDWNKDMSSTGKVEENEEI--MEVKKEVEFRKSFQSKVG----  323

Query  387   SFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQ----DYCDV----VSDERRRKLW  232
                + +T A +  L+  EKRS+SEI    R+R+  V+    + C V    V +ER RK+W
Sbjct  324   ---VTSTSASSSMLNSGEKRSVSEITSLSRYRDFGVKNRITESCSVFENNVKEERTRKIW  380

Query  231   LPIARRTVQWFAKRERRSAHES  166
             LPIARRTVQ FA +E+ S  +S
Sbjct  381   LPIARRTVQRFANKEKSSKRQS  402



>ref|XP_010321060.1| PREDICTED: putative RING-H2 finger protein ATL12 isoform X1 [Solanum 
lycopersicum]
Length=324

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 228/365 (62%), Gaps = 68/365 (19%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT  1096
             NVKA+     +P   S D  ++FQPSL VVI +L IMFSLTF +L YAKFCHR     T+
Sbjct  14    NVKAED----LPTYSSQDVVSSFQPSLAVVIVVLFIMFSLTFVILFYAKFCHR-----TS  64

Query  1095  LQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPK  916
                   L+ S   SSGIDKTVVESLP FRFS L+GS++GLEC VCLS+FEDIEILRL+P 
Sbjct  65    SDDGGQLVRSVSHSSGIDKTVVESLPIFRFSLLRGSKQGLECCVCLSKFEDIEILRLIPM  124

Query  915   CKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYI  742
             CKHAFHI CID+WLE+HS+CPLCRHK++ EDLSL+ +S SLRFL S S   EES++ +YI
Sbjct  125   CKHAFHIKCIDEWLERHSTCPLCRHKISCEDLSLLTYSGSLRFLRSQSIRDEESNMEIYI  184

Query  741   QRQESFKFGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIAL  562
             +R+++         + E+L IQ      K L   NHRIIVSDVV KNRWS+V+SSDLI L
Sbjct  185   EREDN---------ESEELLIQG-----KALDRFNHRIIVSDVVFKNRWSNVTSSDLIFL  230

Query  561   NSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSF  382
             NSE++                     +    +   SM    E  R       V + + S 
Sbjct  231   NSEML---------------------NGITSNRFSSMDTTCEQSR-------VIEEDQSI  262

Query  381   PIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQW  202
              I           + EKRSMSEI+V+ RF N N +     V DERRRKLWLPIARRTV+W
Sbjct  263   NI-----------KDEKRSMSEIIVYSRFNNRNRELS---VRDERRRKLWLPIARRTVKW  308

Query  201   FAKRE  187
             FA RE
Sbjct  309   FANRE  313



>ref|XP_003517066.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Glycine max]
 gb|KHN13133.1| E3 ubiquitin-protein ligase ATL42 [Glycine soja]
Length=426

 Score =   311 bits (796),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 191/390 (49%), Positives = 240/390 (62%), Gaps = 49/390 (13%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS---ILNTTLQIPDALLGSWRRSSG  1048
              + FQPSL VVIGIL +MF LTFFLL+YAKFC R +   + +T  Q+P   + S  R SG
Sbjct  31    VSNFQPSLAVVIGILGVMFLLTFFLLMYAKFCQRCASSPVGDTENQLP--FVRSRSRFSG  88

Query  1047  IDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             IDK V+ESLPFFRFSSLKGS+EGLEC+VCLS+FED+EILRLLPKCKHAFHI CID WLEK
Sbjct  89    IDKNVIESLPFFRFSSLKGSKEGLECAVCLSKFEDVEILRLLPKCKHAFHIDCIDHWLEK  148

Query  867   HSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSR--EESSLGLYIQRQESF----------  724
             HSSCP+CRH+V  ED +   +S+SLR L + S   EES++ +++QR+E            
Sbjct  149   HSSCPICRHRVNPEDHTTFTYSNSLRRLANQSEVGEESNIEIFVQREEEHHGSSRFSFGS  208

Query  723   -KFGSRKIKKDEKLPI----QNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALN  559
                 + K  K+E+  I    ++    QK  H  NHRI +SDVV K+RWS+VSSSDL+ LN
Sbjct  209   SFRKTGKYVKEEEFLIEKGAEDSDGNQKGYHKHNHRITISDVVFKHRWSNVSSSDLMFLN  268

Query  558   SELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFP  379
             SE++ D  S+  S+L +     S       +E Q M+IKEEMERK  FE KV   N    
Sbjct  269   SEMLNDASSNRFSNLESNADMMSSTRGVVENE-QIMNIKEEMERKISFESKVGVLNNIKS  327

Query  378   IP-------------TTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSD-----  253
             +              +T+A  K  +  EKRSMSEI    RF  G++     V  D     
Sbjct  328   VSDKHLLFTSDSAGKSTHA-PKYANPGEKRSMSEITAVSRF--GDLGMKMRVFKDSSSLQ  384

Query  252   -----ERRRKLWLPIARRTVQWFAKRERRS  178
                  ER R++W PIARRT QWF  RERRS
Sbjct  385   NNLKEERMRQIWFPIARRTAQWFVNRERRS  414



>ref|XP_004151734.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis sativus]
 ref|XP_004172920.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis sativus]
Length=412

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 247/403 (61%), Gaps = 57/403 (14%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-ASILNTTLQIPDALLGSWR  1060
             + Q  + + FQPSL  VIGIL +MF LTF LL+YAKFCHR ASI    +  P  +  S  
Sbjct  2     DSQDAENSAFQPSLGFVIGILGVMFLLTFILLVYAKFCHRRASISVDDVNHPRQIRSS-P  60

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R SGIDKTV+ESLPFFRFS+LKG++EGLEC+VCLS+FEDIEILRLLPKCKHAFHI+CID 
Sbjct  61    RFSGIDKTVIESLPFFRFSTLKGTKEGLECAVCLSKFEDIEILRLLPKCKHAFHINCIDH  120

Query  879   WLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSRE---ESSLGLYIQRQES------  727
             WLEKH+SCPLCR +V +EDL L++ SSS+RFL S+  E   +S++ L++QR+E       
Sbjct  121   WLEKHASCPLCRRRVGSEDLKLLSNSSSMRFLLSNLSELKQDSNIELFVQREEEEQQQQI  180

Query  726   ------FKFGS--RKIKKDEKLPIQNDQSLQKP-----------LHHLNHRIIVSDVVLK  604
                   F  G   RKI K++K   +N+  + K            LH  NH+IIVSD V  
Sbjct  181   LHGSSRFSIGRSFRKILKNDK---ENEMLISKASGDYEDEKMKNLHRHNHKIIVSDFVFM  237

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             NRWS+VSSSDL+ LN E+I    S   +SL      S+       +EI  + IKEEME K
Sbjct  238   NRWSNVSSSDLMFLNKEMIDAISSRRFTSLETDIEQSTLPRSRQIEEI--LKIKEEMEIK  295

Query  423   RLFEIKVNK---NNPSFPIPTTYAETKNLSQKE------KRSMSEIV-------------  310
             R FE K+NK   +N     P+T   + N SQ        +RS+SEI              
Sbjct  296   RSFESKLNKITQSNSILGYPSTSQSSTNPSQTRITSPDARRSVSEITGVSRFGHDDLYMN  355

Query  309   VHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
              + +F+NG   D    V  ER R++W PIA+RTVQWFA RE R
Sbjct  356   FNRKFKNGESSDLESNVKQERMREIWYPIAKRTVQWFANRETR  398



>gb|ACU21036.1| unknown [Glycine max]
Length=419

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 194/409 (47%), Positives = 255/409 (62%), Gaps = 59/409 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASIL  1105
             V+AQ   T  P+     +N FQPSL VVIGIL +MF LTFFLL+YAKF HR     +++ 
Sbjct  21    VRAQ---TSAPSSGDAVSN-FQPSLAVVIGILGVMFLLTFFLLMYAKFGHRRHGGASAVG  76

Query  1104  NTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
             ++  Q+    + S  R SGIDKTV+ESLPFFRFS+LKG +EGLEC+VCLS+FED+EILRL
Sbjct  77    DSENQL--TFVRSRSRFSGIDKTVIESLPFFRFSALKGLKEGLECAVCLSKFEDVEILRL  134

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLY  745
             +PKCKHAFHI CID WLEKHS+CP+CRH+V  ED +   +S+SLR L     EES++ + 
Sbjct  135   VPKCKHAFHIDCIDHWLEKHSTCPICRHRVNPEDHTTFTYSNSLRMLAG---EESNIEIL  191

Query  744   IQRQESFKFGS-----------RKIKKDEKLPIQ----NDQSLQKPLHHLNHRIIVSDVV  610
             +QR+E    GS           RK  K+E+L IQ    +    QK  H  N RI +SDVV
Sbjct  192   VQREEEEHHGSSRFSVIGSSSFRKTVKEEELLIQKGAEDSDGNQKGYHKHNRRITISDVV  251

Query  609   LKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEME  430
              K+RWS+VS SDL+ LNSE++ D   +SS+  ++   S + G    +++I  M+IKEEME
Sbjct  252   FKHRWSNVSPSDLMFLNSEMLND---TSSNRFSSNLESITRGVVVENEQI--MNIKEEME  306

Query  429   RKRLFEIKV----------NKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV  280
             RK  FE KV          +K +P F   T+ +  K ++  EKRSMSEI    RF  G++
Sbjct  307   RKISFENKVVGALNNIVSDHKEDPPF---TSDSAPKYVNPGEKRSMSEITAVSRF--GDL  361

Query  279   QDYCDVVSD----------ERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
                  V+ D          ER R++W PIARRT QWF  RE R + +SQ
Sbjct  362   GMKMRVLKDFDSLQNNLKEERMRQIWFPIARRTAQWFVNREERRSLQSQ  410



>ref|XP_010540971.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Tarenaya hassleriana]
Length=433

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 248/391 (63%), Gaps = 51/391 (13%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL---QIPDALLGSWRRSSGIDK  1039
             F+PSL VV G+L+IMF+LTF LLLYAK C+  S L + +   Q    ++    R SG+DK
Sbjct  41    FEPSLAVVTGVLSIMFTLTFVLLLYAKCCY--SDLRSDVGEGQTRQRIVNDSARFSGLDK  98

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
             T +ESLPFFRFS+LKGSR GLECSVCLSRFED+EILRLLPKC+HAFHI CIDQWLE+H+S
Sbjct  99    TAIESLPFFRFSALKGSRHGLECSVCLSRFEDVEILRLLPKCRHAFHIGCIDQWLEQHAS  158

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQ---ESFKFGS--RKIKK  697
             CPLCR+++  +D S+  +S+SLRFL  ++ RE+SSL L I+R+   E F  G   RKI K
Sbjct  159   CPLCRNRIAIDDPSVFAYSNSLRFLNQTEVREDSSLELCIEREEKGEEFSIGGSFRKILK  218

Query  696   --DEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIR----DRf  535
               +++ PI  +   +K +H  NHRI+VSD V ++RWS+VSSSDL+ LNSELI     DRF
Sbjct  219   MGNKEKPISEN---EKQMHRFNHRIVVSDAVFQSRWSNVSSSDLMFLNSELINSMSSDRF  275

Query  534   sssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTT---Y  364
             S       +P  +S+  S+ P  E  S  I EEME KR+    ++  N +FP P +    
Sbjct  276   SWMDRPQKDPMRTSTGASEVPEQEGIS-RIMEEMEMKRMVANTLSSMNTTFPNPLSEPGN  334

Query  363   AETKNLSQKEKRSMSEIVVHPR--------FRNGNVQDYC-------------------D  265
              E+   +   +RS+SEI V PR         +N  + +                     +
Sbjct  335   TESGRTAGTGRRSVSEITVVPRRSVLQATGTKNNAIPENNSDSTAIASVSALAFASSSRN  394

Query  264   VVSDERRRKLWLPIARRTVQWFAKRERRSAH  172
             V ++ERRR+LWLPIARRT QWFA RE+R  H
Sbjct  395   VTTEERRRRLWLPIARRTAQWFANREQRFQH  425



>ref|XP_007152896.1| hypothetical protein PHAVU_004G169200g [Phaseolus vulgaris]
 gb|ESW24890.1| hypothetical protein PHAVU_004G169200g [Phaseolus vulgaris]
Length=426

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 193/396 (49%), Positives = 247/396 (62%), Gaps = 44/396 (11%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC-HRASI--LNTTLQIPDALLGSWRRSSG  1048
              + FQPSL VVIGIL +MF LTFFLL+YAKFC HR S   L     +P   + S  R SG
Sbjct  30    VSNFQPSLAVVIGILGVMFLLTFFLLMYAKFCQHRGSSASLGNQENLP-TFVRSRSRFSG  88

Query  1047  IDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             IDKTV+ESLPFFRFSSLKGS+EGLEC+VCLS+FED+E+LRLLPKCKHAFHI CID WLE+
Sbjct  89    IDKTVIESLPFFRFSSLKGSKEGLECAVCLSKFEDVEVLRLLPKCKHAFHIDCIDHWLER  148

Query  867   HSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS--REESSLGLYIQRQES------FKFGS  712
             HSSCP+CRHKV  ED +   +S+SLR L + S   EES+L +++QR+E       F  GS
Sbjct  149   HSSCPICRHKVNPEDHTTFTYSNSLRRLANQSGLGEESNLDIFVQREEEHHGSSRFSVGS  208

Query  711   --RKIK---KDEKLPIQ----NDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALN  559
               RK+    K+E+L IQ    +    QK  H  NH I +SDVV K+RWS+VSSSDL+ LN
Sbjct  209   SFRKMGKGVKEEELLIQKGAEDSDGNQKGYHKHNHMITISDVVFKHRWSNVSSSDLMFLN  268

Query  558   SELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN----  391
             SE++    S+  S+  +     S   +   +E Q  +IKEEMERK  FE KV+  N    
Sbjct  269   SEMLNATSSNRFSNFESNADLMSTPREVVENE-QIKNIKEEMERKISFESKVSALNNIKS  327

Query  390   -----PSFPIPTTYAET---KNLSQKEKRSMSEIVVHPRFRNGNV-----QDYCDV---V  259
                  P F   +    +   K ++  EKRS+SEI    RF +  +     +D   V   +
Sbjct  328   VSEKDPPFTSDSAGNSSHAPKYVNPGEKRSISEITGVSRFGDLGMKMRVFKDSSSVQNNL  387

Query  258   SDERRRKLWLPIARRTVQWFAKRERRSAH--ESQIP  157
              +ER R++W PIA+RT QWF  RE RS    + Q+P
Sbjct  388   KEERMRQIWFPIAKRTAQWFVNRETRSQQSLDKQLP  423



>ref|XP_009352520.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Pyrus x bretschneideri]
Length=436

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 247/397 (62%), Gaps = 44/397 (11%)
 Frame = -1

Query  1242  IPNDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS  1066
             + +D + D  T +Q S+  VIG+L++MF+  F LL+YAK+CHR   +     +   L+  
Sbjct  36    LGSDMASDEETKYQQSVRTVIGVLSVMFAFLFTLLVYAKYCHRRVPVRENSLLETGLISR  95

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
               R SGIDKTV+E+LPFFRFSSLKGSREGLEC+VCLS+FEDIEILRLLPKCKHAFHI+CI
Sbjct  96    SSRFSGIDKTVIEALPFFRFSSLKGSREGLECAVCLSKFEDIEILRLLPKCKHAFHINCI  155

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYIQRQE-----  730
             D WLEKHSSCPLCRHKV++EDL+ + FS+S+R L    S+ R++S++ L++QR+E     
Sbjct  156   DHWLEKHSSCPLCRHKVSSEDLTFVTFSNSMRVLSNNQSEYRQDSNIDLFVQREEDRCGS  215

Query  729   -------SFKFGSRKIKKDEKLPIQNDQSL-------QKPLHHLNHRIIVSDVVLKNRWS  592
                    SF+   + ++K+ +L I+ + +         K LH   H+I+ S     NRWS
Sbjct  216   SRFSIGSSFRKSEKVVEKEAELLIKAEAACGDVTKEDDKILHKHKHKILFSAFEFNNRWS  275

Query  591   SVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFE  412
             ++SSSDL+ LNSE++    S+  S +   +          ++EI  M IKEEME KRLFE
Sbjct  276   NLSSSDLMFLNSEMLNTVSSNRFSPIKLNDEQLLTAKASGNEEI--MKIKEEMEMKRLFE  333

Query  411   IKV---NKN---------NPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC  268
              KV   NKN         + S  I T+   + + ++ EKRSMSEI    RF N    +  
Sbjct  334   NKVSTMNKNSSATYSIVPSTSDSIATSAHASSSTNRGEKRSMSEITALSRFGNLGFTNRT  393

Query  267   DVVS-------DERRRKLWLPIARRTVQWFAKRERRS  178
                S       ++R  +LW+PIARRTVQ FA RE+RS
Sbjct  394   REPSLLENNPKEDRMTRLWMPIARRTVQSFAIREKRS  430



>ref|XP_008390580.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Malus domestica]
Length=434

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 181/400 (45%), Positives = 243/400 (61%), Gaps = 43/400 (11%)
 Frame = -1

Query  1257  HPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDA  1078
             H  +  P+  S + N +Q    +VIG+L+IMFS+TF LL+YAK+C+R   +     +   
Sbjct  30    HVESQAPDVXSDEGNKYQSGXHMVIGVLSIMFSITFALLVYAKYCYRRVPVRQXSLLETG  89

Query  1077  LLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
             L+ S  R SGIDKT +E+LPFFRFSSLKGS+EGLEC+VCLS+FEDIEILRLLPKCKHAFH
Sbjct  90    LISSSSRFSGIDKTXIEALPFFRFSSLKGSKEGLECAVCLSKFEDIEILRLLPKCKHAFH  149

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC---SDSREESSLGLYIQRQE-  730
             I CID WLEKHSSCPLCRH+V++EDL+   FS S+R L    S++R +SS+ L++QR+E 
Sbjct  150   ISCIDXWLEKHSSCPLCRHRVSSEDLTFDTFSDSMRVLSNNQSENRHDSSIDLFVQREED  209

Query  729   -----------SFKFGSRKIKKDEKLPIQNDQSL-------QKPLHHLNHRIIVSDVVLK  604
                        SF    R ++K+++L I+ + +         K LH   H+I  S +   
Sbjct  210   RXXSXRFSVGRSFXKSKRVVEKEDELLIKEEAACSDVTKEDDKILHKHKHKIJFSALEFN  269

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             NRWS++S SDL+ LNSE++    S+  S     +          ++EI  M I+EEME K
Sbjct  270   NRWSNLSPSDLMFLNSEMLNTVSSNRFSPTRJNDEQFLTAKATGNEEI--MKIREEMEMK  327

Query  423   RLFEIKV---NKNNPSFP--IPTTYAETKNLSQK-------EKRSMSEIVVHPRFRNGNV  280
             RLFE KV   NKN+ +    +P+T   T   +         EKRSMSEI    RF N   
Sbjct  328   RLFENKVSTMNKNSSATNSIVPSTSDSTATSAHASSSTNLGEKRSMSEITALSRFGNLXS  387

Query  279   QDYC-------DVVSDERRRKLWLPIARRTVQWFAKRERR  181
              +         +   +ER R+LW+PIARRTVQ FA RE+R
Sbjct  388   XNRXRXPSLLENNAKEERMRRLWMPIARRTVQSFANREKR  427



>ref|XP_009352521.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Pyrus x bretschneideri]
Length=435

 Score =   306 bits (783),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 179/390 (46%), Positives = 244/390 (63%), Gaps = 40/390 (10%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNTTLQIPDALLGS  1066
             P+D S + + FQPS+ VVIGIL++MF+LTF LL+YAK CHR   ++ N     P  L+  
Sbjct  51    PDDPSDEQSNFQPSVAVVIGILSVMFALTFVLLVYAKLCHRRAGAVGNNNNLQPTGLISR  110

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
               R SGIDKTV+E+LPFFRFSSLKGS+EGLECSVCLS+FE +EILRLLPKCKHAFHI CI
Sbjct  111   SSRFSGIDKTVIEALPFFRFSSLKGSKEGLECSVCLSKFEGVEILRLLPKCKHAFHIGCI  170

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES------  727
             D WLEKHSSCPLCRH+V+AE+L+ + +S+S+R++  S+ R++S++ L++QR+E       
Sbjct  171   DHWLEKHSSCPLCRHRVSAEELTSITYSNSMRWINQSERRQDSNIELFVQREEDHRSSSR  230

Query  726   --FKFGSRKIKK--DEKLPIQNDQSL----QKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
                    RK+ K  D++L IQ    +    QK LH   H I+VSD+  KNRWS++SSSDL
Sbjct  231   FSLGSSFRKVDKAIDKELLIQEAADVTEEDQKVLHKHKHTIVVSDLEFKNRWSNLSSSDL  290

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN  391
             + LNSE++  + S   S         S      ++EI  + I+E+       ++     N
Sbjct  291   MFLNSEMLNTKSSDRFSFRHLNVEQFSPVKATGNEEI--VKIRED-------KVGTMNRN  341

Query  390   PSFPIPT-------TYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC-------DVVSD  253
              S  +P+       +   + ++ + EKRSMSEI    RF N   ++         +   +
Sbjct  342   SSASVPSDSDSIAASAHASSSVKRGEKRSMSEITGLSRFANLGFKNRTRGPSLLENNAEE  401

Query  252   ERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
             ERRR+LWLPIA RTVQWFA RE R     Q
Sbjct  402   ERRRRLWLPIASRTVQWFANRENRPPQPQQ  431



>ref|XP_008462695.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis melo]
Length=436

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 245/403 (61%), Gaps = 54/403 (13%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-ASILNTTLQIPDALLGSWR  1060
             + Q  + + FQPSL  VIGIL +MF LTF LL+YAKFCHR ASI    +  P  +  S  
Sbjct  23    DSQDAENSAFQPSLGFVIGILGVMFLLTFILLVYAKFCHRRASISVDGVNHPRQIRSS-S  81

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R SGIDKTV+ESLPFFRFS+LKG++EGLEC+VCLS+FEDIEILRLLPKCKHAFHI+CID 
Sbjct  82    RFSGIDKTVIESLPFFRFSTLKGTKEGLECAVCLSKFEDIEILRLLPKCKHAFHINCIDH  141

Query  879   WLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSRE---ESSLGLYIQRQE-------  730
             WLEKH+SCPLCR +V +EDL L++ SSS+RFL S+  E   +S++ L++QR+E       
Sbjct  142   WLEKHASCPLCRQRVGSEDLKLLSNSSSMRFLLSNLSELKQDSNIELFVQREEEEQQQQQ  201

Query  729   --------SFKFGSRKIKKDEK-----LP---IQNDQSLQKPLHHLNHRIIVSDVVLKNR  598
                     S +   RKI K++K     +P      +    K LH  NH+IIVSD V  NR
Sbjct  202   ILHGSSRFSIRRSFRKILKNDKENEMLIPQASCDYEDEKMKNLHRHNHKIIVSDFVFMNR  261

Query  597   WSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRL  418
             WS++SSSDL+ LN E+I    S   +SL      S+       DEI  + IKEEME KR 
Sbjct  262   WSNISSSDLMFLNKEMIDAISSCRFTSLDTDIEQSTLPRSMQIDEI--LKIKEEMEIKRS  319

Query  417   FEIKVN---KNNPSFPIPTTYAETKNLSQK-------EKRSMSEIVVHPRF---------  295
             FE K+N   ++N     P+T   + N SQ         +RS+SEI    RF         
Sbjct  320   FESKLNTKIQSNSILGYPSTSQSSTNPSQTTRITSPDARRSVSEITGISRFGHDDDLYMN  379

Query  294   -----RNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
                   NG   D    V  ER RK+W PIA+RTVQWFA RE+R
Sbjct  380   FNRKVENGESSDLESSVKQERMRKIWYPIAKRTVQWFANREKR  422



>ref|XP_010249608.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Nelumbo nucifera]
Length=452

 Score =   304 bits (778),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 205/421 (49%), Positives = 250/421 (59%), Gaps = 59/421 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI--LNT  1099
             V AQ+  T       PD  T F+PSL VVI IL IMFSLTF LL+YAKFCH  +    N 
Sbjct  17    VGAQN-GTRAEGSSPPDAVTAFRPSLAVVIAILCIMFSLTFLLLVYAKFCHVPAFGPFNP  75

Query  1098  TLQIPD--------ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
                  D         L  +  R SGID+TV++SLPFFRFSSL+GSREGLEC VCLS+FED
Sbjct  76    GGDNEDELDHRQHRGLFRTRSRLSGIDRTVIDSLPFFRFSSLRGSREGLECVVCLSKFED  135

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC--SDSR  769
              EILRLLPKCKHAFHI C+D+WLE HSSCPLCR+KV  EDLS   +S+SLR+L   SD  
Sbjct  136   TEILRLLPKCKHAFHIDCVDKWLENHSSCPLCRYKVDPEDLSTFTYSNSLRYLGNPSDLG  195

Query  768   EESSLGLYIQRQES------FKFGS--RKIKKDEKLPIQNDQS-----------LQKPLH  646
             E+S++ L++ R++       F  GS  RKI KD++LP+Q  QS            QK LH
Sbjct  196   EDSTVELFVCREQDNQGSSRFSIGSSFRKIDKDDELPLQVQQSNEDSGGGGEDDQQKLLH  255

Query  645   HLNHRIIVSDVVLKNRWSSVSSSDLIALNSELI--------RDRfsssssslanpefsss  490
                H+IIVSDVVLKNRWS VSSSDL+ LNSE++            S+S    A    + +
Sbjct  256   KFKHKIIVSDVVLKNRWSDVSSSDLMFLNSEMLSVLSSNRFSSSASNSQRFTAVQPITLN  315

Query  489   FGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIP---------------TTYAET  355
             F       E   + IKEE+ERKR FE K+   N S+ I                ++ +  
Sbjct  316   FDDGSSKSEQIIIKIKEEIERKRSFESKIGSINRSYSISDASDLPYISNPEANISSTSRF  375

Query  354   KNLSQKEKRSMSEIVVHPRFRNGNVQDYCDV---VSDERRRKLWLPIARRTVQWFAKRER  184
              N S   KRSMSEIV   RF   +  +   V     +ERRR+LWLPIARRTVQWFA RE+
Sbjct  376   LNQSTAGKRSMSEIVKVSRFAESSANNRIKVGNNAKEERRRRLWLPIARRTVQWFAGREK  435

Query  183   R  181
             R
Sbjct  436   R  436



>ref|XP_008337508.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Malus domestica]
Length=435

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 179/396 (45%), Positives = 244/396 (62%), Gaps = 43/396 (11%)
 Frame = -1

Query  1242  IPNDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS  1066
             + +D   D  T +Q S+  VIG+L++MF+  F LL+YAK+CHR   +     +   L+  
Sbjct  36    LGSDMDSDEETKYQRSVRTVIGVLSVMFAFLFXLLVYAKYCHRRVPVQEHSLLETGLISR  95

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
               R SGIDKTV+E+LPFFRFSSLKGSREGLEC+VCLS+FEDIEILRLLPKCKHAFHI+CI
Sbjct  96    SSRFSGIDKTVIEALPFFRFSSLKGSREGLECAVCLSKFEDIEILRLLPKCKHAFHINCI  155

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDS---REESSLGLYIQRQE-----  730
             D WLEKHSSCPLCRHKV++EDL+ + FS+S+R L ++    R++S++ L++QR+E     
Sbjct  156   DHWLEKHSSCPLCRHKVSSEDLTFVTFSNSMRVLSNNQXEHRQDSNIDLFVQREEDRCGS  215

Query  729   -------SFKFGSRKIKKDEKLPIQN------DQSLQKPLHHLNHRIIVSDVVLKNRWSS  589
                    SF+   + + K+ +L I         +   K LH   H+I+ S     NRWS+
Sbjct  216   SRFSIGSSFRKSXKVVXKEAELLIAEAACSDVTKEDDKILHKHKHKILFSAFEFNNRWSN  275

Query  588   VSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEI  409
             +SSSDL+ LNSE++    S+  S +   +          ++EI  M+I+EEME KRLFE 
Sbjct  276   LSSSDLMFLNSEMLNTVSSNRFSPIKLNDEQFLTAKATGNEEI--MNIREEMEMKRLFEN  333

Query  408   KV---NKN---------NPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCD  265
             KV   NKN         + S  I T+   + + ++  KRSMSEI    RF N    +   
Sbjct  334   KVSTMNKNSSATNSIVPSTSDSIATSAHASSSTNRGXKRSMSEITALSRFGNLGFTNGTR  393

Query  264   VVS-------DERRRKLWLPIARRTVQWFAKRERRS  178
               S       ++R R+LW+PIARRTVQ FA RE+RS
Sbjct  394   EPSLLENNPKEDRMRRLWMPIARRTVQSFANREKRS  429



>gb|KCW82386.1| hypothetical protein EUGRSUZ_C03790, partial [Eucalyptus grandis]
Length=395

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 239/389 (61%), Gaps = 50/389 (13%)
 Frame = -1

Query  1221  DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC--HRASILNTTLQIPDALLGSWR-RS-  1054
             D + FQPSLVVV+ IL++MF L   L++YAK+C   R++I       P+A LG  R RS 
Sbjct  1     DDSNFQPSLVVVMAILSLMFLLACVLIVYAKYCLSSRSAIHGN----PEARLGLARSRSQ  56

Query  1053  -SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
              SGIDKTV+ESLPFFRFSSL+GS+EGLEC+VCLS+FED+EILRLLP+CKHAFHI CID+W
Sbjct  57    LSGIDKTVIESLPFFRFSSLRGSKEGLECAVCLSKFEDVEILRLLPQCKHAFHIECIDRW  116

Query  876   LEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLG--LYIQRQESFKFGSR--  709
             LE HSSCP+CR +++ ED ++  +SSS+      SR + S    L++QR+E  +  SR  
Sbjct  117   LENHSSCPICRLRLSVEDPAIFTYSSSMN---QSSRHDDSNPELLFVQREEGNRGSSRFG  173

Query  708   ---------KIKKDEKLPIQN-----DQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
                      K  +++++ I++     DQ  +  LH  NHRI+V D   KNRWS+VSSSDL
Sbjct  174   IGRSLRRMFKADREDEVSIRDAARNADQDPRGDLHKFNHRILVPDGFFKNRWSNVSSSDL  233

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN  391
             + LNSE++    S+  SSL      S   +   +DE Q   I+EEME KRLFE K    +
Sbjct  234   MFLNSEMLSSVSSNRFSSLEANPGQSK--TSRANDEGQIGKIREEMELKRLFESKPGPKS  291

Query  390   -------PSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV-----------QDYCD  265
                       P PT    +K L   EKRSMSEI    R    N+           ++ C 
Sbjct  292   LTSPAPTAGLPPPTAMGRSKYLVLDEKRSMSEITGVSRLGELNMKSRYTQEASSQENGCG  351

Query  264   VVSDERRRKLWLPIARRTVQWFAKRERRS  178
                +ER R+LWLPIARRT QWFA R+RRS
Sbjct  352   SSREERMRRLWLPIARRTAQWFANRDRRS  380



>ref|XP_010049646.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Eucalyptus 
grandis]
Length=427

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 190/408 (47%), Positives = 247/408 (61%), Gaps = 56/408 (14%)
 Frame = -1

Query  1272  NVKAQHP--STIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC--HRASIL  1105
             +V+AQ P    II  D S     FQPSLVVV+ IL++MF L   L++YAK+C   R++I 
Sbjct  18    HVEAQIPPQGPIISQDDS----NFQPSLVVVMAILSLMFLLACVLIVYAKYCLSSRSAIH  73

Query  1104  NTTLQIPDALLGSWR-RS--SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEI  934
                   P+A LG  R RS  SGIDKTV+ESLPFFRFSSL+GS+EGLEC+VCLS+FED+EI
Sbjct  74    GN----PEARLGLARSRSQLSGIDKTVIESLPFFRFSSLRGSKEGLECAVCLSKFEDVEI  129

Query  933   LRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSL  754
             LRLLP+CKHAFHI CID+WLE HSSCP+CR +++ ED ++  +SSS+      SR + S 
Sbjct  130   LRLLPQCKHAFHIECIDRWLENHSSCPICRLRLSVEDPAIFTYSSSMN---QSSRHDDSN  186

Query  753   G--LYIQRQESFKFGSR-----------KIKKDEKLPIQN-----DQSLQKPLHHLNHRI  628
                L++QR+E  +  SR           K  +++++ I++     DQ  +  LH  NHRI
Sbjct  187   PELLFVQREEGNRGSSRFGIGRSLRRMFKADREDEVSIRDAARNADQDPRGDLHKFNHRI  246

Query  627   IVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS  448
             +V D   KNRWS+VSSSDL+ LNSE++    S+  SSL      S   +   +DE Q   
Sbjct  247   LVPDGFFKNRWSNVSSSDLMFLNSEMLSSVSSNRFSSLEANPGQSK--TSRANDEGQIGK  304

Query  447   IKEEMERKRLFEIKVNKNN-------PSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRN  289
             I+EEME KRLFE K    +          P PT    +K L   EKRSMSEI    R   
Sbjct  305   IREEMELKRLFESKPGPKSLTSPAPTAGLPPPTAMGRSKYLVLDEKRSMSEITGVSRLGE  364

Query  288   GNV-----------QDYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
              N+           ++ C    +ER R+LWLPIARRT QWFA R+RRS
Sbjct  365   LNMKSRYTQEASSQENGCGSSREERMRRLWLPIARRTAQWFANRDRRS  412



>ref|XP_009416728.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 236/377 (63%), Gaps = 40/377 (11%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-LQIPDALLGSWR------RS  1054
             +F+PS+ +VIGI A+MF LTF LL+Y K CH A+  + T L + DA  G  R      R 
Sbjct  39    SFRPSVALVIGIFALMFFLTF-LLIYGKVCHSAAAAHATDLLVADAA-GHGRFILPQDRF  96

Query  1053  SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWL  874
             SGID+TV+ESLPFFRFSSL+G R+GLEC+VCLS+F+D E+LRLLPKCKHAFH+ C+D+WL
Sbjct  97    SGIDRTVIESLPFFRFSSLRGVRDGLECAVCLSKFDDAEVLRLLPKCKHAFHVRCVDRWL  156

Query  873   EKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESS---LGLYIQRQESFKFGSR--  709
             E HSSCPLCR KV A+D  L  +S+S RFL +  R E+S   L L+++R+ +     R  
Sbjct  157   EAHSSCPLCRCKVNADDDGLFKYSTSSRFLFASDRLEASGRDLELFVEREPNDAGNLRGS  216

Query  708   ----------KIKKDEKLP-IQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIAL  562
                          K  +LP ++   S  + LH   H+IIVSDVV K+RWS V+SSDLI+L
Sbjct  217   SGFSISSSFPNTDKWRELPTLEEGASGGRILHQFKHKIIVSDVVFKSRWSDVNSSDLISL  276

Query  561   NSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIK---VNKNN  391
             + E++  +      ++ +   S+S G     D++  + IKEEME+KRL EIK   +NKNN
Sbjct  277   DLEMLSGK--DVVWNVESTRSSASEGKASADDKL--LRIKEEMEKKRLLEIKASQINKNN  332

Query  390   PSFPIPTTY--AETKNLSQKEKRSMSEIVVHPRFRN----GNVQDYCDVVSDERRRKLWL  229
                    +     T+ L     RSMS+I    RF      GN   + D   DE+ RKLWL
Sbjct  333   SMSVPSISSSGTNTRALISSGNRSMSDITNVSRFMQLKDPGNSATHGD--EDEKARKLWL  390

Query  228   PIARRTVQWFAKRERRS  178
             PIARRTVQWFA RERRS
Sbjct  391   PIARRTVQWFAGRERRS  407



>ref|XP_009415751.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/397 (44%), Positives = 231/397 (58%), Gaps = 37/397 (9%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS--ILNTTLQ  1090
             A  PS      Q   T +F+P + VVIGI AIMFS+TF LL+YAKFC  A+     T   
Sbjct  50    AAQPSDANTWSQPDVTISFRPGVAVVIGIFAIMFSVTFLLLVYAKFCRSAASEFFGTASA  109

Query  1089  IPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCK  910
                  L    R SGIDK  VESLP FRFS L+G+R+GLEC+VCLSRF D ++LRLLP+CK
Sbjct  110   GHGEFLLPQHRFSGIDKAAVESLPLFRFSMLRGARDGLECAVCLSRFGDADVLRLLPRCK  169

Query  909   HAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESS---LGLYIQ  739
             HAFH+ C+D+W E HS+CPLCR KV AED  L   S+S RFL S  R E     L L+++
Sbjct  170   HAFHVDCVDRWFEAHSTCPLCRCKVDAEDAELFKCSTSSRFLFSSDRHEDGLPDLELFME  229

Query  738   RQ----------------ESFKFGSRKIKKDEKL-PIQNDQSLQKPLHHLNHRIIVSDVV  610
             RQ                 SF+  SR  K+ E L  ++   +  +PLH   H+IIVSDV+
Sbjct  230   RQRFDDGDHRCSSRFSIGSSFRKISRSTKEKEDLRTLEEGTNDAQPLHRFKHKIIVSDVM  289

Query  609   LKNRWSSVSSSDLIALNSELI--------RDRfsssssslanpefsssFGSKHPHDEIQS  454
              K RWS V++SDL++L+++++         D  ++           S+ G    +++I  
Sbjct  290   FKRRWSDVNASDLLSLSADMLDMVSSKRFSDPDANMEPFGDAIAGESAEGKIATNEKI--  347

Query  453   MSIKEEMERKRLFEIKVNKNNPSFPIP---TTYAETKNLSQKEKRSMSEIVVHPRFR--N  289
             + IK+EME+KRL E K  + N S  +     T A ++++    +RSMSEI   PRFR   
Sbjct  348   LKIKKEMEKKRLLENKARRINSSNSVAMPSNTCANSRDVLSSGERSMSEITNLPRFRMIR  407

Query  288   GNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
                   C    DE+ R++WLPIARRTVQWFA RERRS
Sbjct  408   DAGSSGCAGAKDEKLRRIWLPIARRTVQWFAGRERRS  444



>ref|XP_010254027.1| PREDICTED: putative RING-H2 finger protein ATL12 [Nelumbo nucifera]
Length=457

 Score =   293 bits (751),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 194/426 (46%), Positives = 250/426 (59%), Gaps = 61/426 (14%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSP--DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNT  1099
             +V+AQ+ +     D SP    + F PSL VV+GIL+ M SLTF  + YAKF  +    + 
Sbjct  19    DVQAQNGTRA---DASPPDAVSAFHPSLAVVVGILSAMLSLTFLFIAYAKFFLKGEDSSA  75

Query  1098  TLQIPD----------ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRF  949
               Q  D           L  +  R SGIDKTV+ESLPFFRFSSLKG +EGLEC VCLS+F
Sbjct  76    VDQDDDEDDLDHRQHRGLFRTRSRFSGIDKTVIESLPFFRFSSLKGFKEGLECVVCLSKF  135

Query  948   EDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCS--D  775
             ED EILRLLPKCKHAFHI C+D+WLE HS+CPLCRHKV  EDL+L  +S+SLR L    +
Sbjct  136   EDTEILRLLPKCKHAFHIECVDKWLENHSTCPLCRHKVDPEDLTLFTYSNSLRLLGGPPE  195

Query  774   SREESSLGLYI------QRQESFKFGS--RKI---KKDEKLPIQ----------NDQSLQ  658
               E+ ++ L++      Q    F  GS  RKI   KKD +LP+Q            +  +
Sbjct  196   LMEDPNVELFVCIEQDNQGSSRFSVGSSLRKIDSDKKDNELPLQVGGNADDGVVGGEDDR  255

Query  657   KPLHH-LNHRIIVSDVVLKNRWSSVSSSDLIALNSELI------RDRfsssssslanpef  499
             KPLH    H+IIVSDVV KNRWS VSSSDL+ LNSE++      R     S +S      
Sbjct  256   KPLHDKFKHKIIVSDVVFKNRWSDVSSSDLMFLNSEMLSLMSSNRFSSFLSPNSQRFMAA  315

Query  498   sssFGSKHPHDEIQSMSIKEEMERKRLFEIKV-------NKNNPSFPIPTTYAETKNLSQ  340
              S+F    P  E   + IKE+MERKRL E ++       +  + +  +P+T     N++ 
Sbjct  316   PSAFEDGSPKTE-HIIEIKEDMERKRLLESEIISRISTSHSVSDTSELPSTLDPEANITS  374

Query  339   K------EKRSMSEIVVHPRFRNGNVQD--YCDVVSDERRRKLWLPIARRTVQWFAKRER  184
             +      EKRSMSEI+   RF+N   +     +   +ERRR+LW+PIARRTVQWFA RER
Sbjct  375   RFLNNPSEKRSMSEIINLSRFKNRTKESSVVGNNEKEERRRRLWIPIARRTVQWFASRER  434

Query  183   RSAHES  166
              S  +S
Sbjct  435   SSQQQS  440



>ref|XP_010917719.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Elaeis guineensis]
Length=430

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 239/403 (59%), Gaps = 63/403 (16%)
 Frame = -1

Query  1233  DQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA-----SILNTTLQIPDA-LL  1072
             D    T +F+PS+ +VIG+ ++MFSLTF LL+YAKFCH A     S     +  P+  +L
Sbjct  29    DSQGMTVSFRPSVAIVIGVFSLMFSLTFLLLVYAKFCHTAASELFSSDTAGVDRPNGNIL  88

Query  1071  GSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
              +  R SGID+TV+ESLP FRFSSL+G+R+GLEC+VCLSRF+D E+LRLLP+CKHAFH+ 
Sbjct  89    FNHNRFSGIDRTVIESLPLFRFSSLRGARDGLECAVCLSRFDDTELLRLLPQCKHAFHLG  148

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREES-----SLGLYIQRQES  727
             C+D+WLE HSSCPLCR KV+ ED +L  +S+S RFL   SR E       L L+++R+  
Sbjct  149   CVDRWLEAHSSCPLCRRKVSVEDATLFKYSTSSRFLFPSSRREDPGRDLELELFVEREPG  208

Query  726   ----------FKFGS--RKIKKDEK----LPI---QNDQSLQKPLHHLNHRIIVSDVVLK  604
                       F  GS  RKI++ EK    LPI   +ND   +   H   HRIIVSDVV K
Sbjct  209   DNSGRHGSSRFSIGSSFRKIERKEKEKLNLPILEERNDDGGEF-YHKFKHRIIVSDVVFK  267

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEI---------QSM  451
             +RWS V+SSD I+LN++++        S  ++  FS+     +PH E          QS+
Sbjct  268   SRWSDVNSSDFISLNTDML--------SLASSRRFSALDSDANPHFESIPREKRSVDQSV  319

Query  450   -SIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKN-----------LSQKEKRSMSEIVV  307
               IKEEME+KRL E K ++ N   P+    A               +S    RSMSEI +
Sbjct  320   WKIKEEMEKKRLLESKASQMNRGQPVAVGSASHGEGNSGSAGSRPLVSPGNNRSMSEITI  379

Query  306   HPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
               RFR            +E  R+LWLPIARRTVQWFA RER S
Sbjct  380   LSRFR---AVGEPSGAQEEDVRRLWLPIARRTVQWFAGRERMS  419



>ref|XP_008337507.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Malus domestica]
Length=434

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 250/405 (62%), Gaps = 52/405 (13%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNT  1099
             +V+AQ      P+D+  +   FQPS+ VVIGIL+IMF+LTF LL+YAK CHR    + N 
Sbjct  43    HVEAQSSGPDYPSDEQSN---FQPSVXVVIGILSIMFALTFVLLVYAKLCHRRAGVVGNN  99

Query  1098  TLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLP  919
              LQ P  L+    R SGIDKTV+ESLPFFRF +LKGS+EGLECSVCLS+FE +EILRLLP
Sbjct  100   NLQ-PTGLISRSSRFSGIDKTVIESLPFFRFYALKGSKEGLECSVCLSKFEGVEILRLLP  158

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYI  742
             KCKHAFHI CID WLEKHSSCPLCRH+V+AEDL+ + +S+S+R++  S+ R++S++ L++
Sbjct  159   KCKHAFHIGCIDHWLEKHSSCPLCRHRVSAEDLTSITYSNSMRWINQSERRQDSNIELFV  218

Query  741   QRQES--------FKFGSRKIKK--DEKLPIQNDQSL----QKPLHHLNHRIIVSDVVLK  604
             QR+E              RK+ +  D++L IQ    +    QK LH   H I+VSD+  K
Sbjct  219   QREEDHRSSSRFSVGSSFRKVDRAIDKELLIQQAADVTEEDQKVLHKHKHTIVVSDLEFK  278

Query  603   NRWSSVSSSDLIALNSELIR----DRfsssssslanpefsssFGSKHPHDEIQSMSIKEE  436
             +RWS++SSSDL+ LNSE++     DRFS    +        + G+             EE
Sbjct  279   SRWSNLSSSDLMFLNSEMLNTMSSDRFSFRHLNYERFSPVKATGN-------------EE  325

Query  435   MERKRLFEIKVNKNNPSFPIP-------TTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQ  277
             + + R  ++   K N S  +P       T+   + ++++ EKRSMSEI    RF N   +
Sbjct  326   IVKIREDKVGTMKKNSSASVPSASDSIATSAHPSSSVNRGEKRSMSEITGLSRFGNLGFK  385

Query  276   DYC-------DVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
             +         +   +ERRR+LWLPIA RTVQWFA RE R     Q
Sbjct  386   NRTREPSLLENNEEEERRRRLWLPIASRTVQWFANRENRPPQPQQ  430



>gb|AES76795.2| RING-H2 finger protein ATL4J [Medicago truncatula]
Length=376

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 230/393 (59%), Gaps = 79/393 (20%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             ++AQ P T   N Q   +N FQPSLVVVI IL +MFSLTF LL++AK CHR  +L  +  
Sbjct  19    IRAQSP-TQTTNSQDAVSN-FQPSLVVVIAILGLMFSLTFILLIFAKVCHRRQLLPIS-D  75

Query  1089  IPDALLGSWRRS----SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLL  922
              P+  L +  RS    SGIDKT +ESLPFF+FSSLKGS++GLECS+CLS+FEDIEILRLL
Sbjct  76    DPNNQLATLMRSRSRFSGIDKTAIESLPFFKFSSLKGSKQGLECSICLSKFEDIEILRLL  135

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYI  742
             PKCKHAFHI CID WLEKHSSCP+CRHKV  ED +   +S+SLR L S   EES++ +++
Sbjct  136   PKCKHAFHIDCIDHWLEKHSSCPICRHKVNIEDQTTFAYSNSLRMLVS---EESNIEIFV  192

Query  741   QRQES--------FKFGS--RK---------------IKKDEKLPIQNDQSLQKPLHHLN  637
             +R+E         F  GS  RK               I K+E+L I+   S  K  H  N
Sbjct  193   EREEDNNQHGSSRFSIGSSFRKIGKATTIFKEEEKGIISKEEELLIEKSDSNNKAYHKHN  252

Query  636   HRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQ  457
             H+I +SDVV K+RWS+VSSSDL+ LNSE+I +  SS+  +    +F    G K    EI 
Sbjct  253   HKITISDVVFKHRWSNVSSSDLMFLNSEMI-NASSSNRFNNMESKFQDYDGEKRSVSEIT  311

Query  456   SMS-IKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV  280
              +S  K+   +KR+FE             +++ E                          
Sbjct  312   GVSRFKDFDMKKRVFE------------DSSFVENN------------------------  335

Query  279   QDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
                   + +ERRRKLW PIARRT +WF  RE+R
Sbjct  336   ------LKEERRRKLWFPIARRTAEWFVNREKR  362



>ref|XP_010548699.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Tarenaya hassleriana]
Length=429

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 246/403 (61%), Gaps = 47/403 (12%)
 Frame = -1

Query  1236  NDQSPDTN---TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG-  1069
             +DQ+   N    F+PSL VV G+L+IMF+LTF LL+YAK C+  S L +  +   +  G 
Sbjct  31    DDQNRTGNLVANFEPSLAVVTGVLSIMFTLTFVLLVYAKCCY--SDLRSDAEEGQSRGGI  88

Query  1068  -----SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHA  904
                  S RR SG+DKT +ESLPFFRFS+LKGSR+GLECSVCLSRFED+EILRLLP+C+HA
Sbjct  89    FNGPSSSRRFSGLDKTAIESLPFFRFSALKGSRQGLECSVCLSRFEDVEILRLLPRCRHA  148

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLR-FLCSDSREESSLGLYIQRQES  727
             FHI CIDQWLE+H SCPLCR+++  +D S+ ++S+SLR F  S+ RE+SSL LYI+R+E 
Sbjct  149   FHIGCIDQWLEQHGSCPLCRNRIAIDDPSVFSYSNSLRLFNQSEIREDSSLELYIEREEQ  208

Query  726   -----------FKFGS--RKIKK--DEKLPIQNDQSLQKP-----LHHLNHRIIVSDVVL  607
                        F  G   RKI K  D++  I      +K      +   NH I+VSDVV 
Sbjct  209   EGKREDSGSSRFSIGGSFRKILKMGDKEKSISERAGNRKNSKMMRMDRFNHTIVVSDVVF  268

Query  606   KNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMER  427
             KNRWS+VSSSDL+ LNSE++    S   S L   + SS        + I  + IKEEME 
Sbjct  269   KNRWSNVSSSDLMFLNSEMVSSMSSDRFSFLDRLQTSSDARKVQEQEGI--IRIKEEMEM  326

Query  426   KRLFEIKVNKNNPSFPIPTTYAETKNLSQKE------KRSMSEIVVHPRFRNGNVQD---  274
             KR+FE K++  N     P   +E  +   K       +RS+SEI   PR     V     
Sbjct  327   KRMFEDKLSSMNTIMANPVFVSENSDSDPKTRTVETGRRSVSEITAVPRLSVLQVTTNAS  386

Query  273   YCDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQIPSTQH  145
                  S+ERRR+LWLPIARRT +WFA RE R    +QI +TQ 
Sbjct  387   ASASASEERRRRLWLPIARRTARWFANREER----AQINTTQQ  425



>ref|XP_008801472.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Phoenix dactylifera]
Length=427

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 239/393 (61%), Gaps = 45/393 (11%)
 Frame = -1

Query  1233  DQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS--ILNTT---LQIPDA-LL  1072
             D    T +F+PS+ +VIG+ ++MFSLTF LL+YAKFCH A+  + ++    +  P+  +L
Sbjct  28    DSEGVTVSFRPSVAIVIGVFSLMFSLTFLLLVYAKFCHTAASELFSSDPGRVDRPNGHIL  87

Query  1071  GSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
                 R SGIDKTV+ESLPFFRFSSL+G+R GLEC+VCLSRF+D E+LRLLPKCKHAFH+ 
Sbjct  88    SDNNRFSGIDKTVIESLPFFRFSSLRGARAGLECAVCLSRFDDTELLRLLPKCKHAFHLG  147

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREES-----SLGLYIQRQES  727
             C+D+WLE HSSCPLCR KV+ ED +L  +S+S RFL   SR E       L L+++R+  
Sbjct  148   CVDRWLEAHSSCPLCRCKVSVEDATLFKYSTSSRFLFPSSRREDPAKDLELALFVEREPG  207

Query  726   ----------FKFGS--RKIKKDEK--LPI--QNDQSLQKPLHHLNHRIIVSDVVLKNRW  595
                       F  GS  R++++ EK  LPI  + +    +  H   HRIIVSDVV ++RW
Sbjct  208   DNSGRHGSSRFSVGSSFRRMERKEKPNLPILEERNHDGGEFYHKFKHRIIVSDVVFRSRW  267

Query  594   SSVSSSDLIALNSELI---RDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERK  424
             S V+SSD I+LN++++     +  SS  S  N    S    K   D    + IKEE+E+K
Sbjct  268   SDVNSSDFISLNTDMLSLASSKRFSSLDSDLNSYSESIPNEKRSADR-SVLKIKEEIEKK  326

Query  423   RLFEIKVNKNN--PSFPIPTTYAETKN---------LSQKEKRSMSEIVVHPRFRNGNVQ  277
             RL E K ++ N   S  + +      N         +S    RSMSEI    RFR   V 
Sbjct  327   RLLESKASQMNRDQSAAVGSASDGEGNSGTAGSRALVSSGNNRSMSEITNLSRFR--AVS  384

Query  276   DYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
             +      +E+ R+LWLPIARRTVQWFA RE RS
Sbjct  385   EPAG-AKEEKVRRLWLPIARRTVQWFAGRETRS  416



>ref|XP_011081799.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Sesamum indicum]
Length=407

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/397 (44%), Positives = 245/397 (62%), Gaps = 40/397 (10%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-L  1093
             VKAQ PS+        D +   PS+ VV+ +L+IMF +TF ++ YAKFC R    +   +
Sbjct  17    VKAQPPSS------QGDIDPLHPSMAVVLVVLSIMFCITFLIVAYAKFCQRLEPYHANEV  70

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
             Q P  ++ S  R SGID+TV+ESLPFFRFSSL+GS+EGLEC+VCLSRFED EILRLLP+C
Sbjct  71    QEPGGIVRSGSRFSGIDRTVIESLPFFRFSSLRGSKEGLECAVCLSRFEDAEILRLLPRC  130

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQ  733
             +HAFH++CID+WLE HSSCPLCR+K    DL  + +++S R     S EE +L  +IQR+
Sbjct  131   RHAFHMNCIDKWLENHSSCPLCRYKFDVGDLKSLTYTNSFRNP-QTSVEEPNLEFFIQRE  189

Query  732   ESFKFGSR-----------KIKKDEKL--PIQNDQSLQKPLHHLNHRIIVSDVVLKNRWS  592
              + +  SR           + K++E L    +N+ S +K +HH  HRIIVSDV+ K+RWS
Sbjct  190   PNQERSSRFNMANTFQKLGRGKREEPLIQEFRNENSDRKLVHHFKHRIIVSDVIHKSRWS  249

Query  591   SVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFE  412
              V+SSDL++LNSE++      SS   +  E+SS   +     + Q + IKE+MERKRL+E
Sbjct  250   DVNSSDLMSLNSEML---NVISSKRFSALEYSSGRFTNELSAKEQILKIKEDMERKRLYE  306

Query  411   IKVNKNNPSFPIPTTYAE-----------TKNLSQKEKRSMSEIVVHPRFRNG---NVQD  274
             +KV +   S    ++               + L   +KRSMSEI    RF       +  
Sbjct  307   VKVGRIEHSSATTSSCPNDSDIDLDQSTIARTLDPAQKRSMSEITNISRFTENARSRLST  366

Query  273   YCDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
               ++  D+  R++WL IARRT+QWF+ RE  ++HE++
Sbjct  367   PANMGKDDYVRRVWLRIARRTIQWFSGRE--ASHEAR  401



>ref|XP_009406216.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   286 bits (731),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 181/393 (46%), Positives = 232/393 (59%), Gaps = 49/393 (12%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDA-----LLGSWRRSSG  1048
             +F+PS+ +VIGI   MFSLT  LL+YAKFC  A+         DA     L+    R SG
Sbjct  58    SFRPSVGIVIGIFTFMFSLTLLLLVYAKFCRSAAAPEPDSLGADAAGHGRLILPQHRFSG  117

Query  1047  IDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             IDKTV+ESLPFF FSSL+G R+GLECSVCLSRF+D ++LRLLPKCKHAFH+ C+D+WLE 
Sbjct  118   IDKTVIESLPFFSFSSLRGVRDGLECSVCLSRFDDADVLRLLPKCKHAFHVGCVDRWLEA  177

Query  867   HSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESS---LGLYIQRQES----------  727
             HSSCPLCR KV A+D +L  +S+S RFL    R E+S   L L+++RQ +          
Sbjct  178   HSSCPLCRCKVEADDAALFKYSTSSRFLFPSDRLETSGRDLELFVERQPNDDGDPRGFSR  237

Query  726   FKFGS--------RKIKKDEKLP-IQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSD  574
             F  GS         K KKD+ LP ++      +  H   H+IIVSDVV K+RWS V+SSD
Sbjct  238   FGIGSSFRKTDKVTKDKKDQDLPMLEEGADGGRFFHKFKHKIIVSDVVFKSRWSDVNSSD  297

Query  573   LIALNSELIRDRfsssss--slanpefsssFGSKHPHDEIQS--MSIKEEMERKRLFEIK  406
             LIALNSE++  +  +              S GS      +    + IKEEME+KRL EIK
Sbjct  298   LIALNSEMLSGKTLADVYWNVEPTGAARISGGSSEGKASVDEKVLKIKEEMEKKRLLEIK  357

Query  405   VNKNNPS----FP-IPTTYAETKNLSQKE--------KRSMSEIVVHPRFRN----GNVQ  277
              ++ N S     P + +  A   NL+            R+MSEI    RFR     G++ 
Sbjct  358   ASQLNKSCSTALPSMSSNSAHDANLNNTNSRALISSGNRTMSEITNLSRFRQVKDPGSIG  417

Query  276   DYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
                D   DE+ R+LWLPIA+RTVQWFA RE+RS
Sbjct  418   -TTDENEDEKVRRLWLPIAKRTVQWFAGREKRS  449



>ref|XP_010433156.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Camelina sativa]
Length=434

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 184/413 (45%), Positives = 237/413 (57%), Gaps = 58/413 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P      D   +   F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   + 
Sbjct  18    VSAQPPPPFRNGDLVAN---FEPSLAVVTGVLAIMFALTFVLLVYAKCCHIDLRSGSDDR  74

Query  1098  TLQIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
                      G        S  R SG+DK  +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  75    RRYNRRLRQGIFFNRSTASSDRFSGLDKAAIESLPLFRFSALKGSKQGLECSVCLSKFES  134

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSR  769
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR KV+  ED S+ N+ +S RFL  S+  
Sbjct  135   VEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDKVSMEEDSSVFNYGNSFRFLNQSEVG  194

Query  768   EESSLGLYIQRQES-------------FKFGS--RKI----KKDEKLPIQ--NDQSLQKP  652
             E+SSL LYI+R+E              F  G   RKI     K++ L  Q  ND+  +K 
Sbjct  195   EDSSLELYIEREEEERRQRQELGGSSRFSIGGSFRKILKLGNKEKTLLDQQVNDKDDKKL  254

Query  651   LHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHP  472
             +H  NHRI+VSDVV KNRWS+VSSSDL+ LNSE++        SS               
Sbjct  255   MHKFNHRIVVSDVVFKNRWSNVSSSDLMFLNSEMVNS-----ISSERFSSMDRVKSKGDE  309

Query  471   HDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVVHP  301
              D+   + IKEEME KR+ E K+             + +K+ S   +  +RS+SEI   P
Sbjct  310   EDQTGILGIKEEMEAKRMLENKLTSMKTMLLSEKGDSSSKSRSVMIEPGRRSVSEITAVP  369

Query  300   RFR-------NGNVQDYCDVV------SDERRRKLWLPIARRTVQWFAKRERR  181
             R         +G+       +      ++ERRR+LWLPIARRT QWFA RE+R
Sbjct  370   RLSIAVHGDCSGSTAATASALQTGGNETEERRRRLWLPIARRTAQWFANREKR  422



>ref|XP_010049645.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Eucalyptus 
grandis]
 gb|KCW82385.1| hypothetical protein EUGRSUZ_C03789 [Eucalyptus grandis]
Length=430

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 190/419 (45%), Positives = 251/419 (60%), Gaps = 57/419 (14%)
 Frame = -1

Query  1272  NVKAQHP--STIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC--HRASIL  1105
             +V+AQ P    +I  D   D+N  Q SL VV+ IL++MF +   LL+YAK+C   R++I 
Sbjct  18    HVEAQIPPQGAVISQD---DSNV-QSSLGVVMAILSLMFLIACILLVYAKYCLSSRSAIH  73

Query  1104  NTTLQIPDALLGSWR-RS--SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEI  934
             +     P+ALL   R RS  SGIDKT +ESLPFFRFSSL+GS+EGLEC+VCLS+FED+EI
Sbjct  74    SD----PEALLWLTRSRSQLSGIDKTAIESLPFFRFSSLRGSKEGLECAVCLSKFEDVEI  129

Query  933   LRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSL  754
             LRLLP+CKHAFHI CID+WLE HSSCP+CR +++ ED ++  +SSS+R     SR + S 
Sbjct  130   LRLLPQCKHAFHIECIDRWLENHSSCPICRLRLSVEDPAIFTYSSSMRLRNQSSRHDDSN  189

Query  753   G--LYIQRQESFKFGSR-----------KIKKDEKLPIQN-----DQSLQKPLHHLNHRI  628
                L++QR+E  +  SR           K  +++++ I++     DQ  +  LH  NHRI
Sbjct  190   PELLFVQREEGNRGSSRFGIGRSLRRMFKADREDEVSIRDAARNADQDPRGDLHKFNHRI  249

Query  627   IVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS  448
             +V D   KNRWS+VSSSDL+ LNSE++    S+  SSL      S   +   +DE Q   
Sbjct  250   LVPDGFFKNRWSNVSSSDLMFLNSEMLSSASSNRFSSLEANPGQSK--TSRANDEGQIGK  307

Query  447   IKEEMERKRLFEIKVNKNNPSFPI-------PTTYAETKNLSQKEKRSMSEIVVHPRFRN  289
             I+EEME KRLFE K    + + P+       P     +K L   EKRSMSEI    R   
Sbjct  308   IREEMELKRLFESKPGPKSLTSPVLMAGLPPPMATGRSKYLLPDEKRSMSEITGVSRLGE  367

Query  288   GNVQD-YCDVVS----------DERRRKLWLPIARRTVQWFAKRERRSAHESQIPSTQH  145
              N +  Y    S          +ER R+LWLPIARRT QWFA R+RR    SQ P  Q+
Sbjct  368   LNRKSRYTQEASSQENGGGSSREERMRRLWLPIARRTAQWFANRDRR----SQDPENQN  422



>ref|XP_006282599.1| hypothetical protein CARUB_v10004771mg, partial [Capsella rubella]
 gb|EOA15497.1| hypothetical protein CARUB_v10004771mg, partial [Capsella rubella]
Length=458

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 187/414 (45%), Positives = 245/414 (59%), Gaps = 61/414 (15%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNTTL  1093
             AQ P     +D + +   F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   +   
Sbjct  45    AQPPPPFRNDDLAAN---FEPSLAVVTGVLAIMFALTFVLLVYAKCCHIDLRSGSGDRRR  101

Query  1092  QIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIE  937
                    G        S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE +E
Sbjct  102   HDRRLHQGIFFNRSTASSDRFSGLDKTAIESLPLFRFSALKGSKQGLECSVCLSKFESVE  161

Query  936   ILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSREE  763
             ILRLLPKC+HAFHI CIDQWLE+H++CPLCR +V+  ED S+  + +S RFL  S+ RE+
Sbjct  162   ILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDRVSMEEDSSVFTYGNSFRFLNQSEIRED  221

Query  762   SSLGLYIQRQES--------------FKFGS--RKI----KKDEKLPIQ--NDQSLQKPL  649
             SSL LYI+R+E               F  G   RKI     K++ L  Q  ND+  +K +
Sbjct  222   SSLELYIEREEEEERRQREELGGSSRFSIGGSFRKILKLGNKEKTLLDQQVNDKDEKKLM  281

Query  648   HHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPH  469
             H  NHRI+VSDVV KNRWS+VSSSDL+ LNSE++      SS    + +     G +   
Sbjct  282   HKFNHRIVVSDVVFKNRWSNVSSSDLMFLNSEMVNS---ISSERFTSIDRVKRKGDE--E  336

Query  468   DEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVVHPR  298
             D+I  + IKEEME KR+ E K+             + +K+ S   +  +RS+SEI   PR
Sbjct  337   DQIGILGIKEEMEAKRMLENKLTSLKTMLLSENGDSSSKSRSAMIEPGRRSVSEITAVPR  396

Query  297   FRNGNVQDYCDVV--------------SDERRRKLWLPIARRTVQWFAKRERRS  178
                G V + C                 ++ERRR+LWLPIARRT QWFA RE+R+
Sbjct  397   LSIG-VHEDCSGSSAATASALQNGGNETEERRRRLWLPIARRTAQWFANREKRN  449



>ref|XP_010447908.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Camelina sativa]
Length=436

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 242/415 (58%), Gaps = 60/415 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P      D   +   F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   + 
Sbjct  18    VSAQPPPPFRNGDLVAN---FEPSLAVVTGVLAIMFALTFVLLVYAKCCHIDLRSGSDDR  74

Query  1098  TLQIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
                      G        S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  75    RRHNRRLRQGIFFNRSTASSDRFSGLDKTAIESLPLFRFSALKGSKQGLECSVCLSKFES  134

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSR  769
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR KV+  ED S+ N+ +S RFL  S+ R
Sbjct  135   VEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDKVSMEEDPSVFNYGNSFRFLNQSEIR  194

Query  768   EESSLGLYIQRQES---------------FKFGSR-----KIKKDEKLPIQ---NDQSLQ  658
             E+SSL LYI+R+E                F  G       K+   EK  +    ND+  +
Sbjct  195   EDSSLELYIEREEEEEERRQREELGGSSRFSIGGSFQKILKLGNKEKTLLDQQVNDKDDK  254

Query  657   KPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSK  478
             K +H  NHRI+VSDVV KNRWS+VSSSDL+ LNSE++      SS   ++ +     G +
Sbjct  255   KLMHKFNHRIVVSDVVFKNRWSNVSSSDLMFLNSEMVNS---ISSERFSSMDRVKRKGDE  311

Query  477   HPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVV  307
                D++  + IKEEME KR+ E K+             + +K+ S   +  +RS+SEI  
Sbjct  312   --EDQLGILGIKEEMEAKRMLENKLTSMKTMLLSEKGDSSSKSRSVMIEPGRRSVSEITA  369

Query  306   HPRFR-------NGNVQDYCDVV------SDERRRKLWLPIARRTVQWFAKRERR  181
              PR         +G+       +      ++ERRR+LWLPIARRT QWFA RE+R
Sbjct  370   VPRHSIAVHGECSGSTAATASSLQTGGNDTEERRRRLWLPIARRTAQWFANREKR  424



>ref|XP_003620577.1| RING finger family protein [Medicago truncatula]
Length=362

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 175/393 (45%), Positives = 223/393 (57%), Gaps = 91/393 (23%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             +++AQ P T   N Q   +N FQPSLVVVI IL +MFSLTF LL++AK CHR  +L  + 
Sbjct  18    HIRAQSP-TQTTNSQDAVSN-FQPSLVVVIAILGLMFSLTFILLIFAKVCHRRQLLPIS-  74

Query  1092  QIPDALLGSWRRS----SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
               P+  L +  RS    SGIDKT +ESLPFF+FSSLKGS++GLECS+CLS+FEDIEILRL
Sbjct  75    DDPNNQLATLMRSRSRFSGIDKTAIESLPFFKFSSLKGSKQGLECSICLSKFEDIEILRL  134

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLY  745
             LPKCKHAFHI CID WLEKHSSCP+CRHKV  ED +   +S+SLR L S   EES++ ++
Sbjct  135   LPKCKHAFHIDCIDHWLEKHSSCPICRHKVNIEDQTTFAYSNSLRMLVS---EESNIEIF  191

Query  744   IQRQES--------FKFGS--RKI---------------KKDEKLPIQNDQSLQKPLHHL  640
             ++R+E         F  GS  RKI                K+E+L I+   S  K  H  
Sbjct  192   VEREEDNNQHGSSRFSIGSSFRKIGKATTIFKEEEKGIISKEEELLIEKSDSNNKAYHKH  251

Query  639   NHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEI  460
             NH+I +SDVV K+RWS+VSSSDL                                     
Sbjct  252   NHKITISDVVFKHRWSNVSSSDL-------------------------------------  274

Query  459   QSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNV  280
               M +  EM       I  + +N    + + + +       EKRS+SEI    RF++   
Sbjct  275   --MFLNSEM-------INASSSNRFNNMESKFQDYDG----EKRSVSEITGVSRFKD---  318

Query  279   QDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
                 D+   ERRRKLW PIARRT +WF  RE+R
Sbjct  319   ---FDMKKRERRRKLWFPIARRTAEWFVNREKR  348



>ref|XP_010438372.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Camelina sativa]
Length=436

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 187/415 (45%), Positives = 242/415 (58%), Gaps = 60/415 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P      D   +   F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   + 
Sbjct  18    VSAQPPPPFRNGDLVAN---FEPSLAVVTGVLAIMFALTFVLLVYAKCCHIDLRSGTDDR  74

Query  1098  TLQIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
                      G        S  R SG+DK  +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  75    RRHNRRLRQGIFFNRSTASSDRFSGLDKAAIESLPLFRFSALKGSKQGLECSVCLSKFES  134

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSR  769
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR KV+  ED S+ N+ +  RFL  S+  
Sbjct  135   VEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDKVSMEEDPSVFNYGNRFRFLNQSEVG  194

Query  768   EESSLGLYIQRQES---------------FKFGS--RKI----KKDEKLPIQ--NDQSLQ  658
             E+SSL LYI+R+E                F  G   RKI     K++ L  Q  ND+  +
Sbjct  195   EDSSLELYIEREEEEEERRQRQELGGSSRFSIGGSFRKILKLGNKEKTLLDQQVNDKDDK  254

Query  657   KPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSK  478
             K +H  NHRIIVSDVV KNRWS+VSSSDL+ LNSE++      SS   ++ +     G +
Sbjct  255   KLMHKFNHRIIVSDVVFKNRWSNVSSSDLMFLNSEMVNS---ISSERFSSMDRVKRKGDE  311

Query  477   HPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVV  307
                D+I  + IKEEME KRL E K+             + +K+ S   +  +RS+SEI  
Sbjct  312   --EDQIGILGIKEEMEAKRLLENKLTSMKTMLLSENGDSSSKSRSVMIEPGRRSVSEITT  369

Query  306   HPRFR-------NGNVQDYCDVV------SDERRRKLWLPIARRTVQWFAKRERR  181
              PR         +G+       +      ++ERRR+LWLPIARRT QWFA RE+R
Sbjct  370   VPRHSIAVHGDCSGSTAATASALQTGGNETEERRRRLWLPIARRTAQWFANREKR  424



>gb|KDP34182.1| hypothetical protein JCGZ_07753 [Jatropha curcas]
Length=413

 Score =   279 bits (714),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 182/400 (46%), Positives = 242/400 (61%), Gaps = 54/400 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC--HRASILNTT  1096
             VKAQ PS   P+  S      +PSL VV+GI +IM S+TF +L YAKFC  +R    +  
Sbjct  19    VKAQSPSN--PSSYSGVLKPLRPSLAVVVGITSIMLSVTFLVLAYAKFCRRNRNDHSDRD  76

Query  1095  LQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPK  916
              Q  +AL+ S  R SGID+ V++SLPFFRFSSLKGS++GLECSVCLSRFE+ EILRLLPK
Sbjct  77    NQHLNALIRSRSRFSGIDRAVIDSLPFFRFSSLKGSKQGLECSVCLSRFEETEILRLLPK  136

Query  915   CKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC----SDSREESSLGL  748
             CKHAFH +CIDQWLE HSSCPLCR+K    D  L +FS S R L     S+  ++ +L L
Sbjct  137   CKHAFHQNCIDQWLESHSSCPLCRYKFDP-DNDLKSFSYSNRDLQYRNPSNLTDDPNLEL  195

Query  747   YIQRQESFKF---------GSRKIKKDEKLPIQNDQS----LQKPLHHLNHRIIVSDVVL  607
             +IQR+E ++           SR     ++L + + +S     Q+ LH L H+IIVSDV++
Sbjct  196   FIQREEDYRHSSSRFNLVSSSRGSSNKQELLLADQESDNYNNQQFLHKLKHKIIVSDVII  255

Query  606   KNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS-----IK  442
             KNRWS V+SSDL++LNSE++           +    +    S+  +  I SM+     IK
Sbjct  256   KNRWSDVNSSDLLSLNSEML-----------SAISSNRFSNSRFYNSSILSMNEDIEKIK  304

Query  441   EE-MERKRLFEIKVNKNNPSFPIPTTYAE---TKNLSQKEKRSMSEIVVHPRFRNGNVQD  274
             E+ +ERKRL+  K+  +  S    ++Y E   +K ++  EKRSMSEI +  RF+  N + 
Sbjct  305   EDILERKRLYHSKICSSERSNSFSSSYKEETYSKIINHGEKRSMSEITICSRFKELNTKS  364

Query  273   -----------YCDVVSDERRRKLWLPIARRTVQWFAKRE  187
                          D   DE+RR LWLPI RRTVQWFA  E
Sbjct  365   NKSKELEILPRNSDNKEDEKRR-LWLPIVRRTVQWFAGEE  403



>ref|XP_010688281.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 180/430 (42%), Positives = 245/430 (57%), Gaps = 85/430 (20%)
 Frame = -1

Query  1251  STIIPNDQ-----SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNTTL  1093
             ST + N Q     +P ++ FQPSL VVIG+L+ MFSLT  LL+YAK CHR  ++I N + 
Sbjct  14    STQLANAQDEQQHTPTSSNFQPSLFVVIGVLSFMFSLTIILLIYAKMCHRRPSAIYNVSR  73

Query  1092  QIP----DALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
                    + + G+  R SGIDKTVVE+LPFFRFSSLKGS++GLEC+VCLS FE++EILRL
Sbjct  74    NQNSDNNEGMFGNNTRFSGIDKTVVEALPFFRFSSLKGSKQGLECAVCLSEFEEVEILRL  133

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL--------CSDSR  769
             LPKCKH FHI C+D WLE HS+CPLCR KV+ ED S +  ++S RF+          D  
Sbjct  134   LPKCKHGFHIQCLDLWLEHHSTCPLCRQKVSIEDFSTL--TNSTRFIIGGLKPDDAGDDP  191

Query  768   EESSLGLYIQRQE--------------SFK--FGSRKIKKDEKLPIQNDQSLQKPLHHLN  637
               SS  L+++R++              SFK    +   K++E++ ++ +Q   K LH  N
Sbjct  192   ASSSFELFLEREDEEHRERSSRFCIGGSFKKILSASAKKEEEEMDMKVEQG--KVLHKHN  249

Query  636   HRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQ  457
             H+I+VSDV+ KNRWS VSSSDL+ LNSE++    +   SS      + S   +H     +
Sbjct  250   HQIVVSDVMFKNRWSDVSSSDLMFLNSEMLGVMSNEPFSSSNLLNDAKSVDDEH----YR  305

Query  456   SMSIKEEMERKRLFEIKVN-----KNNPSFPIPTTYAETKNLSQK------------EKR  328
              ++IKEEM++K +FE KV       +N    I     ++  ++              EKR
Sbjct  306   IINIKEEMQKKMIFEHKVGHIKRCNSNSELKIDLGVGDSSEINMNLNPSRRNFLISGEKR  365

Query  327   SMSEIVVHPRFRN--------------------GNVQDYC--DVVSDERRRKLWLPIARR  214
             SMSEI    RF++                     N  DY   DV+   +RRK W PIA+R
Sbjct  366   SMSEITAFSRFKDLMSVKNKLRQCLADSEVNKSDNDDDYAREDVI---KRRKKWFPIAKR  422

Query  213   TVQWFAKRER  184
             TVQWFA RE+
Sbjct  423   TVQWFANREK  432



>gb|KCW79664.1| hypothetical protein EUGRSUZ_C01015, partial [Eucalyptus grandis]
Length=268

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 182/241 (76%), Gaps = 18/241 (7%)
 Frame = -1

Query  1215  NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL-----QIPDALLGSWRRSS  1051
             + FQPSL VVIGIL++MFS+TF LL+YAKFCHRA   +TT      + P AL  S  R S
Sbjct  3     SNFQPSLAVVIGILSVMFSVTFVLLVYAKFCHRAG--STTAGSGDQENPAALTRSRSRFS  60

Query  1050  GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLE  871
             GIDKTV+ESLPFFRFSSLKGS++GLEC+VCLS+FEDIEILRLLPKC+HAFHI CID WLE
Sbjct  61    GIDKTVIESLPFFRFSSLKGSKQGLECAVCLSKFEDIEILRLLPKCRHAFHIDCIDYWLE  120

Query  870   KHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQESFK---------  721
             KHSSCPLCRHKV+AED +   +++S+R +  SD R++S+L L++QR+   +         
Sbjct  121   KHSSCPLCRHKVSAEDPANFTYTNSMRLMSQSDMRQDSNLELFVQREAGIQGSSSRFSIG  180

Query  720   FGSRKI-KKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIR  544
                RKI K +++  IQ +   QK LH  NHRII SDVVLKNRWS++SSSDL+ LNSE++ 
Sbjct  181   SSFRKIFKSNKEEEIQEEAEKQKILHKFNHRIIASDVVLKNRWSNLSSSDLMFLNSEMLN  240

Query  543   D  541
             D
Sbjct  241   D  241



>ref|XP_009137814.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Brassica rapa]
 emb|CDY50930.1| BnaA03g59080D [Brassica napus]
Length=420

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 183/400 (46%), Positives = 233/400 (58%), Gaps = 46/400 (12%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P   + N        F+PSL VV  +LAIMFSLTFFLL+YAK CH   R+     
Sbjct  18    VSAQPPPPPLTNGDL--VANFEPSLAVVTVVLAIMFSLTFFLLVYAKCCHIDLRSRTGEG  75

Query  1098  TLQIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
               Q    + G        S  R SG+DKTV+ESLP FRFS+LKGS++GL+CSVCLS+FE 
Sbjct  76    RRQDRRIIQGIFVNRSANSSDRFSGLDKTVIESLPLFRFSALKGSKQGLDCSVCLSKFES  135

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSRE  766
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR +V+ E+     + +S RFL  S+ RE
Sbjct  136   VEILRLLPKCRHAFHIGCIDQWLEEHATCPLCRDRVSIEE-EYSVYGNSFRFLNQSEVRE  194

Query  765   ESSLGLYIQRQES---------FKFGS--RKI----KKDEKLPIQ--NDQSLQKPLHHLN  637
             +SSL LYI+R++          F  G   RKI     K++ L  Q  ND+  +K +H  N
Sbjct  195   DSSLELYIEREQEEEEVGGSSRFSIGDSFRKILKLGHKEKPLLDQHGNDKDERKLMHKFN  254

Query  636   HRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQ  457
             HRIIVSDVV KNRWS+VSSSDL+ LNSE++      SS S                D   
Sbjct  255   HRIIVSDVVFKNRWSNVSSSDLMFLNSEMV------SSISSERFLSMDRVKRGDEEDGRG  308

Query  456   SMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVVHPRFRNG  286
             S+ +KE+ E KR+ E K+             + +K+ S   +  +RS+SEI   PR    
Sbjct  309   SLQVKEDTEAKRMLENKLTSMKTMLLSENGESGSKSRSVMVETGRRSVSEITAVPRLGIA  368

Query  285   NVQDY-----CDVVSDERRRKLWLPIARRTVQWFAKRERR  181
                DY        +  ERRR+LWLPIAR T QWFA RE R
Sbjct  369   VHGDYSGSTAATALETERRRRLWLPIARNTAQWFANRELR  408



>ref|XP_002867435.1| ring-H2 finger protein ATL4J precursor [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43694.1| ring-H2 finger protein ATL4J precursor [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 244/409 (60%), Gaps = 63/409 (15%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNTTLQIPDALLG--------S  1066
              F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   +          G        S
Sbjct  34    NFEPSLAVVTGVLAIMFALTFVLLVYAKCCHIDLRSDSGDRRRHDRRLRQGIFFNRSTTS  93

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
               R SG+DKT +ESLP FRFS+LKGS++GL+CSVCLS+FE IEILRLLPKC+HAFHI CI
Sbjct  94    SDRFSGLDKTAIESLPLFRFSALKGSKQGLDCSVCLSKFESIEILRLLPKCRHAFHIGCI  153

Query  885   DQWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES-----  727
             DQWLE+H++CPLCR +V+  ED S+ +  +S RFL  S+ RE+SSL LYI+R+E      
Sbjct  154   DQWLEQHATCPLCRDRVSMEEDSSVFSNGNSFRFLNQSEIREDSSLELYIEREEEEDRRQ  213

Query  726   ---------FKFGS--RKIKK---DEKLPI----QNDQSLQKPLHHLNHRIIVSDVVLKN  601
                      F  G   RKI K    EK  +     +D+  +K +H  NHRI+VSDVV KN
Sbjct  214   RDELGGSSRFSIGESFRKILKLGNKEKTLLDEHGNSDKDEKKLMHKFNHRIVVSDVVFKN  273

Query  600   RWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKR  421
             RWS+VSSSDL+ LNSE++     S SS        +  G +   D+I  + IKEEME KR
Sbjct  274   RWSNVSSSDLMFLNSEMVN----SISSERFLSIDRAKRGDE--EDQIGILRIKEEMEAKR  327

Query  420   LFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVVHPRFR-------NGNVQDY  271
             + E K+      F      + +K+ S   +  +RS+S+I   PR         +G+    
Sbjct  328   MLENKLTSMKTMFSPENGDSGSKSRSVMIEPGRRSVSDITAVPRLSISVHRDCSGSAAGT  387

Query  270   CDVV------SDERRRKLWLPIARRTVQWFAKRERRSAHESQIPST-QH  145
                +      ++ERRR+LWLPIAR+T QWFA RE+R    +QI +T QH
Sbjct  388   ASALQNGGNETEERRRRLWLPIARKTAQWFANREKR----NQINTTHQH  432



>emb|CDX92900.1| BnaC07g41580D [Brassica napus]
Length=415

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 182/399 (46%), Positives = 237/399 (59%), Gaps = 48/399 (12%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P+  + N        F+PSL VV  +LAIMFSLTFFLL+YAK CH   R+   + 
Sbjct  19    VSAQRPAPPLTNGDL--VANFEPSLAVVTVVLAIMFSLTFFLLVYAKCCHIDLRSRTGDG  76

Query  1098  TLQIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
               Q   ++ G        S  R SG+D+TV+ESLP FRFS+LKGS++GL+CSVCLS+FE 
Sbjct  77    RRQDRRSIQGIFVNRSTNSSDRFSGLDRTVIESLPLFRFSALKGSKQGLDCSVCLSKFES  136

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSR  769
             +EILRLLPKC+HAFH+ CIDQWLE+H++CPLCR +V+  E+ S+  + +S RFL  S+ R
Sbjct  137   VEILRLLPKCRHAFHVGCIDQWLEEHATCPLCRDRVSIDEEYSV--YGNSFRFLNESEVR  194

Query  768   EESSLGLYIQRQES------FKFGS--RKI----KKDEKLPIQ--NDQSLQKPLHHLNHR  631
             ++SSL LYI+R E       F  G   RKI     K++ L  Q  ND+  +K +H  NHR
Sbjct  195   KDSSLELYIERDEEVGESSRFSIGDSFRKILKLGHKEKPLLDQHGNDKDERKLMHKFNHR  254

Query  630   IIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSM  451
             IIVSDVV KNRWS+VSSSDL+ LNSE++      SS S                D   S+
Sbjct  255   IIVSDVVFKNRWSNVSSSDLMFLNSEMV------SSISSERFSLVDRVKRGDEDDGRGSL  308

Query  450   SIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQK---EKRSMSEIVVHPRFRNGNV  280
              IKEE   KR+ E K++            + +K  + K    +RS+SEI   PR      
Sbjct  309   WIKEE---KRMLENKLSSMKTMLLSENGESGSKARTVKVEPGRRSVSEITAIPRLSIAVH  365

Query  279   QDYCD-----VVSDERRRKLWLPIARRTVQWFAKRERRS  178
              DY        +  ERRR+LWLPIAR T QWFA +E R+
Sbjct  366   GDYSGSTASTALETERRRRLWLPIARNTAQWFANKELRN  404



>ref|XP_006476134.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Citrus sinensis]
 gb|KDO79809.1| hypothetical protein CISIN_1g038034mg [Citrus sinensis]
Length=422

 Score =   274 bits (701),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 180/404 (45%), Positives = 243/404 (60%), Gaps = 55/404 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             VKAQ  S   P+   P      P++ VVIG+L+I FSL F +L YAKFC +++  N    
Sbjct  18    VKAQETSNSEPDSLHP----LHPNIAVVIGVLSIAFSLLFLVLAYAKFC-QSNHSNFADG  72

Query  1089  IP-----DALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
              P       L+ S  R SGIDK V+ESLP FRF+SL+GS+EGLEC+V LS+FED EILRL
Sbjct  73    DPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRL  132

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSLG  751
             LPKC+HAFH+ CIDQWLE H+SCPLCR+K    D    ++S+SLRFL   S+  EE +L 
Sbjct  133   LPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLE  192

Query  750   LYIQRQESFKFGS--------RKI---KKDEKLPIQNDQ---SLQKPLHHLNHRIIVSDV  613
             +++QR++S +  S        RKI   KK E+L I+        QK LH   H+IIV+DV
Sbjct  193   IFVQREQSHQGSSRFNLRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADV  252

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS-----  448
             V+KNRWS V+SSDL++LNSE++        S ++   F  S       D + S++     
Sbjct  253   VIKNRWSDVNSSDLLSLNSEML--------SVMSINRFLPSNSKSGRFDNVFSVNDNMVK  304

Query  447   IKEEMERKRLFE-----IKVNKNNPSFPIPTTYAETKN----LSQKEKRSMSEIVVHPRF  295
             IKE++ERKRL+E     I+ + +     I ++Y   +N    L+  EKRSMSEI    RF
Sbjct  305   IKEDIERKRLYESRFSGIEKSHSVSGSSISSSYYNDENSSKLLNGTEKRSMSEITNFARF  364

Query  294   RNGNVQDYCDVVS-------DERRRKLWLPIARRTVQWFAKRER  184
             R  N+       S       +ER R++WLP+ +RTVQWF+ RER
Sbjct  365   REFNISKKIRETSAGDESRKEERLRRVWLPMVQRTVQWFSGRER  408



>ref|XP_011011910.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Populus euphratica]
Length=409

 Score =   273 bits (699),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 170/392 (43%), Positives = 243/392 (62%), Gaps = 38/392 (10%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC--HRASILNTT  1096
             VKAQ    I  +  +       PSL VV+GI++IM S+TF +L YAK+C  ++ + L + 
Sbjct  16    VKAQ----ITSDSDTGILKPLHPSLAVVLGIISIMLSITFLILAYAKYCRINQNNFLGSN  71

Query  1095  ---LQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRL  925
                 Q    L+ S  + SGID+ ++ SLPFFRFSSLKGS+EGLEC+VC+S+FED E+LRL
Sbjct  72    PGHHQNVHGLIRSRSKFSGIDEEMINSLPFFRFSSLKGSKEGLECAVCISKFEDSEVLRL  131

Query  924   LPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSLG  751
             LPKC HAFH +CIDQWL  HSSCPLCR+K+   DL   + S S R+L   SD  E+ +L 
Sbjct  132   LPKCMHAFHKNCIDQWLTSHSSCPLCRYKLDPMDLKTFSCSKSWRYLRNPSDLTEDPNLE  191

Query  750   LYIQRQE------------SFKFGSRKIKKDEKLPI--QNDQSLQKPLHHLNHRIIVSDV  613
             ++++R++            S +  + K +K+E L I  +N    +K LH   H+II+SDV
Sbjct  192   IFVEREQDHQGSLWFNPRSSIQISNHKDRKEELLIIAGRNADDNRKLLHKFKHKIIISDV  251

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFG-SKHPHDEIQSMSIKEE  436
             ++KNRWS V+SSD ++LN+E++R   S+  S L +       G S++ + E    +IKE+
Sbjct  252   LIKNRWSDVNSSDFLSLNTEMLRVMSSNRFSPLKSSSIRFYNGLSRNENFE----NIKED  307

Query  435   MERKRLFEIKVNK-NNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC---  268
             +ERKRLFE K    +  +    +    +K ++   KRSMSEI +  RFR  +V++     
Sbjct  308   IERKRLFESKFTTVDRSNSVSSSRLNSSKIINSASKRSMSEITIFSRFRQLSVRNKTKES  367

Query  267   ----DVVSDERRRKLWLPIARRTVQWFAKRER  184
                 +  +DER RKLWLPIARRT+QWFA +ER
Sbjct  368   TSPGNGATDERIRKLWLPIARRTIQWFAGQER  399



>ref|XP_006412899.1| hypothetical protein EUTSA_v10025235mg [Eutrema salsugineum]
 gb|ESQ54352.1| hypothetical protein EUTSA_v10025235mg [Eutrema salsugineum]
Length=436

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 187/432 (43%), Positives = 249/432 (58%), Gaps = 73/432 (17%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P    P         F+PSL VV G+LAIMF LTF LL+YAK CH   R+  +  
Sbjct  18    VSAQPPP---PFRNGGIVENFEPSLAVVTGVLAIMFMLTFVLLVYAKCCHIDLRSGTVEG  74

Query  1098  TLQIPDALLG---------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFE  946
               Q      G         S  R SG+DKT +ESLP FRF +LKGS++GLECSVCLS+FE
Sbjct  75    RRQDRRLRQGIFFNRSSNSSEDRFSGLDKTAIESLPLFRFCALKGSKQGLECSVCLSKFE  134

Query  945   DIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSR  769
             ++EILRLLPKC+HAFHI CIDQWLE+H++CPLCR +V+ ED S + + +S RFL  S+ R
Sbjct  135   NVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDRVSIEDESSV-YGNSFRFLNQSEIR  193

Query  768   EESSLGLYIQRQES-----------------FKFGS--RKIKK--DEKLPIQNDQSLQKP  652
             E+SSL LYI+R+E                  F  G   RKI +  D++ P+ +   ++K 
Sbjct  194   EDSSLELYIEREEEEEEERRREREEIGGSSRFSIGGSFRKILRLGDKEKPLLDRHGIEKE  253

Query  651   ----LHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFG  484
                 +   NHRI+VSDVV KNRWS+VSSSDL+ LNSE++    +   SS+          
Sbjct  254   EKKLMRKFNHRIVVSDVVFKNRWSNVSSSDLMFLNSEMVNSISTERFSSMDRV-------  306

Query  483   SKHPHDEIQS--MSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMS  319
              K   +E QS  + IKEEM+ KR+ E K+   N         + +K+ S   +  +RS+S
Sbjct  307   -KRGDEEDQSVILRIKEEMDGKRMLEHKLTSMNTMLLSENRDSGSKSRSVMIEPGRRSVS  365

Query  318   EIVVHPRFR-------NGNVQDYCDVV------SDERRRKLWLPIARRTVQWFAKRERRS  178
             EI   PR         +G+       +      ++ERRR+LWLPIAR+T QWFA RE+R 
Sbjct  366   EITAVPRLSIAVHGDCSGSTAATASALENEGNETEERRRRLWLPIARKTAQWFANREKR-  424

Query  177   AHESQIPST-QH  145
                +QI +T QH
Sbjct  425   ---NQIKTTHQH  433



>ref|NP_194618.3| E3 ubiquitin-protein ligase ATL42 [Arabidopsis thaliana]
 sp|Q5XF85.2|ATL42_ARATH RecName: Full=E3 ubiquitin-protein ligase ATL42; AltName: Full=RING-H2 
finger protein ATL42; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB43903.1| putative protein [Arabidopsis thaliana]
 emb|CAB81477.1| putative protein [Arabidopsis thaliana]
 gb|AAY57611.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE85559.1| E3 ubiquitin-protein ligase ATL42 [Arabidopsis thaliana]
Length=432

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 184/407 (45%), Positives = 241/407 (59%), Gaps = 62/407 (15%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNTTLQIPDALLG--------SW  1063
             F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   +          G        S 
Sbjct  33    FEPSLAVVTGVLAIMFALTFVLLVYAKCCHIDLRSGSGDRRRHDRRLRQGIFFNRSTASS  92

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
              R SG+DKT +ESLP FRFS+LKGS++GL+CSVCLS+FE +EILRLLPKC+HAFHI CID
Sbjct  93    DRFSGLDKTAIESLPLFRFSALKGSKQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCID  152

Query  882   QWLEKHSSCPLCRHKVTA-EDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES------  727
             QWLE+H++CPLCR +V+  ED S++   +S RFL  S+ RE+SSL LYI+R+E       
Sbjct  153   QWLEQHATCPLCRDRVSMEEDSSVLTNGNSFRFLNQSEIREDSSLELYIEREEEEERIHR  212

Query  726   --------FKFGS--RKIKK---DEKLPIQ---NDQSLQKPLHHLNHRIIVSDVVLKNRW  595
                     F  G   RKI K    EK  +    ND+  +K +H  NHRI+VSDVV KNRW
Sbjct  213   EELSGSSRFSIGESFRKILKLGNKEKTLLDEHVNDKDEKKLMHKFNHRIVVSDVVFKNRW  272

Query  594   SSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLF  415
             S+VSSSDL+ LNSE++       S S                D+I  + IKEEME KR+ 
Sbjct  273   SNVSSSDLMFLNSEMVN------SISSERFSSLDHVKRGDEEDQIGILRIKEEMEAKRML  326

Query  414   EIKVNKNNPSFPIPTTYAETKNLS---QKEKRSMSEIVVHPRFR-------NGNVQDYCD  265
             E K+      F      + +K+ S   +  +RS+S+I   PR         +G+  +   
Sbjct  327   ENKLTSMTTMFSSENGDSGSKSRSVMIEPGRRSVSDITAVPRLSISIHGDCSGSAAETAS  386

Query  264   VV------SDERRRKLWLPIARRTVQWFAKRERRSAHESQIPST-QH  145
              +      ++ERRR+LWLPIAR+T QWFA RE+R    SQI +T QH
Sbjct  387   ALQNGGNETEERRRRLWLPIARKTAQWFANREKR----SQINTTHQH  429



>gb|EYU20442.1| hypothetical protein MIMGU_mgv1a025601mg [Erythranthe guttata]
Length=379

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/368 (42%), Positives = 221/368 (60%), Gaps = 30/368 (8%)
 Frame = -1

Query  1215  NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDA--LLGSWRRSSGID  1042
             N   PS+ +V+ +L++MF LTF ++ YAKFCH  +          A  L G   R SG+D
Sbjct  2     NPLHPSMAIVLLVLSLMFCLTFLIVAYAKFCHSPTATEPPGGGGGAHDLTGPRSRFSGLD  61

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             +T++E+LPFFRFSSLKGS++GLECSVCLSRF++ EILRLLPKC+HAFH+ CID+WLE HS
Sbjct  62    RTLIETLPFFRFSSLKGSKDGLECSVCLSRFDESEILRLLPKCRHAFHMSCIDKWLESHS  121

Query  861   SCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREES---SLGLYIQRQESFK----------  721
             SCPLCRHK   +DL  +++++S R   +D  ++    +L  +IQR+++ +          
Sbjct  122   SCPLCRHKFDIKDLKSLSYTNSFRISSTDDYDQDQPPNLEFFIQREQNQERPSSRFNNMA  181

Query  720   ------FGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALN  559
                   + +   K +E L I N+Q     +H++ HRIIVSDV+ K+RWS V+SSDLI+LN
Sbjct  182   NTLQRLYNNTGKKSEEPLIINNNQDYS-IMHNVKHRIIVSDVMHKSRWSDVNSSDLISLN  240

Query  558   SELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFP  379
             SE++    +  +   +     +        ++I  + IKE+MERK+  E KV   N    
Sbjct  241   SEMLMISATYGTGFSSPSGRLTYSNEVSAKEQI--LKIKEDMERKKFVESKVVVGNGQTS  298

Query  378   IPTTYA----ETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRT  211
                + +     TK+L   EKRSMSEI    RF+        D   DE   ++WLPIARRT
Sbjct  299   SGESSSMMVTSTKSLDSGEKRSMSEITSFSRFKELRFGKNVD--EDENVARVWLPIARRT  356

Query  210   VQWFAKRE  187
             +Q FA +E
Sbjct  357   IQKFADQE  364



>ref|XP_006450676.1| hypothetical protein CICLE_v10010263mg [Citrus clementina]
 gb|ESR63916.1| hypothetical protein CICLE_v10010263mg [Citrus clementina]
Length=422

 Score =   271 bits (694),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 243/405 (60%), Gaps = 55/405 (14%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             +VKAQ  S   P+   P      P++ VVIG+L+I FSL F +L YAKFC +++  N   
Sbjct  17    HVKAQETSNSEPDSLHP----LHPNIAVVIGVLSIAFSLLFLVLAYAKFC-QSNHSNFAD  71

Query  1092  QIP-----DALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILR  928
               P       L+ S  R SGIDK V+ESLP FRF+SL+GS+EGLEC+V LS+FED EILR
Sbjct  72    GDPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILR  131

Query  927   LLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSL  754
             LL KC+HAFH+ CIDQWLE H+SCPLCR+K    D    ++S+SLRFL   S+  EE +L
Sbjct  132   LLAKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDHGSFSYSNSLRFLRIPSNLTEEPNL  191

Query  753   GLYIQRQESFKFGS--------RKI---KKDEKLPIQNDQ---SLQKPLHHLNHRIIVSD  616
              +++QR++S +  S        RKI   KK E+L I+        QK LH   H+IIV+D
Sbjct  192   EIFVQREQSHQGSSRFNLRSSFRKIELNKKQEELLIEGGSRSYGDQKLLHKFKHKIIVAD  251

Query  615   VVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS----  448
             VV+KNRWS V+SSDL++LNSE++        S ++   F  S       D + S++    
Sbjct  252   VVIKNRWSDVNSSDLLSLNSEML--------SVMSINRFLPSNSKSGRFDNVFSVNDNMV  303

Query  447   -IKEEMERKRLFE-----IKVNKNNPSFPIPTTYAETKN----LSQKEKRSMSEIVVHPR  298
              IKE++ERKRL+E     I+ + +     I ++Y   +N    L+  EKRSMSEI    R
Sbjct  304   KIKEDIERKRLYESRFSGIEKSHSVSGSSISSSYYNDENSSKLLNGTEKRSMSEITNFAR  363

Query  297   FRNGNVQDYCDVVS-------DERRRKLWLPIARRTVQWFAKRER  184
             FR  N+       S       +ER R++WLP+ +RTVQWF+ RER
Sbjct  364   FREFNISKKIRETSAGDESRKEERLRRVWLPMVQRTVQWFSGRER  408



>gb|KCW81558.1| hypothetical protein EUGRSUZ_C02915 [Eucalyptus grandis]
Length=407

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 229/389 (59%), Gaps = 42/389 (11%)
 Frame = -1

Query  1206  QPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL--QIPDALLGSWRRSSGIDKTV  1033
              PS+VV++ +LA+MFSLTF +L YAKFCHR     + L  Q    L  S  R SGID+  
Sbjct  37    HPSMVVIVSVLAMMFSLTFLVLAYAKFCHRTPAGPSFLDSQNDPGLNESMPRFSGIDQKA  96

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             ++SLP FRFSSL+GS+EGLEC+VC++RFED E LRLLP+CKHAFH +CIDQWL+ HSSCP
Sbjct  97    IDSLPLFRFSSLRGSKEGLECAVCINRFEDSETLRLLPRCKHAFHSNCIDQWLKSHSSCP  156

Query  852   LCRHKVTAEDLSLMNFSSSLRF---LCSDSREESSLGLYIQRQE-------------SFK  721
             LCR+K    DL+    S SLRF   + S+  E+++L L +QR+              SF+
Sbjct  157   LCRYKFNPGDLTSFAHSLSLRFPQRIPSNLLEDANLELSVQREADNDHGSSRYGDRISFR  216

Query  720   FGSRKIKKDEKLPIQND---QSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSEL  550
             +  R++   E+   +      S QK LH   H+IIVSDVV KNRWS V+SSDL+ LNSE+
Sbjct  217   YSERELNYGEECLNEESGDCGSDQKLLHKFKHKIIVSDVVTKNRWSDVNSSDLLFLNSEM  276

Query  549   IRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPT  370
             I + FSSS  + +        G    +  +    IK ++ERKRLF+ KV     S  +  
Sbjct  277   I-NVFSSSRFADSEARSGYFNGDFTANKNL--AKIKNDIERKRLFQSKVGATASSSNVLA  333

Query  369   TYAETKNL---SQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWF  199
                E  +    +  EKRSMSEIV      NG          +ER R+LWLP+ RRTVQWF
Sbjct  334   NPGENSSKLMNNPTEKRSMSEIVDLRGNNNGR---------EERMRQLWLPMVRRTVQWF  384

Query  198   AKRERRSAHESQIPSTQHNP*RHNIQHIL  112
             A +ER S         +    R N+++IL
Sbjct  385   AGQERDSRE------AEEKAHRSNVENIL  407



>ref|XP_002516536.1| ring finger protein, putative [Ricinus communis]
 gb|EEF45877.1| ring finger protein, putative [Ricinus communis]
Length=407

 Score =   271 bits (692),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 236/385 (61%), Gaps = 36/385 (9%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILN----  1102
             VKAQ+   I  +DQS      QPSL VVIGI+++M S+TF +L YAKFC R    N    
Sbjct  18    VKAQN---ISDSDQSGVLRPLQPSLAVVIGIISVMLSVTFLILAYAKFCRRNLTDNHLSH  74

Query  1101  TTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLL  922
              T      L+ S  R SGID+ V++SLPFFRFSSLKGS+EGLEC+VCLSRFEDIEILRLL
Sbjct  75    DTNHQGFTLVRSRSRLSGIDREVIDSLPFFRFSSLKGSKEGLECAVCLSRFEDIEILRLL  134

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSR--EESSLGL  748
             PKCKHAFH +CIDQWLE HSSCPLCR+K    +L    +S+SLR+  + S   ++ +L L
Sbjct  135   PKCKHAFHKNCIDQWLESHSSCPLCRYKFDPNELKSFRYSNSLRYSQTPSNLADDPNLEL  194

Query  747   YIQRQESFK----FGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSS  580
             +I R++ ++    F   K KK+E L  +         H   H+IIVSDV++KNRWS  +S
Sbjct  195   FIHREQDYQGSSTFNLGKGKKEELLSQEGHNKKFL--HKFKHKIIVSDVIIKNRWSDFNS  252

Query  579   SDLIALNSELIRDRfsssssslanpefsssFG-SKHPHDEIQSMSIKEEMERKRLFEIKV  403
             SDL++++SE++    S+  S   +    S    S + H E     IKE++ERKRL E K+
Sbjct  253   SDLLSMSSEMLNVMSSNMFSHSDSTNGRSYNNLSMNEHIE----KIKEDIERKRLCESKL  308

Query  402   NKNNPS-------FPIPTTYAET--KNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVS--  256
              K   S       FP  +   E+  K ++  EKRS+SEI V  RF   ++++     +  
Sbjct  309   TKAEGSDSFSASCFPSTSYKGESSLKMINPGEKRSISEITVCSRFNGSSLKNKIRESASP  368

Query  255   -----DERRRKLWLPIARRTVQWFA  196
                  ++R R+LW PIA+RTVQWFA
Sbjct  369   RSSEREDRTRRLWFPIAQRTVQWFA  393



>ref|XP_010416391.1| PREDICTED: putative RING-H2 finger protein ATL12 [Camelina sativa]
Length=393

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 167/383 (44%), Positives = 227/383 (59%), Gaps = 60/383 (16%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWR  1060
             P DQ   ++ F+PSL ++ G+ +I+F+LTF LL+YAK        N  LQ+     G  R
Sbjct  26    PPDQYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAK------CFNNDLQLETESEGERR  79

Query  1059  RS--------------SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLL  922
             R               SG+DKT +ESLPFFRFS+LKG ++GLECSVCLS+FED+EILRLL
Sbjct  80    RHERLWQGLFNRSSRFSGLDKTAIESLPFFRFSALKGLKQGLECSVCLSKFEDVEILRLL  139

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAE-DLSLMNFSS--SLRFLC-SDSREE-SS  757
             PKCKHAFHI CID+WLE+H++CPLCR++V  E DLS++  +S  SLR +  S +REE S 
Sbjct  140   PKCKHAFHIGCIDEWLEQHATCPLCRNRVNIEDDLSILGCTSSHSLRMVNQSQTREEDSG  199

Query  756   LGLYIQRQESFKFGSRK-------IKKDEKLPIQNDQSLQ--KPLHHLNHRIIVSDVVLK  604
             L +YI+R+E   +GS +       +KK   L  Q ++ ++  K +H  NHRI+VSD+V K
Sbjct  200   LEIYIEREEGISYGSSRFSSFRMILKKSFFLERQGNEDIEEKKAMHKFNHRIVVSDIVFK  259

Query  603   NRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSI--KEEME  430
             NRWS+V+SSDL  L SE++    S   SS+               D +Q  ++  KE+ME
Sbjct  260   NRWSNVTSSDLTYLISEMLNSLSSDRFSSI---------------DRVQRGNLREKEDME  304

Query  429   RKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRN-GNVQDYCDVVSD  253
              KR+ + K +       I T   E    + +   S S        RN GN        ++
Sbjct  305   MKRMLKNKDSSRRTVSEITTVRREN---AVEGCYSGSTAATASTSRNSGNA-----ATTE  356

Query  252   ERRRKLWLPIARRTVQWFAKRER  184
             ERRR+LWLPIARRT QWF  RE+
Sbjct  357   ERRRRLWLPIARRTAQWFVNREK  379



>ref|XP_009129172.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Brassica rapa]
Length=417

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 171/389 (44%), Positives = 232/389 (60%), Gaps = 59/389 (15%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNTTLQIPDALLG-------  1069
                F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   +   Q      G       
Sbjct  33    VTNFEPSLAVVTGVLAIMFTLTFVLLVYAKCCHIDLRSGTGDGRRQDRRLRQGIFFNRST  92

Query  1068  -SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
              S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE +EILRLLPKC+HAFH+ 
Sbjct  93    NSSDRFSGLDKTAIESLPLFRFSALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHVG  152

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES----  727
             CIDQWLE+H++CPLCR +V+ ED S + + +S RFL  S+ RE+SSL LYI+R+E     
Sbjct  153   CIDQWLEQHATCPLCRARVSVEDESSV-YGNSFRFLNQSEVREDSSLELYIEREEEEEER  211

Query  726   -----------FKFGS--RKIKK--DEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWS  592
                        F  G   RKI K   +  P+ +     K +H  NHRI+VSDVV KNRWS
Sbjct  212   RQREELGGSSRFSIGGSFRKILKLGHKDKPLLDQHGEDKAMHKFNHRILVSDVVFKNRWS  271

Query  591   SVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFE  412
             +VSSSDL+ LNSE++    S   SS+   +           D+  ++ IKEE   K + E
Sbjct  272   NVSSSDLMFLNSEMVSSISSERFSSMDRVKR------GDEEDQRGNVGIKEE---KGMLE  322

Query  411   IKVNKNNPSFPIPTTYAETKN-LSQKEKRSMSEIVVHPRF-----------RNGNVQDYC  268
              K+++N          ++++N + +  +RS+S+I   PR               +  +  
Sbjct  323   NKLSENR------DFGSKSRNVMIEPGRRSISDITAVPRLSVVVHGDCSGSNAASALENG  376

Query  267   DVVSDERRRKLWLPIARRTVQWFAKRERR  181
                ++ERRR+LWLPIAR+T QWFA RE+R
Sbjct  377   GNETEERRRRLWLPIARKTAQWFANREKR  405



>ref|XP_004151366.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis sativus]
Length=422

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 243/402 (60%), Gaps = 49/402 (12%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQP-SLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V AQ PS        P   +  P +  +VIGIL+IMFS+ F L++YAKFCH  S      
Sbjct  19    VIAQAPSP-------PKAGSGIPQNFTIVIGILSIMFSMVFILVVYAKFCHPTSHFRGEP  71

Query  1092  Q--IPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLP  919
             Q  +   LL S  R SG+D+ V+++LPFFRFSSLKGSREGLEC+VCLS+FEDIE+LRLLP
Sbjct  72    QAHLGHGLLRSDSRFSGVDQKVIDALPFFRFSSLKGSREGLECAVCLSKFEDIEVLRLLP  131

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREE----SSLG  751
             KCKHAFHI CID WLEKHSSCP+CR ++  ED++    S+S+R + ++SR E    S + 
Sbjct  132   KCKHAFHIGCIDHWLEKHSSCPICRCRIGVEDIAFFK-SNSIRLIRNNSRSELPQDSRIE  190

Query  750   LYIQRQESFKFGSR-----------KIKKDEKLPIQND----QSLQKPLHHLN-HRIIVS  619
             L++QR+E+    SR           K  K++++ I+N+    +S ++ L H + H+I+VS
Sbjct  191   LFVQREENHHNSSRSNNGTSFRNIGKGNKEKEVLIENEAGECESEERVLFHKHKHKILVS  250

Query  618   DVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKE  439
             D V  NRWS++SSSDL+ LN+E++     SS+   +    S S  +    +  ++  IKE
Sbjct  251   DFVFMNRWSNLSSSDLVFLNTEML--GVMSSNRFSSLDSESISQSATREKEGKKTSQIKE  308

Query  438   EMERKRLFEIKVN---KNN-------PSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRN  289
             EME KR FE +++   KN+        S       + ++     E+RS+S+     RF  
Sbjct  309   EMEMKRSFERRISIAEKNSLVSISGISSTSSDPNASTSRTTILNERRSVSDTTAFSRFGY  368

Query  288   GN---VQDYCDVVSDE---RRRKLWLPIARRTVQWFAKRERR  181
              N    +D   + +D    R R+LWLPIARRTVQWFA RE+R
Sbjct  369   FNENATRDSSMIEADAKSFRIRQLWLPIARRTVQWFANREQR  410



>ref|XP_004172921.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis sativus]
Length=422

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 242/402 (60%), Gaps = 49/402 (12%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQP-SLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V AQ PS        P   +  P +  +VIGIL+IMFS+ F L++YAKFCH  S      
Sbjct  19    VIAQAPSP-------PKAGSGIPQNFTIVIGILSIMFSMVFILVVYAKFCHPTSHFRGEP  71

Query  1092  Q--IPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLP  919
             Q  +   LL S  R SG+D+ V+++LPFFRFSSLKGSREGLEC+VCLS FEDIE+LRLLP
Sbjct  72    QAHLGHGLLRSDSRFSGVDQKVIDALPFFRFSSLKGSREGLECAVCLSNFEDIEVLRLLP  131

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREE----SSLG  751
             KCKHAFHI CID WLEKHSSCP+CR ++  ED++    S+S+R + ++SR E    S + 
Sbjct  132   KCKHAFHIGCIDHWLEKHSSCPICRCRIGVEDIAFFK-SNSIRLIRNNSRSELPQDSRIE  190

Query  750   LYIQRQESFKFGSR-----------KIKKDEKLPIQND----QSLQKPLHHLN-HRIIVS  619
             L++QR+E+    SR           K  K++++ I+N+    +S ++ L H + H+I+VS
Sbjct  191   LFVQREENHHNSSRSNNGTSFRNIGKGNKEKEVLIENEAGECESEERVLFHKHKHKILVS  250

Query  618   DVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKE  439
             D V  NRWS++SSSDL+ LN+E++     SS+   +    S S  +    +  ++  IKE
Sbjct  251   DFVFMNRWSNLSSSDLVFLNTEML--GVMSSNRFSSLDSESISQSATREKEGKKTSQIKE  308

Query  438   EMERKRLFEIKVN---KNN-------PSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRN  289
             EME KR FE +++   KN+        S       + ++     E+RS+S+     RF  
Sbjct  309   EMEMKRSFERRISIAEKNSLVSISGISSTSSDPNASTSRTTILNERRSVSDTTAFSRFGY  368

Query  288   GN---VQDYCDVVSDE---RRRKLWLPIARRTVQWFAKRERR  181
              N    +D   + +D    R R+LWLPIARRTVQWFA RE+R
Sbjct  369   FNENATRDSSMIEADAKSFRIRQLWLPIARRTVQWFANREQR  410



>emb|CDX97460.1| BnaC08g13250D [Brassica napus]
Length=408

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 183/418 (44%), Positives = 243/418 (58%), Gaps = 74/418 (18%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-L  1093
             V AQ P+  + N        F+PSL +V G+LAIMF+LTF LL+YAK CH   +  +   
Sbjct  19    VSAQPPAPPLSNGDL--VANFEPSLAIVTGVLAIMFALTFVLLVYAKCCHMDLLSGSGDG  76

Query  1092  QIPDALL----------GSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
             +  D L+           S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  77    RRQDRLIRQGFFFNRSTNSSARFSGLDKTAIESLPMFRFSALKGSKQGLECSVCLSKFES  136

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSRE  766
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR++V+ E+ S + + +S RFL  S  RE
Sbjct  137   VEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRNRVSVEEESSV-YINSFRFLNESARRE  195

Query  765   ESSLGLYIQRQES----------------FKFGS--RKIKK---DEKLPIQ---NDQSLQ  658
             +SSL LYI+R+E                 F  G   RKI K    EK  ++   ND+   
Sbjct  196   DSSLELYIEREEEEERRRRQREEVGSSSRFSIGGSFRKILKLGHKEKPLLEQQGNDKDEN  255

Query  657   KPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSK  478
             K +H  NHRI VSDVV KNRWS+VSSSDL+ LNSE++           +      SF   
Sbjct  256   KVMHKFNHRIFVSDVVFKNRWSNVSSSDLMFLNSEMV----------SSISSERFSFRRS  305

Query  477   HPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPR  298
             +  D+  ++ ++E+ME K L  +K           T      N S   +RS+SEI   PR
Sbjct  306   NEEDQRGNLRVEEDMESK-LSSMK-----------TMLLSESNDSG--RRSVSEITTVPR  351

Query  297   FR---NGNVQDYCDVVS---DERRRKLWLPIARRTVQWFAKRERRSAHESQIPST-QH  145
                  +G+        +   +ERRR+LWLPIAR+T QWFA RE+R    +QI +T QH
Sbjct  352   LSIAVHGDCSGPTAATASETEERRRRLWLPIARKTAQWFANREKR----NQINTTFQH  405



>emb|CDY06859.1| BnaC01g09580D [Brassica napus]
Length=417

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 174/406 (43%), Positives = 237/406 (58%), Gaps = 61/406 (15%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P+   P         F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   + 
Sbjct  18    VSAQPPAP--PFRNGDLVTNFEPSLAVVTGVLAIMFTLTFVLLVYAKCCHIDLRSGTGDG  75

Query  1098  TLQIPDALLG--------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
               Q      G        S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  76    RRQDRRLRQGIFFNRSTNSSDRFSGLDKTAIESLPLFRFSALKGSKQGLECSVCLSKFES  135

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSRE  766
             +EILRLLPKC+HAFH+ CIDQWLE+H++CPLCR +V+ ED S ++  +S RFL  S+ RE
Sbjct  136   VEILRLLPKCRHAFHVGCIDQWLEQHATCPLCRARVSVEDESSVH-GNSFRFLNQSEVRE  194

Query  765   ESSLGLYIQRQES---------------FKFGS--RKIKK--DEKLPIQNDQSLQKPLHH  643
             +SSL LYI+R+E                F  G   RKI K   +  P+ +     K +H 
Sbjct  195   DSSLELYIEREEEEEERRQREELGGSSRFSIGGSFRKILKLGHKDKPLLDQHGEDKVMHK  254

Query  642   LNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDE  463
              NHRI+VSDVV KNRWS+VSSSDL+ LNSE++    S   SS+   +           D 
Sbjct  255   FNHRILVSDVVFKNRWSNVSSSDLMFLNSEMVSSISSERFSSMDRVKR------GDEEDR  308

Query  462   IQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKN-LSQKEKRSMSEIVVHPRF---  295
               ++ +KE+    R+ E K+++N          ++++N + +  +RS+S+I   PR    
Sbjct  309   RGNLQVKED---NRMLENKLSENR------DLGSKSRNVMIEPGRRSISDITAVPRLSIV  359

Query  294   --------RNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
                        +  +     ++ERRR+LWLPIAR+T QWFA RE+R
Sbjct  360   VHGDCSGSNAASALENGGNETEERRRRLWLPIARKTAQWFANREKR  405



>ref|XP_009109068.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Brassica rapa]
Length=420

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 180/421 (43%), Positives = 244/421 (58%), Gaps = 69/421 (16%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH----------  1120
             V AQ P+  + N        F+PSL +V G+LAIMF+LTF +L+YAK CH          
Sbjct  20    VSAQPPAPPLSNGDL--VANFEPSLAIVTGVLAIMFALTFVVLVYAKCCHMDLLSGSGDG  77

Query  1119  -RASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
              R   L       +    S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  78    RRQDRLTRQGFFFNRSTNSSARFSGLDKTAIESLPMFRFSALKGSKQGLECSVCLSKFES  137

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVT-AEDLSLMNFSSSLRFLC-SDSR  769
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR +V+  ED S+  + +S RFL  S  R
Sbjct  138   VEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDRVSIEEDTSV--YVNSFRFLNESARR  195

Query  768   EESSLGLYIQRQES----------------FKFGS--RKIKK---DEKLPIQ---NDQSL  661
             E+SSL +YI+R+E                 F  G   RKI K    EK  ++   ND+  
Sbjct  196   EDSSLEIYIEREEEEERRRRQREEVGSSSRFSIGGSFRKILKLGHKEKPLLEHQGNDKDE  255

Query  660   QKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGS  481
              K +H  NHRI VSDVV KNRWS+VSSSDL+ LNSE++           +      SF  
Sbjct  256   NKVMHKFNHRIFVSDVVFKNRWSNVSSSDLMFLNSEMV----------SSISSERFSFRR  305

Query  480   KHPHDEIQSMSIKEEMERK--RLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVV  307
              +  D+  ++ IKE+ME K   +  + ++++N S     +      +++  +RS+SEI  
Sbjct  306   SNEEDQRGNLRIKEDMENKLSSMKTMLLSESNDSGSKSRSV-----MTETGRRSVSEITT  360

Query  306   HPRFR---NGNVQDYCDVVS---DERRRKLWLPIARRTVQWFAKRERRSAHESQIPST-Q  148
              PR     +G+        +   +ERRR+LWLPIA +T QWFA RE+R    +QI +T Q
Sbjct  361   VPRLSIAVHGDCSGSNAATASETEERRRRLWLPIASKTAQWFANREKR----NQINTTVQ  416

Query  147   H  145
             H
Sbjct  417   H  417



>ref|XP_002886004.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62263.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=398

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 230/385 (60%), Gaps = 44/385 (11%)
 Frame = -1

Query  1233  DQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL--------QIPDA  1078
             D    ++ F+PSL ++ G+ +I+F+LTF LL+YAK  H      T          ++   
Sbjct  34    DIYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAKCFHNDLRSETDGDGETRRHDRLWQG  93

Query  1077  LLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
             L     R SG+DK  +ESLPFFRF++LKG ++GLECSVCLS+FED+EILRLLPKC+HAFH
Sbjct  94    LFNRSSRFSGLDKKAIESLPFFRFAALKGLKQGLECSVCLSKFEDVEILRLLPKCRHAFH  153

Query  897   IHCIDQWLEKHSSCPLCRHKVTAE-DLSLM-NFSSSLRFLC-SDSREESS-LGLYIQRQE  730
             I CIDQWLE+H++CPLCR++V  E DLS++ N SSSLR +  S++REE S L +YI+R+E
Sbjct  154   IGCIDQWLEQHATCPLCRNRVNVEDDLSVLGNSSSSLRIMNQSETREEDSRLEIYIEREE  213

Query  729   SFKFGS------RKI-KKDEKLPIQNDQSL--QKPLHHLNHRIIVSDVVLKNRWSSVSSS  577
                 GS      RKI KK   L  + ++++  +K +H  NHRI+VSDVV KNRWS+V+SS
Sbjct  214   GTSDGSSRFSSFRKILKKSLLLEREGNENIDEKKLMHKFNHRIVVSDVVFKNRWSNVTSS  273

Query  576   DLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK  397
             DL  L SE++                SS   S        ++  KE+ME KR+  +K NK
Sbjct  274   DLTFLTSEML-------------NSLSSDRFSSMDRVHRGNLRDKEDMEMKRM--LKKNK  318

Query  396   NNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIAR  217
             +     +      ++  +     S S        +N  +       ++ERRR+LWLPIAR
Sbjct  319   DTSRRTVSEIMTVSRENAVGGSYSGSTAATASTSQNYAIT----ATTEERRRRLWLPIAR  374

Query  216   RTVQWFAKRERRSAHESQIPSTQHN  142
             RT QWF  RE+R    +++ +T+ N
Sbjct  375   RTAQWFVNREKR----NELNTTRQN  395



>ref|XP_010489106.1| PREDICTED: putative RING-H2 finger protein ATL12 [Camelina sativa]
Length=389

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 165/388 (43%), Positives = 230/388 (59%), Gaps = 73/388 (19%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL---------QI  1087
             P D    ++ F+PSL ++ G+ +I+F+LTF LL+YAK C    + + T          +I
Sbjct  25    PPDPYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAK-CFNNDLRSETESEGERRRHERI  83

Query  1086  PDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKH  907
                L     R SG+DKT +ESLPFF FS+LKG ++GLECSVCLS+FED+EILRLLPKCKH
Sbjct  84    WQGLFNRSSRFSGLDKTAIESLPFFSFSALKGLKQGLECSVCLSKFEDVEILRLLPKCKH  143

Query  906   AFHIHCIDQWLEKHSSCPLCRHKVTAE-DLSLM-NFSSSLRFLC-SDSREE--SSLGLYI  742
             AFHI CID+WLE+H++CPLCR++V  E DLS++ N ++SLR +  S +REE  S L +YI
Sbjct  144   AFHIGCIDEWLEQHATCPLCRNRVNIEDDLSVLGNSNNSLRMVNQSQTREEEDSGLEIYI  203

Query  741   QRQESFKFGS------RKI-KKDEKLPIQNDQSLQ--KPLHHLNHRIIVSDVVLKNRWSS  589
             +R+E    GS      RKI KK   L  Q ++ ++  K +H  NHRI+VSDVV KNRWS+
Sbjct  204   EREEGTSDGSSRFSSFRKILKKSLFLERQGNEDIEEKKAMHKFNHRIVVSDVVFKNRWSN  263

Query  588   VSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIK--EEMERKRLF  415
             V+SSDL  L SE++    S   S +               D +Q  +++  E+ME KR+ 
Sbjct  264   VTSSDLTFLTSEMLNSMSSDRLSLM---------------DRVQRGNLRENEDMEMKRVL  308

Query  414   EIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFR------NGNV----QDYC-  268
             + K +                      +R++SEI+  PR        +G+     Q Y  
Sbjct  309   KTKYSS---------------------RRTVSEIMTVPRENVVGGSYSGSTASTSQSYAV  347

Query  267   DVVSDERRRKLWLPIARRTVQWFAKRER  184
                ++ERRR+LWLPI+RRT QWF  RE+
Sbjct  348   TATTEERRRRLWLPISRRTAQWFVNREK  375



>emb|CDY35230.1| BnaA01g08010D [Brassica napus]
Length=417

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 232/395 (59%), Gaps = 71/395 (18%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNTTLQIPDALLG-------  1069
                F+PSL VV G+LAIMF+LTF LL+YAK CH   R+   +   Q      G       
Sbjct  33    VTNFEPSLAVVTGVLAIMFTLTFVLLVYAKCCHIDLRSGTGDGRRQDRRLRQGIFFNRST  92

Query  1068  -SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
              S  R SG+DKT +ESLP F+FS+LKGS++GLECSVCLS+FE +EILRLLPKC+HAFH+ 
Sbjct  93    NSSDRFSGLDKTAIESLPLFKFSALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHVG  152

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES----  727
             CIDQWLE+H++CPLCR +V+ ED S + + +S RFL  S+ RE+SSL LYI+R+E     
Sbjct  153   CIDQWLEQHATCPLCRARVSVEDESSV-YGNSFRFLNQSEVREDSSLELYIEREEEEEER  211

Query  726   -----------FKFGS--RKIKK--DEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWS  592
                        F  G   RKI K   +  P+ +     K +H  NHRI+VSDVV KNRWS
Sbjct  212   RQREELDGASRFSIGGSFRKILKLGHKDKPLLDQHGEDKVMHKFNHRILVSDVVFKNRWS  271

Query  591   SVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFE  412
             +VSSSDL+ LNSE++    S   SS+   +           D+  ++  KEE   K + E
Sbjct  272   NVSSSDLMFLNSEMVSSISSERFSSMDRVKR------GDEEDQRGNLRFKEE---KGMLE  322

Query  411   IKVNKNNPSFPIPTTYAETKN-LSQKEKRSMSEIVVHPR-----------------FRNG  286
              K+++N          ++++N + +  +RS+S+I   PR                   NG
Sbjct  323   NKLSENR------DFGSKSRNVMIEPGRRSISDITAVPRLSIVVHGDCSGSNAASELENG  376

Query  285   NVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
               +      ++ERRR+LWLPIAR+T QWFA RE+R
Sbjct  377   GNE------TEERRRRLWLPIARKTAQWFANREKR  405



>ref|XP_006408917.1| hypothetical protein EUTSA_v10001998mg [Eutrema salsugineum]
 gb|ESQ50370.1| hypothetical protein EUTSA_v10001998mg [Eutrema salsugineum]
Length=412

 Score =   260 bits (665),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 219/372 (59%), Gaps = 41/372 (11%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG------------S  1066
             F+PSL ++ G+ +++F+LTF LL+YAK C +  + + +    +   G            S
Sbjct  38    FKPSLAIITGVFSVVFTLTFVLLVYAK-CFQNDLRSESDGDGEGDRGRHDRLWQGLFNRS  96

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R SSG++KT +ESLPFFRFS+LKGS++GLECSVCLS+FED+EILRLLPKCKHAFHI CI
Sbjct  97    SRLSSGLNKTAIESLPFFRFSALKGSKQGLECSVCLSKFEDVEILRLLPKCKHAFHIGCI  156

Query  885   DQWLEKHSSCPLCRHKVTAED--LSLMNFSSSLRFLC-SDSREE-SSLGLYIQRQE----  730
             DQWLE+H++CPLCR++V  ED    L   S+SLR +  SD REE SSL +YI+R+E    
Sbjct  157   DQWLEQHATCPLCRNRVNIEDDLFGLGCSSNSLRIMSQSDIREEDSSLEIYIEREEGVNS  216

Query  729   ---SFKFGS----RKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
                S +F S     KI K EK    ++Q  +K +H  NHRI+VSDV  KNRWS+V+SSDL
Sbjct  217   DDGSSRFSSFRKILKIGKKEKSLSLDEQGTEKLMHKFNHRIVVSDVAFKNRWSNVTSSDL  276

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN  391
               L S+++    S   SS+           +   +   ++  KEE+E KR+ + K +   
Sbjct  277   AFLTSKMLNSVSSDRFSSV----------DRVQRENGGNLGNKEEIEMKRMLKNKDSTRR  326

Query  390   PS---FPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIA  220
                    +P         + +EK           F     Q+     ++E RR+LWLPIA
Sbjct  327   AVSEITAVPRLGVLQVTTATREKAVGGSESGLAAFTASTSQNDAVAATEESRRQLWLPIA  386

Query  219   RRTVQWFAKRER  184
             RRT QWF  RE+
Sbjct  387   RRTAQWFVNREK  398



>ref|XP_006853596.1| hypothetical protein AMTR_s00056p00027410 [Amborella trichopoda]
 gb|ERN15063.1| hypothetical protein AMTR_s00056p00027410 [Amborella trichopoda]
Length=489

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 181/459 (39%), Positives = 242/459 (53%), Gaps = 119/459 (26%)
 Frame = -1

Query  1230  QSPDTN---TFQPSLVVVIGILAIMFSLTFFLLLYAKFC---HRASILNTTLQIPDALLG  1069
             Q P  N    F+PS+ V+IG+LAIMFSLTF LL+YAKFC   +   + N   Q   A+LG
Sbjct  31    QDPTGNVAMAFKPSIAVIIGVLAIMFSLTFLLLMYAKFCQANNGVELFNPIDQT--AVLG  88

Query  1068  SWR-RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
               R R SGIDKT++ESLPFFRFS+LKG+++GLEC+VCLS+FED EILR LPKCKHAFHI 
Sbjct  89    QTRARFSGIDKTLIESLPFFRFSTLKGAKQGLECAVCLSKFEDPEILRFLPKCKHAFHID  148

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLG--LYIQRQ-----  733
             C+D+WLE HSSCPLCRHKV AEDL +  +S+SLR     SR +S L   ++++R+     
Sbjct  149   CVDRWLESHSSCPLCRHKVQAEDLRVFTYSNSLRL----SRNQSELTDEIFVRREPEANN  204

Query  732   ----ESFKFGS---------------RKIKKDEK-----LPI----------QNDQSL--  661
                   F  G                R+I+K+++     LP            N+ +L  
Sbjct  205   CGSSSRFSIGGSFRKNSIGGSSKKKPRQIEKEKEKESLLLPSASSELENGNDSNNSNLLS  264

Query  660   -----QKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRD---------------  541
                   +  H   H+IIVSD V ++RWS V++SDL+ LNSEL+                 
Sbjct  265   KISTDSESFHKFKHKIIVSDFVSRHRWSDVNASDLLFLNSELLASVSSKRFGSVLDFGSV  324

Query  540   ---RfsssssslanpefsssFGSKHPH--------DEIQS-------MSIKEEMERKRLF  415
                RF + +   + P      GS            D +Q        + I+EEMERKR+ 
Sbjct  325   SSRRFKADADLGSVPSTRFGMGSDRGFRTRDSSDVDVVQRGGSNGEILRIREEMERKRIL  384

Query  414   EIKVNK-----NNPSFPIPTTYA---ETKNLSQKEKRSMSEIVVHPRFRN----------  289
             EIK  +     +     +        E++ +    KRSMSEI    R +N          
Sbjct  385   EIKAERVRRSLSGSGLALNVGLGDGNESRLIVDSGKRSMSEITNFSRVQNMRGVNFGNSE  444

Query  288   ---GNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERR  181
                GN+ +      +ER R+LW+PIARRTVQW   RERR
Sbjct  445   FGEGNLGNR----KEERVRRLWIPIARRTVQWLVGRERR  479



>ref|NP_179593.1| putative RING-H2 finger protein ATL12 [Arabidopsis thaliana]
 sp|Q9SL78.1|ATL12_ARATH RecName: Full=Putative RING-H2 finger protein ATL12; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD24393.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEC06957.1| putative RING-H2 finger protein ATL12 [Arabidopsis thaliana]
Length=390

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 165/386 (43%), Positives = 231/386 (60%), Gaps = 52/386 (13%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNT  1099
             V AQ P    P +    ++ F+PSL ++ G+ +I+F+LTF LL+YAK  H   R+   + 
Sbjct  20    VSAQSPP---PPNLYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAKCFHNDLRSETDSD  76

Query  1098  TLQIP-----DALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEI  934
               +I        L     R SG+DK  +ESLPFFRFS+LKG ++GLECSVCLS+FED+EI
Sbjct  77    GERIRHDRLWQGLFNRSSRFSGLDKKAIESLPFFRFSALKGLKQGLECSVCLSKFEDVEI  136

Query  933   LRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAE-DLSLM-NFSSSLRFLC-SDSREE  763
             LRLLPKC+HAFHI CIDQWLE+H++CPLCR++V  E DLS++ N S+SLR L  S++REE
Sbjct  137   LRLLPKCRHAFHIGCIDQWLEQHATCPLCRNRVNIEDDLSVLGNSSTSLRILNQSETREE  196

Query  762   SS-LGLYIQRQESFKFGS------RKI-KKDEKLPIQNDQSL--QKPLHHLNHRIIVSDV  613
              S L +YI+R+E    GS      RKI KK   L  + ++++  +K +H  NHRI+VSD 
Sbjct  197   DSRLEIYIEREEGTNDGSSRFSSFRKILKKSLLLEREGNENIDEKKLMHKFNHRIVVSDA  256

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSI--KE  439
             V KNRWS+++SSDL  L SE++    S   SS+               D +   ++  KE
Sbjct  257   VFKNRWSNITSSDLTFLTSEMLNSVSSDRFSSV---------------DRVHRGNLRDKE  301

Query  438   EMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC-DV  262
             +ME KR+     + +  +    TT +  K +    + S +             Q+Y    
Sbjct  302   DMEMKRMLIKHKDSSRRTVSEITTVSREKAVGGSYRGSTA----------STSQNYAVTA  351

Query  261   VSDERRRKLWLPIARRTVQWFAKRER  184
              ++ERRR+LWLPIARRT QWF  RE+
Sbjct  352   TTEERRRRLWLPIARRTAQWFVNREK  377



>emb|CDY66475.1| BnaA08g30720D [Brassica napus]
Length=409

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 181/419 (43%), Positives = 237/419 (57%), Gaps = 76/419 (18%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH----------  1120
             V AQ P+  + N        F+PSL +V G+LAIMF+LTF LL+YAK CH          
Sbjct  20    VSAQPPAPPLSNGDL--VANFEPSLAIVTGVLAIMFALTFVLLVYAKCCHMDLLSGSGDG  77

Query  1119  -RASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFED  943
              R   L       +    S  R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE 
Sbjct  78    RRQDRLTRQGFFFNRSTNSSARFSGLDKTAIESLPMFRFSALKGSKQGLECSVCLSKFES  137

Query  942   IEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVT-AEDLSLMNFSSSLRFLC-SDSR  769
             +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR +V+  ED S+  + +S RFL  S  R
Sbjct  138   VEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDRVSIEEDTSV--YVNSFRFLNESARR  195

Query  768   EESSLGLYIQRQES----------------FKFGS--RKIKK---DEKLPIQ---NDQSL  661
             E+SSL +YI+R+E                 F  G   RKI K    EK  ++   ND+  
Sbjct  196   EDSSLEIYIEREEEEERRRRQREEVGSSSRFSIGGSFRKILKLGHKEKPLLEQQGNDKDE  255

Query  660   QKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGS  481
              K +H  NHRI VSDVV KNRWS+VSSSDL+ LNSE++           +      SF  
Sbjct  256   NKVMHKFNHRIFVSDVVFKNRWSNVSSSDLMFLNSEMV----------SSISSERFSFRR  305

Query  480   KHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHP  301
                 D+  ++  KE+ME K L  +K              +E+K+     +RS+SEI   P
Sbjct  306   SKEEDQRGNLRFKEDMENK-LSSMKT----------MLLSESKD---SGRRSVSEITTVP  351

Query  300   RFR---NGNVQDYCDVVS---DERRRKLWLPIARRTVQWFAKRERRSAHESQIPST-QH  145
             R     +G+        +   +ERRR+LWLPIA +T Q FA RE+R    +QI +T QH
Sbjct  352   RLSIAVHGDCSGSNAATASETEERRRRLWLPIASKTAQLFANREKR----NQINTTVQH  406



>ref|XP_006300042.1| hypothetical protein CARUB_v10016268mg [Capsella rubella]
 gb|EOA32940.1| hypothetical protein CARUB_v10016268mg [Capsella rubella]
Length=396

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 161/389 (41%), Positives = 228/389 (59%), Gaps = 55/389 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT--  1096
             V AQ P      D    ++ F+PSL ++ G+ +I+F+LTF LL+YAK C    + +    
Sbjct  23    VSAQSPPPPPSLDPYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAK-CFYNDLRSEADG  81

Query  1095  -------LQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIE  937
                     ++   L     R SG+DKT +ESLPFFRFS+LKG ++GLECSVCLS+FED+E
Sbjct  82    DVERRRHERLWQGLFNRSSRFSGLDKTAIESLPFFRFSALKGLKQGLECSVCLSKFEDVE  141

Query  936   ILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAE-DLSLM-NFSSSLRFLC-SDSRE  766
             ILRLLPKC+HAFHI CIDQWLE+H++CPLCR++V  E DLS++ N ++SLR +  S +RE
Sbjct  142   ILRLLPKCRHAFHIGCIDQWLEQHATCPLCRNRVDIEDDLSVLGNSNNSLRIVNQSQTRE  201

Query  765   E-SSLGLYIQRQESFKFGSRK-------IKKDEKLPIQNDQSLQ--KPLHHLNHRIIVSD  616
             E S L +YI+R+E    GS +       +KK   L  Q ++ ++  K +H  NHRI+VSD
Sbjct  202   EDSGLEIYIEREERNSDGSSRLSSFRNILKKSLFLERQANEGIEEKKVMHKFNHRIVVSD  261

Query  615   VVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSI--K  442
             VV KNRWS+V+SSDL  L++E++    S   +S+               D +Q  ++  K
Sbjct  262   VVFKNRWSNVTSSDLTFLSAEMLNSMSSERFTSM---------------DRVQRGNVRDK  306

Query  441   EEMERKRLFEIKVNKNNPSFPIPTTYAET---KNLSQKEKRSMSEIVVHPRFRNGNVQDY  271
             E+ E KR+++ K +       I T   E     + S     + S    +P          
Sbjct  307   EDTEMKRMWKNKDSSRRTVSEITTVTRENVVGGSCSCSTAATASTSQSYP----------  356

Query  270   CDVVSDERRRKLWLPIARRTVQWFAKRER  184
                 ++ERRR+LWLPIARRT QWF  RE+
Sbjct  357   --ATTEERRRRLWLPIARRTAQWFVSREK  383



>gb|AAU84668.1| At4g28890 [Arabidopsis thaliana]
 gb|AAV43780.1| At4g28890 [Arabidopsis thaliana]
Length=386

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 174/393 (44%), Positives = 229/393 (58%), Gaps = 62/393 (16%)
 Frame = -1

Query  1167  MFSLTFFLLLYAKFCH---RASILNTTLQIPDALLG--------SWRRSSGIDKTVVESL  1021
             MF+LTF LL+YAK CH   R+   +          G        S  R SG+DKT +ESL
Sbjct  1     MFALTFVLLVYAKCCHIDLRSGSGDRRRHDRRLRQGIFFNRSTASSDRFSGLDKTAIESL  60

Query  1020  PFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRH  841
             P FRFS+LKGS++GL+CSVCLS+FE +EILRLLPKC+HAFHI CIDQWLE+H++CPLCR 
Sbjct  61    PLFRFSALKGSKQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRD  120

Query  840   KVT-AEDLSLMNFSSSLRFLC-SDSREESSLGLYIQRQES--------------FKFGS-  712
             +V+  ED S++   +S RFL  S+ RE+SSL LYI+R+E               F  G  
Sbjct  121   RVSMEEDSSVLTNGNSFRFLNQSEIREDSSLELYIEREEEEERIHREELSGSSRFSIGES  180

Query  711   -RKIKK---DEKLPIQ---NDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSE  553
              RKI K    EK  +    ND+  +K +H  NHRI+VSDVV KNRWS+VSSSDL+ LNSE
Sbjct  181   FRKILKLGNKEKTLLDEHVNDKDEKKLMHKFNHRIVVSDVVFKNRWSNVSSSDLMFLNSE  240

Query  552   LIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIP  373
             ++       S S                D+I  + IKEEME KR+ E K+      F   
Sbjct  241   MVN------SISSERFSSLDHVKRGDEEDQIGILRIKEEMEAKRMLENKLTSMTTMFSSE  294

Query  372   TTYAETKNLS---QKEKRSMSEIVVHPRFR-------NGNVQDYCDVV------SDERRR  241
                + +K+ S   +  +RS+S+I   PR         +G+  +    +      ++ERRR
Sbjct  295   NGDSGSKSRSVMIEPGRRSVSDITAVPRLSISIHGDCSGSAAETASALQNGGNETEERRR  354

Query  240   KLWLPIARRTVQWFAKRERRSAHESQIPST-QH  145
             +LWLPIAR+T QWFA RE+R    SQI +T QH
Sbjct  355   RLWLPIARKTAQWFANREKR----SQINTTHQH  383



>gb|KFK29441.1| hypothetical protein AALP_AA7G134800, partial [Arabis alpina]
Length=408

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 164/385 (43%), Positives = 221/385 (57%), Gaps = 59/385 (15%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCH------RASILNTTLQIPDALL-----GS  1066
              F+PSL VV G+LAIMF+LTF LL+YAK CH              L++   +       S
Sbjct  34    NFEPSLAVVTGVLAIMFALTFILLVYAKCCHIDLRSGPGDGRRQDLRLRQGIFFNRSTNS  93

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
               R SG+DKT +ESLP FRFS+LKGS++GLECSVCLS+FE++E+LRLLPKC+HAFHI CI
Sbjct  94    SDRFSGLDKTSIESLPLFRFSALKGSKQGLECSVCLSKFENVEVLRLLPKCRHAFHIGCI  153

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLC-SDSREESS----------------  757
             DQWLE+H++CPLCR +V+ E+ S + + +S RFL  S++REESS                
Sbjct  154   DQWLEQHATCPLCRDRVSIEEDSSV-YGNSFRFLNQSEAREESSLELYIEREEEEERRQR  212

Query  756   ----LGLYIQRQESFKFGS--RKIKK--DEKLPI----QNDQSLQKPLHHLNHRIIVSDV  613
                 +G    R   F  G   RKI K   ++ P+     ND+  +K +H  NHRI+VSDV
Sbjct  213   LREAIGGSSSR---FSIGGSFRKILKLAHKEKPLLDEHDNDKDEKKLMHKFNHRIVVSDV  269

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEM  433
             V KNRWS+VSSSDL+ LNSE++       S    +       G +  H  I  + IKEEM
Sbjct  270   VFKNRWSNVSSSDLMFLNSEMVNS----ISCERFSSMDRVKRGDEEEHKGI--LLIKEEM  323

Query  432   ERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFR---NGNVQDYCDV  262
             E KR+ E K+     S    +       + +  +RS+SEI    R     +G+       
Sbjct  324   EAKRMLENKLTSMKLSENSDSGSKSRSIMIEPGRRSVSEITAVSRLSIAVHGDCSGSTAA  383

Query  261   V------SDERRRKLWLPIARRTVQ  205
             +      ++ERRR+LWLPIAR+T Q
Sbjct  384   LQSGGNETEERRRRLWLPIARKTAQ  408



>emb|CAN66948.1| hypothetical protein VITISV_020095 [Vitis vinifera]
Length=915

 Score =   264 bits (674),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 166/385 (43%), Positives = 231/385 (60%), Gaps = 46/385 (12%)
 Frame = -1

Query  1206  QPSLVVVIGILAIMFSLTFFLLLYAKFCHRA----SILNTTLQIPDALLGSWRRSSGIDK  1039
             QP L+VV+G+L+IMF LTF LL YAKFCH A    S  +   Q    +     RSSGIDK
Sbjct  536   QPHLMVVVGVLSIMFCLTFLLLAYAKFCHVAVPDFSDFDNHQQNLHGIDRERLRSSGIDK  595

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              V+ESLPFFRFSSLKGS+EGLEC+VCLS+FE+IE+LRLLP C+HAFHI+CIDQWLE HSS
Sbjct  596   RVMESLPFFRFSSLKGSKEGLECAVCLSKFEEIEVLRLLPNCRHAFHINCIDQWLESHSS  655

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFLCS--DSREESSLGLYIQRQE------------SFK  721
             CPLCR+K  A+DL+  ++S+SLRF  +  +  E+S++ L++QR++            SF+
Sbjct  656   CPLCRYKFDAQDLTNFSYSNSLRFPQNPLNLAEDSTINLFVQREQDDQXSSRFSIGSSFQ  715

Query  720   FGSRKIKKDEKLPIQNDQS----LQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSE  553
                 K KK+E L IQ  +S      K  H +NH+II S+++ KNRWS  +SSD + LNSE
Sbjct  716   KAMNKGKKEEFL-IQEGESSNGDYHKLWHKVNHKIIFSNMIFKNRWSDANSSDFMFLNSE  774

Query  552   LIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFE---IKVNKNNPSF  382
             +      + +S         S  +    ++   + ++E +++K L E    +++++N   
Sbjct  775   M------NETSPNNRFPSLESNNNGFSMNKQVVIKMQEGVDKKILHESNFTRISRSNSVC  828

Query  381   PIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVS-------DERRRKLWLPI  223
                   + ++ L+   KRSMSE+    RF   N +D    +S       +ER RKLWL  
Sbjct  829   NSTHEASTSRLLNPDLKRSMSELTNLSRFTELNTKDRVKELSFXRNNAEEERTRKLWLTR  888

Query  222   ARRTVQWFAKRERRSAHESQIPSTQ  148
             A  TVQWFA RE       +IP  Q
Sbjct  889   AHXTVQWFAGRE-------EIPKNQ  906



>ref|XP_009396630.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 164/390 (42%), Positives = 227/390 (58%), Gaps = 52/390 (13%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTV  1033
             +F PS+ + IG+ A M SLT  LL+Y K C R S+ + ++ IP     +  + SGID+TV
Sbjct  44    SFGPSVAIAIGVFATMLSLTVLLLVYVK-C-RWSMPSESI-IPAPTRQTRHQLSGIDRTV  100

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             VES+PFFRF+SL+G R+GLEC+VC+S+F+  E+LRLLPKCKHAFHI C+D+WLE HSSCP
Sbjct  101   VESIPFFRFASLRGVRDGLECAVCISKFDGDEVLRLLPKCKHAFHIDCVDRWLEGHSSCP  160

Query  852   LCRHKVTAEDLSLMNFSSSLRFLCSDSREESS---LGLYIQRQES----------FKFGS  712
             LCR KVTA D++   +S+S RFL +  + E+S   L L+++R+ +          F  GS
Sbjct  161   LCRCKVTAVDVARFAYSTSSRFLFASGQHETSGRELELFVERERNHDAEHRGSSRFGIGS  220

Query  711   ------RKIKKDEKLPI-QNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSE  553
                   R  K+ EKLPI +      + LH   HRI+VSD V K RWS+++SSDL +L S+
Sbjct  221   TFGNMDRSTKEKEKLPILEEATGGDQFLHKFKHRIVVSDNVFKGRWSALNSSDLASLTSD  280

Query  552   LIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK-------N  394
             ++       S +L           +   +E   +  KE  E K L E KVN+        
Sbjct  281   ML-------SITLNERFALLGLNEQTTGEEKIFVDGKETAEEKSLLEAKVNQIGALTSAT  333

Query  393   NPSFPIPT-------TYAETKNLSQKEKRSMSEIVVHPRFRN----GNVQDYCDVVSDER  247
             NP+ P P+       + A   ++S    RSMS+I    R R     GN     D   DE+
Sbjct  334   NPNIPSPSNDNGNLISPASRASISSA-NRSMSDITNLSRSRQERDPGNSTSSRD--EDEK  390

Query  246   RRKLWLPIARRTVQWFAKR-ERRSAHESQI  160
              R+LWLPIARRTVQ FA R +RR +  ++I
Sbjct  391   LRRLWLPIARRTVQCFAGRSDRRLSTATEI  420



>ref|XP_009117511.1| PREDICTED: putative RING-H2 finger protein ATL12 [Brassica rapa]
Length=389

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 165/395 (42%), Positives = 222/395 (56%), Gaps = 68/395 (17%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             V AQ P    P         FQPSL ++ G+ +I+F+LTF LL+YAK C    + + T +
Sbjct  21    VSAQSPPP--PPFLYAANGLFQPSLAIITGVFSIVFTLTFVLLIYAK-CFHNDLRSETYE  77

Query  1089  ---------IPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIE  937
                      +   L     R SG+DK  +ESLPFFRFS+LKGS++GLECSVCLS+FED+E
Sbjct  78    DGEIGRLDRLWQGLFSQSSRFSGLDKAAIESLPFFRFSALKGSKQGLECSVCLSKFEDVE  137

Query  936   ILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAED-LSLMNFSS--SLRFL---CSD  775
             ILRLLPKCKHAFHI CID+WLE+H++CPLCR++V+ ED LS+    S  S+R +      
Sbjct  138   ILRLLPKCKHAFHIECIDEWLEQHATCPLCRNRVSIEDELSVFGGGSNNSMRIMSQLSES  197

Query  774   SREESSLGLYIQRQESFKFGS------RKI----KKDEKLPIQNDQSLQKPLHHLNHRII  625
               EESS+ +YI+R+E  + GS      RKI    K D  L +  +Q  +K LH  NHRI+
Sbjct  198   REEESSMEIYIEREEGIRDGSSRFSSFRKILNFGKNDNSLSLV-EQGNEKCLHKFNHRIV  256

Query  624   VSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSI  445
             VSD V KNRWS+V+ +DL  L S ++    S   SS+                E   +  
Sbjct  257   VSDAVFKNRWSNVTPADLTFLTSNMLSSMSSDRFSSIDRV-------------ERGDLRD  303

Query  444   KEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDY--  271
             KEE++ KR+    VN N  S                 +R  SEI   PR    +      
Sbjct  304   KEEIDMKRM----VNNNKDS----------------TRRVFSEITAVPRLSGMDASTAST  343

Query  270   --CDVVS--DERRRKLWLPIARRTVQWFAKRERRS  178
                DV++  +ERRR+LWLPIAR+T QWF  RE+++
Sbjct  344   SRSDVIAAVEERRRRLWLPIARKTAQWFVNREKKN  378



>gb|EYU30731.1| hypothetical protein MIMGU_mgv1a025117mg, partial [Erythranthe 
guttata]
Length=393

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 180/407 (44%), Positives = 239/407 (59%), Gaps = 45/407 (11%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             N  A  PS    +D S     FQPSL VVI +L+IMFSLT  LLLYAKF  R    ++ L
Sbjct  1     NQLAVKPSPPQADDDS--ATNFQPSLAVVIALLSIMFSLTIILLLYAKFRRRRRSSSSPL  58

Query  1092  Q---IPDALLGSWRRSS----GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEI  934
                 I D LL   RR S    G+DK+V+ESLP FRFSSL+G  EGLEC+VCL++F+  ++
Sbjct  59    SRRIIQDGLL---RRPSPPPSGVDKSVIESLPLFRFSSLRGPAEGLECAVCLAQFDGTDV  115

Query  933   LRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKV--TAEDLSLMNFSSSLRFLCSDSREES  760
             LR+LPKCKHAFHI CID+WLEK  +CPLCR +     E  S    S    +   D    S
Sbjct  116   LRMLPKCKHAFHIDCIDRWLEKRDTCPLCRCRAEPNNEVGSDPQCSEGFPWDPPDHHGYS  175

Query  759   SLGLYIQRQE-SFKFGSR--KIKKDEKLPIQ---------NDQSLQKPLHHLNHRIIV--  622
             +L LY++R+E S  FGS+  + +++E L +Q         N+ +  +  H LNH+I V  
Sbjct  176   NLELYVEREEYSSSFGSKPQEEEEEEGLSMQINNTNTNTDNNNNRDRIFHKLNHKINVIF  235

Query  621   -SDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSI  445
                 VLKNRWS VSSSD++ LNSE++ D     S S      +    S+  HD     +I
Sbjct  236   ECYNVLKNRWSDVSSSDMLYLNSEMLAD----VSDSRFLNSCNLENNSRKNHDYSMMNNI  291

Query  444   KEEMERKRLFEIKVNK-NNPSFPIPTTYAETKNLS-QKEKRSMSEIVVHPRFRNGNVQDY  271
             KEEMERKR+FE KV +  N +  + + Y+  K    + + RS+SEI VHPR R+  +++ 
Sbjct  292   KEEMERKRVFESKVKEIKNHTRIVKSDYSTQKRDGLESDMRSVSEIKVHPRLRDLQLRNS  351

Query  270   --CDVVSDER--RRKLWLPIARRTVQWFAKRERRSAHESQIPSTQHN  142
                D+V +E   RR++WL IARRT+QWFA RE         PSTQ N
Sbjct  352   GNSDLVDEEEVMRRRVWLQIARRTIQWFANREEPR------PSTQIN  392



>ref|XP_006371702.1| hypothetical protein POPTR_0018s00370g [Populus trichocarpa]
 gb|ERP49499.1| hypothetical protein POPTR_0018s00370g [Populus trichocarpa]
Length=338

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 150/341 (44%), Positives = 214/341 (63%), Gaps = 33/341 (10%)
 Frame = -1

Query  1158  LTFFLLLYAKFC--HRASILNTT---LQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLK  994
             +TF +L YAK+C  ++ + L +     Q    L+ S  R SGID+ ++ SLPFFRFSSLK
Sbjct  1     MTFLILAYAKYCRINQNNFLGSNPGHHQNVHGLIRSRSRFSGIDEELINSLPFFRFSSLK  60

Query  993   GSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSL  814
             GS+EGLEC+VC+S+FED E+LRLLPKC HAFH +CIDQWL  HSSCPLCR+K+   DL  
Sbjct  61    GSKEGLECAVCISKFEDSEVLRLLPKCMHAFHKNCIDQWLTSHSSCPLCRYKLDPMDLKS  120

Query  813   MNFSSSLRFLC--SDSREESSLGLYIQRQESFKFGSRKIKKDEKLPIQNDQSLQKPLHHL  640
              + S S R+L   SD  E+ +L ++++R++  +   R    + KL           LH  
Sbjct  121   FSCSKSWRYLQNPSDLTEDPNLEIFVEREQDHQ--GRNADDNRKL-----------LHKF  167

Query  639   NHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFG-SKHPHDE  463
              H+II+SDV++KNRWS V+SSD ++LN+E++R   S+  S L +       G S++ + E
Sbjct  168   KHKIIISDVLIKNRWSDVNSSDFLSLNTEMLRVMSSNRFSPLKSSSARFHDGLSRNENFE  227

Query  462   IQSMSIKEEMERKRLFEIKVNK-NNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNG  286
                 +IKE++ERKRL E K    +  +    ++   +K ++   KRSMSEI +  RFR  
Sbjct  228   ----NIKEDIERKRLLESKFTTVDRSNSVSSSSLNSSKMINPASKRSMSEITIFSRFRQL  283

Query  285   NVQDYC-------DVVSDERRRKLWLPIARRTVQWFAKRER  184
             +V++         +  +DER RKLWLPIARRT+QWFA +ER
Sbjct  284   SVRNKTRESTSPGNGATDERIRKLWLPIARRTIQWFAGQER  324



>emb|CDY13888.1| BnaA09g43900D [Brassica napus]
Length=370

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 215/386 (56%), Gaps = 69/386 (18%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             V AQ P    P         FQPSL ++ G+ +I+F+LTF LL+YAK C    + + T +
Sbjct  21    VSAQSPPP--PPFLYAANGLFQPSLAIITGVFSIVFTLTFVLLIYAK-CFHNDLRSETYE  77

Query  1089  ---------IPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIE  937
                      +   L     R SG+DK  +ESLPFFRFS+LKGS++GLECSVCLS+FED+E
Sbjct  78    DGEIGRLDRLWQGLFSQSSRFSGLDKAAIESLPFFRFSALKGSKQGLECSVCLSKFEDVE  137

Query  936   ILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAED-LSLMNFSS--SLRFLCSDSRE  766
             ILRLLPKCKHAFHI CID+WLE+H++CPLCR++V+ ED LS+    S  S+R +   S +
Sbjct  138   ILRLLPKCKHAFHIECIDEWLEQHATCPLCRNRVSIEDELSVFGGGSNNSMRIMSQLSED  197

Query  765   ESSLGLYIQRQESFK----FGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNR  598
              SS      R  SF+    FG    K D  L +  +Q  +K LH  NHRI+VSD V KNR
Sbjct  198   GSS------RFSSFRKILNFG----KNDNSLSLV-EQGNEKCLHKFNHRIVVSDAVFKNR  246

Query  597   WSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRL  418
             WS+V+ +DL  L S ++    S   SS+                E   +  KEE++ KR+
Sbjct  247   WSNVTPADLTFLTSNMLSSMSSDRFSSIDRV-------------ERGDLRDKEEIDMKRM  293

Query  417   FEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDY----CDVVS--  256
                 VN N  S                 +R +SEI   PR    +         DV++  
Sbjct  294   ----VNNNKDS----------------TRRVVSEITAVPRLSGMDASTASTSRSDVIAAV  333

Query  255   DERRRKLWLPIARRTVQWFAKRERRS  178
             +ERRR+LWLPIAR+T QWF  RE+++
Sbjct  334   EERRRRLWLPIARKTAQWFVNREKKN  359



>ref|XP_006655665.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Oryza brachyantha]
Length=410

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/361 (40%), Positives = 216/361 (60%), Gaps = 41/361 (11%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTV  1033
             +F+PS+ +V+GI  ++FSLTF LL+YAKFCH +   +           +     G+ K V
Sbjct  49    SFRPSVAIVVGIFTMIFSLTFLLLMYAKFCHPSP--SPGAAPTPTPAPAPAAPDGVAKPV  106

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             +ESLPFFRF++L+G+R+GLEC+VCL+RF+D ++LRLLP+C+HAFH+ C+D+WLE  +SCP
Sbjct  107   IESLPFFRFAALRGARQGLECAVCLARFDDADLLRLLPRCRHAFHLDCVDRWLESKASCP  166

Query  852   LCRHKVTAEDLSL-MNFSSSLRFLCSDSRE------------ESSLGLYIQRQESFKFGS  712
             LCR +V A+D +L + ++SS RF+   S E               L ++++R       S
Sbjct  167   LCRARVDADDAALGLKYASSARFVPGGSSERFDDEELAGAPGRDLLNIFVER-----VPS  221

Query  711   RKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfs  532
              +++ + + P +    L +  H   HRI+VSDVV K+RWS ++SSDLIAL++EL+R    
Sbjct  222   SRMEMEAEAPKEAAHCLDR--H--KHRIVVSDVVFKSRWSEINSSDLIALDNELLR----  273

Query  531   ssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK----NNPSFPIPTTY  364
             S S+  A       +G +  H+  +  ++ EE +RKRL ++   K    ++ S P+    
Sbjct  274   SMSTDDAVELELELYGDQADHELPK--AVNEETDRKRLLKVASGKAAGGSSSSGPV----  327

Query  363   AETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRER  184
              +   +     RSMSE+V  PR R    +   D     RRR  W+PIARRT +WFA RER
Sbjct  328   -DAARMISSGVRSMSELVSLPRLRAAMRERLEDDQEQARRR--WVPIARRTARWFAGRER  384

Query  183   R  181
             R
Sbjct  385   R  385



>ref|XP_002308607.1| hypothetical protein POPTR_0006s25600g [Populus trichocarpa]
 gb|EEE92130.1| hypothetical protein POPTR_0006s25600g [Populus trichocarpa]
Length=412

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 160/403 (40%), Positives = 230/403 (57%), Gaps = 61/403 (15%)
 Frame = -1

Query  1269  VKAQ-----HPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA--S  1111
             VKAQ       +T+IP  Q          L +++GIL+ M  +TFF+L YAK+C R   +
Sbjct  16    VKAQITSGSDSATVIPVHQG---------LPLILGILSTMLLITFFVLAYAKYCGRNQNN  66

Query  1110  ILNTTL--QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIE  937
              L   L  Q    L+ S  R SGI + V+ S+PFFRFSSLKGS+EGLEC+VC+S+FED +
Sbjct  67    FLGRYLHHQNFHGLIRSSSRFSGIGEEVINSMPFFRFSSLKGSKEGLECAVCISKFEDSD  126

Query  936   ILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSR--EE  763
             +LRLLPKCKHAFH +CIDQWL+ HSSCPLCR+K+  +D+    +S S R L + S   E+
Sbjct  127   VLRLLPKCKHAFHENCIDQWLKSHSSCPLCRYKIDPKDVKSFTYSRSWRHLQNPSNLAED  186

Query  762   SSLGLYIQRQE------------SFKFGSRKIKKDEKL--PIQNDQSLQKPLHHLNHRII  625
              +L ++++R+             SF+  +   KK+E L     N    +K  H   H+II
Sbjct  187   PNLEIFVEREHDRQVSSCFNPGSSFQISNDNSKKEELLVQAGGNADDNRKLFHKFMHKII  246

Query  624   VSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS-  448
             +SDV++K+RWS  +SSD ++LN+E++    S+  + L +       G       ++++  
Sbjct  247   ISDVLIKSRWSDANSSDFLSLNTEMLGVMSSNRFTPLKSSSARFYNGL----SRVENLEK  302

Query  447   IKEEMERKRLFEIKVNKNNPSFPI--------PTTYAETKNLSQKEKRSMSEIVVHPRFR  292
             +K++ ERKRL       + P FP          ++   +K L+   KRS SEI +  RFR
Sbjct  303   VKDDTERKRL-------SKPQFPTVDRSNSVPSSSLNSSKMLNPVGKRSTSEITIFSRFR  355

Query  291   NGNVQD-------YCDVVSDERRRKLWLPIARRTVQWFAKRER  184
               + ++         +   DER R LWLPIARRTVQWFA RER
Sbjct  356   QLSAKNKMKESASLGNGGKDERIRMLWLPIARRTVQWFAGRER  398



>gb|KEH36058.1| RING-H2 finger protein ATL4J [Medicago truncatula]
Length=344

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 153/365 (42%), Positives = 211/365 (58%), Gaps = 57/365 (16%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHRASI--LN-TTLQIPDALLGSWRRS--SGIDK  1039
             PS  VVI +L+IMF LTF LL+Y KFC    I  LN  +L + + L  +  RS  SG+++
Sbjct  10    PSKGVVIIVLSIMFFLTFILLVYVKFCRVTPIHLLNPNSLNLQNNLGQTRSRSINSGVEQ  69

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              V+E+LPFF+FSSLKGS++GLEC+VCLS+FED EILRLLPKCKHAFH++CID+WLE HS+
Sbjct  70    KVIETLPFFKFSSLKGSKQGLECTVCLSKFEDEEILRLLPKCKHAFHMNCIDKWLESHST  129

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSLGLYIQRQESFKFGSRKIKKDEKL  685
             CPLCR+ V   D+    FS S RFL   S+  E+ +L ++IQRQ S +   ++ ++ E  
Sbjct  130   CPLCRYMVEESDIRNFTFSFSSRFLRVPSNLSEDPNLEIFIQRQPSQRKNKKEEQEHEHE  189

Query  684   PIQNDQS-----------LQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDR  538
              +  D              ++ LH +NH+I++SDVV ++RWS ++SSDL++LNSE++ D 
Sbjct  190   LVLLDHEEGGSSNVTKWKQEQTLHMINHKILISDVVTRSRWSDLNSSDLLSLNSEMLHD-  248

Query  537   fsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAE  358
                               S     E   +S     E +  F                   
Sbjct  249   ----------------MSSTRFSPEFHGISSVHSDEEENSFTA-----------------  275

Query  357   TKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERRS  178
                L+  EKRSMSEI   PRF    +    +  SDER  ++W+PIARRTVQWFA++E  S
Sbjct  276   ---LNPGEKRSMSEIANVPRFV--EISRSGENGSDERLWRIWMPIARRTVQWFARQETNS  330

Query  177   AHESQ  163
                 Q
Sbjct  331   VQLQQ  335



>ref|XP_007137212.1| hypothetical protein PHAVU_009G109000g [Phaseolus vulgaris]
 gb|ESW09206.1| hypothetical protein PHAVU_009G109000g [Phaseolus vulgaris]
Length=401

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 219/378 (58%), Gaps = 50/378 (13%)
 Frame = -1

Query  1221  DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC----HRASILNTTLQIPDALLGSWRRS  1054
             D  T  PS  VVI +L+ MF++T  LLLY KFC    H+    N+ LQ    L  S  R 
Sbjct  51    DPQTVHPSKGVVIAVLSTMFAITLILLLYVKFCRVNPHQLLTRNSNLQNSQGLSRSSLRV  110

Query  1053  SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWL  874
              GIDK VV++LPFF FSSLKG +EGLEC+VCLS+FED E LRLLPKCKHAFH++CID+W 
Sbjct  111   CGIDKEVVKTLPFFTFSSLKGFKEGLECTVCLSKFEDTETLRLLPKCKHAFHMNCIDKWF  170

Query  873   EKHSSCPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSLGLYIQRQESFKFGSRKIK  700
             E HS+CPLCR +V A D+  +N+S S  FL   S+  E+ +L +++QR+ S +  SR+  
Sbjct  171   ESHSTCPLCRRRVEAGDIKNLNYSLSSSFLRVPSNLTEDLNLEIFVQREPSHQGSSRRGF  230

Query  699   KD------EKLPIQNDQS------LQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNS  556
             KD      ++L I +           K +H  NH+I +SDV  ++RWS ++SSD+++L+S
Sbjct  231   KDAGKCKKQELLIGDGSGGSGATKWNKHVHVTNHKITISDVFTRSRWSDLNSSDMLSLSS  290

Query  555   ELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPI  376
             +++ D  S      ++ E +   G  H      +   KE  E K   E+     NPS   
Sbjct  291   QMLND-VSCRRFCFSSLESTEDGGKVH-----GTWRCKE--EGKWFTEL-----NPS---  334

Query  375   PTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCD--VVSDERRRKLWLPIARRTVQW  202
                          EKR MSEIV  PR+     ++     V S ER  ++WLPIARRT+QW
Sbjct  335   -------------EKRCMSEIVNVPRYAEMEKENRIGGSVRSSERLGRIWLPIARRTLQW  381

Query  201   FAKRER-RSAHESQIPST  151
              AK+ER RS  E + P++
Sbjct  382   IAKQERNRSELEYKTPAS  399



>ref|XP_011019810.1| PREDICTED: putative RING-H2 finger protein ATL12 [Populus euphratica]
Length=412

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 152/377 (40%), Positives = 222/377 (59%), Gaps = 34/377 (9%)
 Frame = -1

Query  1221  DTNTFQP---SLVVVIGILAIMFSLTFFLLLYAKFCHRA--SILNTTL--QIPDALLGSW  1063
             D+ T +P    L +++GI+  M  +TFF+L YAKFC R   + L   L  Q    L+ S 
Sbjct  25    DSATLKPVHRGLPLILGIVLTMLFITFFVLAYAKFCGRNQNNFLGRYLHRQNFHGLIRSS  84

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
              R SGI + V+ S+PFFRFSSLKGS+EGLEC+VC+S+FED ++LRLLPKCKHAFH +CID
Sbjct  85    SRFSGIGEEVINSMPFFRFSSLKGSKEGLECAVCISKFEDSDVLRLLPKCKHAFHENCID  144

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSR--EESSLGLYIQRQ--------  733
             QWL+ HSSCPLCR+K+   D+    +SSS R + + S   E+ +L ++++R+        
Sbjct  145   QWLKSHSSCPLCRYKIDPNDVKSFTYSSSWRHMQNPSNLAEDPNLEIFVEREHDRQVSSC  204

Query  732   ----ESFKFGSRKIKKDEKL--PIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
                  SF+  +   KK+E L     N    +K  H   H+I +SDV++K+RWS  +SSDL
Sbjct  205   FNPGSSFQISNDNSKKEELLVQAGGNADDNKKLFHKFMHKITISDVLIKSRWSDANSSDL  264

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK-N  394
             ++LN+E++    S+  S + +       G     +  +   +K++ ERKRLFE +    +
Sbjct  265   LSLNTEMLGVMSSNRFSPMKSSSARFYNGLSRVENLEK---VKDDTERKRLFEPQFAAVD  321

Query  393   NPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC-------DVVSDERRRKL  235
               +    ++   +  L+   KRSMSEI +  RFR  + +          +   DER R L
Sbjct  322   RSNSVPSSSLNSSNMLNPVGKRSMSEITIFSRFRQLSAKKKMKESASPRNGGKDERIRML  381

Query  234   WLPIARRTVQWFAKRER  184
             WLPI+RRT+QWFA RER
Sbjct  382   WLPISRRTIQWFAGRER  398



>emb|CDY35921.1| BnaA07g00660D [Brassica napus]
Length=371

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 157/400 (39%), Positives = 224/400 (56%), Gaps = 75/400 (19%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             V AQ P    P       + F+PSLV+  G+ +++F+LTF LL+YAK C    + + T +
Sbjct  18    VSAQSP----PPPPYTTNDFFKPSLVITTGVFSVVFTLTFVLLVYAK-CFHNDLRSETDE  72

Query  1089  IPDALLG------------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFE  946
               D  +G            S R SSG+++T +ESLPFFRFS+LKGS++GLECSVCLS+FE
Sbjct  73    --DREIGRLERLWQGLFNQSSRLSSGLNRTAIESLPFFRFSALKGSKQGLECSVCLSKFE  130

Query  945   DIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAED-LSLMNFSSSLRFLCSDSR  769
             D+EILRLLPKCKHAFHI CID+WLE+H++CPLCR++V  ED LS+             S 
Sbjct  131   DVEILRLLPKCKHAFHIECIDEWLEQHATCPLCRNRVCIEDELSVF------------SV  178

Query  768   EESSLGLYIQRQE---SFKFGS-RKI----KKDEKLPIQNDQSLQKPLHHLNHRIIVSDV  613
              +S++ +YI+R+E   S +F S RKI    K D+ L +  +Q  +K LH   HRI+VSD+
Sbjct  179   LDSNMEIYIEREEGEDSSRFSSFRKILKFGKNDKSLSLV-EQGNEKRLHKFRHRIVVSDL  237

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEM  433
             V KNRWS+V+ SDL  L S+++                 S    +    E   +  KEEM
Sbjct  238   VFKNRWSNVTPSDLTRLTSDMLN----------------SMSSDRFSSMERVDLRDKEEM  281

Query  432   ERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCD----  265
             + KR+ +   NK+       +T      ++   + S+ E+       +G +         
Sbjct  282   DMKRMMK---NKD-------STRRVVSEITAVPRLSVLEVTTAVGGNDGGLAASTASTSR  331

Query  264   ----VVSDERRRKLWLPIARRTVQWFAKRERRSAHESQIP  157
                   ++ERRR+LWLPIARRT  WFA RE+ +   +  P
Sbjct  332   SDAIAATEERRRQLWLPIARRTAHWFANREKMNELNTTKP  371



>ref|XP_009123853.1| PREDICTED: putative RING-H2 finger protein ATL12 [Brassica rapa]
Length=388

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 153/385 (40%), Positives = 222/385 (58%), Gaps = 64/385 (17%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG------------S  1066
             F+PSLV+  G+ +++F+LTF L +YAK C    + + T +  D  +G            S
Sbjct  34    FKPSLVITTGVFSVVFTLTFVLRVYAK-CFHNDLRSETDE--DREIGRLERLWQGLFNQS  90

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R SSG+++  +ESL FFRFS+LKGS++GLECSVCLS+FED+EILRLLPKCKHAFHI CI
Sbjct  91    SRLSSGLNRKAIESLAFFRFSALKGSKQGLECSVCLSKFEDVEILRLLPKCKHAFHIECI  150

Query  885   DQWLEKHSSCPLCRHKVTAED----LSLMNFSS-SLRFL--CSDSREE-SSLGLYIQRQE  730
             D+WLE+H++CPLCR++V  ED     S++  SS S+R +   +++REE S++ +YI+R+E
Sbjct  151   DEWLEQHATCPLCRNRVCIEDELSVFSVLGCSSNSMRIMNQLTETREEDSNMEIYIEREE  210

Query  729   S-----FKFGSRKI----KKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSS  577
                   F    RKI    K D+ L +  +Q  +K LH   HRI+VSDVV KNRWS+V+ S
Sbjct  211   GEDSSRFSTSFRKILKFGKNDKPLSLV-EQGNEKRLHKFRHRIVVSDVVFKNRWSNVTPS  269

Query  576   DLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNK  397
             DL  L S+++                 S    +    E   +  KEEM+ KR+ +   NK
Sbjct  270   DLTRLTSDMLN----------------SMSSDRFSSMERVDLRDKEEMDMKRMMK---NK  310

Query  396   NNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCD-----VVSDERRRKLW  232
             +       +T      ++   + S+ E+       +G +            ++ERRR+LW
Sbjct  311   D-------STRRVVSEITAVPRLSVLEVTTAVGGNDGGLAASTSRSDAIAATEERRRQLW  363

Query  231   LPIARRTVQWFAKRERRSAHESQIP  157
             LPIARRT  WFA RE+ +   +  P
Sbjct  364   LPIARRTAHWFANREKMNELNTTKP  388



>ref|XP_010049100.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Eucalyptus 
grandis]
Length=372

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 197/323 (61%), Gaps = 27/323 (8%)
 Frame = -1

Query  1206  QPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL--QIPDALLGSWRRSSGIDKTV  1033
              PS+VV++ +LA+MFSLTF +L YAKFCHR     + L  Q    L  S  R SGID+  
Sbjct  37    HPSMVVIVSVLAMMFSLTFLVLAYAKFCHRTPAGPSFLDSQNDPGLNESMPRFSGIDQKA  96

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             ++SLP FRFSSL+GS+EGLEC+VC++RFED E LRLLP+CKHAFH +CIDQWL+ HSSCP
Sbjct  97    IDSLPLFRFSSLRGSKEGLECAVCINRFEDSETLRLLPRCKHAFHSNCIDQWLKSHSSCP  156

Query  852   LCRHKVTAEDLSLMNFSSSLRF---LCSDSREESSLGLYIQRQE-------------SFK  721
             LCR+K    DL+    S SLRF   + S+  E+++L L +QR+              SF+
Sbjct  157   LCRYKFNPGDLTSFAHSLSLRFPQRIPSNLLEDANLELSVQREADNDHGSSRYGDRISFR  216

Query  720   FGSRKIKKDEKLPIQND---QSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSEL  550
             +  R++   E+   +      S QK LH   H+IIVSDVV KNRWS V+SSDL+ LNSE+
Sbjct  217   YSERELNYGEECLNEESGDCGSDQKLLHKFKHKIIVSDVVTKNRWSDVNSSDLLFLNSEM  276

Query  549   IRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPT  370
             I + FSSS  + +        G    +  +    IK ++ERKRLF+ KV     S  +  
Sbjct  277   I-NVFSSSRFADSEARSGYFNGDFTANKNL--AKIKNDIERKRLFQSKVGATASSSNVLA  333

Query  369   TYAETKNL---SQKEKRSMSEIV  310
                E  +    +  EKRSMSEIV
Sbjct  334   NPGENSSKLMNNPTEKRSMSEIV  356



>ref|XP_006581445.1| PREDICTED: putative RING-H2 finger protein ATL12-like [Glycine 
max]
 gb|KHN18176.1| Putative RING-H2 finger protein ATL12 [Glycine soja]
Length=410

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 211/387 (55%), Gaps = 74/387 (19%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFC----HRASILNTTLQIPDALLGSWRRSSGI  1045
             T  PS  +VI +L+ MF++T  LLLY KFC    H     N+ LQ    L  S  R SGI
Sbjct  46    TVHPSKGIVIAVLSTMFAITLLLLLYVKFCRTIPHELLRQNSNLQNFQGLTRSRSRVSGI  105

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             DK VVE+LPFF+FSSLKGS+EGLEC+VCLS+FED E LRLLPKCKHAFH++CID+W E H
Sbjct  106   DKQVVETLPFFKFSSLKGSKEGLECTVCLSKFEDTETLRLLPKCKHAFHMNCIDKWFESH  165

Query  864   SSCPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSLGLYIQRQESF-----------  724
             S+CPLCR +V A D+  +NFS S RFL   S+  E+ +L +++ R+ S            
Sbjct  166   STCPLCRRRVEAGDIKNLNFSLSSRFLRVPSNLTEDPNLEIFVHREPSHGGSASIQRSYL  225

Query  723   ------KFGSR-------KIKKDEKLPIQNDQSL------QKPLHHLNHRIIVSDVVLKN  601
                   +  SR       K KK E L I +  S+       KP+H +NH+I++S+V  ++
Sbjct  226   PLDQRCRGSSRRGFWDVGKCKKQELLLIDDSSSIGGTRKWNKPVHVMNHKIVISNVFTRS  285

Query  600   RWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKR  421
             RWS +++SDL++LNSE++ D  S                                  R  
Sbjct  286   RWSDLNASDLLSLNSEMLNDVCSG---------------------------------RFC  312

Query  420   LFEIKVNKNNPSFPIPTTYAETKNL-----SQKEKRSMSEIVVHPRFRNGNVQDYCDVVS  256
             L  ++ + ++ +F   ++  E +N      S  EKR MSE        N   +      +
Sbjct  313   LCPLESSDDSGNFHGISSSNEEENSFTALNSPAEKRCMSERFTQKGKENRIRECVTSNGA  372

Query  255   DERRRKLWLPIARRTVQWFAKRERRSA  175
              ER  K+WLPIARRTVQWFA +ER S 
Sbjct  373   SERLWKVWLPIARRTVQWFAIQERNSV  399



>ref|XP_004501166.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cicer arietinum]
Length=381

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 150/366 (41%), Positives = 207/366 (57%), Gaps = 74/366 (20%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRS--SGIDKTVV  1030
             PS  VVI +L+IMF +TF LLLY KFC R + L  + Q P     +  RS   G+++ ++
Sbjct  57    PSKGVVIIVLSIMFVITFILLLYVKFC-RVTQLQLSNQNPSNQQNNRSRSIVYGVEQQII  115

Query  1029  ESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPL  850
             E+LPFF+FSSLKGS++GLEC+VCLSRFED EILRLLPKCKHAFH++CID+WLE HS+CPL
Sbjct  116   ETLPFFKFSSLKGSKQGLECTVCLSRFEDEEILRLLPKCKHAFHMNCIDKWLESHSTCPL  175

Query  849   CRHKVTAEDLSLMNFSSSLRFL--CSDSREESSLGLYIQRQESFKFGSRKIKKDEKL---  685
             CR+KV   D+    FS S RFL   S+  E+ +L ++IQR+ S +   R  +++E L   
Sbjct  176   CRYKVEEMDIKNFTFSFSSRFLRVPSNLSEDPNLEIFIQREPSQRKSKRFEEQEEFLLDD  235

Query  684   ---------PIQNDQSLQKPLHHLNHRIIVSDVVL-KNRWSSVSSSDLIALNSELIRDRf  535
                       +      ++PLH +NH+I++SDVV+ ++RWS ++SSDL++LN E++ D  
Sbjct  236   QGGAGSSNGGVTTKLKQKQPLHMINHKILISDVVVARSRWSDLNSSDLLSLNCEMLHD--  293

Query  534   sssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAET  355
                                     + SM   +E                         E 
Sbjct  294   ------------------------VSSMRFSQE-------------------------EN  304

Query  354   KNLSQKEKRSMSEIVVHPRF-----RNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKR  190
               +   EKR MSEI   PRF     RN   +   +  S ER  ++WLPIARRTVQWFA++
Sbjct  305   SIIFSGEKRCMSEIANVPRFVEISRRNRMRECGGEDGSGERLWRIWLPIARRTVQWFARQ  364

Query  189   ERRSAH  172
             E  S  
Sbjct  365   ETNSVQ  370



>emb|CDX81954.1| BnaC08g36470D [Brassica napus]
Length=383

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 205/360 (57%), Gaps = 42/360 (12%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ---------IPDALLGSWRR  1057
             FQPSL ++ G+ +I+F+LTF LL+YAK C    + + T +         +   L     R
Sbjct  39    FQPSLAIITGVFSIVFTLTFVLLIYAK-CFHNDLRSETYEDGEIRRLDRLWQGLFSQSSR  97

Query  1056  SSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
              SG+DKT +ESLPFFRFS+LKGS++GLECSVCLS+FED+EILRLLPKCKHAFHI CID+W
Sbjct  98    LSGLDKTAIESLPFFRFSALKGSKQGLECSVCLSKFEDVEILRLLPKCKHAFHIECIDEW  157

Query  876   LEKHSSCPLCRHKVTAED-LSLMNFSS--SLRFLCSDSREESSLGLYIQRQESFKFGSRK  706
             LE+H++CPLCR++V+ ED LS+    S  S+R +   S             E   FG   
Sbjct  158   LEQHATCPLCRNRVSIEDELSVFGGGSNNSMRIMSQLSESREE----ESSMEILNFG---  210

Query  705   IKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsss  526
              K D  L +  +Q  +K LH  NHRI+VSD V KNRWS+V+ +DL  L S ++    SS+
Sbjct  211   -KNDNSLSLV-EQGNEKCLHKFNHRIVVSDAVFKNRWSNVTPADLTFLTSNML----SST  264

Query  525   ssslanpefsssFGSKHPHDEI--QSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETK  352
             SS   +       G     +EI  + M   ++  R+ + EI      P   + TT A   
Sbjct  265   SSDRFSSIDRVQRGDLRDKEEIDMKKMVDNKDSTRRSVSEITA---VPRLSVVTTAAREN  321

Query  351   NLSQKEKRSMSEIVVHPRFRNGNVQDYCDVVS--DERRRKLWLPIARRTVQWFAKRERRS  178
              +        +      R          DV++  +ERRR++WLPIAR+T QWF  RE+++
Sbjct  322   AVGGSNSGLDASTASTSR---------SDVIAAMEERRRRMWLPIARKTAQWFVNREKKN  372



>ref|XP_007161492.1| hypothetical protein PHAVU_001G073600g [Phaseolus vulgaris]
 gb|ESW33486.1| hypothetical protein PHAVU_001G073600g [Phaseolus vulgaris]
Length=407

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 151/396 (38%), Positives = 216/396 (55%), Gaps = 65/396 (16%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS---ILN  1102
             NV+AQ+  T    D        +PS +VVI  L+I+F+++F LL+Y +FC       I  
Sbjct  36    NVQAQYSETDTMQDF---PQPVRPSKMVVIVALSILFTISFILLVYIRFCRTTPLELINR  92

Query  1101  TTLQIPD--ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILR  928
               L  P+  AL  S  RSSGIDK V+E+LPFF FSSLKGS++GL+C+VCLS+FED EILR
Sbjct  93    RNLHSPNFQALTQSRSRSSGIDKKVIEALPFFMFSSLKGSKQGLDCTVCLSQFEDTEILR  152

Query  927   LLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL--CSDSREESSL  754
             LLPKCKHAFH++CID+W E H++CPLCR+ +   D+   N+S S R L   S+  E+++L
Sbjct  153   LLPKCKHAFHMNCIDKWFESHATCPLCRNNIDPLDIKNFNYSISSRSLRVPSNLTEDTNL  212

Query  753   GLYIQRQES---------FKFGSR--KIKKDEKLPIQNDQSLQKP----LHHLNHRIIVS  619
              +++ R+ S         F  GSR   +    +  +  DQ +       +H   H+I+VS
Sbjct  213   EIFVHREPSHQGSSSSSRFNIGSRFWNLSSSSRKKLLVDQEVSGTNGTHVHKFYHKIVVS  272

Query  618   DVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKE  439
             DVV ++RWS ++SSD+++L SE+I                  S G   P +E        
Sbjct  273   DVVRRSRWSDLNSSDMLSLKSEMIHH---------------VSTGRFSPSNEF----FCG  313

Query  438   EMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYCDVV  259
                   +F    N +  S  +         L+  EKRSMS+I   PRF     Q+  +  
Sbjct  314   NSSLSSIF----NADESSLTL---------LNTAEKRSMSDIAHVPRFIERCEQNRMEPG  360

Query  258   S--------DERRRKLWLPIARRTVQWFAKRERRSA  175
                      +ER R++WL I++RTVQWFA +ER S 
Sbjct  361   EASSGNKEREERMRRVWLAISQRTVQWFAGQERNST  396



>ref|XP_004960965.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like, partial [Setaria 
italica]
Length=421

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/407 (35%), Positives = 213/407 (52%), Gaps = 57/407 (14%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSPDTNT---------FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS  1111
             A  P+T    + +PD N+         F+PS+ +V+GI  ++FSLTF LL+YAKFCH +S
Sbjct  24    AAQPTTA---EAAPDNNSTPGAGIKVSFRPSVAIVVGIFTMIFSLTFLLLMYAKFCHPSS  80

Query  1110  ----------ILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVC  961
                                 A        +G+ K V+E+LPFFRF++L+G+R+G+ECSVC
Sbjct  81    SSPLPAAIPTAAAAAAGNDAAAAALAPAQAGVPKPVIEALPFFRFAALRGARQGMECSVC  140

Query  960   LSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSL-MNFSSSLRFL  784
             L+RF+D + LRLLP+C+HAFH+ C+D+WLE ++SCPLCR +V   D SL   + SS   +
Sbjct  141   LARFDDADHLRLLPRCRHAFHLACVDRWLESNASCPLCRARVDDGDASLGFKYPSSASIV  200

Query  783   CS---------DSREESSLG-----LYIQRQESFKFGSRKIKKDEKLPIQNDQSLQKPLH  646
                        D   ++  G     ++++R  S +F +      ++   +   +   P  
Sbjct  201   FGGHGLSSGRFDGDADAGSGRDLLDIFVERVPSARFAAGGAGPKQQADEEAASARAPPSP  260

Query  645   HLN---HRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfss-------sssslanpefs  496
              L+   HRIIVSDVV K+RWS ++S+DLIAL++E++R   S        S          
Sbjct  261   ELDRHKHRIIVSDVVFKSRWSELNSADLIALDTEMLRSMSSGRFSFPDYSPEYNEAKLSL  320

Query  495   ssFGSKHPHDEIQSMSIKEEMERKRLF---EIKVNKNNPSFPIPTTYAETKNLSQKEKRS  325
             S+ G +  +  + + +   E ERKRL         + + S  +         +     RS
Sbjct  321   SAAGEEEAYGAVPTTT--GETERKRLLVDGRSGGGRCSSSAAVDAAVPAAARMISSGVRS  378

Query  324   MSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRER  184
             MSEIV  PR R    +     +S+E  R+ WLPIARRT +WFA R R
Sbjct  379   MSEIVSLPRLRGAARER----LSEEENRR-WLPIARRTARWFAGRAR  420



>ref|XP_007012113.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY29732.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=391

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 205/343 (60%), Gaps = 37/343 (11%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILN----TTLQIPDALLGSWRRSSGID  1042
             F+ SL +V+GI   M SLTF +L+  KFCH   + N    T  Q    L  S    SGID
Sbjct  33    FRISLSLVVGISLGMLSLTFVVLVCLKFCHANLVDNFDHTTHPQNFHRLFQSSSIFSGID  92

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             + ++ES+P F+FS+LKGS+EGLEC+VC+S+FED +ILRLLPKC+HAFH++CIDQWLE+HS
Sbjct  93    RRIIESIPSFQFSALKGSKEGLECAVCISKFEDSDILRLLPKCEHAFHMNCIDQWLERHS  152

Query  861   SCPLCRHKVTAEDLSLMNFSSSLRFLCSDSR--EESSLGLYIQRQES---------FKFG  715
             +CPLCR+K  + D      S+SLR   + S   ++ ++ L+++R++          F  G
Sbjct  153   TCPLCRYKFDSRDAKSFTHSNSLRLSQNPSNLTDDRNVELFVEREQDDQVQGSSSRFNIG  212

Query  714   S--RKIKKDEK--LPIQNDQSLQ----KPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALN  559
             S  R+I + +K  L IQ  +       K LH   H+IIVSDVV+KNRWS VS  DL++L 
Sbjct  213   SSLRRIDRGKKQELRIQEGEGSSGDDPKLLHKFKHKIIVSDVVIKNRWSDVSPLDLLSLK  272

Query  558   SELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIK--EEMERKRLFEIK---VNKN  394
             SE++      S  S        S   + P     S  I+  E++ERKR+FE +    +KN
Sbjct  273   SEML------SVISSKRFSSLESNSRRFPTGLSTSKLIEKVEDLERKRMFESEFSITDKN  326

Query  393   NPSFPIP---TTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQD  274
             NPS   P      + +  ++  EKRSMSEI V PRFR  ++++
Sbjct  327   NPSSSFPSASYNESSSSEMNHMEKRSMSEITVFPRFRQFSLKN  369



>ref|NP_001056520.1| Os05g0596500 [Oryza sativa Japonica Group]
 gb|AAV59391.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAW57798.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18434.1| Os05g0596500 [Oryza sativa Japonica Group]
 dbj|BAG92154.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64922.1| hypothetical protein OsJ_19782 [Oryza sativa Japonica Group]
Length=385

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 135/372 (36%), Positives = 205/372 (55%), Gaps = 47/372 (13%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTV  1033
             +F+PS+ +V+GI  ++FSLTF LL+YAKFCH +S +            +     G+ K V
Sbjct  47    SFRPSVAIVVGIFTMIFSLTFLLLMYAKFCHPSSPVAAPAPTVVPAAAA---DDGVAKPV  103

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             +ESLPFFRF++L+G+R+GLEC+VCL+RF+D ++LRLLP+C+HAFH+ C+D+WLE  +SCP
Sbjct  104   IESLPFFRFAALRGARQGLECAVCLARFDDADLLRLLPRCRHAFHLDCVDRWLESKASCP  163

Query  852   LCRHKVTAEDLSL-MNFSSSLRFLCSDSREESS--------LGLYIQRQESFKFGSRKIK  700
             LCR +V AED +L + ++SS RF+ +    ES         LG++++R  S +       
Sbjct  164   LCRARVDAEDAALGLKYASSARFVPAGGASESERFDGDQDLLGIFVERVPSSR-------  216

Query  699   KDEKLPIQNDQSLQKP-LHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfssss  523
                   ++   +   P L    HRI+VSD V K+RWS ++SSDLIAL++EL+R   +   
Sbjct  217   ------MEPAAAAHCPDLDRYKHRIVVSDAVFKSRWSEINSSDLIALDTELLRSMETMEV  270

Query  522   sslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS  343
                              + E +      + +RK L      +++           + + S
Sbjct  271   EMEMEL-----------YKETEEEETDHDHQRKTLLAASGGRSSVDAAARARMISSSSSS  319

Query  342   QKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
                + SMSE+V  PR R    +     ++ E R   W+PIARRT +WFA RE R  H+  
Sbjct  320   GSVR-SMSEMVSLPRLRAAMRER----LAHEDR---WVPIARRTARWFAGRESR--HDEA  369

Query  162   IPSTQHNP*RHN  127
              P     P  H+
Sbjct  370   APVVDSPPASHS  381



>gb|KHN48455.1| Putative RING-H2 finger protein ATL12 [Glycine soja]
Length=373

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 226/398 (57%), Gaps = 77/398 (19%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTF--------QPSLVVVIGILAIMFSLTFFLLLYAKF---  1126
             NV+AQ          S DT+T         +PS VVVI  L+I+F+ +F LLLY +F   
Sbjct  8     NVQAQ---------DSTDTDTLPADFPQPVRPSKVVVIVALSILFTFSFLLLLYIRFRRI  58

Query  1125  -----CHRASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVC  961
                    R+S  +   Q       S  R SGID+ V+E+LPFFRFSSLKGS++GLEC+VC
Sbjct  59    TPLELIQRSSHHSPNFQ-ATTRSNSRSRLSGIDRQVIEALPFFRFSSLKGSKQGLECTVC  117

Query  960   LSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL-  784
             LS+FED EILRLLPKCKH FH++CID+WLE HSSCPLCR+ +   D+    +S S R L 
Sbjct  118   LSQFEDTEILRLLPKCKHTFHMNCIDKWLESHSSCPLCRNSIDPLDIKNFTYSISSRSLR  177

Query  783   -CSDSREESSLGLYIQRQES--FKFGSR-----KIKKDEKLPIQNDQSLQKPLHHLNHRI  628
               S+  E+++L +++ R+ S  F  GSR     +  K+E+L  Q  Q   K +H  NH+I
Sbjct  178   VPSNLTEDTNLEIFVHRESSSRFNMGSRFWNLGRNNKEERLLDQ--QVDGKHMHKFNHKI  235

Query  627   IVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS  448
             +VSDVV ++RWS ++SSD+++LNSE++ D  S   S               P +E+    
Sbjct  236   VVSDVVTRSRWSDLNSSDMLSLNSEMLLDMSSRRFS---------------PSNEM----  276

Query  447   IKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC  268
             I+ +     +F    N +  SF +         L+  EKRSMSEI   PRF     Q+  
Sbjct  277   IRGDSSLPFIF----NDDESSFTL---------LNTAEKRSMSEIARVPRFIETCKQNRT  323

Query  267   D--VVS------DERRRKLWLPIARRTVQWFAKRERRS  178
             +  V S      +ER R++WL IA+RTVQWF  +ER S
Sbjct  324   EAGVASSGSNEREERLRRIWLGIAQRTVQWFVGQERNS  361



>ref|XP_003545611.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Glycine max]
Length=395

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 226/398 (57%), Gaps = 77/398 (19%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDTNTF--------QPSLVVVIGILAIMFSLTFFLLLYAKF---  1126
             NV+AQ          S DT+T         +PS VVVI  L+I+F+ +F LLLY +F   
Sbjct  30    NVQAQ---------DSTDTDTLPADFPQPVRPSKVVVIVALSILFTFSFLLLLYIRFRRI  80

Query  1125  -----CHRASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVC  961
                    R+S  +   Q       S  R SGID+ V+E+LPFFRFSSLKGS++GLEC+VC
Sbjct  81    TPLELIQRSSHHSPNFQ-ATTRSNSRSRLSGIDRQVIEALPFFRFSSLKGSKQGLECTVC  139

Query  960   LSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFL-  784
             LS+FED EILRLLPKCKH FH++CID+WLE HSSCPLCR+ +   D+    +S S R L 
Sbjct  140   LSQFEDTEILRLLPKCKHTFHMNCIDKWLESHSSCPLCRNSIDPLDIKNFTYSISSRSLR  199

Query  783   -CSDSREESSLGLYIQRQES--FKFGSR-----KIKKDEKLPIQNDQSLQKPLHHLNHRI  628
               S+  E+++L +++ R+ S  F  GSR     +  K+E+L  Q  Q   K +H  NH+I
Sbjct  200   VPSNLTEDTNLEIFVHRESSSRFNMGSRFWNLGRNNKEERLLDQ--QVDGKHMHKFNHKI  257

Query  627   IVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMS  448
             +VSDVV ++RWS ++SSD+++LNSE++ D  S   S               P +E+    
Sbjct  258   VVSDVVTRSRWSDLNSSDMLSLNSEMLLDMSSRRFS---------------PSNEM----  298

Query  447   IKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDYC  268
             I+ +     +F    N +  SF +         L+  EKRSMSEI   PRF     Q+  
Sbjct  299   IRGDSSLPFIF----NDDESSFTL---------LNTAEKRSMSEIARVPRFIETCKQNRT  345

Query  267   D--VVS------DERRRKLWLPIARRTVQWFAKRERRS  178
             +  V S      +ER R++WL IA+RTVQWF  +ER S
Sbjct  346   EAGVASSGSNEREERLRRIWLGIAQRTVQWFVGQERNS  383



>ref|XP_008462696.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis melo]
Length=365

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/383 (38%), Positives = 208/383 (54%), Gaps = 66/383 (17%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQP-SLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTL  1093
             V AQ PS        P   +  P +  +VIGIL+IMFS+ F L++YAKFCH  S      
Sbjct  19    VIAQAPSP-------PKAGSVIPQNFTIVIGILSIMFSMVFILVVYAKFCHPTSHFRGEP  71

Query  1092  Q--IPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLP  919
             Q  +   LL S  R SG+D+ V+++LPFFRFSSLKGSREGLEC+VCLS+FEDIE+LRLLP
Sbjct  72    QANLRHGLLRSDSRFSGVDQKVIDALPFFRFSSLKGSREGLECAVCLSKFEDIEVLRLLP  131

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSR----EESSLG  751
             KCKHAFHI CID WLEKHSSCP+CR +++ ED++    S+S+R + ++S+    ++S + 
Sbjct  132   KCKHAFHIGCIDHWLEKHSSCPICRCRISVEDVAFFK-SNSIRLIRNNSQPDLPQDSHME  190

Query  750   LYIQRQESFKFGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDL  571
             L++ R+E+  + SR           ND +        + R I  +++     S  SS + 
Sbjct  191   LFVLREENHHYSSR----------SNDGT--------SFRKIGKEMLGAMSSSRFSSLES  232

Query  570   IALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNN  391
              ++     R+R                   K      ++M +K   ER+    I + + N
Sbjct  233   ESIRRSATRERE-----------------GKRTSQIKEAMEMKRSFERR----ISIAEKN  271

Query  390   PSFPIPT------TYAETKNLSQKEKRSMSEIVVHPRFRNGN---VQDYCDVVSDE---R  247
                 I        + A T   +   +RS+S+     RF   N   ++D   + +D    R
Sbjct  272   SLVSISGISSTSDSNASTSKTTNLNERSVSDTTAFSRFGYFNENAIRDSSMIEADAKSYR  331

Query  246   RRKLWLPIARRTVQWFAKRERRS  178
              R+LWLPIARRTVQWFA RE RS
Sbjct  332   IRQLWLPIARRTVQWFANREERS  354



>ref|XP_008650101.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Zea mays]
 gb|AFW79430.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=391

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 196/364 (54%), Gaps = 48/364 (13%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVV  1030
             F+P + +V+GI  ++FSLTF LL+YAKFCH +S  +      +    +     G+ K V+
Sbjct  49    FRPRVAIVVGIFTMIFSLTFLLLMYAKFCHPSSSSSPPQPASNNGAAAAAVCVGLPKQVI  108

Query  1029  ESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPL  850
             ESLPFFRF++L+G+R G+ECSVCL+RF+D ++LRLLP+C+HAFH+ C+D+WL+  ++CPL
Sbjct  109   ESLPFFRFATLRGARHGMECSVCLARFDDADLLRLLPRCRHAFHLACVDRWLQSSATCPL  168

Query  849   CRHKVTAEDLSLMNFS--SSLRF-----LCSDSREESSLGLYIQRQESFKFGSRKIKKDE  691
             CR  V A+D  L      SS RF       +       L ++++R               
Sbjct  169   CRSNVDADDAKLDADHALSSGRFDDGAAAEAAGSGRDLLDIFVER---------------  213

Query  690   KLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfssssssla  511
                      +  P  H  HRIIVSDVV K+RWS ++S+DLIAL++E++R   S       
Sbjct  214   ---------VPGPDRH-KHRIIVSDVVFKSRWSELNSADLIALDTEMLRSMSSGRFVFPP  263

Query  510   npefsssFGSK-HPHDEIQSMSIKEEMERKRLFEIKVNKNNP----SFPIPTTYAETKNL  346
             +  + ++   K    D+ ++    +  ERKRL E  V  + P            A    +
Sbjct  264   DSPYCAAPEHKLAAEDQEETTMANKNKERKRLLEPVVVVDAPLGGECSSGSAVSASAARM  323

Query  345   SQKEKRSMSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKR------ER  184
                  RSMSEIV  PR R    +     +S+E  R+ WLPIARRT +WFA R      E 
Sbjct  324   ISSGVRSMSEIVSLPRLRAAARER----LSEEENRR-WLPIARRTARWFAGRASGGQEEH  378

Query  183   RSAH  172
             R+ H
Sbjct  379   RAVH  382



>ref|XP_006389460.1| hypothetical protein POPTR_0024s00470g [Populus trichocarpa]
 gb|ERP48374.1| hypothetical protein POPTR_0024s00470g [Populus trichocarpa]
Length=324

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 188/363 (52%), Gaps = 83/363 (23%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDK  1039
              + F+PSL+  IGIL IM SLTF LL+Y K CHR                      G D 
Sbjct  29    VSNFRPSLL--IGILCIMSSLTFILLIYEKSCHRG---------------------GSDH  65

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
                E+          GSREGLEC+V LS+FEDIEILRLLP+CKHAF+I+C+   L+   +
Sbjct  66    GDSEN----------GSREGLECAVYLSKFEDIEILRLLPQCKHAFYINCVISGLKNIQA  115

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQE------SFKFGS--RKI  703
                   + T                   +R +S + L++QR+E       F  GS   KI
Sbjct  116   ALFAGARAT-------------------TRFDSDIELFVQREEIHQRSSRFSIGSSFSKI  156

Query  702   KKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfssss  523
              K  K     ++SL K    + H+IIVSDVVLKNRWSS SSSDL+ LNSE++ D  S+  
Sbjct  157   GKVNK----EEESLIKKEAEVKHKIIVSDVVLKNRWSSASSSDLMFLNSEMLYDSSSNRF  212

Query  522   sslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLS  343
              SL      S+       D++  M  KEE+E KRLFE K   ++ S  I +T        
Sbjct  213   LSLDLKNEESTTNRAIEDDQVLKM--KEEIEMKRLFESKGISSHTSRIINST--------  262

Query  342   QKEKRSMSEIVVHPRFRNGNVQDYC-------DVVSDERRRKLWLPIARRTVQWFAKRER  184
               ++RS+SEI    RFRN  +++           +  ER+R+LWLPIARRTV WFA RE+
Sbjct  263   --DRRSISEITAFSRFRNFGLKNTIRESSSDGSNIEAERQRQLWLPIARRTVMWFANREK  320

Query  183   RSA  175
              S 
Sbjct  321   DST  323



>ref|XP_002440385.1| hypothetical protein SORBIDRAFT_09g030900 [Sorghum bicolor]
 gb|EES18815.1| hypothetical protein SORBIDRAFT_09g030900 [Sorghum bicolor]
Length=473

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 136/399 (34%), Positives = 204/399 (51%), Gaps = 63/399 (16%)
 Frame = -1

Query  1212  TFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS--------ILNTTLQIPDALLGSWRR  1057
             +F+P + +V+GI  ++FSLTF LL+YAKFCH +S        ++       +    +   
Sbjct  52    SFRPRVAIVVGIFTMIFSLTFILLMYAKFCHPSSSPSPAASALVGGGETGGNNGAAAAAA  111

Query  1056  SSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
             + G+ K V+ESLPFFRF++L+G+R+G+ECSVCL+RF+D ++LRLLP+C HAFH+ C+D+W
Sbjct  112   AVGVPKQVIESLPFFRFATLRGARQGMECSVCLARFDDADLLRLLPRCHHAFHLDCVDRW  171

Query  876   LEKHSSCPLCRHKVTAEDLSL-MNFSSSLRFLCSDSREESSLGLYIQRQESFKFGSRKIK  700
             L+  +SCPLCR  V A+D +L + + SS R +     +  S G +     +   G+    
Sbjct  172   LQSSASCPLCRTSVDADDATLGLKYPSSARIVFGG--DALSSGRFDDAAAAAAAGTAGSG  229

Query  699   KD------EKLPIQNDQ---------------------SLQKP----LHHLNHRIIVSDV  613
             +D      E++P  + +                     S+  P    L    HRIIVSDV
Sbjct  230   RDLLDIFVERVPGPDTKPQQQQQQQVGDVDDEEEAISSSVALPPGQELDRHKHRIIVSDV  289

Query  612   VLKNRWSSVSSSDLIALNSELIRDRfsssss-----slanpefsssFGSKHPHD-EIQS-  454
             V K+RWS ++S+DLIAL+ E++R   SSS               S+   + P++ EI + 
Sbjct  290   VFKSRWSELNSADLIALDMEMLRSMSSSSGRFVFPPDSPYCPEYSNEAQQAPNNKEIAAE  349

Query  453   -------MSIKEEMERKRLFE----IKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVV  307
                      +     RKRL +    +               A    +     RSMSEIV 
Sbjct  350   EEEEEDEDGVVPTTSRKRLLKPVVVVDARLGGGCSSGSAVSASAARMISSGVRSMSEIVS  409

Query  306   HPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKR  190
              PR R    +   +   +E R + WLPIARRT +WFA R
Sbjct  410   LPRLRAAARERLSE---EENRNRRWLPIARRTARWFAGR  445



>ref|XP_003565801.1| PREDICTED: LOW QUALITY PROTEIN: putative RING-H2 finger protein 
ATL12 [Brachypodium distachyon]
Length=401

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/408 (34%), Positives = 203/408 (50%), Gaps = 65/408 (16%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA---SILNT  1099
             V+ Q P    P         F+PS+ +V+GI  ++FSLTF LL+YAKFCH +   S    
Sbjct  21    VQGQQPEPETPPGAGIKV-AFRPSIAIVVGIFTMIFSLTFLLLMYAKFCHPSTPPSAATD  79

Query  1098  TLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLP  919
             T   P       RR     K VVESLPFFRF++L+G+R+GLEC+VCL+RF+D ++LRLLP
Sbjct  80    TGHPPAGAGDDDRRRRA--KAVVESLPFFRFAALRGARQGLECAVCLARFDDADLLRLLP  137

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREES-SLGLYI  742
             +C+HAFH+ C+D+WL  ++SCPL R    A                S+ R+++   G+++
Sbjct  138   RCRHAFHLDCVDRWLHSNASCPLSR----ASSSPGSGDDDDAAAAASEERDDALQTGIFV  193

Query  741   QRQESFKFGSRKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIAL  562
             +R  S +F       DE  P + ++ L +      HRI+VSD + K+RWS ++++DL  L
Sbjct  194   ERVRSARF-----NLDE--PPEPERELDR----HEHRIVVSDALFKSRWSDLNTADLAVL  242

Query  561   NSELIRDRfsssssslanpefsssFGSKHPH---------------DEIQSMSIKEEMER  427
             ++ +   +    S+S    +  S+    HPH               D +   S    +E+
Sbjct  243   DNRM---KLMLRSTSSGLDDDISALFQHHPHHQDKEEEDEDGILYIDVVSPPSEGRTVEK  299

Query  426   KRLF------EIKVNKNN------PSFPIPTT------YAETKNLSQKEKRSMSEIVVHP  301
             KRL       E K  ++            PTT       A +  L     RSMSEIV  P
Sbjct  300   KRLLVDGQHHEKKSKRSGICGGSSDGVVEPTTTTVGGLAASSSRLITSGVRSMSEIVRLP  359

Query  300   RFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQIP  157
             R  N    +  ++         W+PIARRT +WFA R   ++  S  P
Sbjct  360   RRMNETRTEEEEMRR-------WVPIARRTARWFATRPHHASASSSPP  400



>gb|EPS66214.1| hypothetical protein M569_08563, partial [Genlisea aurea]
Length=160

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRS-SGIDKTV  1033
             FQP+L  VI +L+IMFSLTF LLLYAKFCHR   +    Q  D LL S RR  SG+D+  
Sbjct  6     FQPTLAFVIAMLSIMFSLTFILLLYAKFCHR---IPAAHQFHDGLLISARRRFSGLDRKA  62

Query  1032  VESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCP  853
             VESLP+FRF+ L+G+++GLEC VCL+RFED+E+LRLLPKCKHAFHI CID WLEKH++CP
Sbjct  63    VESLPYFRFADLRGAKQGLECCVCLNRFEDVEVLRLLPKCKHAFHIDCIDNWLEKHATCP  122

Query  852   LCRHKVTAEDL  820
             LCR +VT +DL
Sbjct  123   LCRRRVTQDDL  133



>gb|AFW81364.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=346

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 127/354 (36%), Positives = 191/354 (54%), Gaps = 36/354 (10%)
 Frame = -1

Query  1170  IMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKG  991
             ++FSLTF +L+YAKFCH +   +T      A+      S G+ K V++SLPFFRF++L+G
Sbjct  1     MIFSLTFLVLMYAKFCHPSGSSSTNGAAAAAVC-----SVGVPKQVIQSLPFFRFATLRG  55

Query  990   SREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSL-  814
             +R+G+ECSVCL+RF+D ++LRLLP+C+HAFH+HC+D+WL+ ++SCPLCR  V A+  +L 
Sbjct  56    ARQGMECSVCLARFDDADLLRLLPRCRHAFHLHCVDRWLQSNASCPLCRTSVDADHATLG  115

Query  813   MNFSSSLRFLCSDSREESSLGLYIQRQESFKFGSRKIKK--DEKLP---IQNDQSLQKPL  649
             + + SS R +     +  S G +     +     R +     E++P   I+   S   P 
Sbjct  116   LKYPSSARIVFGG--DALSSGRFDDAAGAGTGSGRDLLDIFVERVPGPYIKKTISSSPPP  173

Query  648   HHLN---HRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSK  478
               L+   HRIIVSDV+ ++RWS ++S+DLIAL++E++R   S                + 
Sbjct  174   PGLDRHKHRIIVSDVLFRSRWSELNSADLIALDTEMLRSVSSGRFVFPPEYNNEMIAAAA  233

Query  477   HPHDEIQSMSI-KEEMERKRLFEIKVNKNNP--------SFPIPTTYAETKNLSQKEKRS  325
                +E +   I    M RKRL E   +  +         S    +  A    +     RS
Sbjct  234   AEEEEEEDDGIMPTAMGRKRLLEPVDDVVDDDLLGDGCRSGFAVSASASAARMISSGVRS  293

Query  324   MSEIVVHPRFRNGNVQDYCDVVSDERRRKLWLPIARRTVQWFAKRERRSAHESQ  163
             MSEIV   R R          +S+E  R+ WL IARRT +WFA       +E +
Sbjct  294   MSEIVSLSRER----------LSEEDNRR-WLTIARRTARWFAAGRASRGNEEE  336



>ref|XP_008223826.1| PREDICTED: RING-H2 finger protein ATL43 [Prunus mume]
Length=454

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 157/281 (56%), Gaps = 46/281 (16%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIP  1084
             + +PS   PN      ++F+PS+ +++G+L  +FS+TF LLLYAK C R +++       
Sbjct  57    SANPSPSPPNAGPAKASSFRPSIAIIVGVLTTLFSITFLLLLYAKHCKRGALVVVAGNSN  116

Query  1083  DALLGS-WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKH  907
                 GS  R++SGID++VVESLP FRF SL+G +EGLEC+VCL+RF+  E+LRLLPKCKH
Sbjct  117   SGPSGSTQRKNSGIDRSVVESLPVFRFGSLRGQKEGLECAVCLTRFDRAEVLRLLPKCKH  176

Query  906   AFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQES  727
             AFH+ C+D WL+ HS+CPLCR++V  ED+ L++ +S +      S++ S + L I+    
Sbjct  177   AFHVECVDTWLDAHSTCPLCRYRVDPEDVLLVDDASKILH----SQQSSDVVLDIENDPG  232

Query  726   FKFGSRK----------------------------IKKDE-------KLPIQNDQSLQKP  652
             ++  S +                             KK E         P ++   L + 
Sbjct  233   YRRVSGRHSFAGEQRPGNPIPTWSFRRSLDSWTAFRKKSEPSTVGCLDRPRKDGLLLGQD  292

Query  651   LHHLNHRIIVSDVV------LKNRWSSVSSSDLIALNSELI  547
                L HRII+S  +      L  RWS V  SDL+ L SE+I
Sbjct  293   RTRLEHRIIISPGLACGPGGLHQRWSDVQPSDLLYLRSEMI  333



>ref|XP_008453535.1| PREDICTED: RING-H2 finger protein ATL43 [Cucumis melo]
Length=399

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 153/292 (52%), Gaps = 66/292 (23%)
 Frame = -1

Query  1233  DQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASIL---------NTTLQIPD  1081
             ++ P  + F+PS+ VV+G+L   FS+TF LLLYAK C R +           NTT+ +P 
Sbjct  77    EEKPVYSPFRPSMAVVVGVLTTTFSITFLLLLYAKHCKRGNGAVVVGYSMRPNTTMGVPS  136

Query  1080  ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAF  901
                 S R++SGID+TV+ESLP FRF SL G +EGLEC+VCL+RFE  E+LRLLPKCKHAF
Sbjct  137   F---STRKNSGIDQTVIESLPIFRFGSLSGQKEGLECAVCLNRFEPTEVLRLLPKCKHAF  193

Query  900   HIHCIDQWLEKHSSCPLCRHKVTAEDLSL-------MNFSSSLRFLCSDSREESSLGLYI  742
             H+ C+D WL+ HS+CPLCR++V  ED+ L       ++            RE +S  + +
Sbjct  194   HVECVDTWLDAHSTCPLCRYRVDPEDVLLVEDVNIFLHNQPPPPPPPPPPRESNSKDVVL  253

Query  741   ---QRQESFKFGSRKI-------------------------------------------K  700
                Q + S K GS ++                                           +
Sbjct  254   NLEQGRRSGKAGSGRVSGRHSSVGEKRTGESSYRDPALLRRSLDSKRTETVSVGCFDRHR  313

Query  699   KDEKLPIQNDQSLQKPLHHLNHRIIVSD-VVLKNRWSSVSSSDLIALNSELI  547
             KD  L  +   +  +  + L HRIIVS  + +  RWS V  SDL+ L SE+I
Sbjct  314   KDGSLLPEEKSNQNQNQNRLEHRIIVSPRMPVVERWSDVQGSDLLYLRSEMI  365



>ref|XP_007225077.1| hypothetical protein PRUPE_ppa017787mg, partial [Prunus persica]
 gb|EMJ26276.1| hypothetical protein PRUPE_ppa017787mg, partial [Prunus persica]
Length=418

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 152/266 (57%), Gaps = 46/266 (17%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS-WRRSSGID  1042
              ++F+PS+ +++G+L  +FS+TF LLLYAK C R +++  T        GS  R++SGID
Sbjct  33    ASSFRPSIAIIVGVLTTLFSITFLLLLYAKHCKRGALVVATGNANSGPSGSTQRKNSGID  92

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             ++VVESLP FRF SL+G +EGLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D WL+ HS
Sbjct  93    RSVVESLPVFRFGSLRGQKEGLECAVCLTRFDRAEVLRLLPKCKHAFHVECVDTWLDAHS  152

Query  861   SCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQESFKFGSRK--------  706
             +CPLCR++V  ED+ L++ +S +      S++ S + L I+    ++  S +        
Sbjct  153   TCPLCRYRVDPEDVLLVDDASKILH----SQQSSDVVLDIENDPGYRRVSGRHSFAGEQR  208

Query  705   --------------------IKKDE-------KLPIQNDQSLQKPLHHLNHRIIVSDVV-  610
                                  KK E         P ++   L +    L HRII+S  + 
Sbjct  209   PGNPILTWSFRRSLDSWTAFRKKSEPSTVGCLDRPRKDGLLLGQDRTRLEHRIIISPGLA  268

Query  609   -----LKNRWSSVSSSDLIALNSELI  547
                  L  RWS V  SDL+ L SE+I
Sbjct  269   CGPGGLHQRWSDVQPSDLLYLRSEMI  294



>ref|XP_004162811.1| PREDICTED: RING-H2 finger protein ATL43-like [Cucumis sativus]
 gb|KGN65511.1| hypothetical protein Csa_1G433100 [Cucumis sativus]
Length=391

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNTTLQIPDALLG-  1069
             P ++ P  + F+PS+ VV+G+L   FS+TF LLLYAK C R  A+++      P+ ++G 
Sbjct  65    PPEEKPVYSPFRPSMAVVVGVLTTTFSITFLLLLYAKHCKRGNAAVVVGYSMRPNTMMGV  124

Query  1068  ---SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
                S R++SGID+TV+ESLP FRF SL G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH
Sbjct  125   PSFSTRKNSGIDQTVIESLPIFRFGSLSGQKEGLECAVCLNRFEPTEVLRLLPKCKHAFH  184

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             + C+D WL+ HS+CPLCR++V  ED+ L+
Sbjct  185   VECVDTWLDAHSTCPLCRYRVDPEDVLLV  213



>ref|XP_010648505.1| PREDICTED: putative RING-H2 finger protein ATL12 [Vitis vinifera]
Length=160

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 108/146 (74%), Gaps = 8/146 (5%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA----SILN  1102
             VKAQ  S    +D S   +  QP L+VV+G+L+IMF LTF LL YAKFCH A    S  +
Sbjct  17    VKAQDTSD---SDHS-GPHFLQPHLMVVVGVLSIMFCLTFLLLAYAKFCHVAVPDFSDFD  72

Query  1101  TTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLL  922
                Q    L     RSSGIDK V+ESLPFFRFSSLKGS+EGLEC+VCLS+FE+IE+LRLL
Sbjct  73    NHQQNLHGLDRERLRSSGIDKRVMESLPFFRFSSLKGSKEGLECAVCLSKFEEIEVLRLL  132

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCR  844
             P C+HAFHI+CIDQWLE HSSCPLCR
Sbjct  133   PNCRHAFHINCIDQWLESHSSCPLCR  158



>ref|XP_009391100.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL43-like 
[Musa acuminata subsp. malaccensis]
Length=455

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 145/279 (52%), Gaps = 58/279 (21%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALL---GSWRRSSGIDK  1039
             F+P + V++G+L I+FSLTF LLLYA+ C R++         +       S RR SG+D+
Sbjct  86    FRPGIAVIVGVLTIIFSLTFLLLLYARHCKRSAASYGAGGSANGGFPPSASERRHSGVDR  145

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              VVESLP FRF SL+G +EGLEC+VCLSRFE  E LRLLPKC+H FH+ C+D WL+ HS+
Sbjct  146   AVVESLPVFRFGSLQGQKEGLECAVCLSRFEPTEALRLLPKCRHGFHVECVDTWLDAHST  205

Query  858   CPLCRHKVTAEDLSLMNFSS---------------------------------SLRFLCS  778
             CPLCR +V  ED+ L+  S                                  S R   +
Sbjct  206   CPLCRVRVDPEDVLLVPRSVPESHGGGGGEKADTKGGGDGATTVAPNPFGRRISGRHSSA  265

Query  777   DSREESSLGLYIQRQE---------------------SFKFGSRKIKKDEKLPIQNDQSL  661
               R    L + + R E                     +   G+ +++KD+ LP +  +  
Sbjct  266   GERSSEPLQIVVHRAEPAGTRWRRSADLPGFGKPGVDAAVAGAPRVRKDKLLPTEATEDR  325

Query  660   QKPLHHLNHRIIVSDVVLK-NRWSSVSSSDLIALNSELI  547
             +      +HRI+VSDV ++ +RWS +  +DL+ L  E+I
Sbjct  326   EAFERRHSHRIVVSDVDVRLDRWSDLRPTDLLFLRREMI  364



>ref|XP_010265393.1| PREDICTED: RING-H2 finger protein ATL43 [Nelumbo nucifera]
Length=528

 Score =   178 bits (452),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 105/139 (76%), Gaps = 7/139 (5%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASIL-----NTTLQIPDALLGSWRRSSGI  1045
             F+PS+ V++G+L  MFS+TF LLLYAK C R+S       N +   P +     RR+SGI
Sbjct  106   FRPSIAVIVGVLTTMFSITFLLLLYAKHCKRSSGFGGYAGNQSSGFPGSYAA--RRNSGI  163

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             D++V+ESLP FRF SL+G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ H
Sbjct  164   DRSVIESLPIFRFGSLRGHKEGLECAVCLTRFETTEVLRLLPKCKHAFHVECVDTWLDAH  223

Query  864   SSCPLCRHKVTAEDLSLMN  808
             S+CPLCR++V  ED+ L++
Sbjct  224   STCPLCRYRVDPEDVLLVD  242



>ref|XP_010656869.1| PREDICTED: RING-H2 finger protein ATL43 [Vitis vinifera]
Length=436

 Score =   176 bits (446),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVV  1030
             F+PS+ V++G+L  MFS+TF LLLYAK C R + +  T   P  L  + R++SGID+TV+
Sbjct  52    FRPSIAVIVGVLTTMFSITFLLLLYAKHCKRGNGVVYTGTPP--LSSAARKNSGIDRTVI  109

Query  1029  ESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPL  850
             ESLP FRF+SL+G ++GLEC+VCL+RFE  EILRLLPKCKHAFH+ C+D WL+ HS+CPL
Sbjct  110   ESLPVFRFASLRGQKDGLECAVCLNRFEPTEILRLLPKCKHAFHVECVDTWLDAHSTCPL  169

Query  849   CRHKVTAEDLSLM  811
             CR++V  ED+ L+
Sbjct  170   CRYRVDPEDILLV  182



>ref|XP_002511366.1| ring finger protein, putative [Ricinus communis]
 gb|EEF51968.1| ring finger protein, putative [Ricinus communis]
Length=493

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNT---TLQIPDALLGSWRRSSGIDK  1039
             F+PS+ V++G+L  MFS+T  LLLYAK C RA I N+               R++SGID+
Sbjct  75    FKPSIAVIVGVLTTMFSITLLLLLYAKHCKRAHIYNSFNNGGGGTGGQTAEARKNSGIDR  134

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              V+ESLP FRFSSL+G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+
Sbjct  135   AVIESLPIFRFSSLRGQKDGLECAVCLTRFEPPEVLRLLPKCKHAFHVECVDTWLDAHST  194

Query  858   CPLCRHKVTAEDLSLMN  808
             CPLCR++V  ED+ L++
Sbjct  195   CPLCRYRVDPEDVLLID  211



>ref|XP_011069943.1| PREDICTED: RING-H2 finger protein ATL43-like [Sesamum indicum]
Length=411

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (67%), Gaps = 25/175 (14%)
 Frame = -1

Query  1263  AQHPS--TIIPNDQSPDTN-----------------TFQPSLVVVIGILAIMFSLTFFLL  1141
             + HPS  T +P D++  TN                 +F+P + V++GIL  +FS+TF LL
Sbjct  18    SNHPSLTTAVPADENDVTNSASAPPPSAAMAGSRISSFKPGIAVIVGILTTVFSVTFLLL  77

Query  1140  LYAKFCHRASILNTTLQI-PDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSV  964
             LY K C R +  N++    P +     RR+SGID+ V+ESLP FRFSSL+G ++GLEC+V
Sbjct  78    LYVKHCKRGNYANSSRGYYPPS-----RRNSGIDRKVIESLPMFRFSSLRGQKDGLECAV  132

Query  963   CLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSS  799
             CL++FE  E+LRLLPKCKHAFHI C+D WL+ HS+CPLCR++V  ED+ L++  S
Sbjct  133   CLNKFEANEVLRLLPKCKHAFHIECVDTWLDGHSTCPLCRYRVDPEDVLLVDTKS  187



>ref|XP_006474307.1| PREDICTED: RING-H2 finger protein ATL43-like [Citrus sinensis]
Length=445

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 146/268 (54%), Gaps = 48/268 (18%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG---SWRRSSGIDK  1039
             F+PS+ VV+G+L  MFS+TF LLLYAK C R + +        AL+    + R++SGID+
Sbjct  61    FKPSMAVVVGVLTTMFSMTFLLLLYAKHCKRGNSVVGYGTSHSALINPSSTNRKNSGIDR  120

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
             TV+ESLP FRF +L+G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+
Sbjct  121   TVIESLPIFRFGALRGHKDGLECAVCLTRFEPTEVLRLLPKCKHAFHVECVDTWLDSHST  180

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFLCSD----------------SREESSLGLYI-----  742
             CPLCR++V  ED+ L++F  ++    S+                S   SS G +      
Sbjct  181   CPLCRYRVDPEDI-LLSFEKNIDSAESEAAPPEPNPNHPEFRRVSGRHSSAGEFGSCSQN  239

Query  741   ----------------QRQESFKFGSRKIKKDEKLPIQNDQSLQKPL--HHLNHRIIVS-  619
                             ++ ES   G     + + L + +  +  +        HRII+S 
Sbjct  240   PTSSRRSLDGAFSKKREQAESVAVGCFDRPRKDGLLLTDGLTADRKSSERRFEHRIIISA  299

Query  618   ----DVVLKNRWSSVSSSDLIALNSELI  547
                       RWS V  SDL+ L SE++
Sbjct  300   GAGAGGGFSRRWSDVQPSDLLYLRSEML  327



>ref|XP_006453207.1| hypothetical protein CICLE_v10010271mg, partial [Citrus clementina]
 gb|ESR66447.1| hypothetical protein CICLE_v10010271mg, partial [Citrus clementina]
Length=499

 Score =   175 bits (444),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 146/268 (54%), Gaps = 48/268 (18%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG---SWRRSSGIDK  1039
             F+PS+ VV+G+L  MFS+TF LLLYAK C R + +        AL+    + R++SGID+
Sbjct  140   FKPSMAVVVGVLTTMFSMTFLLLLYAKHCKRGNSVVGYGTSHSALINPSSTNRKNSGIDR  199

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
             TV+ESLP FRF +L+G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+
Sbjct  200   TVIESLPIFRFGALRGHKDGLECAVCLTRFEPTEVLRLLPKCKHAFHVECVDTWLDSHST  259

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFLCSD----------------SREESSLGLYI-----  742
             CPLCR++V  ED+ L++F  ++    S+                S   SS G +      
Sbjct  260   CPLCRYRVDPEDI-LLSFEKNIDSAESEAAPPEPNPNHPEFRRVSGRHSSAGEFGSCSQN  318

Query  741   ----------------QRQESFKFGSRKIKKDEKLPIQNDQSLQKPL--HHLNHRIIVS-  619
                             ++ ES   G     + + L + +  +  +        HRII+S 
Sbjct  319   PTSSRRSLDGAFSKKREQAESVAVGCFDRPRKDGLLLTDGLTADRKSSERRFEHRIIISA  378

Query  618   ----DVVLKNRWSSVSSSDLIALNSELI  547
                       RWS V  SDL+ L SE++
Sbjct  379   GAGAGGGFSRRWSDVQPSDLLYLRSEML  406



>emb|CBI17870.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVV  1030
             F+PS+ V++G+L  MFS+TF LLLYAK C R + +  T   P  L  + R++SGID+TV+
Sbjct  52    FRPSIAVIVGVLTTMFSITFLLLLYAKHCKRGNGVVYTGTPP--LSSAARKNSGIDRTVI  109

Query  1029  ESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPL  850
             ESLP FRF+SL+G ++GLEC+VCL+RFE  EILRLLPKCKHAFH+ C+D WL+ HS+CPL
Sbjct  110   ESLPVFRFASLRGQKDGLECAVCLNRFEPTEILRLLPKCKHAFHVECVDTWLDAHSTCPL  169

Query  849   CRHKVTAEDLSLM  811
             CR++V  ED+ L+
Sbjct  170   CRYRVDPEDILLV  182



>ref|XP_006374391.1| hypothetical protein POPTR_0015s06750g, partial [Populus trichocarpa]
 gb|ERP52188.1| hypothetical protein POPTR_0015s06750g, partial [Populus trichocarpa]
Length=407

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS---ILNTTLQIPDALLGS  1066
             N   P+   F+ S+ +++ +L  +FS+TF LLLYAK C R S   I  T   I D  + +
Sbjct  22    NISRPNETPFRTSIAIIVAVLTTIFSVTFLLLLYAKHCKRGSGNTISVTGYDINDPNVRA  81

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R+ SGID+ V+ESLP FRFSSL+G +EGLEC+VCL+RFE  E+L+LLPKCKHAFH+ C+
Sbjct  82    ARKHSGIDRAVIESLPIFRFSSLRGQKEGLECAVCLTRFEPTEVLKLLPKCKHAFHVECV  141

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMN  808
             D WL+ HS+CPLCR++V  ED+ L+ 
Sbjct  142   DTWLDAHSTCPLCRYRVDPEDVLLIG  167



>ref|XP_004150747.1| PREDICTED: RING-H2 finger protein ATL43-like [Cucumis sativus]
Length=313

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = -1

Query  1197  LVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNTTLQIPDALLG----SWRRSSGIDKT  1036
             + VV+G+L   FS+TF LLLYAK C R  A+++      P+ ++G    S R++SGID+T
Sbjct  1     MAVVVGVLTTTFSITFLLLLYAKHCKRGNAAVVVGYSMRPNTMMGVPSFSTRKNSGIDQT  60

Query  1035  VVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSC  856
             V+ESLP FRF SL G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+C
Sbjct  61    VIESLPIFRFGSLSGQKEGLECAVCLNRFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTC  120

Query  855   PLCRHKVTAEDLSLM  811
             PLCR++V  ED+ L+
Sbjct  121   PLCRYRVDPEDVLLV  135



>ref|XP_006399040.1| hypothetical protein EUTSA_v10013693mg [Eutrema salsugineum]
 gb|ESQ40493.1| hypothetical protein EUTSA_v10013693mg [Eutrema salsugineum]
Length=409

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 146/295 (49%), Gaps = 77/295 (26%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQI--PDALLGS-------  1066
             T++F P + VVI +L  +FSLTF LLLY K C R    N ++ +  P     S       
Sbjct  58    TSSFMPGIAVVIAVLTAVFSLTFLLLLYVKHCKRR---NGSVYVNHPQRFAVSRYGGGYG  114

Query  1065  ----WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
                  R++SGID++V+ESLP FRF +L G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH
Sbjct  115   GGGGGRKNSGIDRSVIESLPVFRFGALSGQKEGLECAVCLARFEPTEVLRLLPKCKHAFH  174

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSLM---------------------NFSSSLRF--  787
             + C+D WL+ HS+CPLCR++V  ED+ L+                     N + S RF  
Sbjct  175   VECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELRFSYRQEESNSNNNTGSTRFEP  234

Query  786   LCSDSREESSLGLYIQR---------------------------------QESFKFG--S  712
             +   S   SS G    R                                  ES K G   
Sbjct  235   VSRISGRHSSAGERASRLNEVRTSSSSKSNPISFRRSLDSSLTVHDGEEKTESVKLGCLD  294

Query  711   RKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELI  547
             R  +KD  L I N +S +       HRII+S      RWS V  SDL+ L SE+I
Sbjct  295   RPQRKDGMLLIPNRESFEG---RFEHRIIISGGNRDQRWSEVRPSDLLYLRSEMI  346



>ref|XP_006359505.1| PREDICTED: RING-H2 finger protein ATL43-like [Solanum tuberosum]
Length=422

 Score =   173 bits (439),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-LQI  1087
             AQ P   +P       + F+PS+ +V+ IL  +FS+ F LLLYAK C R     TT   +
Sbjct  34    AQSPPPALPPYYRSRGSPFRPSIAIVVAILTTIFSIVFMLLLYAKHCKREGTFGTTSGGL  93

Query  1086  PDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSR-EGLECSVCLSRFEDIEILRLLPKCK  910
              +    S+R++SGID+TV+ESLP FRF SL+G + EGLEC+VCL++FE  EILRLLPKCK
Sbjct  94    TNLHSSSFRKNSGIDRTVIESLPVFRFGSLRGQKAEGLECAVCLNKFESSEILRLLPKCK  153

Query  909   HAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMN  808
             HAFHI C+D WL+ HS+CPLCR++V  ED+ L++
Sbjct  154   HAFHIECVDTWLDAHSTCPLCRYQVDPEDILLIS  187



>gb|KDP31067.1| hypothetical protein JCGZ_11443 [Jatropha curcas]
Length=500

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALL-----  1072
             N  SP    F+PS+ +++G+L  MFS+T  LLLYAK C RA+ +       D+L      
Sbjct  59    NTSSP----FKPSIAIIVGVLTAMFSITLLLLLYAKHCKRANGVVFNGFHGDSLTRGGGP  114

Query  1071  GSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
              S R++SGID+ V+ESLP FRFSSL+G ++GLEC+VCL++FE  E+LRLLPKCKHAFH+ 
Sbjct  115   TSGRKNSGIDRAVIESLPVFRFSSLRGQKDGLECAVCLTKFESAEVLRLLPKCKHAFHVE  174

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLMN  808
             C+D WL+ HS+CPLCRH+V  ED+ L++
Sbjct  175   CVDTWLDAHSTCPLCRHRVDPEDILLID  202



>ref|XP_010552862.1| PREDICTED: RING-H2 finger protein ATL43 [Tarenaya hassleriana]
Length=412

 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 100/136 (74%), Gaps = 2/136 (1%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNTTLQIPDALLGSWRRSSGIDKT  1036
             F+PS+ VV+G+L  +FSLTF LLLYAK C R   ++        +      R++SGID+T
Sbjct  58    FKPSIAVVVGVLTTVFSLTFLLLLYAKHCKRRNGAVYVHHRHHHNHHRFDGRKNSGIDRT  117

Query  1035  VVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSC  856
             V+ESLP FRF +L G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+C
Sbjct  118   VIESLPVFRFGALSGDKEGLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTC  177

Query  855   PLCRHKVTAEDLSLMN  808
             PLCR++V  ED+ L+ 
Sbjct  178   PLCRYRVDPEDILLIG  193



>ref|XP_006845712.1| hypothetical protein AMTR_s00019p00242060 [Amborella trichopoda]
 gb|ERN07387.1| hypothetical protein AMTR_s00019p00242060 [Amborella trichopoda]
Length=502

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 143/275 (52%), Gaps = 60/275 (22%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVV  1030
             F+PS+ V+IG+L  +FS+TF LLLY K C R        Q P+  L +  R SG+D+ ++
Sbjct  51    FKPSIAVIIGVLTTIFSVTFLLLLYVKHCQRGP---HNGQNPNGFLRA--RHSGVDRVII  105

Query  1029  ESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPL  850
             ESLP FRF SL G +  LEC+VCL+RFE +E+LRLLPKCKHAFH+ C+D WLE HS+CPL
Sbjct  106   ESLPMFRFESLNGPKNRLECAVCLNRFESVELLRLLPKCKHAFHVECVDTWLESHSTCPL  165

Query  849   CRHKVTAEDLSLMNFS-------------SSLRFLCSDSREESSLGLYIQR--QESFKFG  715
             CR +V  ED+ L + S             SS R    D      L + +Q+  +E+ +  
Sbjct  166   CRVRVDPEDVLLFDESLQKQGFGDGESRLSSGRKSAGDIFTGDFLQVVVQKEGEETPRRS  225

Query  714   SRKIKKDEKLPIQNDQSLQKPLHHL-----------------------------------  640
             S    K +K+   +DQ L+   H +                                   
Sbjct  226   SDSNSKRKKMEF-SDQKLEFSGHRIEFFGRKMGFSGDSVSMGCFDRGRKDGLLMEERRSF  284

Query  639   ----NHRIIVSDVVLKNRWSSVSSSDLIALNSELI  547
                  HRIIVSD   + RWS +  SDL+ L SE+I
Sbjct  285   ERRVGHRIIVSDAGFRQRWSDLRPSDLLFLRSEMI  319



>emb|CDX70126.1| BnaA10g24750D [Brassica napus]
Length=403

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 146/286 (51%), Gaps = 62/286 (22%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC-HRASILNTTLQIPDA---------LLG  1069
             T++F P + VVI +L ++FSLTF LLLY K C  R   +N T +   +           G
Sbjct  55    TSSFMPGIAVVIAVLTVVFSLTFLLLLYVKHCKRRNGYVNDTQRFATSRYYGGGGYGGGG  114

Query  1068  SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHC  889
               R++SGID++V+ESLP FRF +L G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C
Sbjct  115   VGRKNSGIDRSVIESLPVFRFGALSGHKEGLECAVCLARFEPTEVLRLLPKCKHAFHVEC  174

Query  888   IDQWLEKHSSCPLCRHKVTAEDLSLMN------------------------FSSSLRFLC  781
             +D WL+ HS+CPLCR++V  ED+ L++                         S+   F+ 
Sbjct  175   VDTWLDAHSTCPLCRYRVDPEDILLISDCNSWFELRLSNNRREESNNNNNTGSTRFDFVS  234

Query  780   SDSREESSLGLYIQR-QESFKFGSRKIKKDEKLPI------------------QNDQSLQ  658
               S   SS G    R  +  KF S +   D  L I                  +N Q   
Sbjct  235   RISGRHSSAGERASRLNDVRKFSSFRRSLDSSLRINDGEEKTDSVAVAVGCFDRNQQRKD  294

Query  657   KPLHHLN---------HRIIVSDVVLKNRWSSVSSSDLIALNSELI  547
               L + N         HRII+S      RWS V  +DL+ L SE+I
Sbjct  295   GLLLNSNRESFEARFEHRIIISGGNRDQRWSEVRPADLLYLRSEMI  340



>ref|XP_011007280.1| PREDICTED: RING-H2 finger protein ATL43 [Populus euphratica]
Length=434

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 104/146 (71%), Gaps = 3/146 (2%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA---SILNTTLQIPDALLGS  1066
             N   P+   F+ S+ +++ +L  +FS+TF LLLYAK C R    +I      I D  + +
Sbjct  51    NTSRPNETPFRTSIAIIVAVLTTIFSVTFLLLLYAKHCKRGNGNTISVVGYNINDPNVRA  110

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R+ SGID+ V+ESLP FRFSSL+G +EGLEC+VCL+RFE  E+L+LLPKCKHAFH+ C+
Sbjct  111   ARKHSGIDRAVIESLPIFRFSSLRGQKEGLECAVCLTRFEPTEVLKLLPKCKHAFHVECV  170

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMN  808
             D WL+ HS+CPLCR++V  ED+ L+ 
Sbjct  171   DTWLDAHSTCPLCRYRVDPEDILLIG  196



>ref|XP_009359989.1| PREDICTED: RING-H2 finger protein ATL43-like [Pyrus x bretschneideri]
Length=465

 Score =   171 bits (433),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 153/275 (56%), Gaps = 50/275 (18%)
 Frame = -1

Query  1236  NDQSPD-TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG-SW  1063
             N+  P  +++F+PS+ +++G+L  +FS+ F +LLYAK C  ++++           G S 
Sbjct  74    NNAGPTRSSSFRPSIAIIVGVLTTVFSVFFLILLYAKHCKGSALVVVGANSNSGPSGPSP  133

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             R++SGID+++VESLP FRF SL+G ++GLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D
Sbjct  134   RKNSGIDRSIVESLPVFRFGSLRGHKDGLECAVCLTRFDQTEVLRLLPKCKHAFHVECVD  193

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQESFK------  721
              WL+ HS+CPLCR++V  ED+ L++ ++ L        + S + + I+    F+      
Sbjct  194   TWLDAHSTCPLCRYRVDPEDVLLVDDAAKLL-----QPKNSDVVIEIENDPGFRRISGRH  248

Query  720   --FGSRKI---------------------KKDEKL-------PIQNDQSLQKPLHHLNHR  631
                G R+                      KK E+        P ++   L +    L HR
Sbjct  249   SFAGERRPGHHQIQTWSFRRSLDSWTAFRKKSEQAAVGCFDRPRKDGLLLGQHRTRLEHR  308

Query  630   IIVSDVVLK-------NRWSSVSSSDLIALNSELI  547
             IIVS   L         RWS +  SDL+ L SE+I
Sbjct  309   IIVSPTGLGYGPGGLHQRWSDLQPSDLLYLRSEMI  343



>ref|XP_008799433.1| PREDICTED: RING-H2 finger protein ATL43 [Phoenix dactylifera]
Length=419

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  1230  QSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSS  1051
             +S     F+PS+ V++G+L  MFSLTF LLLYA+ C R S              + RR+S
Sbjct  50    RSSSVAPFRPSIAVIVGVLTAMFSLTFLLLLYARHCKRTSAGYGGGGASGFSAAAERRNS  109

Query  1050  GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLE  871
             G+++ VVESLP FRF SL+G +EGLEC+VCL+RFE  E+LRLLPKC+HAFH+ C+D WL+
Sbjct  110   GVERAVVESLPVFRFGSLRGQKEGLECAVCLNRFEPAEVLRLLPKCRHAFHVECVDTWLD  169

Query  870   KHSSCPLCRHKVTAEDLSLM  811
              HS+CPLCR +V  ED+ L+
Sbjct  170   AHSTCPLCRVRVDPEDVLLV  189



>ref|XP_009349243.1| PREDICTED: RING-H2 finger protein ATL43-like [Pyrus x bretschneideri]
Length=465

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 153/275 (56%), Gaps = 50/275 (18%)
 Frame = -1

Query  1236  NDQSPD-TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG-SW  1063
             N+  P  +++F+PS+ +++G+L  +FS+ F +LLYAK C  ++++           G S 
Sbjct  74    NNAGPTRSSSFRPSIAIIVGVLTTVFSVFFLILLYAKHCKGSALVVVGADSNSGPSGPSP  133

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             R++SGID+++VESLP FRF SL+G ++GLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D
Sbjct  134   RKNSGIDRSIVESLPVFRFGSLRGHKDGLECAVCLTRFDQTEVLRLLPKCKHAFHVECVD  193

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQESFK------  721
              WL+ HS+CPLCR++V  ED+ L++ ++ L        + S + + I+    F+      
Sbjct  194   TWLDAHSTCPLCRYRVDPEDVLLVDDAAKLL-----QPKNSDVVIEIENDPGFRRISGRH  248

Query  720   --FGSRKI---------------------KKDEKL-------PIQNDQSLQKPLHHLNHR  631
                G R+                      KK E+        P ++   L +    L HR
Sbjct  249   SFAGERRPGHHQIQTWSFRRSLDSWTAFRKKSEQGAVGCFDRPRKDGLLLGQHRTRLEHR  308

Query  630   IIVSDV-------VLKNRWSSVSSSDLIALNSELI  547
             IIVS          L  RWS +  SDL+ L SE+I
Sbjct  309   IIVSPTGSGYGPGGLHQRWSDLQPSDLLYLRSEMI  343



>gb|KDO61983.1| hypothetical protein CISIN_1g016846mg [Citrus sinensis]
Length=381

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 142/264 (54%), Gaps = 48/264 (18%)
 Frame = -1

Query  1197  LVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG---SWRRSSGIDKTVVE  1027
             + VV+G+L  MFS+TF LLLYAK C R + +        AL+    + R++SGID+TV+E
Sbjct  1     MAVVVGVLTTMFSMTFLLLLYAKHCKRGNSVVGYGTSHSALINPSSTNRKNSGIDRTVIE  60

Query  1026  SLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLC  847
             SLP FRF +L+G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+CPLC
Sbjct  61    SLPIFRFGALRGHKDGLECAVCLTRFEPTEVLRLLPKCKHAFHVECVDTWLDSHSTCPLC  120

Query  846   RHKVTAEDLSLMNFSSSLRFLCSD----------------SREESSLGLYI---------  742
             R++V  ED+ L++F  ++    S+                S   SS G +          
Sbjct  121   RYRVDPEDI-LLSFEKNIDSAESEAAPPEPNPNHPEFRRVSGRHSSAGEFGSCSQNPTSS  179

Query  741   ------------QRQESFKFGSRKIKKDEKLPIQNDQSLQKPL--HHLNHRIIVS-----  619
                         ++ ES   G     + + L + +  +  +        HRII+S     
Sbjct  180   RRSLDGAFSKKREQAESVAVGCFDRPRKDGLLLTDGLTADRKSSERRFEHRIIISAGAGA  239

Query  618   DVVLKNRWSSVSSSDLIALNSELI  547
                   RWS V  SDL+ L SE++
Sbjct  240   GGGFSRRWSDVQPSDLLYLRSEML  263



>emb|CDP03011.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRA---SILNTTLQIPDALLGSWRRSSGIDK  1039
             F+PS+ V++G+L  +FS+TF LLLYAK C R    S  ++T +I    + + R++SGI +
Sbjct  35    FRPSIAVIVGVLTTVFSVTFLLLLYAKHCRRGGDNSPFSSTSRIGYPAIAA-RKNSGIGR  93

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              V+ESLP FRF+SL+G ++GLEC+VCL++FE  E+LRLLPKCKHAFH+ C+D WL+ HS+
Sbjct  94    AVIESLPVFRFASLRGQKDGLECAVCLNKFEHTEVLRLLPKCKHAFHVECVDTWLDAHST  153

Query  858   CPLCRHKVTAEDLSLM  811
             CPLCR++V  ED+ L+
Sbjct  154   CPLCRYRVDPEDILLV  169



>ref|XP_010929293.1| PREDICTED: RING-H2 finger protein ATL43-like [Elaeis guineensis]
Length=419

 Score =   167 bits (424),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVV  1030
             F+PS+ +++G+L  MFSLTF LLLYAK C RAS                RR+SG+++ VV
Sbjct  57    FRPSIAIIVGVLTAMFSLTFLLLLYAKHCKRASAGYGGGGASGFSAAVERRNSGVERAVV  116

Query  1029  ESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPL  850
             ESLP FRF SL+G +EGLEC+VCL+RFE  E+LRLLPKC+HAFH+ C+D WL+ HS+CPL
Sbjct  117   ESLPVFRFGSLRGQKEGLECAVCLNRFEPAEVLRLLPKCRHAFHVECVDTWLDAHSTCPL  176

Query  849   CRHKVTAEDLSLM  811
             CR +V  ED+ L+
Sbjct  177   CRVRVDPEDVLLV  189



>ref|XP_011079276.1| PREDICTED: RING-H2 finger protein ATL43-like [Sesamum indicum]
Length=403

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 149/286 (52%), Gaps = 72/286 (25%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDK  1039
              N F+PS+V+V+GIL  +FS+TF LLLY K C R  I  ++      L    R +SGI++
Sbjct  49    ANAFKPSIVIVVGILTTIFSITFLLLLYVKHCKR-EIYESSNSRGRPLS---RGNSGINR  104

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              V+ESLP FRFSSL G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+
Sbjct  105   KVIESLPMFRFSSLMGQKDGLECAVCLNRFEPEEVLRLLPKCKHAFHVECVDTWLDAHST  164

Query  858   CPLCRHKVTAEDLSLMN-----------------------------FSSSLRFLC-----  781
             CPLCR ++  ED+ L++                               SSL  +      
Sbjct  165   CPLCRCRLHPEDILLVDQFTPRSSDHRKGREHENTRISGRHSSAGERGSSLGIIVENPGS  224

Query  780   SDSREESSLGLYIQRQESFKFGS----------RKIKKD-------------EKLPIQND  670
              DSR   SL  +  R+++    S          +  +KD              +LP+Q D
Sbjct  225   DDSRGRISLDSWRSRRKTGNPASENKGRSSGSWKSSRKDGPVSDSSTASRKDGQLPVQGD  284

Query  669   QSLQKPLHHLNHRIIVS-----DVVLKNRWSSVSSSDLIALNSELI  547
                    H L HRII+S     +     RWS V +S+++ L SE+I
Sbjct  285   G------HRLEHRIIISGAGEAEEEEGRRWSDVQASEILYLRSEMI  324



>ref|XP_004242728.1| PREDICTED: RING-H2 finger protein ATL43 [Solanum lycopersicum]
Length=420

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALL---GSWRRSSGIDK  1039
             F+PS+V+V+ IL  +FS+ F LLLYAK C R      T            S+R++SGID+
Sbjct  46    FRPSIVIVVAILTTIFSIVFMLLLYAKHCKREGEFGMTGGGGGLTNAGSSSFRKNSGIDR  105

Query  1038  TVVESLPFFRFSSLKGSR-EGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             TV+ESLP FRF SL+G + EGLEC+VCL++FE  EILRLLPKCKHAFHI C+D WL+ HS
Sbjct  106   TVIESLPVFRFGSLRGQKAEGLECAVCLNKFESTEILRLLPKCKHAFHIECVDTWLDAHS  165

Query  861   SCPLCRHKVTAEDLSLMN  808
             +CPLCR++V  ED+ L++
Sbjct  166   TCPLCRYQVDPEDILLIS  183



>ref|XP_009417798.1| PREDICTED: RING-H2 finger protein ATL43-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 132/268 (49%), Gaps = 47/268 (18%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFC-HRASILNTTLQIPDALL--GSWRRSSGIDK  1039
              +P + +++G+L I+F LTF LLLYA+ C H  +   T        L   S RR SG+D 
Sbjct  46    LRPGIAIIVGVLTIIFCLTFLLLLYARHCKHSTASYGTGRGATGGPLTSASERRHSGVDH  105

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              VVESLP FRF SL+G +EGLEC+VCLSRFE  E+LRLLPKC+H+FH+ C+D WL+ HS+
Sbjct  106   AVVESLPVFRFGSLQGQKEGLECAVCLSRFEPAEVLRLLPKCRHSFHVECVDTWLDAHST  165

Query  858   CPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQESFKFGSR----------  709
             CPLCR +V  ED+ L            +  E    G          FG R          
Sbjct  166   CPLCRVRVDPEDVLLFPLQEPEPHGGGEKAEVKGRGDATATAVPNPFGGRISGRHSSAGE  225

Query  708   ---------------------------------KIKKDEKLPIQNDQSLQKPLHHLNHRI  628
                                               ++KD  L  +  +  +      +HRI
Sbjct  226   RTSEPLEIVVHPAEPRRRRSVDCPGCATAAHAPTVRKDALLLAEAAEDSEAFERRHSHRI  285

Query  627   IVSDVVLK-NRWSSVSSSDLIALNSELI  547
             +VSD  ++ +RWS +  +D++ L  E+I
Sbjct  286   VVSDADVRVDRWSDLRPTDMLFLRREMI  313



>ref|XP_009602368.1| PREDICTED: RING-H2 finger protein ATL43 [Nicotiana tomentosiformis]
Length=455

 Score =   166 bits (420),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 6/140 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALL-----GSWRRSSGI  1045
             F+PS+ VV+GIL  +FS+TF LLLYAK C R     TT              S+R++SGI
Sbjct  64    FRPSIAVVVGILTTIFSITFLLLLYAKHCKRGPFGTTTTTAAYGGGGVPPRSSFRKNSGI  123

Query  1044  DKTVVESLPFFRFSSLKGSR-EGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             D+TV+ESLP FRF SL+G + E LEC+VCL+RFE+ EILRLLPKCKHAFH+ C+D WL+ 
Sbjct  124   DRTVIESLPVFRFGSLRGPKAEALECAVCLNRFENSEILRLLPKCKHAFHVECVDTWLDA  183

Query  867   HSSCPLCRHKVTAEDLSLMN  808
             HS+CPLCR++V  ED+ L++
Sbjct  184   HSTCPLCRYQVDPEDILLIS  203



>ref|XP_009349090.1| PREDICTED: RING-H2 finger protein ATL43-like [Pyrus x bretschneideri]
Length=472

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 151/270 (56%), Gaps = 40/270 (15%)
 Frame = -1

Query  1236  NDQSPD-TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG-SW  1063
             N+  P  +++ +PS+ +++ +L  +FS+ F +LLYAK C R  ++           G + 
Sbjct  78    NNAGPTRSSSLRPSIAIIVAVLTTVFSVVFLILLYAKHCKRGGLVIVGSNSNSGPTGPAP  137

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             R++SGID+++VESLP FRF SL+G ++GLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D
Sbjct  138   RKNSGIDRSIVESLPVFRFRSLRGHKDGLECAVCLTRFDQTEVLRLLPKCKHAFHVECVD  197

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMNFSSSLR----------------FLCSDSRE----E  763
              WL+ HS+CPLCR++V  ED+ L++ ++ L                 F     R     E
Sbjct  198   TWLDAHSTCPLCRYRVDPEDVLLVDDAAKLLHPKNSDVVLEIENDPVFRRISGRHSFAGE  257

Query  762   SSLGLYIQRQESFK-----FGSRKIKKDEKL------PIQNDQSLQKPLHHLNHRIIVSD  616
                G +  +  SF+     + + ++K +         P ++   L +    L H+IIVS 
Sbjct  258   HRPGHHQTQTWSFRRSLDSWTAIRMKSEPATVGCFDRPRKDGLLLGQDRTRLEHQIIVSP  317

Query  615   V-------VLKNRWSSVSSSDLIALNSELI  547
                      L+ RWS V  SDL+ L SE+I
Sbjct  318   TGSGSDPGGLQQRWSDVLPSDLLYLRSEMI  347



>ref|XP_009346037.1| PREDICTED: RING-H2 finger protein ATL43-like [Pyrus x bretschneideri]
Length=465

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 151/270 (56%), Gaps = 40/270 (15%)
 Frame = -1

Query  1236  NDQSPD-TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG-SW  1063
             N+  P  +++ +PS+ +++ +L  +FS+ F +LLYAK C R  ++           G + 
Sbjct  71    NNAGPTRSSSLRPSIAIIVAVLTTVFSVVFLILLYAKHCKRGGLVIVGSNSNSGPTGPAP  130

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             R++SGID+++VESLP FRF SL+G ++GLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D
Sbjct  131   RKNSGIDRSIVESLPVFRFRSLRGHKDGLECAVCLTRFDQTEVLRLLPKCKHAFHVECVD  190

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMNFSSSL-------------------RFLCSDS-REE  763
              WL+ HS+CPLCR++V  ED+ L++ ++ L                   R     S   E
Sbjct  191   TWLDAHSTCPLCRYRVDPEDVLLVDDAAKLLHPKNSDVVLEIENDPVFRRISGRHSFAGE  250

Query  762   SSLGLYIQRQESFK-----FGSRKIKKDEKL------PIQNDQSLQKPLHHLNHRIIVSD  616
                G +  +  SF+     + + ++K +         P ++   L +    L H+IIVS 
Sbjct  251   HRPGHHQTQTWSFRRSLDSWTAIRMKSEPATVGCFDRPRKDGLLLGQDRTRLEHQIIVSP  310

Query  615   V-------VLKNRWSSVSSSDLIALNSELI  547
                      L+ RWS V  SDL+ L SE+I
Sbjct  311   TGSGSDPGGLQQRWSDVLPSDLLYLRSEMI  340



>gb|KCW80841.1| hypothetical protein EUGRSUZ_C02205, partial [Eucalyptus grandis]
Length=385

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW-----RRSSGI  1045
             F+PS+ V +G+L  MFS+ F LLLYAK C R        +  DA + S      R++SG+
Sbjct  5     FKPSVAVAVGVLTTMFSIIFLLLLYAKHCTRRGGGGGYPRSNDAAVASSLAAAARKNSGV  64

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             D++V+ESLP FRF SL+G ++GLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D WL+ H
Sbjct  65    DRSVIESLPVFRFGSLRGQKDGLECAVCLTRFDPAEVLRLLPKCKHAFHVECVDTWLDAH  124

Query  864   SSCPLCRHKVTAEDLSLMN  808
             S+CPLCR++V  ED+ L+ 
Sbjct  125   STCPLCRYRVDPEDVLLVG  143



>ref|XP_010927112.1| PREDICTED: RING-H2 finger protein ATL43-like [Elaeis guineensis]
Length=422

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ-----IPDALLGSWRRSSGI  1045
             F+PS+ V++G+L  MFSLTF LLLYAK   + S             P A +   RR+SG+
Sbjct  60    FRPSIAVIVGVLTTMFSLTFLLLLYAKHRKQTSAGLGGGGGVVPGFPAAAV---RRNSGV  116

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             ++TVVESLP FRF SL G +EGLEC+VCL+RFE +E LRLLPKC+HAFH+ C+D WL+ H
Sbjct  117   ERTVVESLPVFRFGSLSGHKEGLECAVCLNRFEPVEALRLLPKCRHAFHVECVDTWLDAH  176

Query  864   SSCPLCRHKVTAEDLSLM  811
             S+CPLCR +V  ED+ L+
Sbjct  177   STCPLCRVRVDPEDVLLV  194



>ref|XP_009785271.1| PREDICTED: RING-H2 finger protein ATL43 [Nicotiana sylvestris]
Length=450

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 6/140 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALL-----GSWRRSSGI  1045
             F+PS+ VV+ IL  +FS+TF LLLYAK C R     TT              S+R++SGI
Sbjct  61    FRPSIAVVVAILTTIFSITFLLLLYAKHCKRGPFGTTTTTAAYGGGGVPPRSSFRKNSGI  120

Query  1044  DKTVVESLPFFRFSSLKGSR-EGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEK  868
             D+TV+ESLP FRF SL+G + E LEC+VCL++FE+ EILRLLPKCKHAFH+ C+D WL+ 
Sbjct  121   DRTVIESLPVFRFGSLRGPKAEALECAVCLNKFENSEILRLLPKCKHAFHVECVDTWLDA  180

Query  867   HSSCPLCRHKVTAEDLSLMN  808
             HS+CPLCR+KV  ED+ L++
Sbjct  181   HSTCPLCRYKVDPEDILLIS  200



>ref|XP_001775043.1| predicted protein [Physcomitrella patens]
 gb|EDQ60150.1| predicted protein [Physcomitrella patens]
Length=908

 Score =   168 bits (425),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 4/144 (3%)
 Frame = -1

Query  1227  SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS----WR  1060
             SP    F+PS+ V+IG+L  MFSLTF LLLYAK C R +        P+    +    + 
Sbjct  372   SPGATPFRPSIAVIIGVLTTMFSLTFLLLLYAKHCKRVAEAEGEGAAPEEAPAAAPAAFH  431

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
               +G+D+ +VE+LP F F+SL+G +EGLEC+VCLSRFED +ILRLLPKCKHAFH+ C+D 
Sbjct  432   VDAGLDRAIVEALPMFTFASLQGVKEGLECAVCLSRFEDADILRLLPKCKHAFHLDCVDT  491

Query  879   WLEKHSSCPLCRHKVTAEDLSLMN  808
             WL  HS+CPLCRH +T++DLSL++
Sbjct  492   WLVSHSTCPLCRHCITSDDLSLVD  515



>ref|XP_010048561.1| PREDICTED: RING-H2 finger protein ATL43 [Eucalyptus grandis]
Length=445

 Score =   162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW-----RRSSGI  1045
             F+PS+ V +G+L  MFS+ F LLLYAK C R        +  DA + S      R++SG+
Sbjct  65    FKPSVAVAVGVLTTMFSIIFLLLLYAKHCTRRGGGGGYPRSNDAAVASSLAAAARKNSGV  124

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             D++V+ESLP FRF SL+G ++GLEC+VCL+RF+  E+LRLLPKCKHAFH+ C+D WL+ H
Sbjct  125   DRSVIESLPVFRFGSLRGQKDGLECAVCLTRFDPAEVLRLLPKCKHAFHVECVDTWLDAH  184

Query  864   SSCPLCRHKVTAEDLSLMN  808
             S+CPLCR++V  ED+ L+ 
Sbjct  185   STCPLCRYRVDPEDVLLVG  203



>ref|XP_010227400.1| PREDICTED: RING-H2 finger protein ATL43 [Brachypodium distachyon]
Length=396

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 98/146 (67%), Gaps = 7/146 (5%)
 Frame = -1

Query  1227  SPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-------LQIPDALLG  1069
             S     F+P + VV+GIL  +FS+TF LLLYAK C R++  ++             A  G
Sbjct  26    SASATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGSGSAGVGGAAGGG  85

Query  1068  SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHC  889
               RR+SG+D+ VVESLP FRF +L+G + GLEC+VCL RFE  E LRLLPKC+H FH+ C
Sbjct  86    EGRRNSGVDRAVVESLPVFRFGALRGQKAGLECAVCLGRFEPTEALRLLPKCRHGFHVEC  145

Query  888   IDQWLEKHSSCPLCRHKVTAEDLSLM  811
             +D WL+ HS+CPLCR +V  ED+ L+
Sbjct  146   VDTWLDAHSTCPLCRSRVDPEDVLLL  171



>ref|XP_004490488.1| PREDICTED: RING-H2 finger protein ATL43-like [Cicer arietinum]
Length=402

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 137/235 (58%), Gaps = 18/235 (8%)
 Frame = -1

Query  1206  QPSLVVVIGILAIMFSLTFFLLLYAKFCHRASIL----NTTLQIPDALLG-SWRRSSGID  1042
             +PS  V+IGIL  + S+T  +LLY K C + ++     N T   P+A      R++SGI+
Sbjct  78    KPSTAVIIGILTTIVSITLLILLYIKHCSKGNVNMFNNNATDANPNAETNLQDRKNSGIE  137

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             +TVVE+LP F+F SL+G + GLEC+VCL+ FED E+LRLLPKC HAFH+ C+D WL +HS
Sbjct  138   RTVVEALPAFKFGSLRGQKNGLECAVCLNGFEDPEVLRLLPKCNHAFHVECVDMWLGEHS  197

Query  861   SCPLCRHKVTAEDLSL----MNFSSSLRFLCSDSREESSLGLYIQRQESFKFGSRKIKKD  694
             +CPLCR+KV  +D+ +    +    S        R  ++  +  +  E+ K    +    
Sbjct  198   TCPLCRYKVDPDDVIIPPRRITEEESSSSNVESGRVTNNTNIP-ENSETSKLSWDRDSNS  256

Query  693   EKL---PIQNDQSLQKPLHHLNHRIIVSDVV---LKNRWSSVSSSDLIALNSELI  547
               +    I++D  + +  H L HRIIVS      ++ RWS++   D++ L S+ I
Sbjct  257   NNINLRDIRSDGGMGE--HKLEHRIIVSPTSCSGVQQRWSNIERCDMLYLTSDGI  309



>ref|XP_002438934.1| hypothetical protein SORBIDRAFT_10g028540 [Sorghum bicolor]
 gb|EER90301.1| hypothetical protein SORBIDRAFT_10g028540 [Sorghum bicolor]
Length=402

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (68%), Gaps = 9/145 (6%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW--------  1063
                F+P + VV+GIL  +FS+TF LLLYAK C R++  ++         GS         
Sbjct  29    ATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGSAGGSGSSGAGGAGGG  88

Query  1062  -RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              RR+SG+D+ VVESLP FRF +L+G +EGLEC+VCL RFE  E LRLLPKC+H FH+ C+
Sbjct  89    DRRNSGVDRAVVESLPVFRFGALRGQKEGLECAVCLGRFEPTEALRLLPKCRHGFHVECV  148

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLM  811
             D WL+ HS+CPLCR +V  ED+ L+
Sbjct  149   DTWLDAHSTCPLCRSRVDPEDVLLL  173



>ref|XP_004966142.1| PREDICTED: RING-H2 finger protein ATL43-like [Setaria italica]
Length=400

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 136/292 (47%), Gaps = 68/292 (23%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW--------  1063
                F+P + VV+GIL  +FS+TF LLLYAK C R++  ++         G          
Sbjct  28    ATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGSAGGGGGGGFGSSGAG  87

Query  1062  ----RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
                 RR+SG+D+ VVESLP FR+ +L+G +EGLEC+VCL RFE  E LRLLPKC+H FH+
Sbjct  88    AAGDRRNSGVDRAVVESLPVFRYGALRGQKEGLECAVCLGRFEPTEALRLLPKCRHGFHV  147

Query  894   HCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSS----------------------------  799
              C+D WL+ HS+CPLCR +V  ED+ L+                                
Sbjct  148   ECVDTWLDAHSTCPLCRSRVDPEDVLLLPEPPKPSTTGPPDPPETKAATKEAPQQTAPAP  207

Query  798   ---------SLRFLCSDSREESSLGLYIQRQESFK-----FGSRKIKKDEKLPIQNDQSL  661
                      S R      R    +G   +R          F S K++KD  L ++    +
Sbjct  208   SPAPAGRRISGRHSTGSVRAPGRVGPSSRRSADGGVAVGCFDSAKVRKDRVLLVEPAAVV  267

Query  660   QKP-----LHHLNHRIIVSDV---------VLKNRWSSVSSSDLIALNSELI  547
              +P          HRI+VS             + RWS +  SDL+ + SE +
Sbjct  268   AEPDPEAFDRRFGHRILVSTAGGCEGETAPAAQQRWSDLRPSDLMFVRSEFL  319



>ref|XP_008645000.1| PREDICTED: RING-H2 finger protein ATL43 [Zea mays]
 gb|AFW69273.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=397

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 10/146 (7%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW--------  1063
                F+P + VV+GIL  +FS+TF LLLYAK C R++  ++         G +        
Sbjct  28    ATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGSAGSGGGFGSSGNGAG  87

Query  1062  --RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHC  889
               RR+SG+D+ VVESLP FRF +L+G +EGLEC+VCL RFE  E LRLLPKC+H FH+ C
Sbjct  88    GDRRNSGVDRAVVESLPVFRFGALRGQKEGLECAVCLGRFEPTEALRLLPKCRHGFHVEC  147

Query  888   IDQWLEKHSSCPLCRHKVTAEDLSLM  811
             +D WL+ HS+CPLCR +V  ED+ L+
Sbjct  148   VDTWLDAHSTCPLCRSRVDPEDVLLL  173



>gb|EAZ02219.1| hypothetical protein OsI_24313 [Oryza sativa Indica Group]
Length=399

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 95/143 (66%), Gaps = 7/143 (5%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-------LQIPDALLGSWR  1060
                F+P + VV+GIL  +FS+TF LLLYAK C R++  ++                   R
Sbjct  28    ATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGSGGAFGSSGGGGAGER  87

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R+SG+D+ VVESLP FRF +L+G + GLEC+VCL RFE  E LRLLPKC+H FH+ C+D 
Sbjct  88    RNSGVDRAVVESLPVFRFGALRGQKAGLECAVCLGRFEPTEALRLLPKCRHGFHVECVDT  147

Query  879   WLEKHSSCPLCRHKVTAEDLSLM  811
             WL+ HS+CPLCR +V  ED+ L+
Sbjct  148   WLDAHSTCPLCRSRVDPEDVLLL  170



>ref|XP_009122181.1| PREDICTED: RING-H2 finger protein ATL43 [Brassica rapa]
Length=404

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 144/289 (50%), Gaps = 69/289 (24%)
 Frame = -1

Query  1215  NTFQPSLVVVIGILAIMFSLTFFLLLYAKFC-HRASILNTTLQIPDA---------LLGS  1066
             ++F P + VVI +L ++FSLT  LLL  K C  R   +N T +   +           G 
Sbjct  56    SSFMPRIAVVIAVLTVVFSLTCLLLLSVKHCKRRNGSVNDTQRFATSRYYGGGGSGGGGV  115

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R++SGID++V+ESLP FRF +L G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+
Sbjct  116   GRKNSGIDRSVIESLPVFRFGALSGHKEGLECAVCLARFEPTEVLRLLPKCKHAFHVECV  175

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMN------------------------FSSSLRFLCS  778
             D WL+ HS+CPLCR++V  ED+ L++                         S+   F+  
Sbjct  176   DTWLDAHSTCPLCRYRVDPEDILLISDCNSWFELRLSNNRREESNNNNNTGSTRFDFVSR  235

Query  777   DSREESSLGLY------IQRQESFK--------------------------FGSRKIKKD  694
              S   SS G        +++  SF+                          F   + +KD
Sbjct  236   ISGRHSSAGERASRLNDVRKLSSFRRSLDSSLRINDGEEEKTDSVAVAVGCFDRNQQRKD  295

Query  693   EKLPIQNDQSLQKPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELI  547
               L   N +S +       HRII+S      RWS V  +DL+ L SE+I
Sbjct  296   GLLLNSNRESFEA---RFEHRIIISGGNRDQRWSEVRPADLLYLRSEMI  341



>ref|XP_004501635.1| PREDICTED: RING-H2 finger protein ATL43-like [Cicer arietinum]
Length=399

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = -1

Query  1251  STIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI-----LNTTLQI  1087
             +T IP  Q    +TF+PS+ +VI +L + FS TF LLLY K     +      ++++   
Sbjct  49    ATSIPQQQHT-FSTFKPSVAIVISVLTVTFSFTFLLLLYIKHFSTTTTSEPINIDSSSST  107

Query  1086  PDAL--LGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
                +  L + R++SGI+++VVESLP FRF SL G ++GL+C+VCLS+FE  EILRLLPKC
Sbjct  108   AAGISSLTAGRKNSGINRSVVESLPIFRFGSLLGQKDGLDCAVCLSKFESSEILRLLPKC  167

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             KHAFH+ C+D WLE HS+CPLCR++V  ED+ L+
Sbjct  168   KHAFHVECVDTWLEAHSTCPLCRYRVDPEDILLV  201



>gb|KFK25007.1| hypothetical protein AALP_AA8G054400 [Arabis alpina]
Length=389

 Score =   159 bits (401),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 140/277 (51%), Gaps = 55/277 (20%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS---ILNTTLQIP----------DA  1078
             T++F P + VVI +L  +FSLTF LLLY K     +    +N T +              
Sbjct  48    TSSFMPGIAVVIAVLTAIFSLTFLLLLYVKHYKTRNDNVYVNQTQRFAVSRYGGGYNGGG  107

Query  1077  LLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
                  R++SGID++V+ESLP FRFS+L G ++G EC+VCLSRFE  E+LRLLPKCKHAFH
Sbjct  108   TGTGGRKNSGIDRSVIESLPVFRFSALSGHKDGFECAVCLSRFEQTEVLRLLPKCKHAFH  167

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSLM-------------------NFSSSLRFL--C  781
             + C+D WL+ HS+CPLCR++V  ED+ L+                   N S+S RF+   
Sbjct  168   VECVDTWLDAHSTCPLCRYRVDPEDILLISDCHSWFELRFSNNRHSNSNDSNSTRFIPVS  227

Query  780   SDSREESSLGLYIQR----QESFKFGSRKIKKDEK---------------LPIQNDQSLQ  658
               S   S  G    R      SF+       K E                L I   +S +
Sbjct  228   RISGRHSYAGEKTSRFSSNPTSFRRSLDSYLKSETTTVSDDSDDRRKDGLLLIPKIESFE  287

Query  657   KPLHHLNHRIIVSDVVLKNRWSSVSSSDLIALNSELI  547
             +      HRII+S      RWS V  SDL+ L SE+I
Sbjct  288   EG--RFEHRIIISGGNRDQRWSEVRPSDLLYLRSEMI  322



>emb|CDX98867.1| BnaC09g49680D [Brassica napus]
Length=353

 Score =   157 bits (398),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (70%), Gaps = 10/142 (7%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFC-HRASILNTTLQIPDA---------LLGSWRRS  1054
             P + VVI +L  +FSLTF +LLY K C  R   +N T +   +           G  R++
Sbjct  2     PGIAVVIAVLTAVFSLTFLILLYVKHCKRRNGYVNDTQRFATSRYYGGGGYGGGGVGRKT  61

Query  1053  SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWL  874
             SGID++V+ESLP FRF +L G +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL
Sbjct  62    SGIDRSVIESLPVFRFGALSGHKEGLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWL  121

Query  873   EKHSSCPLCRHKVTAEDLSLMN  808
             + HS+CPLCR++V  ED+ L++
Sbjct  122   DAHSTCPLCRYRVDPEDILLIS  143



>ref|NP_001058454.2| Os06g0695900 [Oryza sativa Japonica Group]
 gb|EEE66282.1| hypothetical protein OsJ_22489 [Oryza sativa Japonica Group]
 dbj|BAF20368.2| Os06g0695900 [Oryza sativa Japonica Group]
Length=398

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-------LQIPDALLGSWR  1060
                F+P + VV+GIL  +FS+TF LLLYAK C R +  ++                   R
Sbjct  28    ATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRNAAESSGPYGSGGAFGSSGGGGAGER  87

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R+SG+D+ VVESLP FRF +L+G + GLEC+VCL RFE  E LRLLPKC+H FH+ C+D 
Sbjct  88    RNSGVDRAVVESLPVFRFGALRGQKAGLECAVCLGRFEPTEALRLLPKCRHGFHVECVDT  147

Query  879   WLEKHSSCPLCRHKVTAEDLSLM  811
             WL+ HS+CPLCR +V  ED+ L+
Sbjct  148   WLDAHSTCPLCRSRVDPEDVLLL  170



>dbj|BAJ97088.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI----LNTTLQIPDALLGSWRRSSGID  1042
             F+P + VV+GIL  +FS+TF LLLYAK C R++        +           RR+SG++
Sbjct  82    FKPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGSGGGSGGGAAGERRNSGVE  141

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             + VVESLP FRF +L+G + GLEC+VCL RFE  E LRLLPKC+H FH+ C+D WL+ HS
Sbjct  142   RAVVESLPVFRFGALRGQKAGLECAVCLGRFESTEALRLLPKCRHGFHVECVDTWLDAHS  201

Query  861   SCPLCRHKVTAEDLSLM  811
             +CPLCR +V  ED+ L+
Sbjct  202   TCPLCRSRVDPEDVLLL  218



>gb|ADK92879.1| ring H2 finger protein [Hypericum perforatum]
Length=485

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 99/141 (70%), Gaps = 4/141 (3%)
 Frame = -1

Query  1221  DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCH---RASILNTTLQIPDALLGSWRRSS  1051
             + +  +P + VV+ +L  +FS+TF L+LYA+ C         ++      A L + R++S
Sbjct  68    EASPVRPGVAVVVAVLTCIFSITFLLVLYARHCKVGVTGGGTSSAGMTSAATLATGRKNS  127

Query  1050  GIDKTVVESLPFFRFSSLKG-SREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWL  874
             GID+ VVESLP FRF SL G  +EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL
Sbjct  128   GIDRAVVESLPVFRFGSLSGRQKEGLECAVCLNRFEGSEVLRLLPKCKHAFHVECVDTWL  187

Query  873   EKHSSCPLCRHKVTAEDLSLM  811
             + HS+CPLCR++V  ED+ L+
Sbjct  188   DGHSTCPLCRYRVDPEDVLLV  208



>dbj|BAD53905.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD54441.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
Length=425

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT-------LQIPDALLGSWR  1060
                F+P + VV+GIL  +FS+TF LLLYAK C R +  ++                   R
Sbjct  55    ATPFRPGVAVVVGILTSVFSITFLLLLYAKHCKRNAAESSGPYGSGGAFGSSGGGGAGER  114

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             R+SG+D+ VVESLP FRF +L+G + GLEC+VCL RFE  E LRLLPKC+H FH+ C+D 
Sbjct  115   RNSGVDRAVVESLPVFRFGALRGQKAGLECAVCLGRFEPTEALRLLPKCRHGFHVECVDT  174

Query  879   WLEKHSSCPLCRHKVTAEDLSLM  811
             WL+ HS+CPLCR +V  ED+ L+
Sbjct  175   WLDAHSTCPLCRSRVDPEDVLLL  197



>ref|XP_009405737.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 109/167 (65%), Gaps = 4/167 (2%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDK  1039
             T +F PSL +V+GI  +MFS+TF LL+Y KFC R +++   L   D  L    R SGI+K
Sbjct  61    TFSFWPSLAMVVGIFTVMFSVTFLLLVYVKFC-RFTVVE--LSRNDGFLLPQCRFSGINK  117

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
               VESL  F FS L+ + +GLEC VCL RF+  E+LRLLP+CKHAFHI CID+WL  HS+
Sbjct  118   AAVESLLVFWFSGLRDAWDGLECIVCLFRFDGAELLRLLPRCKHAFHIDCIDRWLAAHST  177

Query  858   CPLCRHKVTAE-DLSLMNFSSSLRFLCSDSREESSLGLYIQRQESFK  721
             CP CR KV AE D ++  + +S RFL +  R E ++    +   SF+
Sbjct  178   CPPCRRKVNAEDDNAVFEYFTSSRFLFASCRHEEAVNYVDRVGRSFR  224



>ref|XP_010558086.1| PREDICTED: RING-H2 finger protein ATL43-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558087.1| PREDICTED: RING-H2 finger protein ATL43-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010558088.1| PREDICTED: RING-H2 finger protein ATL43-like isoform X3 [Tarenaya 
hassleriana]
Length=411

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 100/137 (73%), Gaps = 8/137 (6%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFC-HR--ASILNTTLQIPDALLGSWRRSSGIDK  1039
              +PS+ V++G+L  +FS+TF LLLY K C HR  A  +    +  D      R++SGI++
Sbjct  50    LKPSIAVLVGLLTTVFSVTFLLLLYVKHCKHRNGAVYVQHNHRRFDG-----RKNSGIER  104

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
             TV+ESLP FRF +L G +EGLEC+VCL+RFE  E+LRLLPKC+HAFH+ C+D WL+ HS+
Sbjct  105   TVIESLPVFRFGALTGDKEGLECAVCLARFEPTEVLRLLPKCQHAFHVECVDTWLDAHST  164

Query  858   CPLCRHKVTAEDLSLMN  808
             CPLCR++V  ED+ L+ 
Sbjct  165   CPLCRYRVDPEDILLIG  181



>ref|XP_010688440.1| PREDICTED: RING-H2 finger protein ATL43 [Beta vulgaris subsp. 
vulgaris]
Length=382

 Score =   156 bits (394),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRR  1057
             N   P  + F+PS+ VV+  +  +FS+TF +L+Y+K C +    N         +G  R+
Sbjct  31    NQPPPYFSPFKPSIAVVVAAVTTLFSVTFLILMYSKHCKQRPGSNAASG--SYFVGPDRK  88

Query  1056  SSGIDKTVVESLPFFRFSSLKGSR--EGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             +SGID  V+ESLP FRF SL G +  +GLEC+VCL+RFE  EILRLLPKCKHAFH+ C+D
Sbjct  89    NSGIDPIVIESLPVFRFGSLLGEKKKDGLECAVCLNRFEPAEILRLLPKCKHAFHVECVD  148

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMN  808
              WL+ HS+CPLCR +V  ED+ L++
Sbjct  149   TWLDAHSTCPLCRFRVEPEDVLLID  173



>ref|XP_002871181.1| hypothetical protein ARALYDRAFT_908496 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47440.1| hypothetical protein ARALYDRAFT_908496 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 106/166 (64%), Gaps = 22/166 (13%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS--------------  1066
             P + VVI +L   FS+TF LLLY K C R S     +  P     S              
Sbjct  2     PGIAVVIAVLTAFFSITFLLLLYVKHCKRRS-GTVYVNHPQRFAISRYGGGYYNGGGVGG  60

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
              R++SGID++V+ESLP FRF +L G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+
Sbjct  61    GRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPAEVLRLLPKCKHAFHVECV  120

Query  885   DQWLEKHSSCPLCRHKVTAEDLSLMNFSSS---LRFLCSDSREESS  757
             D WL+ HS+CPLCR++V  ED+ L+   +S   LRF    S+EES+
Sbjct  121   DTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELRF----SKEESN  162



>gb|ABK24933.1| unknown [Picea sitchensis]
Length=412

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 136/409 (33%), Positives = 192/409 (47%), Gaps = 95/409 (23%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSPDTN------TFQPSLVVVIGILAIMFSLTFFLLLYAKFC----HRA  1114
             AQ  ST   + Q           +F  S+ V I +L  MF+LTF LLLYAK C    +R 
Sbjct  23    AQSNSTAWTDGQGDGVQGPALAMSFHSSIAVTIVVLTTMFTLTFLLLLYAKHCKIVGNRG  82

Query  1113  SILNTTLQIPDALLGS--WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDI  940
                    +   AL  +   R+ SG++++V+++LP F+F+SL+G +EGLEC+VCLSRFE  
Sbjct  83    GAHGNPNRTRPALSAANLARKDSGVERSVIDALPVFKFASLQGLKEGLECAVCLSRFEGA  142

Query  939   EILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM-----NFSSSLRFLCSD  775
             E+LRLLPKC+HAFH+ C+D WLE HS+CPLCRH+V A+D+ ++     N   +      D
Sbjct  143   EVLRLLPKCRHAFHVDCVDTWLESHSTCPLCRHRVEAQDVLMVYRHDENVEEAKGL---D  199

Query  774   SREESSLGLYIQR-----------------QESFK-----------------FGSRKIKK  697
              R    L +++QR                 + SF+                 FGS    +
Sbjct  200   DRAPQLLQVFVQRENVENAGAEPESSGFIVENSFRQTSASARLSEAAGSIGCFGS---GR  256

Query  696   DEKLPIQNDQSLQKPLH---HLNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsss  526
              E L +       K L       HRI+VSDV+ ++RWS    SDL+ L+S++I       
Sbjct  257   KEGLLLSEADEDSKQLQFDRRFAHRIVVSDVMSQHRWSDRKPSDLLFLSSQMI-------  309

Query  525   ssslanpefsssFGSKHPHDEIQSMSIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNL  346
                        +F    P DE+++ S     E KR             P   + AE    
Sbjct  310   ----TTESGRMAFADVKPTDEMETKS-SSRAETKR-------------PGEHSSAEI---  348

Query  345   SQKEKRSMSEIV----VHPRFRNGNVQDYCDVVSDERRRKLWLPIARRT  211
                +KRSMSEI+      PR RN N         D   +K W  IA +T
Sbjct  349   --DKKRSMSEIIGFSRFQPRSRNNNTVLPVTRSEDGDEQK-WFSIAGKT  394



>ref|XP_010107048.1| RING-H2 finger protein ATL43 [Morus notabilis]
 gb|EXC13479.1| RING-H2 finger protein ATL43 [Morus notabilis]
Length=425

 Score =   153 bits (387),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (60%), Gaps = 23/197 (12%)
 Frame = -1

Query  1257  HPST----IIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFC-------HRAS  1111
             HPS+    ++     P  + F+PS+ V++GIL  +FS+TF LL+YAK C       H+  
Sbjct  21    HPSSAQNDVVSPTPPPHFSPFRPSIAVIVGILTTVFSVTFLLLIYAKHCKPYNHHHHQNH  80

Query  1110  ILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSRE-GLECSVCLSRFEDIEI  934
               NTT     +L    R++SGID++VVESLP FRF SL+  R   L+C+VCL RFE+ E+
Sbjct  81    DTNTTPFSSSSL----RKNSGIDRSVVESLPVFRFGSLRRHRHRHLDCAVCLCRFENSEV  136

Query  933   LRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSSLRFLCSDSREESSL  754
             LRLLPKC HAFH+ C+D WL+ HS+CPLCR +V  ED+ L    S+      D+  E   
Sbjct  137   LRLLPKCNHAFHVECVDTWLDAHSTCPLCRFRVDPEDVLLTTPFSNPNTHMDDAVPEDV-  195

Query  753   GLYIQRQESFKFGSRKI  703
                   +  F F SR++
Sbjct  196   ------ETGFAFSSRRV  206



>ref|XP_006657288.1| PREDICTED: RING-H2 finger protein ATL43-like [Oryza brachyantha]
Length=344

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI---LNTTLQIPDALLGSWRRSSGIDK  1039
             F+P + VV+GIL  +FS+TF LLLYAK C R++                   RR+SG+D+
Sbjct  33    FRPGVAVVVGILTSVFSITFLLLLYAKHCKRSAAESSGPYGGGGASGGAAGERRNSGVDR  92

Query  1038  TVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSS  859
              VVESLP FRF +L+G + GLEC+VCL RFE  E   LLPKC+H FH+ C+D WL+ HS+
Sbjct  93    AVVESLPVFRFGALRGQKAGLECAVCLGRFEPTE--GLLPKCRHGFHVECVDTWLDAHST  150

Query  858   CPLCRHKVTAEDLSLM  811
             CPLCR +V  ED+ L+
Sbjct  151   CPLCRSRVDPEDVLLL  166



>ref|XP_010491126.1| PREDICTED: RING-H2 finger protein ATL43-like [Camelina sativa]
Length=405

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 112/314 (36%), Positives = 154/314 (49%), Gaps = 78/314 (25%)
 Frame = -1

Query  1260  QHPSTIIPNDQSPD---------TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR---  1117
              H + +I N  +P          T++F P + VVI +L   FSLTF LLLY K C R   
Sbjct  28    NHTAVVITNSNTPSPLPPPRHNLTSSFMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRND  87

Query  1116  -------------ASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGL  976
                          +    +       +LG  R++SGID++V+ESLP FRF +L G ++GL
Sbjct  88    GFYGNHHQQRFAVSRYGGSGYYAGGVVLG--RKNSGIDRSVIESLPVFRFGALSGQKDGL  145

Query  975   ECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSS  796
             EC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL+ HS+CPLCR++V  ED+ L+   +S
Sbjct  146   ECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNS  205

Query  795   ---LRFLCSDSREES-SLGL-----YIQR-------------------------------  736
                LRF  +  +EES S GL      I R                               
Sbjct  206   WFELRFSTNRQQEESNSTGLTRFIPVISRISGRHSSAGERASRRLNEIRALKTNPTPFRR  265

Query  735   --QESFKFGSRKIKKDEKLPIQNDQSLQKP--------LHHLNHRIIVSDVVLKN-RWSS  589
                 S K  +   +K E + ++    LQ+              HRII+S     + RWS 
Sbjct  266   SLDSSLKVNNSGEEKSETVAVKCLDRLQRKDGLLLVPNQERFEHRIIISGGNRDDQRWSE  325

Query  588   VSSSDLIALNSELI  547
             V  SDL+ L SE+I
Sbjct  326   VRPSDLLYLRSEMI  339



>ref|XP_006338154.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like isoform X2 
[Solanum tuberosum]
Length=267

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 131/209 (63%), Gaps = 40/209 (19%)
 Frame = -1

Query  795  LRFLCSDSRE-----ESSLGLYIQRQESFKFGSRKIKKDEKLPIQNDQSLQKPLHHLNHR  631
            LRFL S S E     ES+L +YI+R+E+   G+      E+LPIQ     +K LH  NHR
Sbjct  84   LRFLWSQSEELVRDDESNLEIYIEREEN---GT------EELPIQ-----EKELHRFNHR  129

Query  630  IIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDEIQSM  451
            IIVSDVV KNRWS+V+SSDLI LNSE++    S+  SS+      S+       +E QS+
Sbjct  130  IIVSDVVFKNRWSNVTSSDLIFLNSEMLNGMTSNRFSSMDRNAEQSTVI-----EEEQSI  184

Query  450  SIKEEMERKRLFEIKVNKNNPSFPIPTTYAETKNLSQKEKRSMSEIVVHPRFRNGNVQDY  271
            +IK+EMERKRLF+ K+ K             +K L   EKRSMSEI+++ RF N N +  
Sbjct  185  NIKDEMERKRLFDSKLIK-------------SKCLVADEKRSMSEIILYSRFNNRNRELS  231

Query  270  CDVVSDERRRKLWLPIARRTVQWFAKRER  184
               V DERRRKLWLPIARRTV+WFA RER
Sbjct  232  ---VRDERRRKLWLPIARRTVKWFANRER  257


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 5/55 (9%)
 Frame = -1

Query  1272  NVKAQHPSTIIPNDQSPDT-NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS  1111
             NVKA+     +P   S D  ++FQPSL VVIG+L IMFSLTFFLLLYAKFCH AS
Sbjct  14    NVKAED----LPTSSSQDVVSSFQPSLAVVIGVLFIMFSLTFFLLLYAKFCHTAS  64



>ref|XP_010452489.1| PREDICTED: RING-H2 finger protein ATL43-like [Camelina sativa]
Length=405

 Score =   148 bits (374),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 149/294 (51%), Gaps = 72/294 (24%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR---------------ASILNTTLQIP  1084
             T++F P + VVI +L   FSLTF LLLY K C R               +    +     
Sbjct  51    TSSFMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNDGVYSNHQQRFAVSRYGGSGYYAG  110

Query  1083  DALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHA  904
               +LG  R++SGID++V+ESLP FRF +L G ++GLEC+VCL+RFE  E+LRLLPKCKHA
Sbjct  111   GVVLG--RKNSGIDRSVIESLPVFRFGALSGQKDGLECAVCLARFEPTEVLRLLPKCKHA  168

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSS---LRFLCSDSREES-SLGL----  748
             FH+ C+D WL+ HS+CPLCR++V  ED+ L+   +S   LRF  +  +EES S GL    
Sbjct  169   FHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELRFSTNRQQEESNSTGLTRFI  228

Query  747   -YIQR-----QESFKFGSRKIKK-------------------DEKLPIQNDQSLQKPLHH  643
               I R       + +  SR++ +                   D  L + N    +     
Sbjct  229   PVISRISGRHSSAGERASRRLNEIRASSTSSKAKPAPFRRSLDSSLKVNNSGEEKSETVS  288

Query  642   LN---------------------HRIIVSDVVLKN-RWSSVSSSDLIALNSELI  547
             LN                     HRII+S     + RWS V  SDL+ L SE+I
Sbjct  289   LNCLDRSQRKDGLLLVPNQERFEHRIIISGGNRDDQRWSEVRPSDLLYLRSEMI  342



>ref|XP_006287867.1| hypothetical protein CARUB_v10001094mg [Capsella rubella]
 gb|EOA20765.1| hypothetical protein CARUB_v10001094mg [Capsella rubella]
Length=407

 Score =   148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 145/297 (49%), Gaps = 80/297 (27%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR------------------ASILNTTL  1093
             T++F P + VVI +L   FSLTF LLLY K C R                          
Sbjct  53    TSSFMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGGVYVNHHQRFAISRYGGGGYGYY  112

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKC  913
                  +LG  R++SGID++V+ESLP FRF +L G ++GLEC+VCL+RFE  E+LRLLPKC
Sbjct  113   GGGGVVLG--RKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKC  170

Query  912   KHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSS---LRFLCSDSREE-------  763
             KHAFH+ C+D WL+ HS+CPLCR++V  ED+ L+   +S   LRF  S+ +EE       
Sbjct  171   KHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELRF--SNRQEESNSTGLT  228

Query  762   ------------SSLGLYIQRQESFKFGS-------------------------------  712
                         SS G    R    K  S                               
Sbjct  229   RFVPVTRISGRHSSAGERASRLNEIKASSSSKTNPTSFRRSLDSSLKVNTGEEKSEPVAV  288

Query  711   -RKIKKDEKLPIQNDQSLQKPLHHLNHRIIVSDVVLKN-RWSSVSSSDLIALNSELI  547
              R  +KD  L I N +SL+       HRII+S     + RWS V  SDL+ L SE+I
Sbjct  289   DRVQRKDGLLLIPNRESLEG---RFEHRIIISGGNRDDQRWSEVRPSDLLYLRSEMI  342



>ref|XP_003615295.1| RING zinc finger protein-like protein [Medicago truncatula]
 gb|AES98253.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=433

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG-SWR  1060
             ND+   ++ F+PS  V++G+L   F L   LLLYA+ C+RA +   +   P+       R
Sbjct  71    NDRERSSDAFKPSTAVIVGVLTTTFFLVLLLLLYARHCNRADMPVASNPNPNGESNLHKR  130

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQ  880
             ++SGI++ VVESLP F+F SL G + GLEC+VCL+ FED ++LRLLPKCKHAFH+ C+D 
Sbjct  131   KNSGIERAVVESLPVFKFGSLSGKKNGLECAVCLNGFEDPDVLRLLPKCKHAFHMECVDM  190

Query  879   WLEKHSSCPLCRHKVTAEDLSL  814
             WL++HSSCPLCR+KV  +D+ L
Sbjct  191   WLDEHSSCPLCRYKVNPDDIVL  212



>ref|XP_010423421.1| PREDICTED: RING-H2 finger protein ATL43-like [Camelina sativa]
Length=404

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 113/175 (65%), Gaps = 20/175 (11%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR--------------ASILNTTLQIPD  1081
             T++F P + VVI +L   FSLTF LLLY K C R               S          
Sbjct  47    TSSFMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNDGVYSNHQQRFAVSRYGGGYYAGG  106

Query  1080  ALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAF  901
              +LG  R++SGID++V+ESLP FRF +L G ++GLEC+VCL+RFE  E+LRLLPKCKHAF
Sbjct  107   VVLG--RKNSGIDRSVIESLPVFRFGALSGQKDGLECAVCLARFEPTEVLRLLPKCKHAF  164

Query  900   HIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSS---LRFLCSDSREES-SLGL  748
             H+ C+D WL+ HS+CPLCR++V  ED+ L++  +S   LRF  +  +EES S GL
Sbjct  165   HVECVDTWLDAHSTCPLCRYRVDPEDILLISDCNSWFELRFSTNRQQEESNSTGL  219



>ref|XP_003602920.1| RING zinc finger protein-like protein [Medicago truncatula]
Length=402

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 18/166 (11%)
 Frame = -1

Query  1254  PSTIIPND-----QSPDTNT---FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNT  1099
             P T IP D     QS   +T   F+PS+ +VIG+  I+FSLTF LLLY K  + ++    
Sbjct  35    PPTPIPEDATTIAQSQPQHTVTPFKPSVAIVIGVFTILFSLTFLLLLYIKHINNSNTTGE  94

Query  1098  TLQIPDALLGSW----------RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRF  949
             T+ I  +               R++SGID++VVESLP FRF SL G +EGL+C+VCLS+F
Sbjct  95    TINIDSSSFVGSGGGVSSFAGGRKNSGIDRSVVESLPIFRFGSLTGQKEGLDCAVCLSKF  154

Query  948   EDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             E  E+LRLLPKCKHAFH+ C+D WL+ HS+CPLCR++V  ED+ L+
Sbjct  155   ESSEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLV  200



>gb|AES73171.2| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=411

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 18/166 (11%)
 Frame = -1

Query  1254  PSTIIPND-----QSPDTNT---FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNT  1099
             P T IP D     QS   +T   F+PS+ +VIG+  I+FSLTF LLLY K  + ++    
Sbjct  44    PPTPIPEDATTIAQSQPQHTVTPFKPSVAIVIGVFTILFSLTFLLLLYIKHINNSNTTGE  103

Query  1098  TLQIPDALLGSW----------RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRF  949
             T+ I  +               R++SGID++VVESLP FRF SL G +EGL+C+VCLS+F
Sbjct  104   TINIDSSSFVGSGGGVSSFAGGRKNSGIDRSVVESLPIFRFGSLTGQKEGLDCAVCLSKF  163

Query  948   EDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             E  E+LRLLPKCKHAFH+ C+D WL+ HS+CPLCR++V  ED+ L+
Sbjct  164   ESSEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLV  209



>gb|EYU37302.1| hypothetical protein MIMGU_mgv1a009321mg [Erythranthe guttata]
Length=345

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = -1

Query  1158  LTFFLLLYAKFCHRASIL--NTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSR  985
             +TF LLLY K C R+      +            RR+SGI++ V+ESLP FRFSSL+G +
Sbjct  1     MTFLLLLYVKHCKRSGYAADGSASYGGGGGHRLSRRNSGINRKVIESLPLFRFSSLRGQK  60

Query  984   EGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             EGLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D WL++HS+CPLCR++V  ED+ L+
Sbjct  61    EGLECAVCLNRFEAEEVLRLLPKCKHAFHVECVDTWLDEHSTCPLCRYRVDPEDILLV  118



>ref|XP_007137653.1| hypothetical protein PHAVU_009G144600g [Phaseolus vulgaris]
 gb|ESW09647.1| hypothetical protein PHAVU_009G144600g [Phaseolus vulgaris]
Length=446

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/284 (35%), Positives = 147/284 (52%), Gaps = 63/284 (22%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ---IPDALLG-SWRRSSGID  1042
             F+P + VV+ +L  + SLT  LLLY K C+  +I         IP  +   + R++SGID
Sbjct  54    FRPGIAVVVCVLTTIISLTSLLLLYIKHCNGGAIHGGGSGGSSIPWTVSPFAGRKNSGID  113

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             ++VVESLP FRF +L+G +EGL+C+VCL++FE  E+LRLLPKCKHAFH+ C+D WL+ HS
Sbjct  114   RSVVESLPVFRFGALRGQKEGLDCAVCLTKFEAAEVLRLLPKCKHAFHVECVDTWLDAHS  173

Query  861   SCPLCRHKVTAEDLSLMNFSSSLRFLC------SDSREESSLGLYIQRQESFKFGSR---  709
             +CPLCR++V  ED+ L+  + + R         +++ E   L L +++QE  + G R   
Sbjct  174   TCPLCRYRVDPEDILLVEDAKAFRQSQQQRNSHNNNEERVRLNLDVEKQEIVECGRRHSS  233

Query  708   -------------------------KIKKDEKLPI--------------------QNDQS  664
                                        KK+E + +                    + +  
Sbjct  234   VGERGTEEQSRRWTSSFRRSLDSATSKKKNESVGVVGIGWFVRGRKDGMLLTQETEREGD  293

Query  663   LQKPLHHLNHRIIVSDV-----VLKNRWSSVSSSDLIALNSELI  547
                    L HRIIVS        ++ RWS V +SDL+ L SE+I
Sbjct  294   RTSVERRLEHRIIVSPGPGKMNGVQQRWSDVQASDLLYLTSEMI  337



>ref|XP_003523773.1| PREDICTED: RING-H2 finger protein ATL43-like [Glycine max]
Length=336

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 141/287 (49%), Gaps = 66/287 (23%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLG--SWRRSSGIDKT  1036
             F+P + V++ +L  + SLT  LLLY K C+               +   S R++SGID++
Sbjct  37    FRPGIAVLVCVLTTIISLTSLLLLYIKHCNGGIPDGGGGNSAPWTVAPFSGRKNSGIDRS  96

Query  1035  VVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSC  856
             VVESLP FRF +L+G +EGL+C+VCL++FE  E+LRLLPKCKHAFH+ C+D WL+ HS+C
Sbjct  97    VVESLPVFRFGALRGQKEGLDCAVCLNKFEAAEVLRLLPKCKHAFHVECVDTWLDAHSTC  156

Query  855   PLCRHKVTAEDLSLMNFSSSLRFLCSDSR----EESSLGLYIQRQE---------SFKFG  715
             PLCR++V  ED+ L+  +   R      R    E   L L +++QE         S   G
Sbjct  157   PLCRYRVDPEDILLVEDAKPFRQSHQQQRNKEEERVRLNLDLEKQEIVESRRRHSSVGVG  216

Query  714   SRKIKKDEKLPIQNDQSLQKPL--------------------------------------  649
               +  ++++   +   S ++ L                                      
Sbjct  217   EGETTEEQQQSRRWTTSFRRSLDSISATSRKKNESVGVGCFVRPRKDGMLLTQETERASV  276

Query  648   -HHLNHRIIVSDVV------------LKNRWSSVSSSDLIALNSELI  547
                L HRIIVS               L+ RWS + +SDL+ L SE+I
Sbjct  277   ERRLEHRIIVSPGQGPGPGPGPGPCGLEQRWSDLQASDLLYLTSEMI  323



>sp|Q5EAE9.2|ATL43_ARATH RecName: Full=RING-H2 finger protein ATL43; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09675.1| unnamed protein product [Arabidopsis thaliana]
Length=407

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 96/150 (64%), Gaps = 13/150 (9%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-------------ASILNTTLQIPDA  1078
             T++  P + VVI +L   FSLTF LLLY K C R             A            
Sbjct  51    TSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGGGYYNGG  110

Query  1077  LLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
              +   R++SGID++V+ESLP FRF +L G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH
Sbjct  111   GVVGGRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCKHAFH  170

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSLMN  808
             + C+D WL+ HS+CPLCR++V  ED+ L+ 
Sbjct  171   VECVDTWLDAHSTCPLCRYRVDPEDILLIG  200



>ref|XP_004301413.1| PREDICTED: RING-H2 finger protein ATL43-like [Fragaria vesca 
subsp. vesca]
Length=416

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             R++SGID+TVVESLP FRF SL+G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D
Sbjct  48    RKNSGIDRTVVESLPVFRFGSLRGHKDGLECAVCLTRFEPTEVLRLLPKCKHAFHVECVD  107

Query  882   QWLEKHSSCPLCRHKVTAEDLSLM  811
              WL+ HS+CPLCR++V  ED+ L+
Sbjct  108   TWLDAHSTCPLCRYRVDPEDILLI  131



>ref|NP_196200.2| RING-H2 finger protein ATL43 [Arabidopsis thaliana]
 gb|AAW81728.1| At5g05810 [Arabidopsis thaliana]
 gb|AAX49381.1| At5g05810 [Arabidopsis thaliana]
 gb|AED90928.1| RING-H2 finger protein ATL43 [Arabidopsis thaliana]
Length=353

 Score =   135 bits (339),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHR-------------ASILNTTLQIPDALLGSW  1063
             P + VVI +L   FSLTF LLLY K C R             A             +   
Sbjct  2     PGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGGGYYNGGGVVGG  61

Query  1062  RRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
             R++SGID++V+ESLP FRF +L G ++GLEC+VCL+RFE  E+LRLLPKCKHAFH+ C+D
Sbjct  62    RKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCKHAFHVECVD  121

Query  882   QWLEKHSSCPLCRHKVTAEDLSLMN  808
              WL+ HS+CPLCR++V  ED+ L+ 
Sbjct  122   TWLDAHSTCPLCRYRVDPEDILLIG  146



>gb|EPS66471.1| hypothetical protein M569_08311, partial [Genlisea aurea]
Length=182

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -1

Query  1158  LTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREG  979
             L F  +LY K+C   +++       +      +R SG+D+ VVESLP FRFS++   R  
Sbjct  1     LIFTFVLYTKYCSSITVIPPPSSSANNRFHQLKRKSGVDRRVVESLPLFRFSAVAWRRTA  60

Query  978   LECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSL  814
             +EC+VCL RF   E+LRLLPKCKHAFH+ C+D WL++HS+CPLCR++V  ED+ L
Sbjct  61    VECAVCLCRFRGEELLRLLPKCKHAFHVECVDTWLDEHSTCPLCRYRVDPEDVLL  115



>emb|CDY05713.1| BnaC07g00900D [Brassica napus]
Length=147

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 91/137 (66%), Gaps = 19/137 (14%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             V AQ P    P       + F+PSLV+  GI + +F+LTF LL+YAK C    + + T +
Sbjct  18    VSAQSP----PPPPYTTNDLFKPSLVITTGIFSAVFTLTFVLLVYAK-CFHNDLRSETDE  72

Query  1089  IPDALLG------------SWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFE  946
               D  +G            S R SSG+++T +ESLPFFRFS+LKGS++GLECSVCLS+FE
Sbjct  73    --DREIGRLERLWQGLFNQSSRLSSGLNRTAIESLPFFRFSALKGSKQGLECSVCLSKFE  130

Query  945   DIEILRLLPKCKHAFHI  895
             D+EILRLLPKCKHAFHI
Sbjct  131   DVEILRLLPKCKHAFHI  147



>ref|XP_007047832.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX91989.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=354

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             V A  P+     D     + F PS+ +V+ +L   F    FL +Y + C+ ++ + T   
Sbjct  17    VAAAQPTAPPRGDSYGLYSHFDPSMAIVVMVLVCAFFFVGFLSIYIRQCNESNAIATPSA  76

Query  1089  IPDALLGSWRRSSGIDKTVVESLPFFRFS---SLKGSREGLECSVCLSRFEDIEILRLLP  919
             +  A  G   R  G+D  V+ES P F +S    LK  +  LEC+VCLS FED E LRL+P
Sbjct  77    VAAASSGERSRRKGLDSAVIESFPVFIYSCVKDLKMGKGALECAVCLSEFEDDEALRLIP  136

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAE-DLSLMNFSSSLRFLCSDSREESS  757
             KC H FH  CID WLE H +CP+CR K+T + D   +  SS++  L S++ E SS
Sbjct  137   KCSHVFHPDCIDAWLEYHVTCPVCRAKLTPDSDGKPVESSSNVTELNSNNNEWSS  191



>ref|XP_002514252.1| RING-H2 finger protein ATL4J precursor, putative [Ricinus communis]
 gb|EEF48206.1| RING-H2 finger protein ATL4J precursor, putative [Ricinus communis]
Length=267

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 137/248 (55%), Gaps = 44/248 (18%)
 Frame = -1

Query  771  REESSLGLYIQRQES------FKFGS------RKIKKDEKLPIQNDQSL-----QKPLHH  643
            +E+SS+  +IQR+ES      F  GS      + + KDE+  IQ  ++      Q+ LH 
Sbjct  24   QEDSSIEYFIQREESRQASSRFSIGSSFRRTDKVLNKDEEALIQEQEAEDSDDEQRVLHK  83

Query  642  LNHRIIVSDVVLKNRWSSVSSSDLIALNSELIRDRfsssssslanpefsssFGSKHPHDE  463
             NH+II+SDVVLKNRWS+VSSSDL+ LN+E+++D  S+  SS  +               
Sbjct  84   FNHKIIISDVVLKNRWSNVSSSDLMFLNAEMLQDMSSNRFSSSDSNNEQFISTENE----  139

Query  462  IQSMSIKEEMERKRLFEIKV----NKNNPS-FPI-PTTYAETKNLS---------QKEKR  328
             Q + IKEEME+KRLFE K     N ++P+ FP  P+T +++  +S           ++R
Sbjct  140  -QMVKIKEEMEKKRLFESKFSTISNCDSPTPFPGNPSTSSDSNRISGHNTSSIIDSGDRR  198

Query  327  SMSEIVVHPRFRNGNVQDYC-------DVVSDERRRKLWLPIARRTVQWFAKRERRSAHE  169
            S+SEI    RFRN +++          +   ++R R+ WLPIARRTVQWFA RE+ S   
Sbjct  199  SVSEITGLSRFRNVSIKKTIRESFSGENNREEDRVRRQWLPIARRTVQWFANREKTSQQT  258

Query  168  SQIPSTQH  145
                 T H
Sbjct  259  QNRRQTLH  266



>emb|CDX74219.1| BnaA03g28280D [Brassica napus]
Length=280

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASIL-NTTLQIPDALLGSWRRSSG----I  1045
             F P L+ +IGILA  F L  +  L +K+C R+S     T+     +  +W+RS+G    +
Sbjct  56    FSPLLIALIGILASAFILVSYYTLTSKYCRRSSTASGATISSSAVVTDTWQRSNGASNGL  115

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             D+T++ES+  +++    G  E  +CSVCLS F++ E LRLLPKC HAFH+ CID WL+ H
Sbjct  116   DETLIESITVYKYRKGDGFVESSDCSVCLSEFQEEERLRLLPKCSHAFHVPCIDTWLKSH  175

Query  864   SSCPLCRHKVT  832
             S+CPLCR +++
Sbjct  176   SNCPLCRAEIS  186



>ref|XP_009134730.1| PREDICTED: RING-H2 finger protein ATL51-like [Brassica rapa]
Length=323

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASIL-NTTLQIPDALLGSWRRSSG----I  1045
             F P L+ +IGILA  F L  +  L +K+C R+S     T+     +  +W+RS+G    +
Sbjct  56    FSPLLIALIGILASAFILVSYYTLTSKYCRRSSTASGATISSSAVVTDTWQRSNGASNGL  115

Query  1044  DKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             D+T++ES+  +++    G  E  +CSVCLS F++ E LR+LPKC HAFH+ CID WL+ H
Sbjct  116   DETLIESITVYKYRKGDGFVESSDCSVCLSEFQEEERLRMLPKCSHAFHVACIDTWLKSH  175

Query  864   SSCPLCRHKVT  832
             S+CPLCR +++
Sbjct  176   SNCPLCRAEIS  186



>ref|XP_010056545.1| PREDICTED: RING-H2 finger protein ATL52-like [Eucalyptus grandis]
 gb|KCW73319.1| hypothetical protein EUGRSUZ_E01776 [Eucalyptus grandis]
Length=385

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 12/149 (8%)
 Frame = -1

Query  1239  PNDQSPDTNT----FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALL  1072
             P+D S D  +    F P ++ VIGILA  F L  +  +  K+C R    N +L + D+  
Sbjct  40    PDDYSGDDGSGGTYFSPLVIAVIGILASAFLLVSYYTIITKYCRRRRGSNYSLDLEDSAG  99

Query  1071  ------GSWRRSS--GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPK  916
                   GSW+ ++  G+D+  ++S+   ++    G  EG +CSVCLS F + E LRLLPK
Sbjct  100   DHQMNSGSWQNAAPAGLDEAAIKSIAVCKYKKGDGLVEGTDCSVCLSEFREEESLRLLPK  159

Query  915   CKHAFHIHCIDQWLEKHSSCPLCRHKVTA  829
             C HAFH+ CID WL+ HSSCPLCR  + A
Sbjct  160   CSHAFHLPCIDTWLKSHSSCPLCRSNIAA  188



>ref|XP_006287967.1| hypothetical protein CARUB_v10001202mg [Capsella rubella]
 gb|EOA20865.1| hypothetical protein CARUB_v10001202mg [Capsella rubella]
Length=373

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 13/142 (9%)
 Frame = -1

Query  1215  NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR---ASILNTTLQIPDALLGSWRRS---  1054
             NTF P L+ +IGIL   F L  +  L +K+CHR    S  +TTL + ++  G++  +   
Sbjct  54    NTFSPLLIALIGILVSAFILVSYYTLISKYCHRHHQNSSSDTTLNLNNSDGGAFSSTQRL  113

Query  1053  -------SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
                     G++++ ++S+  +R+    G  +G +CSVCLS FE+ E LRLLPKC HAFH+
Sbjct  114   SNTTTTGDGLNESTIKSITVYRYKKGDGFVDGSDCSVCLSEFEENESLRLLPKCNHAFHL  173

Query  894   HCIDQWLEKHSSCPLCRHKVTA  829
              CID WL+ H +CPLCR  VTA
Sbjct  174   PCIDTWLKSHPNCPLCRAFVTA  195



>emb|CDX92043.1| BnaC03g33450D [Brassica napus]
Length=326

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 85/130 (65%), Gaps = 8/130 (6%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSG------ID  1042
             P L+ +IGILA  F L  +  L +K+C R+S    T+     +  +W+RS+G      +D
Sbjct  59    PLLIALIGILASAFILVTYYTLTSKYCRRSS--GATISSSAVVTDTWQRSNGASNPIGLD  116

Query  1041  KTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKHS  862
             +T+++S+  +++    G  E  +CSVCLS F++ E LRLLPKC+HAFH+ CID WL+ HS
Sbjct  117   ETLIKSITVYKYRKGDGFVESSDCSVCLSEFQEEESLRLLPKCRHAFHVACIDTWLKSHS  176

Query  861   SCPLCRHKVT  832
             +CPLCR +++
Sbjct  177   NCPLCRAEIS  186



>ref|XP_008232120.1| PREDICTED: RING-H2 finger protein ATL52-like [Prunus mume]
Length=373

 Score =   121 bits (303),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = -1

Query  1233  DQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASILNTTLQIPDALL  1072
             D S D+ T F P ++ VIGI A  F L  +  + +K+C R        ++     P+ + 
Sbjct  48    DDSKDSATDFSPLIIAVIGIFASAFILVTYYTIISKYCRRRDNDGGRDIDMENSNPNQIS  107

Query  1071  GSWRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
              SW+ S+ G+D+++++S+   ++       EG +CSVCLS FE+ E LRLLPKC HAFH+
Sbjct  108   ESWQGSTTGLDESLIKSIKVHKYKRGDSLVEGTDCSVCLSEFEENESLRLLPKCSHAFHV  167

Query  894   HCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
              CID WL+ HSSCPLCR  + A  ++L+
Sbjct  168   PCIDTWLKSHSSCPLCRSNIAAPAIALV  195



>gb|KHN08798.1| RING-H2 finger protein ATL51 [Glycine soja]
Length=244

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 86/139 (62%), Gaps = 3/139 (2%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILN-TTLQIPDALLG--S  1066
              D  P    F P +V VIGILA  F L  +  + ++FC R +  N +T    ++ L   S
Sbjct  47    GDDDPSGFEFSPLIVAVIGILASTFILVTYYTIISRFCRRRNNTNDSTEDDGNSELARVS  106

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
                +SG+D+ +++S+   +++   G  EG +CSVCLS FE+ E LRLLPKC HAFH+ CI
Sbjct  107   SSANSGLDEALIKSITVCKYNKRGGLVEGHDCSVCLSEFEENEDLRLLPKCNHAFHLPCI  166

Query  885   DQWLEKHSSCPLCRHKVTA  829
             D WL+ H++CPLCR  VTA
Sbjct  167   DTWLKSHATCPLCRSSVTA  185



>ref|XP_010266641.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Nelumbo nucifera]
Length=425

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 108/205 (53%), Gaps = 20/205 (10%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRR  1057
             NDQ P  N F PS+ ++I +L   F    F  +Y + C  A   N     P  ++G  RR
Sbjct  56    NDQQPYRN-FNPSMAIIIIVLISAFFFMGFFSIYIRQC--AEDRNGGSIRPANMVGRSRR  112

Query  1056  SS-GIDKTVVESLPFFRFSSLKG---SREGLECSVCLSRFEDIEILRLLPKCKHAFHIHC  889
             ++ G+D  V+E+ P F +S +KG    +  LEC+VCL+ FED E LRLLPKC H FH  C
Sbjct  113   AARGLDPAVIETFPTFMYSVVKGLQLGKGALECAVCLNEFEDDETLRLLPKCDHVFHPEC  172

Query  888   IDQWLEKHSSCPLCRHKV---TAEDLSLM-------NFSSSLRFLCSDSREESSLGL---  748
             ID WL  H++CP+CR  +   + ED + +       N  S +     + RE+ S G    
Sbjct  173   IDAWLSSHTTCPVCRANLVPGSGEDAAALEQVPDDTNGESDVENPRPEVREDQSQGGSLH  232

Query  747   YIQRQESFKFGSRKIKKDEKLPIQN  673
              I+ Q + +  +  +    ++PIQN
Sbjct  233   VIEEQNTEQQAAPDVISPCQVPIQN  257



>ref|XP_004307157.1| PREDICTED: RING-H2 finger protein ATL51-like [Fragaria vesca 
subsp. vesca]
Length=352

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 92/151 (61%), Gaps = 3/151 (2%)
 Frame = -1

Query  1254  PSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ--IPD  1081
             PS +  + +      F P ++ +IGI+A  F L  +  + +K+C R +      +   P+
Sbjct  43    PSELGDSSEEGSGINFSPLIIALIGIVASAFILVTYYTIISKYCRRRTGARDIDREANPN  102

Query  1080  ALLGSWRRS-SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHA  904
              +  SW+ S +G+++++++S+   +F    G  EG +CSVCLS FE+ E LRLLPKC HA
Sbjct  103   TVNESWQGSNTGMEESLIKSITVHKFKKNDGVVEGTDCSVCLSEFEENESLRLLPKCSHA  162

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             FH+ CID WL+ HSSCPLCR  + A  ++L+
Sbjct  163   FHVPCIDAWLKSHSSCPLCRSNIAAPAIALV  193



>ref|XP_006578406.1| PREDICTED: RING-H2 finger protein ATL52-like [Glycine max]
Length=248

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 86/139 (62%), Gaps = 3/139 (2%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILN-TTLQIPDALLG--S  1066
              D  P    F P +V VIGILA  F L  +  + ++FC R +  N +T    ++ L   S
Sbjct  53    GDDDPSGFEFSPLIVAVIGILASTFILVTYYTIISRFCRRRNNTNDSTEDDGNSELARVS  112

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
                +SG+D+ +++S+   +++   G  EG +CSVCLS FE+ E LRLLPKC HAFH+ CI
Sbjct  113   SSANSGLDEALIKSITVCKYNKRGGLVEGHDCSVCLSEFEENEDLRLLPKCNHAFHLPCI  172

Query  885   DQWLEKHSSCPLCRHKVTA  829
             D WL+ H++CPLCR  VTA
Sbjct  173   DTWLKSHATCPLCRASVTA  191



>ref|XP_007218185.1| hypothetical protein PRUPE_ppa007682mg [Prunus persica]
 gb|EMJ19384.1| hypothetical protein PRUPE_ppa007682mg [Prunus persica]
Length=359

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 88/147 (60%), Gaps = 7/147 (5%)
 Frame = -1

Query  1233  DQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASILNTTLQIPDALL  1072
             D S D+ T F P ++ VIGI A  F L  +  + +K+C R        ++     P+ + 
Sbjct  48    DDSKDSATDFSPLIIAVIGIFASAFILVTYYTIISKYCRRRDNDGGRDIDMENSNPNQIS  107

Query  1071  GSWRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
              SW+ S+ G+D+++++S+   ++       EG +CSVCLS FE+ E LRLLPKC HAFH+
Sbjct  108   ESWQGSTTGLDESLIKSIKVHKYKRGDSLVEGTDCSVCLSEFEENESLRLLPKCSHAFHV  167

Query  894   HCIDQWLEKHSSCPLCRHKVTAEDLSL  814
              CID W + HSSCPLCR  + A  ++L
Sbjct  168   PCIDTWFKSHSSCPLCRSNIAAPAIAL  194



>ref|XP_007148807.1| hypothetical protein PHAVU_005G016000g [Phaseolus vulgaris]
 ref|XP_007148808.1| hypothetical protein PHAVU_005G016000g [Phaseolus vulgaris]
 gb|ESW20801.1| hypothetical protein PHAVU_005G016000g [Phaseolus vulgaris]
 gb|ESW20802.1| hypothetical protein PHAVU_005G016000g [Phaseolus vulgaris]
Length=241

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ---IPDALLGS  1066
             +D  P    F P +V VIGILA  F L  +  + ++FC R ++ +  L      +    S
Sbjct  49    SDDDPSAFEFSPLIVAVIGILASTFILVTYYTIISRFCRRRTMHSNDLAEDGSSELAQVS  108

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
                +SG+D+ +++S+   +++   G  EG +CSVCLS FE+ E LRLLPKC HAFH+ CI
Sbjct  109   SSSNSGLDEALIKSITVCKYTKGGGVVEGHDCSVCLSEFEENESLRLLPKCNHAFHLPCI  168

Query  885   DQWLEKHSSCPLCRHKVT  832
             D WL+ H+SCPLCR  +T
Sbjct  169   DTWLKSHASCPLCRSTIT  186



>ref|XP_007029812.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY10314.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=372

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 89/142 (63%), Gaps = 6/142 (4%)
 Frame = -1

Query  1236  NDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDAL----L  1072
             ND   ++ T F P ++ VIGILA +F L  +  + +K+C R    +T LQ+ ++      
Sbjct  46    NDDDDNSGTDFSPLIIAVIGILASVFILVSYYTIISKYCRRRRQDHTRLQLNESRDELNH  105

Query  1071  GSWRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
               W+ +S G+D+ +++S+   ++    G  EG +CSVCLS F++ E LR+LPKC HAFH+
Sbjct  106   DGWQAASEGLDEGLIKSITVCKYKKGDGLIEGTDCSVCLSEFQEDESLRVLPKCNHAFHV  165

Query  894   HCIDQWLEKHSSCPLCRHKVTA  829
              CID WL+ HSSCPLCR  + +
Sbjct  166   PCIDTWLKSHSSCPLCRANIAS  187



>ref|XP_008345229.1| PREDICTED: RING-H2 finger protein ATL51-like [Malus domestica]
Length=350

 Score =   117 bits (292),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 89/149 (60%), Gaps = 7/149 (5%)
 Frame = -1

Query  1236  NDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASILNTTLQIPDAL  1075
             +DQ+  + T   P ++ +IGI A  F L  +  + +K+C R     A   N     P+ +
Sbjct  48    DDQNHGSPTDLSPLIIAIIGIFASAFILVTYYTVISKYCRRRGSDGARDTNMDSSNPNLV  107

Query  1074  LGSWRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
               SW+ S+ G+D+++++S+   ++       EG +CSVCLS FE+ E LRLLPKC HAFH
Sbjct  108   SESWQGSNNGLDESLIKSITVHKYKKGDKLVEGTDCSVCLSEFEENESLRLLPKCSHAFH  167

Query  897   IHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             + CID WL+ HSSCPLCR  + A  + L+
Sbjct  168   VPCIDTWLKSHSSCPLCRSNIAAPAIXLV  196



>ref|XP_010694616.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 95/155 (61%), Gaps = 13/155 (8%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSL-VVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWR  1060
             N+  PD   F PS+ V++I ++A +F + FF + Y + C   S   +T+ +P   +GS R
Sbjct  36    NNFGPDGGRFSPSMGVIIIVLIAALFFMGFFSI-YIRHC---SDNPSTVGVPGRGIGSVR  91

Query  1059  RSS----GIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHAF  901
             RS     G+D  V+ES P F + S+K ++ G   LEC+VCL+ FED + LRL+PKC H F
Sbjct  92    RSRRAPRGLDPEVIESFPTFDYVSVKNAKIGKGALECAVCLTEFEDDDTLRLIPKCDHVF  151

Query  900   HIHCIDQWLEKHSSCPLCRHKVTAEDLSLMNFSSS  796
             H  CID WL  H++CP+CR  + A+D  +++   S
Sbjct  152   HPDCIDAWLIGHTTCPVCRCNL-ADDTPIISIEES  185



>ref|XP_006466567.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Citrus sinensis]
Length=291

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -1

Query  1248  TIIPNDQSPDT--NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDAL  1075
             T+     +PD    T  PS+ ++I +L   F +     +Y + C  +      L  P   
Sbjct  59    TVTQPPANPDGLYTTLDPSMAIIILVLISTFFIVAMFSIYVRHCSDSRAQGGVL--PSRA  116

Query  1074  LGSWRRSSGIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHA  904
             L    R+ G+D +V+ES P F +S++K  + G   LEC+VCLS FED E LRLLPKC H 
Sbjct  117   LAGLSRNRGLDPSVIESFPIFVYSAVKDLKIGKGALECAVCLSEFEDDETLRLLPKCDHV  176

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAE  826
             FH HCID WL  H +CP+CR  +T E
Sbjct  177   FHPHCIDVWLASHVTCPVCRANLTPE  202



>gb|KDO60644.1| hypothetical protein CISIN_1g014794mg [Citrus sinensis]
Length=418

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -1

Query  1248  TIIPNDQSPDT--NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDAL  1075
             T+     +PD    T  PS+ ++I +L   F +     +Y + C  +      L  P   
Sbjct  59    TVTQPPANPDGLYTTLDPSMAIIILVLISTFFIVAMFSIYVRHCSDSRAQGGVL--PSRA  116

Query  1074  LGSWRRSSGIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHA  904
             L    R+ G+D +V+ES P F +S++K  + G   LEC+VCLS FED E LRLLPKC H 
Sbjct  117   LAGLSRNRGLDPSVIESFPIFVYSAVKDLKIGKGALECAVCLSEFEDDETLRLLPKCDHV  176

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAE  826
             FH HCID WL  H +CP+CR  +T E
Sbjct  177   FHPHCIDVWLASHVTCPVCRANLTPE  202



>ref|XP_004957082.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Setaria italica]
Length=395

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 79/146 (54%), Gaps = 7/146 (5%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-ASILNTTL  1093
               AQ P     N Q+P TN F PS+ +VI +L   F    F  +Y + C+   S   +  
Sbjct  26    TAAQGPQQT--NGQTPYTN-FSPSMAIVIVVLIAAFFFLGFFSIYVRHCYGDGSSGYSAS  82

Query  1092  QIPDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLL  922
               P+      RR  G+D  V+E+ P   ++ +K  + G   LEC+VCLS F+D E LRLL
Sbjct  83    PAPNGAAARSRRQRGLDAAVLETFPTMAYADVKAHKAGKGALECAVCLSEFDDDETLRLL  142

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCR  844
             PKC H FH  CID WL  H +CP+CR
Sbjct  143   PKCSHVFHPDCIDTWLASHVTCPVCR  168



>ref|NP_568080.2| RING-H2 finger protein ATL32 [Arabidopsis thaliana]
 sp|Q8W571.3|ATL32_ARATH RecName: Full=RING-H2 finger protein ATL32; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE87164.1| RING-H2 finger protein ATL32 [Arabidopsis thaliana]
Length=323

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  1224  PDTNTFQ-PSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSG  1048
             PD  T   PS   V  +L  +F LT  L +Y + C R++  ++T    +       R  G
Sbjct  36    PDLQTGHTPSKTTVFAVLVTLFFLTGLLSVYIRHCARSNPDSSTRYFRNRANDGSSRRGG  95

Query  1047  IDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
             +D  VVES P F +SS+K S+ G   LEC++CL+  ED E +RLLP C H FHI CID W
Sbjct  96    LDNAVVESFPVFAYSSVKESKIGSKDLECAICLNELEDHETVRLLPICNHLFHIDCIDTW  155

Query  876   LEKHSSCPLCRHKVTAE  826
             L  H++CP+CR  +TA+
Sbjct  156   LYSHATCPVCRSNLTAK  172



>emb|CAB38920.2| putative protein [Arabidopsis thaliana]
 emb|CAB80670.1| putative protein [Arabidopsis thaliana]
Length=322

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  1224  PDTNTFQ-PSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSG  1048
             PD  T   PS   V  +L  +F LT  L +Y + C R++  ++T    +       R  G
Sbjct  35    PDLQTGHTPSKTTVFAVLVTLFFLTGLLSVYIRHCARSNPDSSTRYFRNRANDGSSRRGG  94

Query  1047  IDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
             +D  VVES P F +SS+K S+ G   LEC++CL+  ED E +RLLP C H FHI CID W
Sbjct  95    LDNAVVESFPVFAYSSVKESKIGSKDLECAICLNELEDHETVRLLPICNHLFHIDCIDTW  154

Query  876   LEKHSSCPLCRHKVTAE  826
             L  H++CP+CR  +TA+
Sbjct  155   LYSHATCPVCRSNLTAK  171



>ref|XP_006426309.1| hypothetical protein CICLE_v10027093mg, partial [Citrus clementina]
 gb|ESR39549.1| hypothetical protein CICLE_v10027093mg, partial [Citrus clementina]
Length=548

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -1

Query  1248  TIIPNDQSPDT--NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDAL  1075
             T+     +PD    T  PS+ ++I +L   F +     +Y + C  +      L  P   
Sbjct  100   TVTQPPANPDGLYTTLDPSMAIIILVLISTFFIVAMFSIYVRHCSDSRAQGGVL--PSRA  157

Query  1074  LGSWRRSSGIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHA  904
             L    R+ G+D +V+ES P F +S++K  + G   LEC+VCLS FED E LRLLPKC H 
Sbjct  158   LAGLSRNRGLDPSVIESFPIFVYSAVKDLKIGKGALECAVCLSEFEDDETLRLLPKCDHV  217

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAE  826
             FH HCID WL  H +CP+CR  +T E
Sbjct  218   FHPHCIDVWLASHVTCPVCRANLTPE  243



>ref|XP_004138996.1| PREDICTED: RING-H2 finger protein ATL51-like [Cucumis sativus]
 ref|XP_004165975.1| PREDICTED: RING-H2 finger protein ATL51-like [Cucumis sativus]
 gb|KGN61413.1| hypothetical protein Csa_2G119350 [Cucumis sativus]
Length=365

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 87/145 (60%), Gaps = 11/145 (8%)
 Frame = -1

Query  1233  DQSPDTNTF-QPSLVVVIGILAIMFSLTFFLLLYAKFCHR------ASILNTTLQIPDAL  1075
             D + D+ TF  P +V VIGILA  F L  +  + +K+C R             L+  D +
Sbjct  49    DDTDDSGTFFSPLIVAVIGILASAFVLVTYYAIVSKYCRRRVDDSGGGGSGDNLEA-DRV  107

Query  1074  LGSWRRS---SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHA  904
             +   R+S   +G+D+ +++S+  ++F   +G  EG +CSVCLS F++ E LRLLPKC HA
Sbjct  108   VNDTRQSGAGAGLDEALIKSISIYKFKKGEGLIEGSDCSVCLSEFQENESLRLLPKCSHA  167

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTA  829
             FH+ CID WL+  SSCPLCR  + +
Sbjct  168   FHLACIDTWLKSSSSCPLCRCNIAS  192



>ref|XP_002866907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43166.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=250

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 83/141 (59%), Gaps = 5/141 (4%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWR  1060
             P D  P  +T  PS   V  +L  +F LT  L +Y + C R++  ++T         ++ 
Sbjct  35    PPDLQPGGHT--PSKTTVFTVLVALFFLTGLLSVYIRHCTRSNPDSSTRYFRRRANDNFS  92

Query  1059  RSSGIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHAFHIHC  889
             R  G+D  VVES P F +S++K S+ G   LEC++CL+  ED E +RLLP C H FHI C
Sbjct  93    RRGGLDNAVVESFPVFAYSTVKESKIGSKDLECAICLNELEDHETVRLLPICNHLFHIDC  152

Query  888   IDQWLEKHSSCPLCRHKVTAE  826
             ID WL  H++CP+CR  +TA+
Sbjct  153   IDAWLYSHATCPVCRSNLTAK  173



>ref|XP_004501681.1| PREDICTED: RING-H2 finger protein ATL11-like [Cicer arietinum]
Length=373

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 84/143 (59%), Gaps = 12/143 (8%)
 Frame = -1

Query  1242  IPNDQSP------DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNT-TLQIP  1084
             IPN  SP       T  F  S+ +V+ IL ++F +  FL +Y + C    +     L IP
Sbjct  32    IPNALSPPPADRISTLKFDKSMAIVLIILIVVFLILGFLSVYTRQCTEQRMRGRFDLTIP  91

Query  1083  DALLGSWRRSSGIDKTVVESLPFFRFSSLKG---SREGLECSVCLSRFEDIEILRLLPKC  913
              A  GS RR  G+DK ++E+ P F +S++KG    R  LEC+VCL+ F+D E LRL+P C
Sbjct  92    IA--GSHRRHRGLDKEIIETFPTFVYSAVKGLKIGRAALECAVCLNEFQDDETLRLIPNC  149

Query  912   KHAFHIHCIDQWLEKHSSCPLCR  844
              H FH  CID WL  HSSCP+CR
Sbjct  150   CHVFHSECIDAWLVNHSSCPVCR  172



>ref|XP_008457172.1| PREDICTED: RING-H2 finger protein ATL52-like [Cucumis melo]
Length=365

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 89/149 (60%), Gaps = 11/149 (7%)
 Frame = -1

Query  1233  DQSPDTNTF-QPSLVVVIGILAIMFSLTFFLLLYAKFCHR------ASILNTTLQIPDAL  1075
             D + D+ TF  P +V VIGILA  F L  +  + +K+C R             L+  D +
Sbjct  49    DDTDDSATFFSPLIVAVIGILASAFVLVTYYAIVSKYCRRRVDESGGGGSGENLEA-DRV  107

Query  1074  LGSWRRS---SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHA  904
             +   R+S   +G+D+ +++S+  ++F   +G  EG +CSVCLS F++ E LRLLPKC HA
Sbjct  108   VNDTRQSGVGAGLDEALIKSISIYKFKKGEGLIEGSDCSVCLSEFQENESLRLLPKCSHA  167

Query  903   FHIHCIDQWLEKHSSCPLCRHKVTAEDLS  817
             FH+ CID WL+  SSCPLCR  + + + S
Sbjct  168   FHLACIDTWLKSSSSCPLCRCNIASTNPS  196



>gb|EPS71380.1| hypothetical protein M569_03379, partial [Genlisea aurea]
Length=212

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 4/139 (3%)
 Frame = -1

Query  1236  NDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASI-LNTTLQIPDALLGS--  1066
             +D       F P ++ VIG+LA  F L  +  L A+ C R S   N+  QI   +     
Sbjct  44    DDSGGGATQFSPLIIAVIGVLASAFLLVGYYALVARLCWRRSDDSNSADQISGTVFVGRD  103

Query  1065  -WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHC  889
              W    G+D+ ++E +   ++    GS EG +C+VCLS F + E LRLLP C HAFH+ C
Sbjct  104   RWNSGGGLDEAIIEKISVCKYEKGNGSIEGTDCAVCLSEFRENETLRLLPNCSHAFHLPC  163

Query  888   IDQWLEKHSSCPLCRHKVT  832
             ID WL  +S+CPLCR  ++
Sbjct  164   IDIWLRSNSTCPLCRADIS  182



>ref|XP_010549745.1| PREDICTED: RING-H2 finger protein ATL52-like [Tarenaya hassleriana]
Length=367

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 84/153 (55%), Gaps = 11/153 (7%)
 Frame = -1

Query  1254  PSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTT----LQI  1087
             PS  + N     +  F P L+ ++GIL+I F    +  L +KFC R    + T       
Sbjct  41    PSFFLGNTDDSSSAHFSPFLIALVGILSIAFIFVSYYTLISKFCRRHGFSSHTDRDISSF  100

Query  1086  PDALLGSWRRSS-------GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILR  928
             P A   +W+          G+D+ +++S+  +++    G  +   CSVCLS F++ E LR
Sbjct  101   PAAAGDNWQGYGSPEVAVDGLDEALIKSIQVYKYRKSDGLVDCSACSVCLSEFQEDESLR  160

Query  927   LLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTA  829
             LLPKC HAFH+ CID WL+ HS+CPLCR  +TA
Sbjct  161   LLPKCNHAFHVPCIDTWLKSHSNCPLCRANLTA  193



>ref|XP_006484722.1| PREDICTED: RING-H2 finger protein ATL52-like [Citrus sinensis]
Length=352

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -1

Query  1233  DQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPD------AL  1075
             D+  D+ T F P ++ VIGILA  F L  +  + +K+C R S   T L+  +      A 
Sbjct  48    DEDDDSGTDFSPLIIAVIGILASAFILVTYYTIISKYCKRRSD-ETGLEFSENRDQMSAD  106

Query  1074  LGSWRRSS--GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAF  901
               +W+  +  G+D+ +++S+   ++    G  EG +CSVCLS F++ E LRLLPKC HAF
Sbjct  107   DQAWQLGNNVGLDEALIKSITVCKYKKGDGLVEGTDCSVCLSEFQEHESLRLLPKCNHAF  166

Query  900   HIHCIDQWLEKHSSCPLCRHKV  835
             H+ CID WL+ HSSCPLCR  +
Sbjct  167   HLPCIDTWLKSHSSCPLCRATI  188



>ref|XP_011014076.1| PREDICTED: RING-H2 finger protein ATL11-like [Populus euphratica]
Length=435

 Score =   115 bits (288),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 9/155 (6%)
 Frame = -1

Query  1254  PSTIIPNDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDA  1078
             PS   P+DQ+   N  F P++ +++ +L   F L  F  +Y + C       T    P A
Sbjct  42    PSPPTPDDQNSKQNQKFNPAMAIIMVVLISAFFLMGFFSVYVRQCADRRFRGTRFD-PAA  100

Query  1077  LLG----SWRRSSGIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLP  919
             L G    SWR   G+++ V+++ P F +S++KG + G   LEC+VCL  FED + LRL+P
Sbjct  101   LAGAGRGSWRGYHGLEQEVIDTFPTFLYSTVKGLKIGEGSLECAVCLIEFEDDQTLRLIP  160

Query  918   KCKHAFHIHCIDQWLEKHSSCPLCRHKVTAEDLSL  814
             KC H FH  CID WL  H +CP+CR  +  +   L
Sbjct  161   KCSHVFHPDCIDAWLASHVTCPVCRANLVPKPGDL  195



>ref|XP_006437376.1| hypothetical protein CICLE_v10031956mg [Citrus clementina]
 gb|ESR50616.1| hypothetical protein CICLE_v10031956mg [Citrus clementina]
Length=352

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -1

Query  1233  DQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPD------AL  1075
             D+  D+ T F P ++ VIGILA  F L  +  + +K+C R S   T L+  +      A 
Sbjct  48    DEDDDSGTDFSPLIIAVIGILASAFILVTYYTIISKYCKRRSD-ETGLEFSENRDQMSAD  106

Query  1074  LGSWRRSS--GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAF  901
               +W+  +  G+D+ +++S+   ++    G  EG +CSVCLS F++ E LRLLPKC HAF
Sbjct  107   DQAWQLGNNVGLDEALIKSITVCKYKKGDGLVEGTDCSVCLSEFQEHESLRLLPKCNHAF  166

Query  900   HIHCIDQWLEKHSSCPLCRHKV  835
             H+ CID WL+ HSSCPLCR  +
Sbjct  167   HLPCIDTWLKSHSSCPLCRATI  188



>ref|XP_010094662.1| E3 ubiquitin-protein ligase ATL6 [Morus notabilis]
 gb|EXB56540.1| E3 ubiquitin-protein ligase ATL6 [Morus notabilis]
Length=344

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 87/152 (57%), Gaps = 6/152 (4%)
 Frame = -1

Query  1269  VKAQHPSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
              +AQ  +   P DQ     +F PS+ +++ +L        F  +Y + C   +  +  + 
Sbjct  30    ARAQPTAPSTPTDQY--NYSFSPSMAIIVVVLVSALFFMGFFSIYIRHCSDGTQNSVGVG  87

Query  1089  IPDALLGSWRRSS-GIDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLL  922
               +  +G  RR++ G+D  V+ES P F +S++KG + G   LEC+VCL  FED E LRL+
Sbjct  88    AVNGGVGRSRRAARGLDAAVIESFPTFTYSAVKGLKIGKGALECAVCLCEFEDDETLRLI  147

Query  921   PKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAE  826
             PKC H FH+ C+D WLE H++CP+CR  +  E
Sbjct  148   PKCDHVFHMECVDTWLESHTTCPVCRANLVPE  179



>ref|XP_011093432.1| PREDICTED: RING-H2 finger protein ATL52-like isoform X2 [Sesamum 
indicum]
Length=315

 Score =   113 bits (283),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 9/143 (6%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS--  1066
             P+D S    T  P ++ +IG+LA  F L  +  +  +FC R +  +T L+  +   GS  
Sbjct  41    PDDDS--ATTLSPLIIAIIGVLASAFLLVSYYTVVTRFCRRRN-QSTGLENDENHEGSIA  97

Query  1065  ---WRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
                W+ +S G+D+ V++++   ++    G  EG +C+VCLS F D E LRLLPKC HAFH
Sbjct  98    QDQWQAASTGLDEAVIKTITVCKYQKGDGLIEGSDCAVCLSEFRDDEPLRLLPKCSHAFH  157

Query  897   IHCIDQWLEKHSSCPLCRHKVTA  829
             + CID WL+ HS+CPLCR  V A
Sbjct  158   LPCIDTWLKSHSNCPLCRANVIA  180



>ref|XP_002319229.2| hypothetical protein POPTR_0013s07100g [Populus trichocarpa]
 gb|EEE95152.2| hypothetical protein POPTR_0013s07100g [Populus trichocarpa]
Length=349

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 7/141 (5%)
 Frame = -1

Query  1221  DTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIP---DALLG-SWRR  1057
             D+NT   P ++ VIGILA  F L  +  L +K+C R    +    +    D +   +W+ 
Sbjct  49    DSNTDLSPLIIAVIGILASAFILVTYYTLISKYCRRRGQGDGATDLNENHDQMASEAWQG  108

Query  1056  --SSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCID  883
               + G+D+ +V+S+   ++    G  EG ECSVCLS F++ E LRLLPKC HAFH+ CID
Sbjct  109   IPAGGLDEALVKSITVCKYKKGDGFVEGTECSVCLSEFQENESLRLLPKCSHAFHLPCID  168

Query  882   QWLEKHSSCPLCRHKVTAEDL  820
              WL+ H+SCPLCR  +   ++
Sbjct  169   TWLKSHASCPLCRANIAPANI  189



>ref|XP_011093431.1| PREDICTED: RING-H2 finger protein ATL52-like isoform X1 [Sesamum 
indicum]
Length=330

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 9/143 (6%)
 Frame = -1

Query  1239  PNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGS--  1066
             P+D S    T  P ++ +IG+LA  F L  +  +  +FC R +  +T L+  +   GS  
Sbjct  41    PDDDS--ATTLSPLIIAIIGVLASAFLLVSYYTVVTRFCRRRN-QSTGLENDENHEGSIA  97

Query  1065  ---WRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
                W+ +S G+D+ V++++   ++    G  EG +C+VCLS F D E LRLLPKC HAFH
Sbjct  98    QDQWQAASTGLDEAVIKTITVCKYQKGDGLIEGSDCAVCLSEFRDDEPLRLLPKCSHAFH  157

Query  897   IHCIDQWLEKHSSCPLCRHKVTA  829
             + CID WL+ HS+CPLCR  V A
Sbjct  158   LPCIDTWLKSHSNCPLCRANVIA  180



>gb|KDO46830.1| hypothetical protein CISIN_1g036833mg [Citrus sinensis]
Length=352

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -1

Query  1233  DQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPD------AL  1075
             D+  D+ T F P ++ VIGILA  F L  +  + +K+C R S   T L+  +      A 
Sbjct  48    DEDDDSGTDFSPLIIAVIGILASAFILVTYYTIISKYCKRRSD-ETGLEFSENRDQMSAN  106

Query  1074  LGSWRRSS--GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAF  901
               +W+  +  G+D+ +++S+   ++    G  EG +CSVCLS F++ E LRLLPKC HAF
Sbjct  107   DQAWQLGNNVGLDEALIKSITVCKYKKGDGLVEGSDCSVCLSEFQEHESLRLLPKCNHAF  166

Query  900   HIHCIDQWLEKHSSCPLCRHKV  835
             H+ CID WL+ HSSCPLCR  +
Sbjct  167   HLPCIDTWLKSHSSCPLCRATI  188



>gb|KFK37786.1| hypothetical protein AALP_AA3G029000 [Arabis alpina]
Length=354

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 84/146 (58%), Gaps = 19/146 (13%)
 Frame = -1

Query  1209  FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRAS------ILNTTLQ---IPDALLGSWRR  1057
             F P L+ +IGILA  F L  +  L +K+CHR         ++TT     I   +  SW+ 
Sbjct  56    FSPLLIALIGILASAFILVSYYTLISKYCHRRRNNNNNHTISTTTNDRGISSFVTDSWQS  115

Query  1056  ----------SSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKH  907
                         G+D+++++S+  ++F    G  E  +CSVCLS F++ E LRLLPKC H
Sbjct  116   NPNPNPNQTIGDGLDESLIKSITVYKFKKRDGFVESSDCSVCLSEFQENESLRLLPKCNH  175

Query  906   AFHIHCIDQWLEKHSSCPLCRHKVTA  829
             AFH+ CID WL+ HS+CPLCR  +TA
Sbjct  176   AFHVPCIDTWLKSHSNCPLCRAFITA  201



>ref|XP_010511717.1| PREDICTED: RING-H2 finger protein ATL51-like [Camelina sativa]
Length=351

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 89/152 (59%), Gaps = 21/152 (14%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHR-------------ASILNTTLQIPDALLGSW  1063
             P L+ +IGILA  F L  +  L +K+CHR             A+I+NT      +   +W
Sbjct  57    PLLIALIGILASAFILVSYYTLISKYCHRRRQNSSSSSSSSAAAIINTDHGRISSDYTTW  116

Query  1062  RRSS--------GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKH  907
             + ++        G+D+++++S+  +++  + G  E  +CSVCLS F++ E LRLLPKC H
Sbjct  117   QEATNPNQAIGDGLDESLIKSITVYKYKKIDGFVESSDCSVCLSEFQENESLRLLPKCNH  176

Query  906   AFHIHCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             AFH+ CID WL+ HS+CPLCR  +   ++ ++
Sbjct  177   AFHVSCIDTWLKSHSNCPLCRAFIAGAEIVVV  208



>ref|XP_009361402.1| PREDICTED: RING-H2 finger protein ATL52 [Pyrus x bretschneideri]
Length=362

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 85/147 (58%), Gaps = 6/147 (4%)
 Frame = -1

Query  1233  DQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASILNTTLQIPDALLG  1069
             +Q        P ++ +IGI A  F L  +  + +++C R     A  +      P+ +  
Sbjct  50    NQQDSPTDLSPLIIAIIGIFASAFILVTYYTIISRYCRRRGGDGAQDMEMDSSNPNLVSE  109

Query  1068  SWRRSS-GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
             S + S+ G+D+T+++S+   ++       EG +CSVCLS FE+ E LRLLPKC HAFH+ 
Sbjct  110   SMQGSNNGLDETLIKSITVHKYKKGDKLVEGTDCSVCLSEFEENESLRLLPKCNHAFHVR  169

Query  891   CIDQWLEKHSSCPLCRHKVTAEDLSLM  811
             CID WL+ HSSCPLCR  + A  ++L+
Sbjct  170   CIDTWLKSHSSCPLCRSNIAAPAIALV  196



>ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60653.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 24/150 (16%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHR----------ASILNTTLQI-----------  1087
             P L+ +IGILA  F L  +  L +K+CHR          A+++N    I           
Sbjct  57    PLLIALIGILASAFILVSYYTLISKYCHRRRHNSSSSTSAAVINRDHGISSDYTWQEATN  116

Query  1086  PDALLGSWRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKH  907
             P+  +G      G+D+++++S+  +++  + G  E  +CSVCLS F++ E LRLLPKC H
Sbjct  117   PNPTIGG---GDGLDESLIKSITVYKYRKMDGFVESSDCSVCLSEFQENESLRLLPKCNH  173

Query  906   AFHIHCIDQWLEKHSSCPLCRHKVTAEDLS  817
             AFH+ CID WL+ HS+CPLCR  +   +++
Sbjct  174   AFHVPCIDTWLKSHSNCPLCRAFIAGVNVT  203



>gb|ACN37076.1| unknown [Zea mays]
Length=233

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 74/131 (56%), Gaps = 6/131 (5%)
 Frame = -1

Query  1218  TNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW---RRSSG  1048
             + +F PS+ +VI +L   F    F  +Y + C+       +   P A  G+    RR  G
Sbjct  47    SQSFSPSMAIVIVVLIAAFFFLGFFSIYVRHCYGDGSSGYSANRPPAPGGAAARSRRQRG  106

Query  1047  IDKTVVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQW  877
             +D+ V+ES P   ++ +K  + G   LEC+VCLS F+D E LRLLPKC H FH  CID W
Sbjct  107   LDEAVLESFPTMAYADVKAHKAGKGALECAVCLSEFDDDETLRLLPKCSHVFHPDCIDTW  166

Query  876   LEKHSSCPLCR  844
             L  H +CP+CR
Sbjct  167   LASHVTCPVCR  177



>gb|KDP41433.1| hypothetical protein JCGZ_15840 [Jatropha curcas]
Length=424

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 85/162 (52%), Gaps = 12/162 (7%)
 Frame = -1

Query  1263  AQHPSTIIPNDQSP--DTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             AQ  S   PN   P      F PSL +++ I+   F L  F  +Y + C  +    TT  
Sbjct  31    AQQGSPPPPNVNDPFAQQPKFNPSLAILMVIIVSAFFLMGFCSIYVRRCAESRYRGTTFN  90

Query  1089  I---PDALLGSWRRSS--GIDKTVVESLPFFRFSSLKG---SREGLECSVCLSRFEDIEI  934
                 P    G W R    G+D  V+ + P F +S++KG    ++ LEC+VCL+ FED + 
Sbjct  91    PSASPIGGAGRWSRRGQQGLDAEVIGTFPTFLYSTVKGHKIGKDSLECAVCLNEFEDDQT  150

Query  933   LRLLPKCKHAFHIHCIDQWLEKHSSCPLCRHKVTAE--DLSL  814
             LRL+PKC H FH  CID WL  H++CP+CR  +  +  DLS 
Sbjct  151   LRLIPKCSHVFHPDCIDAWLGSHTTCPVCRANLVPKPGDLSF  192



>gb|EYU24462.1| hypothetical protein MIMGU_mgv1a019339mg [Erythranthe guttata]
Length=335

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 112/212 (53%), Gaps = 12/212 (6%)
 Frame = -1

Query  1224  PDTNT---FQPSLVVVIGILAIMFSLTFFLLLYAKFC----HRASILNTTLQIPDALLGS  1066
             PDT++   F P ++ +IG+LA +F L  +  +  ++C    +R +  +     P+     
Sbjct  41    PDTDSAAPFSPLIIAIIGVLASVFLLVSYYAIVTRYCKGRRNRTATTSPDQTEPNRDQFH  100

Query  1065  WRRSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
                +SG+D+ +++ +   +F    G  EG EC+VCLS FE+ E LRLLPKC HAFH+ CI
Sbjct  101   VDSASGLDEALIKKIAVCKFVRGDGLIEGSECAVCLSEFEENEPLRLLPKCSHAFHLPCI  160

Query  885   DQWLEKHSSCPLCRHKVT--AEDLSLMNFSSSLRFLCSDSREESSLGLYIQRQESFKFGS  712
             D WL  HS+CPLCR  V   A  L +   SSS   L  DS ++ +L   +   +  +  S
Sbjct  161   DTWLRSHSNCPLCRAHVVVLANHLPIAQPSSSPPPLYVDSNQDPALNELVLTVDDREIVS  220

Query  711   RKIKKDEKLPIQN-DQSLQKPLHHLNHRIIVS  619
                  D + P Q+ D++ +  +  +   IIV 
Sbjct  221   P--ISDNRSPFQDCDENAEVVIKEVTSEIIVG  250



>gb|KFK41641.1| hypothetical protein AALP_AA2G154100 [Arabis alpina]
Length=391

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (59%), Gaps = 14/151 (9%)
 Frame = -1

Query  1266  KAQHPSTIIPNDQSPDTNTFQPSLVVVIGIL-AIMFSLTFFLLLYAKFCHRASILNTTLQ  1090
             KA   +T   +D + D++ F P++ +++ +L ++ F+L FF +   +   R   +   + 
Sbjct  31    KASGQATHGGSDVTGDSSRFDPTMAILMIVLVSVFFALGFFSVYIRRCLERVMGMENNVD  90

Query  1089  IPDALLGSWR------RSSGIDKTVVESLPFFRFSSLKG---SREGLECSVCLSRFEDIE  937
             +     G+WR       + G+D +V+E+ P FR+S++K     +E LEC VCL+ FED E
Sbjct  91    V----TGNWRSGINRQAARGLDASVIETFPTFRYSTVKTLRIGKEALECPVCLNEFEDDE  146

Query  936   ILRLLPKCKHAFHIHCIDQWLEKHSSCPLCR  844
              LRL+PKC H FH  CID WL  H++CPLCR
Sbjct  147   TLRLIPKCCHVFHPACIDAWLRSHATCPLCR  177



>ref|XP_004494634.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Cicer arietinum]
Length=377

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 5/133 (4%)
 Frame = -1

Query  1215  NTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSWRRSSGIDKT  1036
             N F PS  ++I IL     L  F  +Y + C  +   N  L I D    S R + G+D +
Sbjct  43    NEFNPSFAIIIVILVAALFLMGFFSIYIRRCADSPTSNFVLPITDGR--SRRAARGLDSS  100

Query  1035  VVESLPFFRFSSLKGSREG---LECSVCLSRFEDIEILRLLPKCKHAFHIHCIDQWLEKH  865
             V+ + P   +S +K  + G   LEC+VCL  FED E LRL+PKC H FH  CID+WL  H
Sbjct  101   VINTFPILEYSEVKIHKIGKEILECAVCLCEFEDTETLRLIPKCDHVFHPECIDEWLSSH  160

Query  864   SSCPLCRHKVTAE  826
             ++CP+CR  +  +
Sbjct  161   TTCPVCRANLVPQ  173



>ref|XP_010420490.1| PREDICTED: RING-H2 finger protein ATL52-like [Camelina sativa]
Length=376

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 83/139 (60%), Gaps = 14/139 (10%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHR--ASILNTTLQIPDALLGSWRRSS-------  1051
             P L+ +IGIL   F L  +  L +K+CHR  +S  ++TL + +   G    SS       
Sbjct  59    PLLIALIGILVSAFILVSYYTLISKYCHRHHSSDTSSTLNLNNNRNGEGTFSSTQRLSNT  118

Query  1050  -----GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIHCI  886
                  G++++ ++S+  +++    G  +G +CSVCLS FE+ E LRLLPKC HAFH+ CI
Sbjct  119   NTTGDGLNESTIKSITVYKYRKGDGFVDGSDCSVCLSEFEENESLRLLPKCNHAFHLPCI  178

Query  885   DQWLEKHSSCPLCRHKVTA  829
             D WL+ HS+CPLCR  VT 
Sbjct  179   DTWLKSHSNCPLCRAFVTG  197



>ref|XP_010485695.1| PREDICTED: RING-H2 finger protein ATL51-like [Camelina sativa]
Length=347

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 89/148 (60%), Gaps = 17/148 (11%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHR---------ASILNTTLQIPDALLGSWRRSS  1051
             P L+ +IGILA  F L  +  L +K+CHR         A+ +NT      +   +W+ ++
Sbjct  57    PLLIALIGILASAFILVSYYTLISKYCHRRRQNSSSSSAAAINTEHGRISSDYTTWQEAT  116

Query  1050  --------GIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHI  895
                     G+D+++++S+  +++  + G  E  +CSVCLS F++ E LRLLPKC HAFH+
Sbjct  117   NPNPAIGDGLDESLIKSITVYKYKKIDGFVESSDCSVCLSEFQENESLRLLPKCNHAFHV  176

Query  894   HCIDQWLEKHSSCPLCRHKVTAEDLSLM  811
              CID WL+ HS+CPLCR  ++  ++ ++
Sbjct  177   PCIDTWLKSHSNCPLCRAFISGAEIVVV  204



>gb|KDO36222.1| hypothetical protein CISIN_1g045417mg, partial [Citrus sinensis]
Length=184

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 83/144 (58%), Gaps = 8/144 (6%)
 Frame = -1

Query  1239  PNDQSPDTNT-FQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIPDALLGSW  1063
             P    P +N  F PSL ++I +L        F  +Y + C  +S  N+ ++   A     
Sbjct  42    PGSVDPYSNMKFSPSLAIIIVVLISALFFMGFFSIYIRHCSDSS--NSVIRPSGAGGNRS  99

Query  1062  RRSS--GIDKTVVESLPFFRFS---SLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFH  898
             RR +  G+D+ V+++ P F +S   +LK  +  LEC+VCL+ FED E LRL+PKC H FH
Sbjct  100   RRGAARGLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFH  159

Query  897   IHCIDQWLEKHSSCPLCRHKVTAE  826
               CID WLE H++CP+CR  + +E
Sbjct  160   PECIDAWLESHTTCPVCRSNLASE  183



>gb|KHN10200.1| Putative RING-H2 finger protein ATL12 [Glycine soja]
Length=281

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFC----HRASILNTTLQIPDALLGSWRRSSGIDKT  1036
             PS  ++I +L+ MF++ F LLLY KFC    H     N+ LQ    L     R SGIDK 
Sbjct  51    PSKGIIIAVLSTMFAIAFLLLLYVKFCRVIPHELLRQNSNLQNFQGLTRPRSRVSGIDKQ  110

Query  1035  VVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHA  904
             V+E+LP+F+FSSLKGS+EGLEC+VCLS+FED E LRLLP  +  
Sbjct  111   VIETLPYFKFSSLKGSKEGLECTVCLSKFEDTETLRLLPNTRFG  154



>emb|CDP09319.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 6/145 (4%)
 Frame = -1

Query  1254  PSTIIPNDQSPDTNTFQPSLVVVIGILAIMFSLTFFLLLYAKFCHRASILNTTLQIP---  1084
             P   + ND    T TF P ++ ++GILA  F L  +  +  ++C R    N+ ++     
Sbjct  38    PPPPLGNDDGSGT-TFSPLIIAILGILASAFLLVSYYTIVTRYCRRRRSRNSNIEFEAHH  96

Query  1083  -DALLGSWR-RSSGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCK  910
              +     W+  ++G+D+ +++S+  FR+    G  EG EC+VCL+ F++ E LRLLPKC 
Sbjct  97    DEVTHDQWQVATTGLDEALIKSITVFRYKKGDGLVEGTECAVCLNEFQEDESLRLLPKCC  156

Query  909   HAFHIHCIDQWLEKHSSCPLCRHKV  835
             HAFH+ CID WL+ HS+CPLCR  V
Sbjct  157   HAFHLPCIDAWLKSHSNCPLCRANV  181



>ref|XP_006408292.1| hypothetical protein EUTSA_v10022279mg [Eutrema salsugineum]
 gb|ESQ49745.1| hypothetical protein EUTSA_v10022279mg [Eutrema salsugineum]
Length=381

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 94/174 (54%), Gaps = 22/174 (13%)
 Frame = -1

Query  1203  PSLVVVIGILAIMFSLTFFLLLYAKFCHR-----ASILNTTLQIPDALLGSWRRS-----  1054
             P L+ +IGILA  F L  +  L +K+CHR     +  ++  L I  +    W+ +     
Sbjct  57    PLLIALIGILASAFILVSYYTLISKYCHRRRLGSSGAISRDLGISSSATDPWQGTIRAPN  116

Query  1053  ------SGIDKTVVESLPFFRFSSLKGSREGLECSVCLSRFEDIEILRLLPKCKHAFHIH  892
                    G+D+++++S+  +++    G  E  +CSVCLS F++ E LRLLPKC HAFH+ 
Sbjct  117   PNAEAGDGLDESLIKSITVYKYRKGDGFVESSDCSVCLSEFQEDESLRLLPKCNHAFHVP  176

Query  891   CIDQWLEKHSSCPLCR------HKVTAEDLSLMNFSSSLRFLCSDSREESSLGL  748
             CID WL+ HS+CPLCR      + V A  +S    S       S  R+E ++G+
Sbjct  177   CIDTWLKSHSNCPLCRAFIAGINAVEAVAVSSQPISGHQVSAESGDRDEGTVGI  230



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3840081377382