BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32540_g1_i1 len=990 path=[968:0-989]

Length=990
                                                                      Score     E

ref|XP_006349932.1|  PREDICTED: cytochrome b5-like                      147   2e-39   
ref|XP_004252999.1|  PREDICTED: cytochrome b5-like                      146   4e-39   
ref|XP_009625302.1|  PREDICTED: cytochrome b5, seed isoform-like        144   1e-38   
ref|XP_009789167.1|  PREDICTED: cytochrome b5-like                      143   4e-38   
emb|CDO99453.1|  unnamed protein product                                134   2e-34   
ref|XP_011091691.1|  PREDICTED: cytochrome b5, seed isoform-like        133   3e-34   
gb|EYU32657.1|  hypothetical protein MIMGU_mgv1a017734mg                132   9e-34   
ref|XP_002265677.1|  PREDICTED: cytochrome b5                           121   6e-30   Vitis vinifera
ref|XP_006847492.1|  hypothetical protein AMTR_s00163p00076750          121   1e-29   
ref|XP_007049778.1|  Cytochrome B5, n4,ATCB5-B,CB5-B                    119   5e-29   
ref|XP_010509977.1|  PREDICTED: cytochrome b5 isoform B-like            119   5e-29   
ref|XP_010036819.1|  PREDICTED: cytochrome b5-like                      119   5e-29   
ref|XP_009371627.1|  PREDICTED: cytochrome b5-like                      119   7e-29   
ref|XP_004296652.1|  PREDICTED: cytochrome b5 isoform B-like            119   8e-29   
ref|XP_008372473.1|  PREDICTED: cytochrome b5                           119   8e-29   
ref|XP_002521096.1|  cytochrome B5 isoform 1, putative                  119   8e-29   Ricinus communis
ref|XP_009334928.1|  PREDICTED: cytochrome b5-like                      118   1e-28   
ref|XP_009348240.1|  PREDICTED: cytochrome b5 isoform B-like            118   2e-28   
ref|XP_008382631.1|  PREDICTED: cytochrome b5-like                      118   2e-28   
gb|KDP20335.1|  hypothetical protein JCGZ_06421                         117   2e-28   
ref|XP_008376513.1|  PREDICTED: cytochrome b5 isoform B-like            117   2e-28   
ref|XP_009792131.1|  PREDICTED: cytochrome b5                           117   2e-28   
emb|CAA50575.1|  cytochrome b5                                          117   2e-28   Nicotiana tabacum [American tobacco]
ref|XP_006352692.1|  PREDICTED: cytochrome b5-like                      117   3e-28   
gb|KHG05589.1|  Cytochrome b5                                           117   3e-28   
ref|XP_004247085.1|  PREDICTED: cytochrome b5                           117   3e-28   
gb|AAT84460.1|  cytochrome b5 isoform Cb5-C                             117   3e-28   Vernicia fordii [tung oil tree]
ref|XP_006420893.1|  hypothetical protein CICLE_v10006192mg             117   3e-28   
gb|KDP26389.1|  hypothetical protein JCGZ_17547                         117   4e-28   
ref|XP_002303038.1|  cytochrome b5 isoform Cb5-C family protein         117   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004242405.1|  PREDICTED: cytochrome b5-like                      116   4e-28   
ref|XP_002518143.1|  cytochrome B5 isoform 1, putative                  116   5e-28   Ricinus communis
ref|XP_009611133.1|  PREDICTED: cytochrome b5                           116   5e-28   
ref|XP_010069657.1|  PREDICTED: cytochrome b5                           116   6e-28   
ref|XP_010469554.1|  PREDICTED: cytochrome b5 isoform B                 116   7e-28   
ref|XP_009611358.1|  PREDICTED: cytochrome b5, seed isoform             116   7e-28   
gb|AAT84459.1|  cytochrome b5 isoform Cb5-B                             116   8e-28   Vernicia fordii [tung oil tree]
ref|XP_010929918.1|  PREDICTED: cytochrome b5-like                      115   8e-28   
ref|XP_009599430.1|  PREDICTED: cytochrome b5-like                      115   1e-27   
gb|ABK94544.1|  unknown                                                 115   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_004240459.1|  PREDICTED: cytochrome b5-like                      115   1e-27   
dbj|BAJ92137.1|  predicted protein                                      115   1e-27   
ref|XP_003552132.1|  PREDICTED: cytochrome b5-like isoform X1           115   1e-27   
ref|XP_010245991.1|  PREDICTED: cytochrome b5                           115   1e-27   
gb|KGN56742.1|  hypothetical protein Csa_3G131950                       115   1e-27   
ref|XP_009393770.1|  PREDICTED: cytochrome b5 isoform B                 115   2e-27   
sp|O04354.1|CYB5_BOROF  RecName: Full=Cytochrome b5                     115   2e-27   Borago officinalis
ref|XP_010413956.1|  PREDICTED: cytochrome b5 isoform B-like            115   2e-27   
ref|XP_008438367.1|  PREDICTED: cytochrome b5 isoform B-like            115   2e-27   
ref|XP_009766798.1|  PREDICTED: cytochrome b5-like                      115   2e-27   
gb|EYU39233.1|  hypothetical protein MIMGU_mgv1a016179mg                114   2e-27   
ref|XP_008380573.1|  PREDICTED: cytochrome b5-like                      114   2e-27   
ref|XP_006443603.1|  hypothetical protein CICLE_v10022818mg             114   2e-27   
ref|XP_008235483.1|  PREDICTED: cytochrome b5                           115   2e-27   
gb|KFK31291.1|  hypothetical protein AALP_AA6G093400                    115   2e-27   
ref|XP_009374604.1|  PREDICTED: cytochrome b5-like                      114   3e-27   
ref|XP_010107764.1|  putative cytochrome b5 isoform 2                   114   3e-27   
ref|XP_004290210.1|  PREDICTED: cytochrome b5-like                      114   3e-27   
gb|KFK26373.1|  hypothetical protein AALP_AA8G240100                    114   3e-27   
ref|NP_001054434.1|  Os05g0108800                                       114   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010552054.1|  PREDICTED: cytochrome b5-like                      114   5e-27   
emb|CAA53366.1|  cytochrome b5                                          114   5e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007201359.1|  hypothetical protein PRUPE_ppa013179mg             114   5e-27   
ref|XP_007034387.1|  Cytochrome B5, n4,ATCB5-B,CB5-B                    114   5e-27   
ref|XP_006356775.1|  PREDICTED: cytochrome b5-like                      114   5e-27   
ref|XP_010685005.1|  PREDICTED: cytochrome b5                           113   6e-27   
gb|KHN37769.1|  Cytochrome b5                                           113   7e-27   
gb|EMT13800.1|  Cytochrome b5                                           113   9e-27   
ref|NP_001045534.1|  Os01g0971500                                       113   9e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EYU40608.1|  hypothetical protein MIMGU_mgv1a016092mg                113   1e-26   
ref|XP_003569109.1|  PREDICTED: cytochrome b5-like                      113   1e-26   
ref|XP_010264100.1|  PREDICTED: cytochrome b5                           112   1e-26   
ref|NP_180831.1|  cytochrome B5 isoform B                               112   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAA48240.1|  cytochrome b5                                          111   1e-26   Nicotiana tabacum [American tobacco]
ref|XP_004133998.1|  PREDICTED: cytochrome b5 isoform B-like            114   1e-26   
ref|XP_002881239.1|  B5 #4                                              112   1e-26   
emb|CDY00045.1|  BnaC09g02560D                                          113   1e-26   
ref|XP_006601762.1|  PREDICTED: uncharacterized protein LOC100500...    112   1e-26   
ref|XP_006645329.1|  PREDICTED: cytochrome b5-like                      112   1e-26   
ref|XP_009403628.1|  PREDICTED: cytochrome b5 isoform B-like            112   1e-26   
ref|XP_007223823.1|  hypothetical protein PRUPE_ppa013221mg             112   1e-26   
ref|XP_010069046.1|  PREDICTED: cytochrome b5                           112   1e-26   
emb|CDY23792.1|  BnaC04g43300D                                          112   1e-26   
ref|XP_009141270.1|  PREDICTED: cytochrome b5 isoform B                 112   2e-26   
ref|XP_006856406.1|  hypothetical protein AMTR_s00047p00213630          112   2e-26   
gb|EMS64911.1|  Cytochrome b5                                           112   2e-26   
ref|XP_009386687.1|  PREDICTED: cytochrome b5-like                      111   3e-26   
ref|XP_006295218.1|  hypothetical protein CARUB_v10024300mg             112   3e-26   
ref|XP_003532293.1|  PREDICTED: cytochrome b5-like                      112   3e-26   
ref|XP_010520941.1|  PREDICTED: cytochrome b5                           112   3e-26   
emb|CDJ26519.1|  unnamed protein product                                112   3e-26   
emb|CAA04702.1|  cytochrome b5                                          111   3e-26   Olea europaea
ref|XP_007133998.1|  hypothetical protein PHAVU_010G010400g             111   3e-26   
ref|XP_009415974.1|  PREDICTED: cytochrome b5 isoform B-like            111   3e-26   
gb|KHN07183.1|  Cytochrome b5                                           112   3e-26   
ref|XP_008457249.1|  PREDICTED: cytochrome b5 isoform B-like            111   3e-26   
ref|XP_009111854.1|  PREDICTED: cytochrome B5 isoform D-like            111   4e-26   
emb|CDY19937.1|  BnaA09g03140D                                          111   4e-26   
gb|AFK43806.1|  unknown                                                 111   5e-26   
ref|XP_002457023.1|  hypothetical protein SORBIDRAFT_03g047300          111   5e-26   Sorghum bicolor [broomcorn]
gb|ABA54489.1|  cytochrome b5 type 06                                   110   5e-26   Crepis alpina
emb|CDX79471.1|  BnaC03g18070D                                          110   6e-26   
ref|XP_006410400.1|  hypothetical protein EUTSA_v10017407mg             110   6e-26   
emb|CDP05012.1|  unnamed protein product                                110   6e-26   
gb|ACG40422.1|  cytochrome b5                                           112   6e-26   Zea mays [maize]
ref|XP_004971419.1|  PREDICTED: cytochrome b5-like                      110   6e-26   
ref|XP_006653959.1|  PREDICTED: cytochrome b5-like                      110   7e-26   
ref|XP_008224490.1|  PREDICTED: cytochrome b5 isoform B                 110   8e-26   
ref|XP_008656842.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome b5      112   8e-26   
ref|NP_001238196.1|  uncharacterized protein LOC100306652               110   9e-26   
gb|EMS45540.1|  Cytochrome b5                                           110   1e-25   
ref|XP_009151679.1|  PREDICTED: cytochrome B5 isoform D                 110   1e-25   
ref|XP_003565166.1|  PREDICTED: cytochrome b5                           110   1e-25   
dbj|BAJ94749.1|  predicted protein                                      110   1e-25   
gb|ACF84051.1|  unknown                                                 109   1e-25   Zea mays [maize]
ref|XP_006395118.1|  hypothetical protein EUTSA_v10005107mg             109   2e-25   
ref|NP_199692.1|  cytochrome B5 isoform D                               110   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132870.1|  PREDICTED: cytochrome b5 isoform B                 109   2e-25   
ref|XP_002439129.1|  hypothetical protein SORBIDRAFT_09g000970          109   2e-25   Sorghum bicolor [broomcorn]
ref|XP_008793730.1|  PREDICTED: cytochrome b5-like                      109   2e-25   
gb|KFK38164.1|  hypothetical protein AALP_AA3G077400                    109   2e-25   
ref|XP_010912953.1|  PREDICTED: cytochrome b5-like                      109   2e-25   
ref|XP_006401690.1|  hypothetical protein EUTSA_v10014996mg             109   3e-25   
emb|CDX86279.1|  BnaA06g29960D                                          109   3e-25   
ref|XP_004138957.1|  PREDICTED: cytochrome b5 isoform B-like            108   3e-25   
ref|XP_002864250.1|  ATB5-A                                             108   4e-25   
ref|NP_001136781.1|  uncharacterized protein LOC100216924               108   4e-25   Zea mays [maize]
ref|XP_011089100.1|  PREDICTED: cytochrome b5-like                      108   5e-25   
ref|NP_001236788.1|  uncharacterized protein LOC100500611               107   5e-25   
ref|XP_009143942.1|  PREDICTED: cytochrome b5 isoform B-like            108   5e-25   
ref|XP_006279708.1|  hypothetical protein CARUB_v10027337mg             108   5e-25   
gb|KCW57256.1|  hypothetical protein EUGRSUZ_H00059                     110   6e-25   
ref|NP_200168.1|  cytochrome B5 isoform E                               108   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770042.1|  predicted protein                                  108   6e-25   
ref|XP_009397516.1|  PREDICTED: cytochrome b5 isoform A-like            108   6e-25   
ref|XP_010671362.1|  PREDICTED: cytochrome b5 isoform E                 108   7e-25   
ref|XP_010550884.1|  PREDICTED: cytochrome b5-like                      107   8e-25   
ref|XP_010439683.1|  PREDICTED: cytochrome B5 isoform D                 107   9e-25   
emb|CDX84725.1|  BnaA03g15050D                                          107   9e-25   
gb|KHN23327.1|  Cytochrome b5 isoform 1                                 107   9e-25   
ref|XP_009119906.1|  PREDICTED: cytochrome b5                           107   1e-24   
emb|CDX85364.1|  BnaC07g26750D                                          107   1e-24   
ref|NP_001065073.2|  Os10g0518200                                       107   1e-24   Oryza sativa Japonica Group [Japonica rice]
sp|P40934.1|CYB5_BRAOB  RecName: Full=Cytochrome b5                     107   1e-24   Brassica oleracea var. botrytis [cauliflower]
ref|XP_010522424.1|  PREDICTED: cytochrome b5 isoform B                 107   1e-24   
gb|ACG33225.1|  cytochrome b5                                           107   1e-24   Zea mays [maize]
gb|EMT06977.1|  Cytochrome b5                                           107   1e-24   
gb|EMS59648.1|  Cytochrome b5                                           107   1e-24   
ref|NP_001235088.1|  uncharacterized protein LOC100305929               107   1e-24   
ref|XP_006281477.1|  hypothetical protein CARUB_v10027561mg             107   1e-24   
ref|XP_003574201.1|  PREDICTED: cytochrome b5                           107   1e-24   
emb|CDY14370.1|  BnaA10g06850D                                          107   1e-24   
ref|XP_006493156.1|  PREDICTED: cytochrome b5 isoform A-like isof...    107   2e-24   
dbj|BAK03168.1|  predicted protein                                      107   2e-24   
ref|XP_010442925.1|  PREDICTED: cytochrome b5 isoform A                 107   2e-24   
gb|AFK39502.1|  unknown                                                 107   2e-24   
emb|CDP03875.1|  unnamed protein product                                107   2e-24   
ref|XP_010252345.1|  PREDICTED: cytochrome b5 isoform A                 106   2e-24   
ref|XP_007140599.1|  hypothetical protein PHAVU_008G125800g             106   2e-24   
ref|XP_009127155.1|  PREDICTED: cytochrome b5-like                      106   2e-24   
ref|XP_011011719.1|  PREDICTED: cytochrome b5 isoform A                 106   3e-24   
ref|XP_010318050.1|  PREDICTED: cytochrome b5 isoform A                 106   3e-24   
sp|P49097.1|CYB5_CUSRE  RecName: Full=Cytochrome b5                     106   3e-24   Cuscuta reflexa [giant dodder]
gb|KEH29077.1|  cytochrome b5-like heme/steroid-binding domain pr...    106   3e-24   
gb|ABK23699.1|  unknown                                                 106   3e-24   Picea sitchensis
ref|XP_010524689.1|  PREDICTED: cytochrome b5                           106   3e-24   
ref|XP_002865680.1|  ATB5-B                                             106   3e-24   
ref|XP_011089685.1|  PREDICTED: cytochrome b5-like                      105   4e-24   
ref|XP_010482757.1|  PREDICTED: cytochrome b5 isoform A-like            105   4e-24   
ref|XP_002314997.2|  cytochrome b5 isoform Cb5-D family protein         105   4e-24   Populus trichocarpa [western balsam poplar]
gb|EYU42121.1|  hypothetical protein MIMGU_mgv1a016165mg                105   4e-24   
ref|XP_010464293.1|  PREDICTED: cytochrome b5-like                      105   4e-24   
gb|EEC67315.1|  hypothetical protein OsI_34332                          107   4e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_006661960.1|  PREDICTED: cytochrome b5-like                      105   4e-24   
emb|CDY20247.1|  BnaC09g29920D                                          107   4e-24   
ref|XP_006577772.1|  PREDICTED: uncharacterized protein LOC100499...    105   4e-24   
ref|XP_006367355.1|  PREDICTED: cytochrome b5 isoform A-like            105   5e-24   
ref|XP_011075921.1|  PREDICTED: cytochrome b5 isoform E                 105   5e-24   
gb|AFK40091.1|  unknown                                                 105   6e-24   
ref|XP_002884627.1|  hypothetical protein ARALYDRAFT_896865             105   6e-24   
ref|XP_003604969.1|  Cytochrome b5                                      105   8e-24   
ref|XP_010090895.1|  Cytochrome b5 isoform 1                            105   8e-24   
gb|EYU45298.1|  hypothetical protein MIMGU_mgv1a016099mg                105   8e-24   
ref|XP_009602193.1|  PREDICTED: cytochrome b5 isoform A-like            105   8e-24   
emb|CDP00455.1|  unnamed protein product                                105   8e-24   
ref|XP_009388909.1|  PREDICTED: cytochrome b5                           105   9e-24   
ref|XP_009593163.1|  PREDICTED: cytochrome b5 isoform A                 104   1e-23   
gb|ABK22670.1|  unknown                                                 104   1e-23   Picea sitchensis
ref|XP_010486251.1|  PREDICTED: cytochrome B5 isoform D-like            104   1e-23   
ref|XP_011084546.1|  PREDICTED: cytochrome b5 isoform E-like            104   1e-23   
ref|XP_003559382.1|  PREDICTED: cytochrome b5                           104   1e-23   
gb|ABK23501.1|  unknown                                                 104   1e-23   Picea sitchensis
ref|XP_008811745.1|  PREDICTED: cytochrome b5-like                      104   1e-23   
ref|NP_001288487.1|  cytochrome b5                                      104   1e-23   
emb|CDY12180.1|  BnaC04g12100D                                          105   1e-23   
ref|NP_001236501.1|  uncharacterized protein LOC100499823               104   1e-23   
ref|XP_010555748.1|  PREDICTED: cytochrome b5 isoform E-like            104   1e-23   
ref|XP_009786222.1|  PREDICTED: cytochrome b5 isoform B                 104   1e-23   
emb|CAA04703.1|  cytochome b5                                           104   2e-23   Olea europaea
ref|XP_006441191.1|  hypothetical protein CICLE_v10022811mg             104   2e-23   
ref|XP_008810951.1|  PREDICTED: cytochrome b5                           103   2e-23   
gb|ACG45610.1|  cytochrome b5                                           103   2e-23   Zea mays [maize]
ref|XP_010933787.1|  PREDICTED: cytochrome b5 isoform E-like            103   2e-23   
ref|XP_010445931.1|  PREDICTED: cytochrome b5 isoform A-like            103   2e-23   
gb|ACG41888.1|  cytochrome b5                                           103   2e-23   Zea mays [maize]
gb|ACG49215.1|  cytochrome b5                                           103   2e-23   Zea mays [maize]
emb|CDY59638.1|  BnaAnng16110D                                          103   3e-23   
ref|XP_009796903.1|  PREDICTED: cytochrome b5 isoform A-like            103   3e-23   
ref|XP_004981737.1|  PREDICTED: cytochrome b5 isoform B-like            103   3e-23   
ref|XP_004960538.1|  PREDICTED: cytochrome b5-like                      103   3e-23   
gb|AFK33484.1|  unknown                                                 103   3e-23   
ref|XP_009115356.1|  PREDICTED: cytochrome b5 isoform A                 103   3e-23   
ref|XP_002466437.1|  hypothetical protein SORBIDRAFT_01g007770          103   3e-23   Sorghum bicolor [broomcorn]
ref|XP_002300176.1|  cytochrome b5 isoform 2 family protein             103   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009628358.1|  PREDICTED: cytochrome b5 isoform B                 103   3e-23   
ref|XP_007039163.1|  Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1          103   4e-23   
ref|XP_009798397.1|  PREDICTED: cytochrome b5 isoform A-like            103   4e-23   
ref|XP_007136483.1|  hypothetical protein PHAVU_009G048900g             103   4e-23   
ref|XP_009389266.1|  PREDICTED: cytochrome b5 isoform A-like            103   4e-23   
ref|XP_010937875.1|  PREDICTED: cytochrome b5 isoform A                 102   4e-23   
ref|XP_009351942.1|  PREDICTED: cytochrome b5 isoform A-like            102   5e-23   
ref|XP_001764653.1|  predicted protein                                  103   6e-23   
gb|AFK48600.1|  unknown                                                 102   6e-23   
ref|XP_002464365.1|  hypothetical protein SORBIDRAFT_01g017020          102   6e-23   Sorghum bicolor [broomcorn]
emb|CDX85016.1|  BnaC05g20390D                                          102   6e-23   
ref|XP_002264175.1|  PREDICTED: cytochrome b5 isoform A                 102   6e-23   Vitis vinifera
ref|XP_004982596.1|  PREDICTED: cytochrome b5-like isoform X1           102   7e-23   
gb|ADB85108.1|  cytochrome b5                                           102   7e-23   
ref|XP_010100688.1|  Cytochrome b5, seed isoform                        102   7e-23   
emb|CDY47080.1|  BnaA03g12180D                                          102   9e-23   
ref|XP_002893406.1|  B5 #6                                              102   9e-23   
ref|XP_010680659.1|  PREDICTED: cytochrome b5 isoform A                 102   9e-23   
ref|XP_004239033.1|  PREDICTED: cytochrome b5 isoform B                 102   1e-22   
gb|AAM28288.1|  cytochrome b5                                           102   1e-22   Ananas comosus
gb|EPS71800.1|  hypothetical protein M569_02962                         102   1e-22   
ref|XP_010692750.1|  PREDICTED: cytochrome b5-like                      102   1e-22   
gb|EPS63893.1|  hypothetical protein M569_10892                         101   1e-22   
ref|XP_008791612.1|  PREDICTED: cytochrome b5 isoform A                 101   1e-22   
gb|KFK28993.1|  hypothetical protein AALP_AA7G074900                    101   1e-22   
ref|XP_006407869.1|  hypothetical protein EUTSA_v10021984mg             102   2e-22   
ref|XP_008790560.1|  PREDICTED: cytochrome b5 isoform A-like            101   2e-22   
ref|XP_010109733.1|  Cytochrome b5                                      101   2e-22   
ref|XP_004506597.1|  PREDICTED: cytochrome b5-like                      100   2e-22   
gb|ACG48334.1|  cytochrome b5                                           100   2e-22   Zea mays [maize]
gb|EPS57444.1|  hypothetical protein M569_17373                         101   2e-22   
ref|XP_008437642.1|  PREDICTED: cytochrome b5 isoform A                 100   2e-22   
ref|XP_007039165.1|  Cytochrome B5, n2,ATCB5-E,CB5-E isoform 3          101   2e-22   
ref|NP_001281054.1|  cytochrome b5-like                                 100   3e-22   
ref|XP_006348668.1|  PREDICTED: cytochrome b5 isoform B-like            100   3e-22   
ref|XP_009803510.1|  PREDICTED: cytochrome b5-like                      100   3e-22   
gb|AEC11004.1|  cytochrome b5                                           100   3e-22   
ref|NP_001169183.1|  uncharacterized protein LOC100383035               100   3e-22   Zea mays [maize]
gb|EPS64889.1|  hypothetical protein M569_09892                         100   3e-22   
ref|XP_010260586.1|  PREDICTED: cytochrome b5 isoform B isoform X1      100   3e-22   
ref|XP_008234680.1|  PREDICTED: cytochrome b5 isoform A                 100   3e-22   
gb|ACG37757.1|  cytochrome b5                                           100   3e-22   Zea mays [maize]
gb|ACG44497.1|  cytochrome b5                                           100   3e-22   Zea mays [maize]
ref|XP_008465053.1|  PREDICTED: cytochrome b5, seed isoform-like        100   3e-22   
ref|XP_002323982.1|  hypothetical protein POPTR_0017s08140g             100   4e-22   Populus trichocarpa [western balsam poplar]
gb|KHG21565.1|  Cytochrome b5                                           100   4e-22   
ref|NP_173958.1|  cytochrome B5 isoform A                               100   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ACG47454.1|  cytochrome b5                                           100   4e-22   Zea mays [maize]
ref|XP_007218582.1|  hypothetical protein PRUPE_ppa013232mg             100   4e-22   
gb|AAT84461.1|  cytochrome b5 isoform Cb5-D                             100   5e-22   Vernicia fordii [tung oil tree]
ref|XP_002518220.1|  cytochrome B5 isoform 1, putative                  100   5e-22   Ricinus communis
gb|ACG44032.1|  cytochrome b5                                           100   5e-22   Zea mays [maize]
ref|XP_010729780.1|  PREDICTED: cytochrome b5-like                      100   5e-22   
dbj|BAK07446.1|  predicted protein                                      100   5e-22   
ref|XP_011041869.1|  PREDICTED: cytochrome b5-like                    99.8    6e-22   
ref|XP_008381360.1|  PREDICTED: cytochrome b5-like                    99.8    6e-22   
gb|AGC26410.1|  CYB5                                                  99.8    6e-22   
ref|XP_010048740.1|  PREDICTED: cytochrome b5 isoform A               99.8    7e-22   
ref|XP_010460320.1|  PREDICTED: cytochrome b5-like isoform X1         99.8    7e-22   
ref|XP_009607109.1|  PREDICTED: cytochrome b5-like                    99.4    7e-22   
ref|XP_004490217.1|  PREDICTED: cytochrome b5-like                    99.4    8e-22   
gb|AAT84458.1|  cytochrome b5 isoform Cb5-A                           99.4    8e-22   Vernicia fordii [tung oil tree]
ref|XP_008335256.1|  PREDICTED: cytochrome b5-like isoform X1           100   9e-22   
ref|XP_007045813.1|  Cytochrome B5, n6,ATCB5-A,CB5-A                  99.4    9e-22   
ref|XP_006415913.1|  hypothetical protein EUTSA_v10009081mg           99.4    9e-22   
ref|XP_008335257.1|  PREDICTED: cytochrome b5-like isoform X2         99.8    9e-22   
gb|AJE26127.1|  nitrate reductase                                     99.4    9e-22   
gb|KDP22680.1|  hypothetical protein JCGZ_02465                       99.4    9e-22   
ref|XP_002986043.1|  hypothetical protein SELMODRAFT_271829           99.0    1e-21   
ref|XP_011070917.1|  PREDICTED: cytochrome b5 isoform A               99.4    1e-21   
gb|EYU19677.1|  hypothetical protein MIMGU_mgv1a016108mg              99.4    1e-21   
ref|XP_010532510.1|  PREDICTED: cytochrome b5                         99.4    1e-21   
gb|AFX82679.1|  cytochrome b5                                         99.4    1e-21   
ref|XP_004145949.1|  PREDICTED: cytochrome b5 isoform A-like          99.0    1e-21   
ref|XP_002273913.1|  PREDICTED: cytochrome b5 isoform E               99.0    1e-21   
gb|KHG25542.1|  Cytochrome b5                                         99.4    1e-21   
ref|XP_004144383.1|  PREDICTED: cytochrome b5, seed isoform-like      98.6    1e-21   
ref|XP_010499050.1|  PREDICTED: cytochrome b5 isoform B-like          98.6    2e-21   
ref|XP_010477866.1|  PREDICTED: cytochrome b5-like                    98.6    2e-21   
ref|XP_002318471.2|  cytochrome b5 isoform Cb5-C family protein       98.6    2e-21   
gb|ABK93631.1|  unknown                                               98.6    2e-21   
ref|XP_011043723.1|  PREDICTED: cytochrome b5-like                    98.6    2e-21   
gb|KDP41326.1|  hypothetical protein JCGZ_15733                       98.2    2e-21   
gb|AAO86521.1|  cytochrome B5                                         98.2    2e-21   
gb|KHG03127.1|  hypothetical protein F383_27157                       98.2    2e-21   
ref|XP_004144166.1|  PREDICTED: cytochrome b5-like                    98.2    2e-21   
ref|XP_010460321.1|  PREDICTED: cytochrome b5-like isoform X2         98.2    2e-21   
gb|KHN35403.1|  Cytochrome b5 isoform 1                               98.6    2e-21   
gb|ABA54491.1|  cytochrome b5 type 28                                 98.2    3e-21   
ref|XP_006350625.1|  PREDICTED: metal-nicotianamine transporter Y...    105   3e-21   
ref|XP_010919339.1|  PREDICTED: cytochrome b5 isoform E               97.8    3e-21   
ref|XP_008445442.1|  PREDICTED: cytochrome B5 isoform D               97.4    4e-21   
ref|XP_010091602.1|  putative cytochrome b5 isoform 2                 97.4    4e-21   
ref|XP_006304208.1|  hypothetical protein CARUB_v10010310mg           99.4    4e-21   
ref|XP_003614164.1|  Cytochrome b5                                    97.1    4e-21   
ref|XP_010257977.1|  PREDICTED: cytochrome b5 isoform B-like          97.1    6e-21   
gb|AFP55583.1|  yellow stripe-like protein                              103   6e-21   
ref|XP_007218583.1|  hypothetical protein PRUPE_ppa013234mg           97.1    7e-21   
ref|XP_007153493.1|  hypothetical protein PHAVU_003G040400g           96.3    7e-21   
ref|XP_009356430.1|  PREDICTED: cytochrome b5                         96.7    7e-21   
ref|NP_001235769.1|  uncharacterized protein LOC100500537             96.3    8e-21   
ref|XP_003602315.1|  YSL transporter                                    103   8e-21   
ref|XP_006444773.1|  hypothetical protein CICLE_v10022828mg           96.3    9e-21   
ref|XP_006437888.1|  hypothetical protein CICLE_v10033049mg           96.3    1e-20   
gb|EMS58621.1|  Cytochrome b5                                         99.4    1e-20   
ref|XP_008360086.1|  PREDICTED: cytochrome b5-like                    96.3    1e-20   
ref|XP_001602324.1|  PREDICTED: cytochrome b5                         96.3    1e-20   
ref|XP_008233085.1|  PREDICTED: cytochrome b5-like                    95.9    1e-20   
ref|XP_004297217.1|  PREDICTED: cytochrome b5-like                    95.5    2e-20   
ref|NP_001232778.1|  uncharacterized protein LOC100219971             95.9    2e-20   
ref|XP_001660580.1|  cytochrome B5 (cytb5)                            94.7    2e-20   
ref|XP_001650033.1|  cytochrome b5, putative                          94.7    2e-20   
ref|XP_010044383.1|  PREDICTED: cytochrome b5                         95.1    2e-20   
gb|AFK43559.1|  unknown                                               95.1    3e-20   
gb|AFK34591.1|  unknown                                               95.5    3e-20   
gb|ABK23103.1|  unknown                                               95.5    3e-20   
gb|ABK21817.1|  unknown                                               95.5    3e-20   
gb|ABK22959.1|  unknown                                               95.5    3e-20   
ref|XP_002711710.1|  PREDICTED: cytochrome b5 type B                  95.5    3e-20   
emb|CBY24561.1|  unnamed protein product                              94.7    3e-20   
ref|XP_004306632.1|  PREDICTED: cytochrome b5-like isoform 1          95.1    3e-20   
ref|NP_001239968.1|  uncharacterized protein LOC100788796             95.1    3e-20   
ref|XP_006849131.1|  hypothetical protein AMTR_s00027p00071500        94.7    4e-20   
ref|XP_006648885.1|  PREDICTED: cytochrome b5-like                    94.7    4e-20   
ref|XP_005537823.1|  similar to cytochrome B5                         95.5    4e-20   
ref|NP_998041.1|  cytochrome b5 type B                                95.1    4e-20   
ref|XP_002512059.1|  cytochrome B5 isoform 1, putative                94.4    4e-20   
ref|XP_011093011.1|  PREDICTED: cytochrome b5                         94.4    4e-20   
ref|XP_004309105.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    101   4e-20   
ref|XP_006858716.1|  hypothetical protein AMTR_s00066p00110400        94.7    5e-20   
ref|NP_001237928.1|  uncharacterized protein LOC100306380             94.4    5e-20   
ref|XP_008339788.1|  PREDICTED: cytochrome b5                         94.4    6e-20   
ref|XP_007051468.1|  Cytochrome B5, n2,ATCB5-E,CB5-E, putative        94.4    6e-20   
emb|CDS06811.1|  hypothetical protein LRAMOSA09336                    94.0    6e-20   
ref|XP_002442010.1|  hypothetical protein SORBIDRAFT_08g007120        94.4    7e-20   
ref|XP_008376183.1|  PREDICTED: cytochrome b5-like                    94.0    7e-20   
ref|XP_004230012.1|  PREDICTED: cytochrome b5                         94.0    7e-20   
ref|NP_001153064.1|  cytochrome b5 type B                             94.4    7e-20   
ref|XP_008352951.1|  PREDICTED: cytochrome b5-like                    94.0    8e-20   
gb|KFM28189.1|  Cytochrome b5 isoform B                               94.0    8e-20   
ref|XP_003626585.1|  Cytochrome b5                                    94.0    8e-20   
ref|XP_008351951.1|  PREDICTED: cytochrome b5 isoform A-like          93.6    9e-20   
ref|XP_007198261.1|  PREDICTED: cytochrome b5 type B-like isoform X3  93.6    9e-20   
ref|XP_001754123.1|  predicted protein                                94.0    9e-20   
ref|XP_009334383.1|  PREDICTED: cytochrome b5-like                    93.6    9e-20   
ref|XP_007147342.1|  hypothetical protein PHAVU_006G115900g           94.0    1e-19   
ref|XP_007570503.1|  PREDICTED: cytochrome b5-like isoform X2         94.4    1e-19   
gb|ABA54490.1|  cytochrome b5 type 11                                 93.6    1e-19   
ref|XP_007570502.1|  PREDICTED: cytochrome b5-like isoform X1         94.4    1e-19   
ref|XP_008661570.1|  PREDICTED: uncharacterized protein LOC100272...  94.0    1e-19   
ref|XP_008243822.1|  PREDICTED: cytochrome b5                         93.6    1e-19   
emb|CDH55944.1|  cytochrome b5                                        93.2    1e-19   
ref|XP_001987202.1|  GH20101                                          93.6    1e-19   
ref|XP_008403556.1|  PREDICTED: cytochrome b5-like isoform X2         94.0    1e-19   
ref|XP_008403555.1|  PREDICTED: cytochrome b5-like isoform X1         94.0    1e-19   
ref|XP_002060982.1|  GK10686                                          93.2    1e-19   
ref|XP_004315931.1|  PREDICTED: cytochrome b5 type B-like             93.6    1e-19   
ref|XP_004273260.1|  PREDICTED: cytochrome b5 type B-like             93.6    1e-19   
ref|XP_002968587.1|  hypothetical protein SELMODRAFT_170012           93.6    1e-19   
ref|XP_007198260.1|  PREDICTED: cytochrome b5 type B-like isoform X2  93.2    1e-19   
ref|XP_009375446.1|  PREDICTED: cytochrome b5-like                    93.2    1e-19   
ref|XP_007129086.1|  PREDICTED: cytochrome b5 type B-like             93.6    1e-19   
ref|XP_009361312.1|  PREDICTED: cytochrome b5 isoform A               93.2    1e-19   
ref|XP_004468176.1|  PREDICTED: cytochrome b5 type B-like             93.6    1e-19   
ref|XP_011207274.1|  PREDICTED: cytochrome b5                         92.8    2e-19   
gb|KFB50614.1|  cytochrome b5                                         92.8    2e-19   
ref|XP_007090419.1|  PREDICTED: cytochrome b5 type B-like             93.2    2e-19   
ref|XP_006941735.1|  PREDICTED: cytochrome b5 type B-like             93.2    2e-19   
gb|EAY91897.1|  hypothetical protein OsI_13549                        94.4    2e-19   
ref|XP_008138181.1|  PREDICTED: cytochrome b5 type B                  93.2    2e-19   
ref|XP_004625880.1|  PREDICTED: cytochrome b5 type B-like             93.2    2e-19   
emb|CEG72906.1|  Putative Cytochrome b5                               92.8    2e-19   
pdb|3NER|A  Chain A, Structure Of Human Type B Cytochrome B5          91.7    2e-19   
ref|XP_007198259.1|  PREDICTED: cytochrome b5 type B-like isoform X1  93.2    2e-19   
ref|XP_006909874.1|  PREDICTED: cytochrome b5 type B-like             93.2    2e-19   
ref|XP_009857888.1|  PREDICTED: cytochrome b5-like isoform X2         92.0    2e-19   
ref|XP_005403611.1|  PREDICTED: cytochrome b5 type B-like             92.8    2e-19   
ref|XP_002975894.1|  hypothetical protein SELMODRAFT_18723            90.5    2e-19   
gb|AET01997.2|  cytochrome b5-like heme/steroid-binding domain pr...  92.8    2e-19   
ref|XP_007224672.1|  hypothetical protein PRUPE_ppa025894mg           92.4    2e-19   
ref|XP_003627519.1|  Cytochrome b5                                    92.8    2e-19   
ref|XP_001867082.1|  cytochrome B5                                    92.4    2e-19   
ref|XP_007449986.1|  PREDICTED: cytochrome b5 type B-like             92.8    3e-19   
ref|XP_006339753.1|  PREDICTED: cytochrome b5-like                    92.4    3e-19   
emb|CAI46070.1|  hypothetical protein                                 91.7    3e-19   
gb|AET01996.2|  cytochrome b5-like heme/steroid-binding domain pr...  92.8    3e-19   
gb|EMT17049.1|  Cytochrome b5                                         93.2    3e-19   
ref|XP_004744601.1|  PREDICTED: cytochrome b5 type B-like isoform X2  92.0    3e-19   
gb|KDP41647.1|  hypothetical protein JCGZ_16054                       92.4    3e-19   
ref|XP_006641268.1|  PREDICTED: cytochrome b5-like                    92.0    3e-19   
ref|XP_004690483.1|  PREDICTED: cytochrome b5 type B-like             92.4    3e-19   
ref|XP_004875986.1|  PREDICTED: cytochrome b5 type B-like isoform X1  93.2    3e-19   
ref|NP_610294.1|  cytochrome b5, isoform B                            92.0    3e-19   
ref|XP_010577839.1|  PREDICTED: cytochrome b5 isoform X2              92.0    3e-19   
ref|XP_005810480.1|  PREDICTED: cytochrome b5 type B-like isoform X1  92.8    3e-19   
ref|XP_001970611.1|  GG23285                                          92.0    4e-19   
ref|XP_010577838.1|  PREDICTED: cytochrome b5 isoform X1              92.4    4e-19   
ref|XP_005810481.1|  PREDICTED: cytochrome b5 type B-like isoform X2  92.4    4e-19   
ref|XP_005531962.1|  PREDICTED: cytochrome b5 type B-like             92.0    4e-19   
emb|CDQ64750.1|  unnamed protein product                              92.4    4e-19   
gb|ABW37749.1|  cytochrome b5                                         92.0    4e-19   
gb|KCW66300.1|  hypothetical protein EUGRSUZ_F00125                   92.0    4e-19   
ref|XP_003442320.1|  PREDICTED: cytochrome b5 type B-like isoform X1  92.4    4e-19   
ref|XP_010223004.1|  PREDICTED: cytochrome b5                         92.0    4e-19   
ref|XP_008537436.1|  PREDICTED: cytochrome b5 type B isoform X2       91.7    4e-19   
ref|XP_005467096.1|  PREDICTED: cytochrome b5 type B-like isoform X2  92.4    4e-19   
gb|KCW48471.1|  hypothetical protein EUGRSUZ_K02164                   90.9    4e-19   
ref|NP_001236891.1|  uncharacterized protein LOC100305546             92.0    4e-19   
ref|XP_006598693.1|  PREDICTED: uncharacterized protein LOC100305...  92.0    5e-19   
ref|NP_001047585.1|  Os02g0649800                                     91.7    5e-19   
ref|XP_011190618.1|  PREDICTED: cytochrome b5                         91.7    5e-19   
ref|XP_008376797.1|  PREDICTED: cytochrome b5                         91.7    5e-19   
gb|EHA97401.1|  Cytochrome b5 type B                                  91.7    5e-19   
ref|XP_004875987.1|  PREDICTED: cytochrome b5 type B-like isoform X2  92.0    5e-19   
ref|XP_005881264.1|  PREDICTED: cytochrome b5 type B-like isoform X1  90.9    5e-19   
gb|KEH18604.1|  cytochrome b5-like heme/steroid-binding domain pr...  92.8    5e-19   
ref|XP_001632606.1|  predicted protein                                90.1    6e-19   
ref|XP_006180636.1|  PREDICTED: cytochrome b5 type B-like             91.7    6e-19   
gb|EMT31495.1|  Putative cytochrome b5 isoform 2                      91.7    6e-19   
ref|XP_005608424.1|  PREDICTED: cytochrome b5 type B-like isoform X2  91.7    6e-19   
ref|XP_008286411.1|  PREDICTED: cytochrome b5-like isoform X2         92.0    6e-19   
ref|XP_002122197.1|  PREDICTED: cytochrome b5-like isoform X1         91.3    6e-19   
gb|KHN06340.1|  Cytochrome b5 isoform 1                               91.7    6e-19   
gb|ABM01874.1|  cytochrome b5                                         91.3    6e-19   
ref|XP_004661712.1|  PREDICTED: cytochrome b5 type B-like             91.7    6e-19   
ref|XP_001649220.1|  cytochrome b5, putative                          90.9    6e-19   
ref|XP_009089044.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome b5    91.7    7e-19   
ref|XP_002005571.1|  GI18997                                          91.3    7e-19   
ref|XP_008286410.1|  PREDICTED: cytochrome b5-like isoform X1         92.0    7e-19   
dbj|BAB17854.1|  cytochrome b5                                        91.3    7e-19   
ref|XP_004960764.1|  PREDICTED: cytochrome b5-like                    91.3    7e-19   
ref|NP_001236379.1|  uncharacterized protein LOC100500069             91.3    7e-19   
gb|AFK36070.1|  unknown                                               91.3    8e-19   
ref|XP_001497331.1|  PREDICTED: cytochrome b5 type B-like isoform X1  91.3    8e-19   
ref|XP_006203810.1|  PREDICTED: cytochrome b5 type B-like             91.3    8e-19   
ref|XP_010791969.1|  PREDICTED: cytochrome b5-like                    91.7    8e-19   
gb|AAV84214.1|  cytochrome B5                                         91.3    8e-19   
ref|XP_006156982.1|  PREDICTED: cytochrome b5 type B-like             91.3    8e-19   
ref|XP_002027176.1|  GL20014                                          90.9    8e-19   
emb|CDY61721.1|  BnaA04g27110D                                        90.9    8e-19   
ref|XP_005318431.1|  PREDICTED: cytochrome b5 type B-like isoform X2  90.9    9e-19   
emb|CEI87379.1|  Putative Cytochrome b5                               90.9    9e-19   
ref|XP_009142432.1|  PREDICTED: cytochrome B5 isoform C-like          90.9    9e-19   
ref|XP_004744600.1|  PREDICTED: cytochrome b5 type B-like isoform X1  91.3    9e-19   
ref|NP_001157254.1|  cytochrome b5 type B                             91.3    9e-19   
gb|EFN70224.1|  Cytochrome b5                                         90.9    9e-19   
emb|CEG81673.1|  Putative Cytochrome b5                               89.4    9e-19   
ref|XP_002050870.1|  GJ19962                                          90.9    1e-18   
ref|XP_005707529.1|  cytochrome b5                                    90.5    1e-18   
ref|XP_005141978.1|  PREDICTED: cytochrome b5 type B-like             90.9    1e-18   
gb|ELR55775.1|  Cytochrome b5 type B                                  91.3    1e-18   
gb|EKV06300.1|  Cytochrome b5, putative                               90.9    1e-18   
gb|ACG31263.1|  cytochrome b5 isoform 2                               90.9    1e-18   
sp|Q9HFV1.1|CYB5_RHIST  RecName: Full=Cytochrome b5                   90.5    1e-18   
ref|XP_003472031.1|  PREDICTED: cytochrome b5 type B-like             90.9    1e-18   
gb|EHH31803.1|  Cytochrome b5 outer mitochondrial membrane isoform    90.9    1e-18   
ref|XP_009195026.1|  PREDICTED: cytochrome b5 type B isoform X2       90.9    1e-18   
ref|XP_004584041.1|  PREDICTED: cytochrome b5 type B-like             90.9    1e-18   
ref|XP_006878715.1|  PREDICTED: cytochrome b5 type B-like             90.9    1e-18   
ref|XP_002321974.1|  cytochrome b5 isoform Cb5-C family protein       90.5    1e-18   
ref|XP_004953293.1|  PREDICTED: cytochrome b5 isoform A-like          90.5    1e-18   
emb|CDH55943.1|  cytochrome b5                                        90.1    1e-18   
ref|XP_008700629.1|  PREDICTED: cytochrome b5 type B                  90.9    1e-18   
dbj|BAA23735.1|  cytochrome b5                                        90.9    1e-18   
gb|EYC18927.1|  hypothetical protein Y032_0026g1457                   90.5    1e-18   
ref|NP_085056.2|  cytochrome b5 type B                                90.9    1e-18   
ref|XP_004494850.1|  PREDICTED: cytochrome b5 isoform A-like          90.9    1e-18   
ref|XP_308640.2|  AGAP007121-PA                                       90.1    1e-18   
sp|O43169.2|CYB5B_HUMAN  RecName: Full=Cytochrome b5 type B; AltN...  90.5    1e-18   
ref|XP_005881265.1|  PREDICTED: cytochrome b5 type B-like isoform X2  90.5    1e-18   
ref|XP_006760415.1|  PREDICTED: cytochrome b5 type B-like             90.5    1e-18   
ref|XP_004057932.1|  PREDICTED: cytochrome b5 type B-like             90.9    1e-18   
emb|CDY47078.1|  BnaA03g12200D                                        89.7    1e-18   
ref|XP_003369798.1|  cytochrome b5                                    90.1    2e-18   
ref|XP_003262993.1|  PREDICTED: cytochrome b5 type B-like isoform 1   90.5    2e-18   
ref|NP_001181096.1|  cytochrome b5 type B                             90.5    2e-18   
ref|XP_001649221.1|  cytochrome b5, putative                          89.7    2e-18   
ref|XP_008984394.1|  PREDICTED: cytochrome b5 type B isoform X2       90.5    2e-18   
ref|XP_002761156.1|  PREDICTED: cytochrome b5 type B isoform X1       90.5    2e-18   
sp|Q5RDJ5.2|CYB5B_PONAB  RecName: Full=Cytochrome b5 type B; AltN...  90.5    2e-18   
gb|ETN62714.1|  cytochrome B5                                         89.7    2e-18   
ref|NP_001125049.1|  cytochrome b5 type B                             90.5    2e-18   
ref|XP_003569990.1|  PREDICTED: cytochrome b5 isoform A-like          90.1    2e-18   
gb|KFB46995.1|  AGAP002113-PA-like protein                            89.7    2e-18   
ref|XP_003940021.1|  PREDICTED: cytochrome b5 type B                  90.5    2e-18   
ref|XP_005929613.1|  PREDICTED: cytochrome b5 type B-like isoform X2  90.5    2e-18   



>ref|XP_006349932.1| PREDICTED: cytochrome b5-like [Solanum tuberosum]
Length=142

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG   K L + +EVSLHN PKDCWVIINAKAYNVTNFLN+HPGGE+VLLAAAGKDASEEF
Sbjct  1    MGVDNKVLKTYDEVSLHNNPKDCWVIINAKAYNVTNFLNDHPGGEEVLLAAAGKDASEEF  60

Query  482  EDAGHGSAARLMLDEFYVGEVD  547
            E+AGHGSAARLMLDEFYVGE+D
Sbjct  61   EEAGHGSAARLMLDEFYVGEID  82



>ref|XP_004252999.1| PREDICTED: cytochrome b5-like [Solanum lycopersicum]
Length=142

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG   K L + +EVSLHN PKDCWVIINAKAYNVTNFLN+HPGGE+VLLAAAGKDASEEF
Sbjct  1    MGVDNKVLKTYDEVSLHNNPKDCWVIINAKAYNVTNFLNDHPGGEEVLLAAAGKDASEEF  60

Query  482  EDAGHGSAARLMLDEFYVGEVD  547
            E+AGHGSA+RLMLDEFYVGE+D
Sbjct  61   EEAGHGSASRLMLDEFYVGEID  82



>ref|XP_009625302.1| PREDICTED: cytochrome b5, seed isoform-like [Nicotiana tomentosiformis]
Length=107

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 87/105 (83%), Gaps = 5/105 (5%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA +  L +  EVSLHN+P DCWVIINAKAYNVTNFLN+HPGG++VLLAAAGKDASEEF
Sbjct  1    MGANKNVLKTYREVSLHNSPDDCWVIINAKAYNVTNFLNDHPGGDEVLLAAAGKDASEEF  60

Query  482  EDAGHGSAARLMLDEFYVGEVD-----tatiaavaaaYIPPEQPK  601
            E+AGHGSAARLMLDEFYVGE+D     T +   +++ Y+ P+QPK
Sbjct  61   EEAGHGSAARLMLDEFYVGEIDPSTKTTVSTTTISSTYLLPKQPK  105



>ref|XP_009789167.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
Length=141

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 6/120 (5%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA +  L +  EVSLHN P DCW+IINAKAYNVTNFLN+HPGG++VLLAAAGKDASEEF
Sbjct  1    MGADKNVLKTYGEVSLHNCPDDCWIIINAKAYNVTNFLNDHPGGDEVLLAAAGKDASEEF  60

Query  482  EDAGHGSAARLMLDEFYVGEVD-----tatiaavaaaYIPPEQPKDGDPGESS-PRIINV  643
            E+AGHGSAARLMLDEFYVGE+D     T +   +++ Y+ P+ PK    G+SS P I+ +
Sbjct  61   EEAGHGSAARLMLDEFYVGEIDPSTKTTVSTTTISSTYLLPKLPKINRQGKSSRPNIVKL  120



>emb|CDO99453.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA +K L   +EVSLHNT KDCWVIINAKAY+VTNFL++HPGG DVLL AAGKDASEEF
Sbjct  1    MGADDKVL-GYDEVSLHNTSKDCWVIINAKAYDVTNFLDDHPGGGDVLLEAAGKDASEEF  59

Query  482  EDAGHGSAARLMLDEFYVGEVD  547
            E AGHGSAARLMLDE+YVGE+D
Sbjct  60   ESAGHGSAARLMLDEYYVGEID  81



>ref|XP_011091691.1| PREDICTED: cytochrome b5, seed isoform-like [Sesamum indicum]
Length=135

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA E ++ + ++VS HNT +DCWVIINAK YNVTN+L +HPGG++VLLAAAGKDASEEF
Sbjct  1    MGA-ESKVFTHSQVSAHNTSEDCWVIINAKVYNVTNYLTDHPGGDEVLLAAAGKDASEEF  59

Query  482  EDAGHGSAARLMLDEFYVGEVD  547
            ED GHGSAARLMLDEFY+GE+D
Sbjct  60   EDVGHGSAARLMLDEFYIGEID  81



>gb|EYU32657.1| hypothetical protein MIMGU_mgv1a017734mg [Erythranthe guttata]
Length=133

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ S +EVS HN+ +DCW+IIN+K YNVT+FLN+HPGG+DVLL  AGKDASEEFED G
Sbjct  4    ESKMFSYSEVSAHNSSEDCWIIINSKVYNVTSFLNDHPGGDDVLLGQAGKDASEEFEDVG  63

Query  494  HGSAARLMLDEFYVGEVD  547
            HGSAARLMLDEFYVGEVD
Sbjct  64   HGSAARLMLDEFYVGEVD  81



>ref|XP_002265677.1| PREDICTED: cytochrome b5 [Vitis vinifera]
 emb|CAN78289.1| hypothetical protein VITISV_008139 [Vitis vinifera]
 emb|CBI37308.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            GE ++ +  EVS HNTPKDCW+II+ K Y+VT FL +HPGG+DVLL+A GKDA+++FED 
Sbjct  2    GEGKVYTLAEVSEHNTPKDCWLIIDGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDV  61

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR M+DEF+VG++D          Y PP+QP
Sbjct  62   GHSSSARAMMDEFHVGDID-TATIPSKVNYTPPKQP  96



>ref|XP_006847492.1| hypothetical protein AMTR_s00163p00076750 [Amborella trichopoda]
 gb|ERN09073.1| hypothetical protein AMTR_s00163p00076750 [Amborella trichopoda]
Length=134

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA + ++ +  +VS HNTP+DCW++IN K YNVT FL +HPGG++VLL+A GKDA+++F
Sbjct  1    MGA-DGKVFTLQDVSNHNTPQDCWLVINGKVYNVTEFLEDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++AR M+DEFYVGE+D  +       Y PP+QP
Sbjct  60   EDVGHSTSARAMMDEFYVGEID-PSTFPTKLKYTPPKQP  97



>ref|XP_007049778.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao]
 gb|EOX93935.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao]
Length=135

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G  ++ +  EVS HN PKDCW++I  K YNVT FL +HPGG++VLL+A GKDA+++FED
Sbjct  2    GGRGKVYTLAEVSQHNNPKDCWLVIEGKVYNVTKFLEDHPGGDEVLLSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S+AR M+DEFYVG++D  +       Y PP+QP
Sbjct  62   VGHSSSARAMMDEFYVGDID-TSTIPTKIKYTPPKQP  97



>ref|XP_010509977.1| PREDICTED: cytochrome b5 isoform B-like [Camelina sativa]
Length=134

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + ++VS HN P+DCW++IN K YNVT FL +HPGG+DVLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSQVSEHNQPQDCWLVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +ARLM++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESARLMMEQYYVGEID-KTTIPKKVKYTPPKQP  97



>ref|XP_010036819.1| PREDICTED: cytochrome b5-like [Eucalyptus grandis]
 gb|KCW48470.1| hypothetical protein EUGRSUZ_K02164 [Eucalyptus grandis]
Length=133

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (68%), Gaps = 4/114 (4%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ E +  +  EVS HN+PKDCW+++  K Y+VT FL +HPGG+ VLL+A GKDA+++F
Sbjct  1    MGS-ESKFFTLAEVSEHNSPKDCWLVVEGKVYDVTKFLEDHPGGDAVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ M+DEFYVGE+D  +       Y PP+QP      E +P+ I +
Sbjct  60   EDVGHSSTAKAMMDEFYVGEID-TSTVLNKTKYTPPKQPHYNQ--EKTPKFIKL  110



>ref|XP_009371627.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=136

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG+K++ +  EVS H+  KDCW++I+ K Y+VT FL +HPGG++VLLAA GKDAS +FED
Sbjct  2    AGDKKVYTLAEVSTHSDRKDCWLVIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S AR M+DEFYVG++D +        Y PP+QP
Sbjct  62   IGHSSTARAMMDEFYVGDID-SASIPAKRMYTPPKQP  97



>ref|XP_004296652.1| PREDICTED: cytochrome b5 isoform B-like [Fragaria vesca subsp. 
vesca]
Length=134

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G++++ +  +VS HNTPKDCW+IIN K Y+VT FL +HPGG+DVLL+A GKDA+++FED
Sbjct  2    GGDEKVFTLAQVSDHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR ML +FYVGE+D  +      AY PP+QP
Sbjct  62   VGHSDNARDMLKDFYVGEID-VSTIPKKTAYTPPKQP  97



>ref|XP_008372473.1| PREDICTED: cytochrome b5 [Malus domestica]
Length=136

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG+K++ +  EVS H+  KDCW++I+ K Y+VT FL +HPGG++VLLAA GKDAS +FED
Sbjct  2    AGDKKVYTLAEVSXHSDRKDCWLVIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S AR M+DEFYVG+++ +        Y PP+QP
Sbjct  62   VGHSSTARAMMDEFYVGDIB-SASIPAKRMYTPPKQP  97



>ref|XP_002521096.1| cytochrome B5 isoform 1, putative [Ricinus communis]
 gb|EEF41247.1| cytochrome B5 isoform 1, putative [Ricinus communis]
Length=136

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G+ ++ +  +VS HN+PKDCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++FED 
Sbjct  3    GQGKVYTLADVSEHNSPKDCWLVIEGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR M+DEFYVGE+D  +      AY PP+QP
Sbjct  63   GHSSSARAMMDEFYVGEID-TSTIPTKKAYTPPKQP  97



>ref|XP_009334928.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=136

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG+K++ +  EVS H+  KDCW++I+ K Y+VT FL++HPGG++VLLA  GKDAS +FED
Sbjct  2    AGDKKVYTLAEVSTHSDRKDCWLVIDGKVYDVTKFLDDHPGGDEVLLAVTGKDASNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S AR MLDEFYVG++D +        Y PP+QP
Sbjct  62   IGHSSTARAMLDEFYVGDID-SASIPTNRKYTPPKQP  97



>ref|XP_009348240.1| PREDICTED: cytochrome b5 isoform B-like [Pyrus x bretschneideri]
 ref|XP_009348243.1| PREDICTED: cytochrome b5 isoform B-like [Pyrus x bretschneideri]
Length=134

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+G K + +  +VS HNTPKDCW+IIN K Y+VT FL +HPGG+DVL++A GKDA+++F
Sbjct  1    MGSGGK-VFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLVSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH   AR ML +FYVGE+D A+    ++ Y PP+QP
Sbjct  60   EDVGHSDNARDMLKDFYVGEID-ASTIPKSSTYTPPKQP  97



>ref|XP_008382631.1| PREDICTED: cytochrome b5-like [Malus domestica]
Length=136

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG+K++ +  EVS H+  KDCW++I+ K Y+VT FL +HPGG++VLLA  GKDAS +FED
Sbjct  2    AGDKKVYTLAEVSTHSDRKDCWLVIDGKVYDVTKFLEDHPGGDEVLLAVTGKDASNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S AR MLDEFYVG++D +        Y PP+QP
Sbjct  62   IGHSSTARAMLDEFYVGDID-SASIPTNRKYTPPKQP  97



>gb|KDP20335.1| hypothetical protein JCGZ_06421 [Jatropha curcas]
Length=134

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            GE+++ +  EVS HNTPKDCW+II+ K Y+VT FL++HPGG++VLL+A GKDA+++FED 
Sbjct  3    GEEKVFTLAEVSEHNTPKDCWLIIDGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH ++A+ M+D++YVG++D  +       Y PP+QP
Sbjct  63   GHSTSAKEMMDQYYVGKID-PSTIPQKTTYKPPKQP  97



>ref|XP_008376513.1| PREDICTED: cytochrome b5 isoform B-like [Malus domestica]
 ref|XP_008376520.1| PREDICTED: cytochrome b5 isoform B-like [Malus domestica]
Length=134

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+G K + +  +VS HNTPKDCW+IIN K Y+VT FL +HPGG+DVL++A GKDA+++F
Sbjct  1    MGSGGK-VFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLVSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH   AR ML +FYVGE+D A+    +  Y PP+QP
Sbjct  60   EDVGHSDNARDMLKDFYVGEID-ASTIPKSTTYTPPKQP  97



>ref|XP_009792131.1| PREDICTED: cytochrome b5 [Nicotiana sylvestris]
 sp|P49098.1|CYB5_TOBAC RecName: Full=Cytochrome b5 [Nicotiana tabacum]
Length=136

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG GE ++ +  EVS HN  KDCW++I+ K Y+VT FL++HPGG++VLL+A GKDA+++F
Sbjct  1    MG-GETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR MLDE+YVG++D +        Y PP QP
Sbjct  60   EDVGHSSSARAMLDEYYVGDID-SATIPTKTKYTPPNQP  97



>emb|CAA50575.1| cytochrome b5 [Nicotiana tabacum]
Length=139

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG GE ++ +  EVS HN  KDCW++I+ K Y+VT FL++HPGG++VLL+A GKDA+++F
Sbjct  4    MG-GETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDF  62

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR MLDE+YVG++D +        Y PP QP
Sbjct  63   EDVGHSSSARAMLDEYYVGDID-SATIPTKTKYTPPNQP  100



>ref|XP_006352692.1| PREDICTED: cytochrome b5-like [Solanum tuberosum]
Length=132

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW+II+ K Y+VT FL++HPGG+DVLL+A GKDA+++FED GH 
Sbjct  3    KVFNLAEVSQHNNAKDCWLIISGKVYDVTKFLDDHPGGDDVLLSATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S+AR MLDE+YVGE+D ++    +  Y PP+QP
Sbjct  63   SSARAMLDEYYVGEID-SSTIPTSVKYTPPKQP  94



>gb|KHG05589.1| Cytochrome b5 [Gossypium arboreum]
Length=137

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            GE+++ +  EVS HN  KDCW++I  K ++VT FL +HPGG+DVLL++ GKDA+++FED 
Sbjct  3    GERKVYTLAEVSQHNHAKDCWLVIEGKVFDVTKFLEDHPGGDDVLLSSTGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR M+DEFYVG++D  +       Y PP+QP
Sbjct  63   GHSSSARAMMDEFYVGDID-TSTIPSKRKYTPPKQP  97



>ref|XP_004247085.1| PREDICTED: cytochrome b5 [Solanum lycopersicum]
Length=133

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN+ KDCW++IN K YNVT FL++HPGG++VL+++ GKDA+++FED GH 
Sbjct  3    KVYTLAEVSQHNSAKDCWLVINGKVYNVTKFLDDHPGGDEVLISSTGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            S+AR MLDE+YVG++D +        Y PP+QP+
Sbjct  63   SSARAMLDEYYVGDID-SATIPTKTKYTPPKQPQ  95



>gb|AAT84460.1| cytochrome b5 isoform Cb5-C [Vernicia fordii]
Length=136

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN PKDCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++FED GH 
Sbjct  6    KVFTLAEVSEHNNPKDCWLVIEGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S+AR M+DEFYVGE+D ++      AY PP+QP
Sbjct  66   SSARAMMDEFYVGEID-SSTIPSRMAYTPPKQP  97



>ref|XP_006420893.1| hypothetical protein CICLE_v10006192mg [Citrus clementina]
 ref|XP_006493802.1| PREDICTED: cytochrome b5 isoform B-like [Citrus sinensis]
 gb|ESR34133.1| hypothetical protein CICLE_v10006192mg [Citrus clementina]
Length=135

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS HN  KDCW+IIN K Y+VT FL +HPGG++VLL+A GKDA+++F
Sbjct  1    MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH  +AR M+D++YVGE+D  +       Y PP+QP
Sbjct  61   EDVGHSPSAREMMDQYYVGEID-VSTIPKKKEYTPPKQP  98



>gb|KDP26389.1| hypothetical protein JCGZ_17547 [Jatropha curcas]
Length=136

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G+ +  + +EVS HN  KDCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++FED 
Sbjct  3    GQGKFFTLSEVSEHNNAKDCWLVIEGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR M+DEFYVGE+D ++      AY PP+QP
Sbjct  63   GHSSSARAMMDEFYVGEID-SSTIPARKAYTPPKQP  97



>ref|XP_002303038.1| cytochrome b5 isoform Cb5-C family protein [Populus trichocarpa]
 gb|ABK93619.1| unknown [Populus trichocarpa]
 gb|EEE82311.1| cytochrome b5 isoform Cb5-C family protein [Populus trichocarpa]
Length=136

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G  ++ +  EVS HN+PKDCW+++  + Y+VT FL +HPGG+DVLL+A GKDA+++F
Sbjct  1    MG-GNGKVFTLAEVSAHNSPKDCWLVVEGRVYDVTKFLEDHPGGDDVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S AR ++DEFYVG++D       +  Y PP+QP
Sbjct  60   EDVGHSSTARALMDEFYVGDID-TATIPTSVKYTPPKQP  97



>ref|XP_004242405.1| PREDICTED: cytochrome b5-like [Solanum lycopersicum]
Length=133

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW+II+ K Y+VT FL +HPGG+DVLL+A GKDA+++FED GH 
Sbjct  3    KVFNLAEVSQHNNAKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S+AR MLDE+YVGE+D ++    +  Y PP+QP
Sbjct  63   SSARAMLDEYYVGEID-SSTIPTSVKYTPPKQP  94



>ref|XP_002518143.1| cytochrome B5 isoform 1, putative [Ricinus communis]
 gb|EEF44276.1| cytochrome B5 isoform 1, putative [Ricinus communis]
Length=140

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            +GE ++ +  +VS HN PKDCW+IIN K Y+VT FL +HPGG++VLL+A GKDA+++FED
Sbjct  2    SGEGKVFTLAQVSEHNNPKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH ++AR M+D++YVGE+D  +     A Y PP+QP
Sbjct  62   VGHSTSAREMMDQYYVGEID-PSTIPKKATYKPPKQP  97



>ref|XP_009611133.1| PREDICTED: cytochrome b5 [Nicotiana tomentosiformis]
Length=136

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG GE ++ +  EVS HN  KDCW++I+ K Y+VT FL++HPGG++VLL+A GKDA+++F
Sbjct  1    MG-GETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR M+DE+YVG++D +        Y PP QP
Sbjct  60   EDVGHSSSARAMVDEYYVGDID-SATIPTKTKYTPPNQP  97



>ref|XP_010069657.1| PREDICTED: cytochrome b5 [Eucalyptus grandis]
 gb|KCW58068.1| hypothetical protein EUGRSUZ_H00800 [Eucalyptus grandis]
Length=134

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            GE ++ +  +VS HNT KDCW++I+ K Y+VT F+ +HPGG++VLL++ GKDA+++FED 
Sbjct  3    GEGKVYTLAQVSEHNTSKDCWLVIDGKVYDVTKFMEDHPGGDEVLLSSTGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            GH S+AR M+D+FYVGE+D A+       Y PP+QP+
Sbjct  63   GHSSSARAMMDDFYVGEID-ASTIPARTKYTPPKQPQ  98



>ref|XP_010469554.1| PREDICTED: cytochrome b5 isoform B [Camelina sativa]
Length=134

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + ++VS HN P+DCW++IN K YNVT FL +HPGG+DVLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSQVSEHNQPQDCWLVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-KTTIPKKVKYTPPKQP  97



>ref|XP_009611358.1| PREDICTED: cytochrome b5, seed isoform [Nicotiana tomentosiformis]
 sp|P49099.1|CYB5S_TOBAC RecName: Full=Cytochrome b5, seed isoform [Nicotiana tabacum]
 emb|CAA56318.1| cytochrome b5 [Nicotiana tabacum]
Length=135

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G+ ++ +  EVS HN  KDCW+II+ K YNVT FL +HPGG +VLL+A GKDA+++FED 
Sbjct  3    GQSKVFTLAEVSNHNNAKDCWLIISGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFEDI  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR MLDE+YVG++D ++       Y PP+QP
Sbjct  63   GHSSSARAMLDEYYVGDID-SSTIPTKVKYTPPKQP  97



>gb|AAT84459.1| cytochrome b5 isoform Cb5-B [Vernicia fordii]
Length=134

 Score =   116 bits (290),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G+K++ +  +VS HN PKDCW+II  K Y+VT FL++HPGG++VLL+A GKDA+++FED
Sbjct  2    GGDKKVFTLAQVSQHNNPKDCWLIIGGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH  +AR M+D++YVGE+D  +     A Y PP+QP
Sbjct  62   VGHSLSAREMMDQYYVGEID-PSTVPKKATYKPPKQP  97



>ref|XP_010929918.1| PREDICTED: cytochrome b5-like [Elaeis guineensis]
Length=134

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ + ++ +  EVS HN+ KDCW+II+ K Y+VT FL +HPGG++VLL+A GKDA+++F
Sbjct  1    MGS-DTKVYTLAEVSKHNSNKDCWLIIDGKVYDVTKFLEDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            ED GH + AR M+DE+YVGE+D A+       Y PP+QP+
Sbjct  60   EDVGHSTTARAMMDEYYVGEID-ASTVPTKVKYTPPKQPR  98



>ref|XP_009599430.1| PREDICTED: cytochrome b5-like [Nicotiana tomentosiformis]
Length=136

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG GE ++ +  EV+ HN  KDCW++I+ K Y+VT FL++HPGG++VLLAA GKDA+++F
Sbjct  1    MG-GETKVYTLAEVAPHNNNKDCWLVISGKVYDVTKFLDDHPGGDEVLLAATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR MLDE+YVG++D +        Y PP QP
Sbjct  60   EDVGHSSSARAMLDEYYVGDID-SATIPTKTKYTPPNQP  97



>gb|ABK94544.1| unknown [Populus trichocarpa]
Length=136

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G  ++ +  EVS HN+PKDCW+++  + Y+VT FL +HPGG+DVLL+A GKD +++F
Sbjct  1    MG-GNGKVFTLAEVSAHNSPKDCWLVVEGRVYDVTKFLEDHPGGDDVLLSATGKDTTDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S AR ++DEFYVG++D       +  Y PP+QP
Sbjct  60   EDVGHSSTARALMDEFYVGDID-TATIPTSVKYTPPKQP  97



>ref|XP_004240459.1| PREDICTED: cytochrome b5-like [Solanum lycopersicum]
Length=135

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ E ++ +  EV+ HN  KDCW++I+ K Y+VT FL++HPGG++VLLAA GKDA+++F
Sbjct  1    MGS-ETKVYTLQEVAPHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLAATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR MLDE+YVG++D +       AY PP QP
Sbjct  60   EDVGHSSSARAMLDEYYVGDID-SATIPTKKAYTPPNQP  97



>dbj|BAJ92137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +2

Query  317  KRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGH  496
            K  ++  EVS HNT  DCW+II  K Y+VT FL +HPGG+DVLL++ GKDA+++FED GH
Sbjct  3    KAALTLEEVSKHNTKDDCWLIIAGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGH  62

Query  497  GSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             + AR MLDEFYVG+VD  T       Y PP+QP
Sbjct  63   STTARAMLDEFYVGDVD-TTTIPARTKYTPPKQP  95



>ref|XP_003552132.1| PREDICTED: cytochrome b5-like isoform X1 [Glycine max]
 gb|KHN15374.1| Cytochrome b5 [Glycine soja]
Length=138

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             GE+++ +  EVS HNT KDCW+II+ K YNVT FL++HPGG+DVLL++ GKDA+++FED
Sbjct  2    GGERKVYTLAEVSEHNTSKDCWLIIDGKVYNVTKFLDDHPGGDDVLLSSTGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESS  625
             GH   AR MLD+ YVG++D  +       + P  QP++     SS
Sbjct  62   VGHSKGARAMLDDLYVGDID-PSTIPTKVQHTPLTQPQNNQDKTSS  106



>ref|XP_010245991.1| PREDICTED: cytochrome b5 [Nelumbo nucifera]
Length=135

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA + ++ +  EVS HN  KDCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++F
Sbjct  1    MGA-DGKVYTLAEVSQHNNSKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR M+DE++VGE+D A+       YIPP+QP
Sbjct  60   EDVGHSSSARAMMDEYFVGEID-ASTIPAKTKYIPPKQP  97



>gb|KGN56742.1| hypothetical protein Csa_3G131950 [Cucumis sativus]
Length=134

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+GEK + +  EV+ HN  KDCW+II+ K Y+VT FL +HPGG+DVLL+A GKDA+++F
Sbjct  1    MGSGEK-VFTLKEVAEHNNHKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH   AR M+D++YVGE+D ++      AY PP+QP
Sbjct  60   EDVGHSDNAREMMDQYYVGEID-SSTIPKKVAYTPPKQP  97



>ref|XP_009393770.1| PREDICTED: cytochrome b5 isoform B [Musa acuminata subsp. malaccensis]
Length=134

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ + ++ +  EVS HNTP+DCW+++N K Y+VT FL +HPGG+DVLL++ GKDA+++F
Sbjct  1    MGS-DAKVYTLAEVSAHNTPQDCWLVVNGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+Y+GE+D          Y  P QP
Sbjct  60   EDVGHSTTARAMMDEYYIGEID-TATIPEKVKYTAPNQP  97



>sp|O04354.1|CYB5_BOROF RecName: Full=Cytochrome b5 [Borago officinalis]
 gb|AAC49701.1| cytochrome b5 [Borago officinalis]
Length=132

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HN  KDCW+IIN K Y+VT FL +HPGG+DVLL+A GKDA+++FED GH 
Sbjct  3    KIFTLAEVAQHNNSKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S+A+ MLDE+YVG++D ++       Y PP+QP
Sbjct  63   SSAKAMLDEYYVGDID-SSSIPSQVKYTPPKQP  94



>ref|XP_010413956.1| PREDICTED: cytochrome b5 isoform B-like [Camelina sativa]
Length=134

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + ++VS HN P+DCW+++N K YNVT FL +HPGG+DVLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSQVSEHNQPQDCWLVMNGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-KTTIPKKVKYTPPKQP  97



>ref|XP_008438367.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis melo]
Length=134

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+GEK + +  EV+ HN  KDCW+II+ K Y+VT FL +HPGG+DVLL+A GKDA+++F
Sbjct  1    MGSGEK-VFTLKEVAEHNNHKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH   AR M+D++YVGE+D A+      AY PP+QP
Sbjct  60   EDVGHSDNAREMMDQYYVGEID-ASTIPKKVAYTPPKQP  97



>ref|XP_009766798.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
Length=136

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG GE ++ +  EV+ HN  KDCW++I+ K Y+VT FL++HPGG++VLLAA GKDA+++F
Sbjct  1    MG-GETKVYTLAEVAPHNNNKDCWLVISGKVYDVTKFLDDHPGGDEVLLAATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++AR MLDE+YVG++D +        Y PP QP
Sbjct  60   EDVGHSTSARAMLDEYYVGDID-SATIPTKTKYTPPNQP  97



>gb|EYU39233.1| hypothetical protein MIMGU_mgv1a016179mg [Erythranthe guttata]
Length=132

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ S  EVS HNT KDCW+II  K Y+VT FL +HPGG+DVLL++ GKDA+++FED GH 
Sbjct  3    KVFSLAEVSEHNTNKDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ++A+ M+DEFYVGE++ ++       Y PP+QP
Sbjct  63   TSAKAMMDEFYVGEIN-SSTIPKQTKYTPPKQP  94



>ref|XP_008380573.1| PREDICTED: cytochrome b5-like [Malus domestica]
Length=134

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G+ ++ +  +VS HNTPKDCW+II+ K Y+VT FL +HPGG+DVL++A GKDA+++FED
Sbjct  2    GGDGKVFTLAQVSEHNTPKDCWLIISGKVYDVTRFLEDHPGGDDVLVSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR ML +FYVGE+D A+    +  Y PP+QP
Sbjct  62   VGHSENARGMLKDFYVGEID-ASTIPKSTTYAPPKQP  97



>ref|XP_006443603.1| hypothetical protein CICLE_v10022818mg [Citrus clementina]
 ref|XP_006479281.1| PREDICTED: cytochrome b5-like [Citrus sinensis]
 gb|ESR56843.1| hypothetical protein CICLE_v10022818mg [Citrus clementina]
 gb|KDO65927.1| hypothetical protein CISIN_1g032750mg [Citrus sinensis]
Length=134

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             GE ++ +  EVS HN  KDCW+II  K Y+VT FL++HPGG++VLL+A GKDA+++FED
Sbjct  2    GGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S+A+ M+DEFYVG++D ++       Y PP+QP
Sbjct  62   VGHSSSAKAMMDEFYVGDID-SSTVPTKTKYTPPKQP  97



>ref|XP_008235483.1| PREDICTED: cytochrome b5 [Prunus mume]
Length=136

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG  ++ +  EVS H+  KDCW++I+ K Y+VT FL +HPGG++VLLAA GKDAS +FED
Sbjct  2    AGGNKVYTLAEVSAHSDRKDCWLLIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S AR M+DEFYVG++D ++      AY PP+QP
Sbjct  62   VGHSSTARAMMDEFYVGDID-SSSIPTKRAYTPPKQP  97



>gb|KFK31291.1| hypothetical protein AALP_AA6G093400 [Arabis alpina]
Length=137

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H++P+DCW++I  K Y+VT FL++HPGG++V+L A GKDA+++F
Sbjct  1    MG-GDGKVFTLTEVSQHSSPQDCWIVIEGKVYDVTKFLDDHPGGDEVILTATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++D +  A     ++PP +  +    +SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDID-SATAPTKTKFVPPSKQTESIQDKSSDLVIKI  112



>ref|XP_009374604.1| PREDICTED: cytochrome b5-like [Pyrus x bretschneideri]
Length=134

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G  ++ +  +VS HNTPKDCW+II+ K Y+VT FL +HPGG+DVL++A GKDA+++FED
Sbjct  2    GGNGKVFTLAQVSEHNTPKDCWLIISGKVYDVTRFLEDHPGGDDVLVSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR ML +FYVGE+D A+    +  Y PP+QP
Sbjct  62   VGHSENARGMLKDFYVGEID-ASTIPKSTTYTPPKQP  97



>ref|XP_010107764.1| putative cytochrome b5 isoform 2 [Morus notabilis]
 gb|EXC16929.1| putative cytochrome b5 isoform 2 [Morus notabilis]
Length=134

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G+ ++ +  EVS HNT KDCW+II+ K Y+VT FL +HPGG++VLL+A GKDA+++FED 
Sbjct  3    GDGKVFTLAEVSDHNTSKDCWLIISGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH  +AR M+ EFYVGE+D AT       Y PP+QP
Sbjct  63   GHSDSARDMMKEFYVGEID-ATTIPKKTTYTPPKQP  97



>ref|XP_004290210.1| PREDICTED: cytochrome b5-like [Fragaria vesca subsp. vesca]
Length=137

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA EK++ +   VS H+  KDCW++I+ K Y+VT FL +HPGG++VLL++ GKDA+++F
Sbjct  1    MGA-EKKVYTLEVVSKHSDRKDCWLVIDGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            +D GH ++AR M+DE+YVG+ D A I A  A Y PP+QP   +P ++S  II +
Sbjct  60   DDVGHSTSARAMMDEYYVGDFDKAFIPAKTAKYTPPKQPH-YNPDKTSDFIIRL  112



>gb|KFK26373.1| hypothetical protein AALP_AA8G240100 [Arabis alpina]
Length=134

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW+IIN K YNVT FL +HPGG+DVLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNQADDCWIIINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-TTTIPKKVKYTPPKQP  97



>ref|NP_001054434.1| Os05g0108800 [Oryza sativa Japonica Group]
 sp|P49100.2|CYB5_ORYSJ RecName: Full=Cytochrome b5 [Oryza sativa Japonica Group]
 gb|AAK73138.1|AC079022_11 cytochrome B5 [Oryza sativa]
 gb|AAU44139.1| cytochrome b5 [Oryza sativa Japonica Group]
 dbj|BAF16348.1| Os05g0108800 [Oryza sativa Japonica Group]
 gb|EAY96251.1| hypothetical protein OsI_18149 [Oryza sativa Indica Group]
 dbj|BAG89223.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62055.1| hypothetical protein OsJ_16839 [Oryza sativa Japonica Group]
 gb|AFI71841.1| cytochrome b5 protein [Oryza sativa]
Length=137

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M    K++ +  EV+ HN+  DCW+II  K YNV+ FL +HPGG+DVLL++ GKDA+++F
Sbjct  1    MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+YVG++D  +       Y+PP+QP
Sbjct  61   EDVGHSTTARAMMDEYYVGDID-TSTIPARTKYVPPKQP  98



>ref|XP_010552054.1| PREDICTED: cytochrome b5-like [Tarenaya hassleriana]
Length=137

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G+ ++ +  EVS H+T  DCW++I  K Y+VT FL++HPGG++VLL+A GKDA+++FED 
Sbjct  3    GDGKVFTLAEVSQHSTKHDCWLVIGGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            GH + A+ MLDE+YVG++D +       +Y PP+QP+  D  ++S  II +
Sbjct  63   GHSTTAKAMLDEYYVGDID-SASIPSKTSYTPPKQPQ-YDQDKTSEFIIKI  111



>emb|CAA53366.1| cytochrome b5 [Oryza sativa]
Length=137

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M    K++ +  EV+ HN+  DCW+II  K YNV+ FL +HPGG+DVLL++ GKDA+++F
Sbjct  1    MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+YVG++D  +       Y+PP+QP
Sbjct  61   EDVGHTTTARAMMDEYYVGDID-TSTIPARTKYVPPKQP  98



>ref|XP_007201359.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
 ref|XP_007201360.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
 gb|EMJ02558.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
 gb|EMJ02559.1| hypothetical protein PRUPE_ppa013179mg [Prunus persica]
Length=136

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG  ++ +  EVS H+  KDCW++I+ K Y+VT FL +HPGG++VLLAA GKDAS +FED
Sbjct  2    AGGSKVYTLAEVSAHSDRKDCWLLIDGKVYDVTKFLEDHPGGDEVLLAATGKDASNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH S AR M+DE+YVG++D ++      AY PP+QP
Sbjct  62   VGHSSTARAMMDEYYVGDID-SSSIPTKRAYTPPKQP  97



>ref|XP_007034387.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao]
 gb|EOY05313.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao]
Length=132

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G+ +L +  +VS HNTPKDCW+IIN K Y+VT FL +HPGG++VLL+A GKDA+++FED
Sbjct  2    GGDGKLFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVD  547
             GH  +AR M+D++YVGE+D
Sbjct  62   VGHSDSARDMMDQYYVGEID  81



>ref|XP_006356775.1| PREDICTED: cytochrome b5-like [Solanum tuberosum]
Length=133

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN+ KDCW++I+ K Y+VT FL++HPGG++VL+++ GKDA+++FED GH 
Sbjct  3    KVYTLAEVSQHNSAKDCWLVISGKVYDVTKFLDDHPGGDEVLISSTGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            S+AR MLDE+YVG++D +        Y PP+QP+
Sbjct  63   SSARAMLDEYYVGDID-SATIPTKTKYTPPKQPQ  95



>ref|XP_010685005.1| PREDICTED: cytochrome b5 [Beta vulgaris subsp. vulgaris]
Length=136

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            GE ++ S +EV+ HN+ KDCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++FED 
Sbjct  3    GEGKVFSLSEVAEHNSSKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            GH S AR M+DE YVG+++          Y PP+QP+
Sbjct  63   GHSSTARAMMDEMYVGDIN-TATIPTKVRYTPPKQPQ  98



>gb|KHN37769.1| Cytochrome b5 [Glycine soja]
Length=135

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG    ++ S  EVS HN  KDCW++I+ K YNVT FL +HPGG++VLL++ GKDA+ +F
Sbjct  1    MGGERNKVFSLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++A  M+DEFYVG++D  +       Y PP+QP
Sbjct  61   EDIGHSTSAVAMMDEFYVGDID-TSTIPSKVKYTPPKQP  98



>gb|EMT13800.1| Cytochrome b5 [Aegilops tauschii]
Length=134

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +2

Query  317  KRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGH  496
            K  ++  EVS HNT  DCW+II  K YNVT FL +HPGG+DVLL++  KDA+++FED GH
Sbjct  3    KAALTLEEVSKHNTKDDCWLIIAGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGH  62

Query  497  GSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             S AR MLDE+YVG++D          Y PP+QP
Sbjct  63   SSTARAMLDEYYVGDID-MATIPARTKYAPPKQP  95



>ref|NP_001045534.1| Os01g0971500 [Oryza sativa Japonica Group]
 dbj|BAB63673.1| putative cytochrome b5 [Oryza sativa Japonica Group]
 dbj|BAF07448.1| Os01g0971500 [Oryza sativa Japonica Group]
 gb|EAY77397.1| hypothetical protein OsI_05385 [Oryza sativa Indica Group]
 gb|EAZ14988.1| hypothetical protein OsJ_04923 [Oryza sativa Japonica Group]
 gb|ABR25698.1| cytochrome b5 [Oryza sativa Indica Group]
 gb|ABR26100.1| cytochrome b5 [Oryza sativa Indica Group]
 dbj|BAH00198.1| unnamed protein product [Oryza sativa Japonica Group]
Length=135

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++++  EVS HNT  DCW+II  K YNVT FL +HPGG+DVLL++  KDA+++FED GH 
Sbjct  5    KVLTLEEVSKHNTKDDCWLIIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHS  64

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+YVG++D AT       Y PP+QP
Sbjct  65   TTARAMMDEYYVGDID-ATTIPTKVKYTPPKQP  96



>gb|EYU40608.1| hypothetical protein MIMGU_mgv1a016092mg [Erythranthe guttata]
Length=134

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HNT KDCW+II+ K Y+VT FL++HPGG++VL+ A GKDA+++FED GH 
Sbjct  3    KVFTLAEVSQHNTNKDCWLIIDGKVYDVTKFLDDHPGGDEVLVTATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
            + A+ MLDE+YVG++D ++      +Y+PP+Q
Sbjct  63   TTAKAMLDEYYVGDID-SSTITTKTSYVPPKQ  93



>ref|XP_003569109.1| PREDICTED: cytochrome b5-like [Brachypodium distachyon]
Length=135

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +2

Query  317  KRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGH  496
            K  ++  EV+ HNT  DCW+II  K Y+VT FLN+HPGG+DVLL++  KDA+++FED GH
Sbjct  4    KEALTLQEVAKHNTKDDCWLIIAGKVYDVTKFLNDHPGGDDVLLSSTAKDATDDFEDVGH  63

Query  497  GSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             + AR MLDE+YVG+VD A      + Y PP+QP
Sbjct  64   STTARAMLDEYYVGDVD-ALTIPANSKYTPPKQP  96



>ref|XP_010264100.1| PREDICTED: cytochrome b5 [Nelumbo nucifera]
Length=135

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MGA + ++ +  EVS H + KDCW+II  K Y++T F+ +HPGG++VLL+A GKDA+++F
Sbjct  1    MGA-DGKVYTLEEVSQHRSSKDCWLIIGGKVYDLTKFMEDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S+AR M+DEFY+GE+D A+       Y PP+QP
Sbjct  60   EDVGHSSSARAMMDEFYIGEID-ASTIPKKVKYAPPKQP  97



>ref|NP_180831.1| cytochrome B5 isoform B [Arabidopsis thaliana]
 sp|O48845.1|CYB5B_ARATH RecName: Full=Cytochrome b5 isoform B; Short=AtCb5-B; AltName: 
Full=Cytochrome b5 isoform 2; AltName: Full=Cytochrome b5 
isoform E; Short=AtCb5-E [Arabidopsis thaliana]
 gb|AAC04491.1| putative cytochrome b5 [Arabidopsis thaliana]
 gb|AAM91608.1| putative cytochrome b5 [Arabidopsis thaliana]
 gb|AAN15404.1| putative cytochrome b5 [Arabidopsis thaliana]
 dbj|BAE99419.1| putative cytochrome b5 [Arabidopsis thaliana]
 gb|AEC08729.1| cytochrome B5 isoform B [Arabidopsis thaliana]
Length=134

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++IN K YNVT FL +HPGG+DVLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKVKYTPPKQP  97



>emb|CAA48240.1| cytochrome b5 [Nicotiana tabacum]
Length=97

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  EVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHGSAARLM  517
            EVS HN  KDCW++I+ K Y+VT FL++HPGG++VLL+A GKDA+++FED GH S+AR M
Sbjct  3    EVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSARAM  62

Query  518  LDEFYVGEVDtatiaavaaaYIPPEQP  598
            LDE+YVG++D +        Y PP QP
Sbjct  63   LDEYYVGDID-SATIPTKTKYTPPNQP  88



>ref|XP_004133998.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
 ref|XP_004170095.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
Length=201

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +2

Query  290  ESQAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDA  469
            +   MG+GEK + +  EV+ HN  KDCW+II+ K Y+VT FL +HPGG+DVLL+A GKDA
Sbjct  64   QFHVMGSGEK-VFTLKEVAEHNNHKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDA  122

Query  470  SEEFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            +++FED GH   AR M+D++YVGE+D ++      AY PP+QP
Sbjct  123  TDDFEDVGHSDNAREMMDQYYVGEID-SSTIPKKVAYTPPKQP  164



>ref|XP_002881239.1| B5 #4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57498.1| B5 #4 [Arabidopsis lyrata subsp. lyrata]
Length=134

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++IN K YNVT FL +HPGG+DVLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKVKYTPPKQP  97



>emb|CDY00045.1| BnaC09g02560D [Brassica napus]
Length=140

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 79/116 (68%), Gaps = 4/116 (3%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H T +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVYTLAEVSQHTTAQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK--DGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++D          ++PP  PK  + D  +SS  ++ +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDID-TAAVPAKTKFVPPPSPKQTESDQSKSSDFLVKI  114



>ref|XP_006601762.1| PREDICTED: uncharacterized protein LOC100500611 isoform X1 [Glycine 
max]
 gb|KHN15515.1| Cytochrome b5 [Glycine soja]
Length=135

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG    ++ +  EVS HN  KDCW++I+ K YNVT FL +HPGG++VLL++ GKDA+ +F
Sbjct  1    MGGERNKVFTLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++A  M+DEFYVG++D  +       Y PP+QP
Sbjct  61   EDIGHSTSAVAMMDEFYVGDID-TSTIPSKVKYTPPKQP  98



>ref|XP_006645329.1| PREDICTED: cytochrome b5-like [Oryza brachyantha]
Length=136

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++++  EVS HNT  DCW++I  K YNVT FL +HPGG+DVLL++  KDA+++FED GH 
Sbjct  6    KVLTLEEVSKHNTKDDCWLVIGGKVYNVTRFLEDHPGGDDVLLSSTAKDATDDFEDVGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+YVG++D AT       Y PP+QP
Sbjct  66   TTARAMMDEYYVGDID-ATTIPTKVKYTPPKQP  97



>ref|XP_009403628.1| PREDICTED: cytochrome b5 isoform B-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HNT KDCW++IN K Y+VT FL +HPGG+DVLL++ GKDA+++FED GH 
Sbjct  6    KVYTLAEVSTHNTHKDCWLVINGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDIGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+++G++D A        Y PP+QP
Sbjct  66   NTARAMMDEYFIGKID-AATIPQKVKYTPPKQP  97



>ref|XP_007223823.1| hypothetical protein PRUPE_ppa013221mg [Prunus persica]
 gb|EMJ25022.1| hypothetical protein PRUPE_ppa013221mg [Prunus persica]
Length=134

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +  +  +VS HNTPKDCW+IIN K Y+VT FL +HPGG+DVLL+A GKDA+++FED GH 
Sbjct  6    KFFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDVGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
              AR ML + YVG++D A+    +  Y PP+QP
Sbjct  66   DNARDMLKDMYVGDID-ASTIPSSTTYTPPKQP  97



>ref|XP_010069046.1| PREDICTED: cytochrome b5 [Eucalyptus grandis]
Length=133

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            GE ++ +  EVS HN  KDCW++I+ K Y+VT FL +HPGG++VLL+A GKDA+++FED 
Sbjct  2    GEGKVFTLAEVSEHNNSKDCWIVIDGKVYDVTKFLEDHPGGDEVLLSAIGKDATDDFEDV  61

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR M+DE+ VG++D ++      AY PP+QP
Sbjct  62   GHSSSARAMMDEYLVGDID-SSTIPTKRAYTPPKQP  96



>emb|CDY23792.1| BnaC04g43300D [Brassica napus]
Length=134

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++INAK YNVT FL +HPGG++VLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNHAHDCWIVINAKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  97



>ref|XP_009141270.1| PREDICTED: cytochrome b5 isoform B [Brassica rapa]
 emb|CDY19161.1| BnaA04g19010D [Brassica napus]
Length=134

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++INAK YNVT FL +HPGG++VLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNHAHDCWIVINAKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  97



>ref|XP_006856406.1| hypothetical protein AMTR_s00047p00213630 [Amborella trichopoda]
 gb|ERN17873.1| hypothetical protein AMTR_s00047p00213630 [Amborella trichopoda]
Length=134

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  EVSLHN  KDCWVII+ K Y+VT++L++HPGG+DVLLA  GKDA EEFEDAGH 
Sbjct  6    KLFSLEEVSLHNNNKDCWVIIDNKVYDVTSYLDDHPGGDDVLLAVTGKDAKEEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
            + AR ++DE+++GEVD
Sbjct  66   ADARKLMDEYFIGEVD  81



>gb|EMS64911.1| Cytochrome b5 [Triticum urartu]
Length=134

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +2

Query  317  KRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGH  496
            K  ++  EVS HNT  DCW+II  K Y+VT FL +HPGG+DVLL++  KDA+++FED GH
Sbjct  3    KAALTLEEVSKHNTKDDCWLIIAGKVYDVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGH  62

Query  497  GSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             + AR MLDE+YVG+VD          Y PP+QP
Sbjct  63   STTARAMLDEYYVGDVD-TATIPARTKYTPPKQP  95



>ref|XP_009386687.1| PREDICTED: cytochrome b5-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV  HN+PKDCW+IIN K ++VT FL +HPGGE+VLLA+ GKDAS +FED GH 
Sbjct  3    KIYTLAEVLTHNSPKDCWLIINGKVFDVTKFLEDHPGGEEVLLASIGKDASVDFEDIGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+ VGE+D          Y PP+QP
Sbjct  63   TTARAMMDEYCVGEID-VATIPKRVKYTPPKQP  94



>ref|XP_006295218.1| hypothetical protein CARUB_v10024300mg [Capsella rubella]
 gb|EOA28116.1| hypothetical protein CARUB_v10024300mg [Capsella rubella]
Length=134

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ + +EVS HN   DCW++IN K YNVT FL +HPGG+DVLL++ GKDA+++FED GH 
Sbjct  6    KIFTLSEVSEHNQAHDCWLVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             +AR M++++YVGE+D  T       Y PP+QP
Sbjct  66   ESAREMMEQYYVGEID-QTTIPKKVKYTPPKQP  97



>ref|XP_003532293.1| PREDICTED: cytochrome b5-like [Glycine max]
Length=142

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E+++ +  +VS HNT KDCW+II+ K YNVT FL++HPGG+DVL+++ GKDA+++FED G
Sbjct  4    ERKVYTLAQVSEHNTSKDCWLIIDGKVYNVTKFLDDHPGGDDVLVSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKD  604
            H   AR MLD+ Y+G++D +TI        PP QP++
Sbjct  64   HSKGARAMLDDLYIGDIDPSTIPTKVQN-TPPTQPQN  99



>ref|XP_010520941.1| PREDICTED: cytochrome b5 [Tarenaya hassleriana]
 ref|XP_010520943.1| PREDICTED: cytochrome b5 [Tarenaya hassleriana]
Length=135

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M + EK++++ +EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +F
Sbjct  1    MASDEKKVLTFDEVSNHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
            ED GH   AR M+ ++Y+GE+D ++       Y+PP+Q
Sbjct  61   EDVGHSDTARDMMKQYYIGEID-SSTVPAKRTYVPPQQ  97



>emb|CDJ26519.1| unnamed protein product [Triticum aestivum]
Length=137

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M +   +L +  EV+ H++  DCW++I  K YNVT FL++HPGG+DVLL++  KDA+++F
Sbjct  1    MASSGGKLFTLEEVAKHSSKDDCWLVIGGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+YVGE+D AT       Y PP+QP
Sbjct  61   EDVGHSTTARAMMDEYYVGEID-ATTIPTKVKYTPPKQP  98



>emb|CAA04702.1| cytochrome b5 [Olea europaea]
Length=132

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW+II+ K Y+VT FL +HPGG++VLL+A GKDA+++FED GH 
Sbjct  3    KVFTLAEVSEHNNAKDCWLIIDGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S A+ M+DEFYVG+ D  +       Y PP+QP
Sbjct  63   STAKAMMDEFYVGDFD-TSTVPTKTQYTPPKQP  94



>ref|XP_007133998.1| hypothetical protein PHAVU_010G010400g [Phaseolus vulgaris]
 gb|ESW05992.1| hypothetical protein PHAVU_010G010400g [Phaseolus vulgaris]
Length=135

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M     ++ +  EVS HN  +DCW++I+ K YNVT FL +HPGG+DVLL++ GKDA+ +F
Sbjct  1    MAGQRSKVFTLAEVSQHNNVQDCWLVIHGKVYNVTKFLEDHPGGDDVLLSSTGKDATNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++A  M+DEFYVG++D  +       Y PP+QP
Sbjct  61   EDIGHSTSAVAMMDEFYVGDID-TSSIPSKVQYTPPKQP  98



>ref|XP_009415974.1| PREDICTED: cytochrome b5 isoform B-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ ++++ +  EVS HN+  DCW++I+ K Y+VT FL++HPGG++VL+++ GKDA+++F
Sbjct  1    MGS-DRKVYTLAEVSAHNSAHDCWLVIDGKVYDVTKFLDDHPGGDEVLVSSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH +AAR MLDE+YVGE+D  T       Y  P+QP
Sbjct  60   EDVGHSTAARAMLDEYYVGEID-DTTILKDVKYTAPKQP  97



>gb|KHN07183.1| Cytochrome b5 [Glycine soja]
Length=142

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E+++ +  +VS HNT KDCW+II+ K YNVT FL++HPGG+DVL+++ GKDA+++FED G
Sbjct  4    ERKVYTLAQVSEHNTSKDCWLIIDGKVYNVTKFLDDHPGGDDVLVSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKD  604
            H   AR MLD+ Y+G++D +TI        PP QP++
Sbjct  64   HSKGARAMLDDLYIGDIDPSTIPTKVQN-TPPTQPQN  99



>ref|XP_008457249.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis melo]
Length=134

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G+ +L +  EVS HN PKDCW+IIN K YNVT FL +HPGG++VLL+  GKDA+++FED
Sbjct  2    GGDGKLYTLAEVSQHNNPKDCWLIINGKVYNVTEFLEDHPGGDEVLLSGTGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH  +AR M+ ++Y+GE+D  +       Y  P+QP
Sbjct  62   VGHSESAREMMSKYYIGEID-ISTIPEQLTYTGPKQP  97



>ref|XP_009111854.1| PREDICTED: cytochrome B5 isoform D-like [Brassica rapa]
Length=140

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G K + +  EVS H T +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MGGGGK-VYTLAEVSQHTTNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGES  622
            ED GH S A+ MLDE+YVG++D          ++PP  PK  +  +S
Sbjct  60   EDVGHSSTAKAMLDEYYVGDID-TATVPAKTKFVPPSPPKQTESNQS  105



>emb|CDY19937.1| BnaA09g03140D [Brassica napus]
Length=140

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H T +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVYTLAEVSQHTTNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGES  622
            ED GH S A+ MLDE+YVG++D          ++PP  PK  +  +S
Sbjct  60   EDVGHSSTAKAMLDEYYVGDID-TATVPAKTKFVPPSPPKQTESNQS  105



>gb|AFK43806.1| unknown [Lotus japonicus]
Length=135

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG    +L +  EV+ H+  KDCW++I+ K YNVT FL +HPGG+DVLL++ GKDAS +F
Sbjct  1    MGGEGTKLFTLAEVAEHSNVKDCWLVIHGKVYNVTKFLEDHPGGDDVLLSSTGKDASNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            +D GH ++A  M+DEFYVG++D  +    +  Y PP+QP+
Sbjct  61   DDIGHSTSAVSMMDEFYVGDID-TSTIPSSVKYTPPKQPQ  99



>ref|XP_002457023.1| hypothetical protein SORBIDRAFT_03g047300 [Sorghum bicolor]
 gb|EES02143.1| hypothetical protein SORBIDRAFT_03g047300 [Sorghum bicolor]
Length=135

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
             E ++ +  EV+ HNT  DCW++I  K YNVT FL++HPGG+DVLL++  KDA+++FED 
Sbjct  2    SESKVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFEDV  61

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH + AR M+DE+ VGE+D A        Y PP+QP
Sbjct  62   GHSTTARAMMDEYLVGEID-AATIPTKVKYTPPKQP  96



>gb|ABA54489.1| cytochrome b5 type 06 [Crepis alpina]
Length=131

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HN PKDCW+II+ K ++VT FL++HPGG+DVLL+A GKDA+++FED GH 
Sbjct  3    KVYTLKEVAEHNDPKDCWLIIDGKVFDVTKFLDDHPGGDDVLLSATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
            + A+ M+DEFYVG++D +        Y PP+Q
Sbjct  63   TTAKSMMDEFYVGDID-SATIPSKVEYKPPKQ  93



>emb|CDX79471.1| BnaC03g18070D [Brassica napus]
Length=134

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++IN K YNVT FL +HPGG++VLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNHAHDCWIVINGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  97



>ref|XP_006410400.1| hypothetical protein EUTSA_v10017407mg [Eutrema salsugineum]
 gb|ESQ51853.1| hypothetical protein EUTSA_v10017407mg [Eutrema salsugineum]
Length=134

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++IN K YNVT FL +HPGG++VLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSEHNHAHDCWIVINGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  97



>emb|CDP05012.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++ + +EV  HN  KDCW+IIN K Y+VT F+ EHPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDQKVHTFDEVVQHNKTKDCWLIINGKVYDVTPFMEEHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M+D++Y+GE+D      +   YIPP+Q +  +P ++   +I +
Sbjct  62   VGHSDSARDMMDQYYIGEID-KATVPLKRMYIPPQQAQ-YNPDKTPEFVIKI  111



>gb|ACG40422.1| cytochrome b5 [Zea mays]
Length=185

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = +2

Query  275  PQRRKESQAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAA  454
            P R++    M     ++ +  EV+ HNT  DCW++I  K YNVT FL +HPGG+DVLL++
Sbjct  42   PDRQQRKTRMSGS--KVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVLLSS  99

Query  455  AGKDASEEFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
              KDA+++FED GH S AR M+DE+ VGE+D A        Y PP+QP
Sbjct  100  TAKDATDDFEDVGHSSTARAMMDEYLVGEID-AATIPTKVKYTPPKQP  146



>ref|XP_004971419.1| PREDICTED: cytochrome b5-like [Setaria italica]
Length=135

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HNT  DCW+II  K YNVT FL +HPGG+DVLL++  KDA+++FED GH 
Sbjct  5    KVFTLEEVAKHNTKDDCWLIIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHS  64

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+ VGE+D AT       Y+PP+QP
Sbjct  65   TTARAMMDEYLVGEID-ATTIPTKVKYMPPKQP  96



>ref|XP_006653959.1| PREDICTED: cytochrome b5-like [Oryza brachyantha]
Length=134

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HN+  DCW++I  K YNV+ FL +HPGG+DVLL++ GKDA+++FED GH 
Sbjct  4    KVYTLEEVAKHNSKDDCWLVIGGKVYNVSRFLEDHPGGDDVLLSSTGKDATDDFEDVGHS  63

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+YVG++D A+       Y+PP+QP
Sbjct  64   TTARAMMDEYYVGDID-ASTIPARTKYVPPKQP  95



>ref|XP_008224490.1| PREDICTED: cytochrome b5 isoform B [Prunus mume]
Length=134

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  +VS HNTPKDCW+IIN K Y+VT FL +HPGG+DVLL+A GKDA+++FED GH 
Sbjct  6    KLFTLAQVSEHNTPKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDVGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
              AR ML +  VG++D A+    +  Y PP+QP
Sbjct  66   DNARDMLKDMCVGDID-ASTIPSSTTYTPPKQP  97



>ref|XP_008656842.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b5 [Zea mays]
Length=198

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = +2

Query  275  PQRRKESQAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAA  454
            P R++    M     ++ +  EV+ HNT  DCW++I  K YNVT FL +HPGG+DVLL++
Sbjct  55   PDRQQRKTRMSGS--KVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVLLSS  112

Query  455  AGKDASEEFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
              KDA+++FED GH S AR M+DE+ VGE+D A        Y PP+QP
Sbjct  113  TAKDATDDFEDVGHSSTARAMMDEYLVGEID-AATIPTKVKYTPPKQP  159



>ref|NP_001238196.1| uncharacterized protein LOC100306652 [Glycine max]
 gb|ACU14939.1| unknown [Glycine max]
Length=135

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG    ++ S  EVS HN  KDCW++I+ K YNVT FL +H GG++VLL++ GKDA+ +F
Sbjct  1    MGGERNKVFSLAEVSQHNNVKDCWLVIHGKVYNVTKFLEDHSGGDEVLLSSTGKDATNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++A  M+DEFYVG++D  +       Y PP+QP
Sbjct  61   EDIGHSTSAVAMMDEFYVGDID-TSTIPSKVKYTPPKQP  98



>gb|EMS45540.1| Cytochrome b5 [Triticum urartu]
Length=137

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M +   ++ +  EV+ H +  DCW++I  K YNVT FL++HPGG+DVLL++  KDA+++F
Sbjct  1    MSSSGGKVFTLEEVAKHTSKDDCWLVIGGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+YVGE+D AT       Y PP+QP
Sbjct  61   EDVGHSTTARAMMDEYYVGEID-ATTIPTKVKYTPPKQP  98



>ref|XP_009151679.1| PREDICTED: cytochrome B5 isoform D [Brassica rapa]
Length=138

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H + +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLEEVSQHTSNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++D+AT+ A      PP      +  +SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDIDSATVPAKTKFVAPPSNQTQSNQNKSSDFLIKI  113



>ref|XP_003565166.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
Length=138

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G  ++ +  EV+ H++  DCW+II+ K YNVT FL++HPGG+DVLL++  KDA+++FED 
Sbjct  5    GSSKVFTLEEVAKHSSKDDCWLIISGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFEDV  64

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH + AR M+DE+YVGE+D AT       Y P +QP
Sbjct  65   GHSTTARAMMDEYYVGEID-ATTIPTKVKYTPAKQP  99



>dbj|BAJ94749.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87115.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99688.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  305  GAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFE  484
             +   ++ +  EV+ H +  DCW++I  K YNVT FL++HPGG+DVLL++  KDA+++FE
Sbjct  4    SSSTTKVFTLEEVAKHASKDDCWLVIAGKVYNVTKFLDDHPGGDDVLLSSTAKDATDDFE  63

Query  485  DAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            D GH + AR M+DE+YVGE+D AT       Y+PP+QP
Sbjct  64   DVGHSTTARAMMDEYYVGEID-ATTIPTKVKYMPPKQP  100



>gb|ACF84051.1| unknown [Zea mays]
 gb|ACG24679.1| cytochrome b5 [Zea mays]
 gb|ACG35561.1| cytochrome b5 [Zea mays]
 gb|AFW83857.1| cytochrome b5 [Zea mays]
Length=135

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HNT  DCW++I  K YNVT FL +HPGG+DVLL++  KDA+++FED GH 
Sbjct  5    KVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHS  64

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S AR M+DE+ VGE+D A        Y PP+QP
Sbjct  65   STARAMMDEYLVGEID-AATIPTKVKYTPPKQP  96



>ref|XP_006395118.1| hypothetical protein EUTSA_v10005107mg [Eutrema salsugineum]
 gb|ESQ32404.1| hypothetical protein EUTSA_v10005107mg [Eutrema salsugineum]
Length=137

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H++ +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLAEVSQHSSTQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++D +        + PP +  + +  +SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDID-SATVPAKTKFTPPPKQTESNQNKSSDFVIKI  112



>ref|NP_199692.1| cytochrome B5 isoform D [Arabidopsis thaliana]
 sp|Q9ZWT2.1|CYB5D_ARATH RecName: Full=Cytochrome B5 isoform D; Short=AtCb5-D; AltName: 
Full=Cytochrome b5 isoform B; Short=AtCb5-B [Arabidopsis thaliana]
 gb|AAK44071.1|AF370256_1 putative cytochrome b5 protein [Arabidopsis thaliana]
 dbj|BAA74840.1| cytochrome b5 [Arabidopsis thaliana]
 dbj|BAB09434.1| cytochrome b5 [Arabidopsis thaliana]
 gb|AAL34247.1| putative cytochrome b5 protein [Arabidopsis thaliana]
 gb|AAM63789.1| cytochrome b5 (dbj|BAA74840.1) [Arabidopsis thaliana]
 gb|AED95727.1| cytochrome B5 isoform D [Arabidopsis thaliana]
Length=140

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ + +EVS H++ KDCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            ED GH S A+ MLDE+YVG++D      V A ++PP   K
Sbjct  60   EDVGHSSTAKAMLDEYYVGDID-TATVPVKAKFVPPTSTK  98



>ref|XP_009132870.1| PREDICTED: cytochrome b5 isoform B [Brassica rapa]
Length=134

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E ++ + +EVS HN   DCW++I+ K YNVT FL +HPGG++VLL++ GKDA+++FED G
Sbjct  4    EAKIFTLSEVSKHNHANDCWIVISGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  97



>ref|XP_002439129.1| hypothetical protein SORBIDRAFT_09g000970 [Sorghum bicolor]
 gb|EES17559.1| hypothetical protein SORBIDRAFT_09g000970 [Sorghum bicolor]
Length=133

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  +V+ HNT +DCW+II  K Y+VT FL +HPGG+DVLL++ GKDA+++FED GH 
Sbjct  3    KVFTLEDVAKHNTKEDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+ VGE+D A+       Y+PP+QP
Sbjct  63   NTARAMMDEYLVGEID-ASTIPSRTKYVPPKQP  94



>ref|XP_008793730.1| PREDICTED: cytochrome b5-like [Phoenix dactylifera]
Length=134

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ + ++ +  +VS HN+ +DCW+II  K YNVT FL +HPGG++VLL+A GKDA+++F
Sbjct  1    MGS-DAKVYTLEDVSKHNSNEDCWLIIGGKVYNVTKFLEDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+YVGE+D AT       Y  P+QP
Sbjct  60   EDVGHSTTARAMMDEYYVGEID-ATTIPTKVNYTAPKQP  97



>gb|KFK38164.1| hypothetical protein AALP_AA3G077400 [Arabis alpina]
Length=140

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG+ ++++  E+S H+T +DCW++I+ K Y+VT FLN+HPGG+D+LL A GKDA+ EFE+
Sbjct  2    AGKGKVINFAELSQHSTSQDCWLLIDGKVYDVTKFLNDHPGGDDLLLLATGKDATREFEE  61

Query  488  AGHGSAARLMLDEFYVGEVD  547
             GH S+A+ ML+EFYVG++D
Sbjct  62   VGHSSSAKTMLNEFYVGDID  81



>ref|XP_010912953.1| PREDICTED: cytochrome b5-like [Elaeis guineensis]
Length=134

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ + ++ +  EVS HNT KDCW++I  K Y+VT FL +HPGG++VLL++ GKDA+++F
Sbjct  1    MGS-DAKVYTLKEVSQHNTNKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+ VG++D  +       Y PP+QP
Sbjct  60   EDVGHSTTARAMMDEYCVGKID-TSTIPTKVKYTPPKQP  97



>ref|XP_006401690.1| hypothetical protein EUTSA_v10014996mg [Eutrema salsugineum]
 gb|ESQ43143.1| hypothetical protein EUTSA_v10014996mg [Eutrema salsugineum]
Length=134

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +K++++  EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDKKILAFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTARDMMEKYYIGEID-SSSVPATRTYVAPQQP  97



>emb|CDX86279.1| BnaA06g29960D [Brassica napus]
Length=138

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H + +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLEEVSQHTSNQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++D+AT+ A      PP      +  +SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDIDSATVPAKTKFVPPPSNQTQSNQNKSSDFLIKI  113



>ref|XP_004138957.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
 ref|XP_004169544.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus]
 gb|KGN61465.1| hypothetical protein Csa_2G138200 [Cucumis sativus]
Length=134

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             G+ +L +  EVS HN PKDCW+IIN K YNVT FL +HPGG++VLL+  GKDA+++FED
Sbjct  2    GGDGKLFTFAEVSQHNNPKDCWLIINGKVYNVTEFLEDHPGGDEVLLSGTGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH  +AR  + ++YVGE+D  +       Y  P+QP
Sbjct  62   VGHSESARETMSKYYVGEID-ISTLPERLTYTGPKQP  97



>ref|XP_002864250.1| ATB5-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40509.1| ATB5-A [Arabidopsis lyrata subsp. lyrata]
Length=134

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++++  EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M+D++++GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTARDMMDKYFIGEID-SSSVPATRTYVAPQQP  97



>ref|NP_001136781.1| uncharacterized protein LOC100216924 [Zea mays]
 gb|ACF82620.1| unknown [Zea mays]
 gb|ACG32418.1| cytochrome b5 [Zea mays]
Length=135

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HNT  DCW++I  K YNVT FL +HPGG+DVLL++  KDA+++FED GH 
Sbjct  5    KVYTLEEVAKHNTKDDCWLVIGGKVYNVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHS  64

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+ VGE+D A        Y PP+QP
Sbjct  65   TTARAMMDEYLVGEID-AATIPSKVKYTPPKQP  96



>ref|XP_011089100.1| PREDICTED: cytochrome b5-like [Sesamum indicum]
Length=132

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HNT KDCW++I  K Y+VT FL +HPGG++VL+++ GKDA+++FED GH 
Sbjct  3    KVFTLAEVSEHNTNKDCWLVIGGKVYDVTKFLEDHPGGDEVLVSSTGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ++A+ M++EFY+GE++  +       Y PP+QP+  D  ++S  II +
Sbjct  63   ASAKAMMEEFYIGEIN-TSTIPTQNKYTPPKQPQ-YDQDKTSEFIIKL  108



>ref|NP_001236788.1| uncharacterized protein LOC100500611 [Glycine max]
 gb|ACU15736.1| unknown [Glycine max]
Length=95

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG    ++ +  EVS HN  KDCW++I+ K YNVT FL +HPGG++VLL++ GKDA+ +F
Sbjct  1    MGGERNKVFTLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPP  589
            ED GH ++A  M+DEFYVG++D  +       Y PP
Sbjct  61   EDIGHSTSAVAMMDEFYVGDID-TSTIPSKVKYTPP  95



>ref|XP_009143942.1| PREDICTED: cytochrome b5 isoform B-like [Brassica rapa]
Length=150

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +2

Query  293  SQAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDAS  472
            ++ MG  E ++ + ++VS HN   DCW++IN K Y+VT FL +HPGG++VLL++ GKDA+
Sbjct  14   AKTMG-DEAKIFTLSQVSEHNKAHDCWIVINGKVYDVTKFLEDHPGGDEVLLSSTGKDAT  72

Query  473  EEFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ++FED GH  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  73   DDFEDVGHSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  113



>ref|XP_006279708.1| hypothetical protein CARUB_v10027337mg [Capsella rubella]
 gb|EOA12606.1| hypothetical protein CARUB_v10027337mg [Capsella rubella]
Length=140

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H++ KDCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLAEVSQHSSSKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK-DGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG +D  +   V A ++PP   K + + G+SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGNID-TSTVPVKAKFVPPSSNKAEPNQGKSSDFVIKL  113



>gb|KCW57256.1| hypothetical protein EUGRSUZ_H00059 [Eucalyptus grandis]
Length=211

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW++I+ K Y+VT FL +HPGG++VLL+A GKDA+++FED GH 
Sbjct  83   KVFTLAEVSEHNNSKDCWIVIDGKVYDVTKFLEDHPGGDEVLLSAIGKDATDDFEDVGHS  142

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S+AR M+DE+ VG++D ++      AY PP+QP
Sbjct  143  SSARAMMDEYLVGDID-SSTIPTKRAYTPPKQP  174



>ref|NP_200168.1| cytochrome B5 isoform E [Arabidopsis thaliana]
 sp|Q42342.2|CYB5E_ARATH RecName: Full=Cytochrome b5 isoform E; Short=AtCb5-E; AltName: 
Full=Cytochrome b5 isoform 1; AltName: Full=Cytochrome b5 
isoform A; Short=AtCb5-A [Arabidopsis thaliana]
 dbj|BAA74839.1| cytochrome b5 [Arabidopsis thaliana]
 dbj|BAB09732.1| cytochrome b5 [Arabidopsis thaliana]
 gb|AAL87348.1| putative cytochrome b5 protein [Arabidopsis thaliana]
 gb|AAM45093.1| putative cytochrome b5 protein [Arabidopsis thaliana]
 gb|AAM64631.1| cytochrome b5 (dbj|BAA74839.1) [Arabidopsis thaliana]
 gb|AED96377.1| cytochrome B5 isoform E [Arabidopsis thaliana]
Length=134

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            + +++++S  EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    SSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M+D++++GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTARDMMDKYFIGEID-SSSVPATRTYVAPQQP  97



>ref|XP_001770042.1| predicted protein [Physcomitrella patens]
 gb|EDQ65218.1| predicted protein [Physcomitrella patens]
Length=138

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
             EK++ +  EVS HN  +DCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++FED 
Sbjct  2    AEKKVFTLEEVSGHNHARDCWLVIGGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDV  61

Query  491  GHGSAARLMLDEFYVGEVD  547
            GH ++AR+++DE+YVGE+D
Sbjct  62   GHSTSARVLMDEYYVGEID  80



>ref|XP_009397516.1| PREDICTED: cytochrome b5 isoform A-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
             + ++   +EVS HN  KDCW+II+ K Y+VT FL+EHPGG++VLLA  GKDA+ +FED 
Sbjct  2    ADSKVYRFDEVSKHNVAKDCWLIISGKVYDVTPFLDEHPGGDEVLLAVTGKDATNDFEDI  61

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            GH ++AR M+ ++Y+G+VD  +       YIPP+Q    +P ++S  +I +
Sbjct  62   GHSNSARDMMAKYYIGQVD-LSTVPTTRTYIPPQQAS-YNPDKTSEFVIRI  110



>ref|XP_010671362.1| PREDICTED: cytochrome b5 isoform E [Beta vulgaris subsp. vulgaris]
Length=135

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++ +  EVS HN+ KDCW+II+ K Y+V+ F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDRKVHTFEEVSKHNSNKDCWLIISGKVYDVSPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+GEVD  +   +  +Y+PP+Q
Sbjct  62   VGHSDSAREMMDKYYIGEVD-VSTVPLKRSYVPPQQ  96



>ref|XP_010550884.1| PREDICTED: cytochrome b5-like [Tarenaya hassleriana]
Length=138

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG GE ++ +  EVS H   KDCW++I+ K Y+VT FL +HPGG++VLL++  KDA+++F
Sbjct  1    MG-GEGKVFTLAEVSEHKDRKDCWIVIHGKVYDVTRFLEDHPGGDEVLLSSTAKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH S A+ M++EFYVG++D  +       Y PP+QP
Sbjct  60   EDIGHSSTAKAMMEEFYVGDID-TSTIPTKRKYTPPDQP  97



>ref|XP_010439683.1| PREDICTED: cytochrome B5 isoform D [Camelina sativa]
 ref|XP_010442330.1| PREDICTED: cytochrome B5 isoform D [Camelina sativa]
 ref|XP_010482147.1| PREDICTED: cytochrome B5 isoform D [Camelina sativa]
Length=140

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ + +EVS H++ KDCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLSEVSEHSSSKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++DTAT+   A    P  +  +    +SS   I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVAPTSKNAEATQDKSSDFFIKL  113



>emb|CDX84725.1| BnaA03g15050D [Brassica napus]
Length=134

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E  + + +EVS HN   DCW++I+ K YNVT FL +HPGG++VLL++ GKDA+++FED G
Sbjct  4    EATIFTLSEVSEHNHAHDCWIVISGKVYNVTKFLEDHPGGDEVLLSSTGKDATDDFEDVG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H  +AR M++++YVGE+D  T       Y PP+QP
Sbjct  64   HSESAREMMEQYYVGEID-PTTIPKKTKYTPPKQP  97



>gb|KHN23327.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=118

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +++L +  EV+ HN  KDCW+II+ K Y+VT F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDRKLHTFEEVAKHNQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
             GH  +AR M++++Y+GE+D A+   +   YIPP+Q +
Sbjct  62   VGHSDSARDMMEKYYIGEID-ASTVPLKRTYIPPQQAQ  98



>ref|XP_009119906.1| PREDICTED: cytochrome b5 [Brassica rapa]
Length=134

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A EK+++   EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P QP
Sbjct  62   VGHSDTARDMMEKYYIGEID-SSTVPATRTYVAPVQP  97



>emb|CDX85364.1| BnaC07g26750D [Brassica napus]
Length=138

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H + +DCW+ I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLEEVSQHTSNQDCWIAIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++D+AT+        PP      +  +SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDIDSATVPTKTKFVPPPSNQTQSNQNKSSDFLIKI  113



>ref|NP_001065073.2| Os10g0518200 [Oryza sativa Japonica Group]
 gb|AAK39593.1|AC025296_28 putative cytochrome [Oryza sativa Japonica Group]
 gb|AAP54641.1| Cytochrome b5, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26987.2| Os10g0518200 [Oryza sativa Japonica Group]
Length=134

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGEK++    EV+ HN  KDCW+II  K Y+VT+F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGEKKVFGFEEVAGHNVTKDCWLIIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGE  619
             GH  +AR M++++ +GE+D +TI        P + P + D G+
Sbjct  62   IGHSESAREMMEKYLIGEIDASTIPVKRTHVTPQQAPGNPDKGD  105



>sp|P40934.1|CYB5_BRAOB RecName: Full=Cytochrome b5 [Brassica oleracea var. botrytis]
 gb|AAA32990.1| cytochrome b-5 [Brassica oleracea]
 prf||1905426A cytochrome b5
Length=134

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A EK+++   EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P QP
Sbjct  62   VGHSDTARDMMEKYYIGEID-SSTVPATRTYVAPVQP  97



>ref|XP_010522424.1| PREDICTED: cytochrome b5 isoform B [Tarenaya hassleriana]
Length=134

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A E ++ + +EVS HN  KDCW++IN K Y+VT FL +HPGG++VLL++ GKDA+++FED
Sbjct  2    ADEGKIFALSEVSQHNHAKDCWLVINGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH  +AR M+ ++ VGE+D          Y PP+QP
Sbjct  62   VGHSESAREMMGQYCVGEID-TETIPKKTKYTPPQQP  97



>gb|ACG33225.1| cytochrome b5 [Zea mays]
 gb|ACG35428.1| cytochrome b5 [Zea mays]
 gb|ACG45086.1| cytochrome b5 [Zea mays]
 gb|ACN27410.1| unknown [Zea mays]
 gb|AFW82897.1| cytochrome b5 [Zea mays]
Length=133

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ + + V+ HN+ +DCW+II  K Y+VT FL +HPGG+DVLL++ GKDA+++FED GH 
Sbjct  3    KVFTLDAVAKHNSKEDCWLIIGGKVYDVTKFLVDHPGGDDVLLSSTGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+ VGE+D A+       Y+PP+QP
Sbjct  63   NTARAMMDEYLVGEID-ASTIPSRTKYVPPKQP  94



>gb|EMT06977.1| Cytochrome b5 [Aegilops tauschii]
Length=134

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGEK++    EV+ HN  KDCW++I  K Y+VT F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGEKKMFGFEEVAKHNVTKDCWLVIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATSDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M++++++GE+D A+       ++PP+Q
Sbjct  62   IGHSDSAREMMEKYHIGEID-ASTIPAKRTFVPPQQ  96



>gb|EMS59648.1| Cytochrome b5 [Triticum urartu]
Length=134

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGEK++    EV+ HN  KDCW++I  K Y+VT F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGEKKMFGFEEVAKHNVAKDCWLVIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATSDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M++++++GE+D A+       ++PP+Q
Sbjct  62   IGHSDSAREMMEKYHIGEID-ASTIPAKRTFVPPQQ  96



>ref|NP_001235088.1| uncharacterized protein LOC100305929 [Glycine max]
 gb|ACU13851.1| unknown [Glycine max]
Length=134

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +++L +  EV+ HN  KDCW+II+ K Y+VT F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDRKLHTFEEVAKHNQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M++++Y+GE+D A    +   YIPP+Q +  +P ++   +I +
Sbjct  62   VGHSDSARDMMEKYYIGEID-ALTVPLKRTYIPPQQAQ-YNPDKTPEFVIKI  111



>ref|XP_006281477.1| hypothetical protein CARUB_v10027561mg [Capsella rubella]
 gb|EOA14375.1| hypothetical protein CARUB_v10027561mg [Capsella rubella]
Length=134

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++++  +VS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDRKVLTFEDVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTAREMMEKYYIGEID-SSSVPATRTYVAPQQP  97



>ref|XP_003574201.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
 ref|XP_010234918.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
Length=134

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGEK++    EV+ HN  KDCW++I  K Y+VT F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGEKKVFGFEEVAKHNVAKDCWLVIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATSDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDG  607
             GH  +AR M++++++GE+D A+       ++PP+Q   G
Sbjct  62   IGHSESAREMMEKYHIGEID-ASTIPAKRTFVPPQQAPHG  100



>emb|CDY14370.1| BnaA10g06850D [Brassica napus]
Length=156

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A EK+++   EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  24   ASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  83

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P QP
Sbjct  84   VGHSDTARDMMEKYYIGEID-SSTVPATRTYVAPVQP  119



>ref|XP_006493156.1| PREDICTED: cytochrome b5 isoform A-like isoform X1 [Citrus sinensis]
 ref|XP_006493157.1| PREDICTED: cytochrome b5 isoform A-like isoform X2 [Citrus sinensis]
 ref|XP_006493158.1| PREDICTED: cytochrome b5 isoform A-like isoform X3 [Citrus sinensis]
 gb|KDO40567.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
 gb|KDO40568.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
 gb|KDO40569.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
 gb|KDO40570.1| hypothetical protein CISIN_1g032745mg [Citrus sinensis]
Length=134

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+II+ K Y+V++F+++HPGG++VL++A GKDA+ +FED
Sbjct  2    ASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH  +AR M+D++Y+G++D  +      AYIPP+QP
Sbjct  62   VGHSDSAREMMDKYYIGDID-PSTVPRKRAYIPPQQP  97



>dbj|BAK03168.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG+K++    EV+ HN  KDCW++I  K Y+VT+F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGDKKVFGFEEVARHNVTKDCWLVIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATSDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M++++++GE+D A+       ++PP+Q
Sbjct  62   IGHSDSAREMMEKYHIGEID-ASTIPAKRTFVPPQQ  96



>ref|XP_010442925.1| PREDICTED: cytochrome b5 isoform A [Camelina sativa]
Length=134

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++++  EVS HN  KDCW+II+ K Y+VT F+ +HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M+D++++GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTARDMMDKYHIGEID-SSSVPATRTYVAPQQP  97



>gb|AFK39502.1| unknown [Medicago truncatula]
 gb|KEH35476.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=134

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + +L + ++VS HN  KDCW+I++ K Y+V+ F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKLHTFDDVSKHNKTKDCWLILSGKVYDVSPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M+D++Y+GE+D  +   +   Y+PP+Q +  +P ++S  +I +
Sbjct  62   VGHSDSAREMMDKYYIGEID-PSTVPLKRTYVPPQQSQ-YNPDKTSEFVIKI  111



>emb|CDP03875.1| unnamed protein product [Coffea canephora]
Length=135

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ E +  + ++VS HN  KDCW++I  K Y+VT FL +HPGG++VLL+A GKDA+++F
Sbjct  1    MGS-ETKAFTLSQVSEHNHSKDCWLVIGGKVYDVTKFLEDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH ++AR M+DE  VGE+D  +       Y PP QP
Sbjct  60   EDVGHSTSARAMMDEMCVGEID-TSTIPSRTKYTPPIQP  97



>ref|XP_010252345.1| PREDICTED: cytochrome b5 isoform A [Nelumbo nucifera]
 ref|XP_010252353.1| PREDICTED: cytochrome b5 isoform A [Nelumbo nucifera]
Length=133

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + +     EV+ HN  KDCW+II+ K Y+VT+F+++HPGG++VLLAA GKDA+ +FED
Sbjct  2    ASDSKTYLFEEVAEHNKTKDCWLIISGKVYDVTSFMDDHPGGDEVLLAATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ-PKDGDPGESSPRIIN  640
             GH  +AR +++++Y+GE+D ++   +   YIPP+Q P + D  +   +I+ 
Sbjct  62   VGHSDSAREIMEKYYIGEID-SSTIPLKRTYIPPQQTPYNSDKTQFVIKIMQ  112



>ref|XP_007140599.1| hypothetical protein PHAVU_008G125800g [Phaseolus vulgaris]
 gb|ESW12593.1| hypothetical protein PHAVU_008G125800g [Phaseolus vulgaris]
Length=137

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
             GE+ + +  +VS HN  KDCW+II+ K YNVT FL++HPGG+DVLL++ GKDA+++FED
Sbjct  2    GGERMVYTLAQVSEHNNSKDCWLIIDGKVYNVTKFLDDHPGGDDVLLSSTGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVD  547
             GH  +AR ML + YVG++D
Sbjct  62   VGHSKSARAMLGDLYVGDID  81



>ref|XP_009127155.1| PREDICTED: cytochrome b5-like [Brassica rapa]
 emb|CDY28830.1| BnaA02g10220D [Brassica napus]
 emb|CDX96233.1| BnaC02g14180D [Brassica napus]
Length=134

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +K+++   EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P QP
Sbjct  62   VGHSDTARDMMEKYYIGEID-SSSVPKTRTYVAPAQP  97



>ref|XP_011011719.1| PREDICTED: cytochrome b5 isoform A [Populus euphratica]
Length=133

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E + HNTP+DCW++I+ K Y+V ++L+EHPGG+DV+LA  GKDA++EFEDAGH 
Sbjct  6    KLYTMQEAAQHNTPQDCWIVIDGKVYDVGSYLDEHPGGDDVILATTGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR +L+ F++GE+D
Sbjct  66   KSARELLETFFIGELD  81



>ref|XP_010318050.1| PREDICTED: cytochrome b5 isoform A [Solanum lycopersicum]
 ref|XP_010318051.1| PREDICTED: cytochrome b5 isoform A [Solanum lycopersicum]
Length=134

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++ +  EV+ HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDRKIHAFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+GE+D  +   +  AYIP EQ
Sbjct  62   VGHSDSAREMMDKYYIGEID-MSTVPLKRAYIPSEQ  96



>sp|P49097.1|CYB5_CUSRE RecName: Full=Cytochrome b5 [Cuscuta reflexa]
 gb|AAA62621.1| cytochrome b5 [Cuscuta reflexa]
Length=135

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G  ++ S  EVS H+ P DCW++I  K Y+VT FL++HPGG DVLL++  KDA+++FED 
Sbjct  2    GGSKVYSLAEVSEHSQPNDCWLVIGGKVYDVTKFLDDHPGGADVLLSSTAKDATDDFEDI  61

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH S+AR M+DE  VG++D ++      +Y PP+QP
Sbjct  62   GHSSSARAMMDEMCVGDID-SSTIPTKTSYTPPKQP  96



>gb|KEH29077.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
Length=148

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = +2

Query  296  QAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASE  475
            Q+    E+++ +  +VS HN+ KDCW++I+ K Y+VT FL +HPGG++VL+++ GKDAS 
Sbjct  11   QSTMGEERKVFTLADVSKHNSAKDCWLVIHNKVYDVTKFLEDHPGGDEVLISSTGKDASN  70

Query  476  EFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            +F+D GH ++A  M++E+YVG++D ++       Y PP+QP
Sbjct  71   DFDDIGHSTSAYTMMEEYYVGDID-SSTIPSKVDYTPPKQP  110



>gb|ABK23699.1| unknown [Picea sitchensis]
Length=134

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
             + ++    +VS HNT +DCW++I+ K Y+VT FL +HPGG++VL++A GKDA+++FED 
Sbjct  3    SDTKVYRLEDVSKHNTHQDCWLVIDGKVYDVTKFLEDHPGGDEVLISATGKDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            GH S+AR M+DE+YVG++D  +       Y P +Q    +P +SS  II +
Sbjct  63   GHSSSARAMMDEYYVGDID-PSTIPSKPKYTPAKQAP-YNPDKSSEFIIKI  111



>ref|XP_010524689.1| PREDICTED: cytochrome b5 [Tarenaya hassleriana]
Length=134

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H+T  DCW++I+ K Y+VT FL++HPGG++VLL+A GKDA+++F
Sbjct  1    MG-GDDKVFTLAEVSEHSTKHDCWLVIDGKVYDVTKFLDDHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVD  547
            ED GH + A+ MLDE+YVG++D
Sbjct  60   EDVGHSTTAKAMLDEYYVGDID  81



>ref|XP_002865680.1| ATB5-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41939.1| ATB5-B [Arabidopsis lyrata subsp. lyrata]
Length=140

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG G+ ++ +  EVS H++ +DCW++I+ K Y+VT FL++HPGG++V+L + GKDA+++F
Sbjct  1    MG-GDGKVFTLAEVSQHSSSQDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH S A+ MLDE+YVG++DTAT+   A    P  +    +  +SS  +I +
Sbjct  60   EDVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSKTVKANQDKSSEFVIKL  113



>ref|XP_011089685.1| PREDICTED: cytochrome b5-like [Sesamum indicum]
Length=132

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HNT KDCW+II  K Y+VT FL++HPGG++VL+ A GKDA+++FED GH 
Sbjct  3    KVFTLAEVSQHNTNKDCWLIIGGKVYDVTKFLDDHPGGDEVLVTATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPG  616
            + AR ML+E+YVG++++++  A  A+  P +  K+ D G
Sbjct  63   ATARAMLEEYYVGDINSSSTPAKTASAPPKQTQKNEDAG  101



>ref|XP_010482757.1| PREDICTED: cytochrome b5 isoform A-like [Camelina sativa]
Length=134

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++++  EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++++GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTARDMMEKYHIGEID-SSTVPATRTYVAPQQP  97



>ref|XP_002314997.2| cytochrome b5 isoform Cb5-D family protein [Populus trichocarpa]
 gb|EEF01168.2| cytochrome b5 isoform Cb5-D family protein [Populus trichocarpa]
Length=132

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E + HNTP+DCWV+I+ K Y+V ++L+EHPGG+DV+LA  GKDA++EFEDAGH 
Sbjct  6    KLYTMQEAAQHNTPQDCWVVIDGKVYDVGSYLDEHPGGDDVILATTGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR  L+ F++GE+D
Sbjct  66   KSAREQLETFFIGELD  81



>gb|EYU42121.1| hypothetical protein MIMGU_mgv1a016165mg [Erythranthe guttata]
Length=132

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L++  E S HNT +DCWV+I+ K Y+V+ +L+EHPGG+DVLL A GKDA+EEFEDAGH 
Sbjct  6    KLITMKEASEHNTAEDCWVVIDGKVYDVSAYLDEHPGGDDVLLKATGKDATEEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
              AR +++EF +GE+D
Sbjct  66   KTARELMEEFCIGEID  81



>ref|XP_010464293.1| PREDICTED: cytochrome b5-like [Camelina sativa]
Length=134

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG +++++  E+S H +  DCW++I+ K Y+VT+FL +HPGG+DV+L A GKDA+ EFE+
Sbjct  2    AGNRKVLNLLELSQHRSRHDCWLLIDGKVYDVTDFLKDHPGGDDVILFATGKDATHEFEE  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRII  637
             GH ++A+ ML EFYVG++D+     VA     P Q +     ++S  +I
Sbjct  62   VGHSTSAKAMLSEFYVGDIDSTKANDVAITTATPTQTEQNQDNKNSELLI  111



>gb|EEC67315.1| hypothetical protein OsI_34332 [Oryza sativa Indica Group]
 gb|EEE51272.1| hypothetical protein OsJ_32170 [Oryza sativa Japonica Group]
Length=197

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGEK++    EV+ HN  KDCW+II  K Y+VT+F++EHPGG++VLLA  GKDA+ +FED
Sbjct  65   AGEKKVFGFEEVAGHNVTKDCWLIIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATNDFED  124

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGE  619
             GH  +AR M++++ +GE+D +TI        P + P + D G+
Sbjct  125  IGHSESAREMMEKYLIGEIDASTIPVKRTHVTPQQAPGNPDKGD  168



>ref|XP_006661960.1| PREDICTED: cytochrome b5-like [Oryza brachyantha]
Length=133

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGEK++    EV+ HN  KDCW+II  K Y+VT+F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGEKKVFGFEEVAGHNVTKDCWLIIAGKVYDVTSFMDEHPGGDEVLLAVTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGE  619
             GH  +AR M++++ +GE+D A+   V   ++ P+Q    D G+
Sbjct  62   IGHSESAREMMEKYLIGEID-ASTIPVKRTHVSPQQVPSNDKGD  104



>emb|CDY20247.1| BnaC09g29920D [Brassica napus]
Length=190

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A EK+++   EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +FED
Sbjct  58   ASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFED  117

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M++++Y+GE+D ++       Y+ P QP
Sbjct  118  VGHSDTARDMMEKYYIGEID-SSTVPATRTYVAPVQP  153



>ref|XP_006577772.1| PREDICTED: uncharacterized protein LOC100499823 isoform X1 [Glycine 
max]
 gb|KHN19531.1| Cytochrome b5 isoform 1 [Glycine soja]
Length=134

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +++L +  EV+ H+  KDCW+II+ K Y+VT F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDRKLHTFEEVAKHDQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M++++Y+GE+D ++   +   YIPP+Q +  +P ++   +I +
Sbjct  62   VGHSDSARDMMEKYYIGEID-SSTVPLKRTYIPPQQAQ-YNPDKTPEFVIKI  111



>ref|XP_006367355.1| PREDICTED: cytochrome b5 isoform A-like [Solanum tuberosum]
Length=134

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ +K  V   EV+ HN  KDCW+II+ K Y+VT F+ +HPGG++VLL+A GKDA+ +F
Sbjct  1    MGSDQKVHV-FEEVAKHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH  +AR M+D++Y+G++D  +   +  AYIPP+Q    +P ++S  +I +
Sbjct  60   EDVGHSDSAREMMDKYYIGDID-QSTVPLKRAYIPPQQAP-YNPDKTSEFVIKI  111



>ref|XP_011075921.1| PREDICTED: cytochrome b5 isoform E [Sesamum indicum]
 ref|XP_011075922.1| PREDICTED: cytochrome b5 isoform E [Sesamum indicum]
Length=134

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+IIN K Y+VT F+++HPGG++VLLAA GKDA+ +FED
Sbjct  2    ASDPKVHLFEEVAKHNEVKDCWLIINGKVYDVTPFMDDHPGGDEVLLAAVGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+GE+D      +  AY+PP+Q
Sbjct  62   VGHSDSAREMMDKYYIGEID-MATVPLKRAYVPPKQ  96



>gb|AFK40091.1| unknown [Medicago truncatula]
Length=153

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + +L + ++VS HN  KDCW+I++ K Y+V+ F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKLHTFDDVSKHNKTKDCWLILSGKVYDVSPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M+D++Y+GE+D  +   +   Y+PP+Q +  +P ++S  +I +
Sbjct  62   VGHSDSAREMMDKYYIGEID-PSTVPLKRTYVPPQQSQ-YNPDKTSEFVIKI  111



>ref|XP_002884627.1| hypothetical protein ARALYDRAFT_896865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60886.1| hypothetical protein ARALYDRAFT_896865 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG  ++++ +E+S H++  DCW++I  K Y+VT FL +HPGG+DVLL+A GKDA+ EFE+
Sbjct  2    AGNGKVLNLSELSQHSSRHDCWLLIEGKVYDVTEFLKDHPGGDDVLLSATGKDATHEFEE  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGES  622
             GH S+A++ML EFYVG++D+   +   A    P Q +      S
Sbjct  62   VGHSSSAKVMLSEFYVGDIDSTKASDDIATTATPNQTEQNQDNRS  106



>ref|XP_003604969.1| Cytochrome b5 [Medicago truncatula]
 gb|AES87166.1| cytochrome b5-like heme/steroid-binding domain protein [Medicago 
truncatula]
 gb|AFK33403.1| unknown [Medicago truncatula]
Length=135

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  314  EKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAG  493
            E+++ +  +VS HN+ KDCW++I+ K Y+VT FL +HPGG++VL+++ GKDAS +F+D G
Sbjct  4    ERKVFTLADVSKHNSAKDCWLVIHNKVYDVTKFLEDHPGGDEVLISSTGKDASNDFDDIG  63

Query  494  HGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            H ++A  M++E+YVG++D ++       Y PP+QP
Sbjct  64   HSTSAYTMMEEYYVGDID-SSTIPSKVDYTPPKQP  97



>ref|XP_010090895.1| Cytochrome b5 isoform 1 [Morus notabilis]
 gb|EXB41100.1| Cytochrome b5 isoform 1 [Morus notabilis]
Length=135

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDSKVHVFEEVAKHNKTKDCWLIISGKVYDVTTFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+ ++Y+GE+D ++   +   YIPP+Q
Sbjct  62   VGHSDSARDMMKKYYIGEID-SSTVPLKRTYIPPQQ  96



>gb|EYU45298.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
 gb|EYU45299.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
 gb|EYU45300.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
 gb|EYU45301.1| hypothetical protein MIMGU_mgv1a016099mg [Erythranthe guttata]
Length=134

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  338  EVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHGSAARLM  517
            EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED GH  +AR M
Sbjct  12   EVSKHNKTKDCWLIIDGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFEDVGHSDSAREM  71

Query  518  LDEFYVGEVDtatiaavaaaYIPPEQP  598
            +D++Y+GE+D      +   Y+ P+QP
Sbjct  72   MDKYYIGEID-KATVPLKRTYVAPQQP  97



>ref|XP_009602193.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana tomentosiformis]
Length=169

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 80/116 (69%), Gaps = 5/116 (4%)
 Frame = +2

Query  248  AMSAYIY*LPQRRKESQAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHP  427
            ++ A +Y +   R+E   MG+ +K  V   EV+ HN  KDCW+II+ K Y+VT F+ +HP
Sbjct  21   SIYACLYSIQSSREE---MGSNQKVHVF-EEVAKHNKTKDCWLIISGKVYDVTPFMEDHP  76

Query  428  GGEDVLLAAAGKDASEEFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
            GG++VLL+A GKDA+ +FED GH   AR M+D++Y+GE+D  +   +  AY+PP+Q
Sbjct  77   GGDEVLLSATGKDATNDFEDVGHSDDARKMMDKYYIGEID-TSTVPLKCAYVPPQQ  131



>emb|CDP00455.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E + HNT +DCWV+I+ K Y+V+++LNEHPGG+DVL+AA GKDA++EFEDAGH 
Sbjct  6    KLYTMQEAAQHNTSEDCWVVIDGKVYDVSSYLNEHPGGDDVLIAATGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKD  604
             +AR ++++F +GE+D +++A      +  +Q  D
Sbjct  66   KSARELMEKFCIGELDESSLAIPELEIVRAKQAAD  100



>ref|XP_009388909.1| PREDICTED: cytochrome b5 [Musa acuminata subsp. malaccensis]
Length=133

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A   +L S  E + HNT  DCWV+I+ K Y+VT++L+EHPGG+DVLL+AAG+D++E+FED
Sbjct  2    ATLSKLYSMREAAEHNTRDDCWVVIHGKVYDVTSYLDEHPGGDDVLLSAAGRDSTEDFED  61

Query  488  AGHGSAARLMLDEFYVGEVD  547
            AGH  +AR ++ ++Y+GE+D
Sbjct  62   AGHSKSARELMQDYYIGELD  81



>ref|XP_009593163.1| PREDICTED: cytochrome b5 isoform A [Nicotiana tomentosiformis]
Length=134

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+IIN K Y+VT F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDGKVHGFEEVAKHNKTKDCWLIINGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+G++D  +   +  AYIPP+Q
Sbjct  62   VGHSDSAREMMDKYYIGDID-VSTVPLKRAYIPPQQ  96



>gb|ABK22670.1| unknown [Picea sitchensis]
Length=136

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW+IIN K Y+VTN+L EHPGG++VLL+A GKDA+++FEDAGH 
Sbjct  11   KMYTLLEVSQHNNDKDCWLIINGKVYDVTNYLEEHPGGDEVLLSATGKDATDDFEDAGHS  70

Query  500  SAARLMLDEFYVGEVD  547
            ++AR  ++E+Y+G++D
Sbjct  71   NSARETMEEYYIGDID  86



>ref|XP_010486251.1| PREDICTED: cytochrome B5 isoform D-like [Camelina sativa]
Length=140

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 72/107 (67%), Gaps = 3/107 (3%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AG +++ +  E+S H +  DCW++I+ K Y+VT+FL +HPGG+DVLL A GKDA+ EFE+
Sbjct  8    AGNRKVFNLLELSQHRSRHDCWLLIDGKVYDVTDFLKDHPGGDDVLLFATGKDATHEFEE  67

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIP---PEQPKDGDPGE  619
             GH S+A+ ML EFYVG++D+     +A    P    EQ +D +  E
Sbjct  68   VGHSSSAKAMLSEFYVGDIDSTKANDIAITATPKQTTEQIQDNNNSE  114



>ref|XP_011084546.1| PREDICTED: cytochrome b5 isoform E-like [Sesamum indicum]
Length=136

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++ +  EV+ HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKVHTFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+GE+D      +  AY PP+Q
Sbjct  62   VGHSDSAREMMDKYYIGEID-MATVPLKRAYTPPQQ  96



>ref|XP_003559382.1| PREDICTED: cytochrome b5 [Brachypodium distachyon]
Length=135

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP DCWV+++ K Y+VT +L++HPGG DVLLA  GKD +EEFEDAGH 
Sbjct  6    KLYSMKEAALHNTPDDCWVVVDGKIYDVTKYLDDHPGGADVLLAVTGKDGTEEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ ++++GE+D
Sbjct  66   KSAKELMQDYFIGELD  81



>gb|ABK23501.1| unknown [Picea sitchensis]
Length=134

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ + ++ S  EVS HN  KDCW++I  K Y+VTNFL EHPGG++VLL+A GKDA+++F
Sbjct  1    MGS-DPKVYSLAEVSEHNYNKDCWLVIGGKVYDVTNFLEEHPGGDEVLLSATGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVD  547
            ED GH ++AR M+D++++GE+D
Sbjct  60   EDVGHSNSAREMMDQYHIGEID  81



>ref|XP_008811745.1| PREDICTED: cytochrome b5-like [Phoenix dactylifera]
Length=132

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG+ + ++ +  E S HN+ +DCW++I  K Y+VT FL +HPGG++VLL++ GKDA+++F
Sbjct  1    MGS-DAKVYTLEEASKHNSNEDCWLVIGGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDF  59

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ED GH + AR M+DE+ VGE+D A+       Y PP+QP
Sbjct  60   EDVGHSTTARAMMDEYCVGEID-ASTIPTKVKYTPPKQP  97



>ref|NP_001288487.1| cytochrome b5 [Zea mays]
 gb|ACG33399.1| cytochrome b5 [Zea mays]
 gb|AFW67588.1| cytochrome b5 [Zea mays]
Length=135

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP DCWV+++ K Y+VT +L +HPGG DVLL A GKDA+EEF+DAGH 
Sbjct  6    KLYSMKEAALHNTPDDCWVVVDGKIYDVTKYLEDHPGGADVLLEATGKDATEEFDDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ +++VGE+D
Sbjct  66   KSAKELMQDYFVGELD  81



>emb|CDY12180.1| BnaC04g12100D [Brassica napus]
Length=156

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +2

Query  293  SQAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDAS  472
            ++ MG  E ++ + ++VS HN   DCW++IN K Y+VT FL +HPGG++VLL++ GKDA+
Sbjct  20   AKTMG-DEAKIFTLSQVSEHNQAHDCWIVINGKVYDVTKFLEDHPGGDEVLLSSTGKDAT  78

Query  473  EEFEDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            ++FED GH  +AR M++++ VGE+D  T       Y PP+QP
Sbjct  79   DDFEDVGHSESAREMMEQYCVGEID-PTTIPKKTKYTPPKQP  119



>ref|NP_001236501.1| uncharacterized protein LOC100499823 [Glycine max]
 gb|ACU13805.1| unknown [Glycine max]
Length=134

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +++L +  EV+ H+  KDCW+II+ K Y+VT F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDRKLHTFEEVAKHDQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M++++Y+G++D ++   +   YIPP+Q +  +P ++   +I +
Sbjct  62   VGHSDSARDMMEKYYIGKID-SSTVPLKRTYIPPQQAQ-YNPDKTPEFVIKI  111



>ref|XP_010555748.1| PREDICTED: cytochrome b5 isoform E-like [Tarenaya hassleriana]
 ref|XP_010555749.1| PREDICTED: cytochrome b5 isoform E-like [Tarenaya hassleriana]
Length=135

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            M +  K+ ++  EVS HN  +D W+II+ K Y+VT F+++HPGG++VLL++ GKDA+ +F
Sbjct  1    MSSDSKKFLTFEEVSKHNKTEDLWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATSDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
            ED GH    R M+ ++++GE+D ++       Y+PP+QP   +P ++   ++N+
Sbjct  61   EDVGHSDTTRDMMHQYFIGEID-SSTVPTKRTYVPPQQPA-YNPDKTPDFVMNI  112



>ref|XP_009786222.1| PREDICTED: cytochrome b5 isoform B [Nicotiana sylvestris]
Length=133

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E S HNT  DCWV+I+ K Y+V+++L+EHPGG+DV+LAA GKDA++EFEDAGH 
Sbjct  6    KLFTMEEASQHNTKDDCWVVIDGKVYDVSSYLDEHPGGDDVVLAATGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
              AR ++++F++GE+D
Sbjct  66   KDARELMEKFFIGELD  81



>emb|CAA04703.1| cytochome b5 [Olea europaea]
Length=134

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV  H+  KDCW++IN K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKIYVYEEVEKHDKTKDCWLVINGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+GE+D  +       Y PP+Q
Sbjct  62   VGHSDSAREMMDKYYIGEID-VSTVPTKRTYTPPQQ  96



>ref|XP_006441191.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 ref|XP_006441192.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 ref|XP_006441193.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 gb|ESR54431.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 gb|ESR54432.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
 gb|ESR54433.1| hypothetical protein CICLE_v10022811mg [Citrus clementina]
Length=134

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+II+ K Y+V++F+++HPGG++VL++A GKDA+ +FED
Sbjct  2    ASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH  +AR M+D++Y+G++D  +      AYIP EQP
Sbjct  62   VGHSDSAREMMDKYYIGDID-PSTVPRKRAYIPLEQP  97



>ref|XP_008810951.1| PREDICTED: cytochrome b5 [Phoenix dactylifera]
Length=133

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E S HNT  DCWV+I+ K Y+VTN+L+EHPGG+DVLL+AAG+D++EEFE+AGH 
Sbjct  6    KLYSMEEASQHNTQDDCWVVIDGKVYDVTNYLDEHPGGDDVLLSAAGRDSTEEFEEAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR ++ ++ +GE+D
Sbjct  66   KSARELMQDYCIGELD  81



>gb|ACG45610.1| cytochrome b5 [Zea mays]
Length=135

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP DCWV+++ K Y+VT +L +HPGG DVLL A GKDA+EEF+DAGH 
Sbjct  6    KLYSMKEAALHNTPDDCWVVVDGKIYDVTKYLEDHPGGADVLLEATGKDATEEFDDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ ++++GE+D
Sbjct  66   KSAKELMQDYFIGELD  81



>ref|XP_010933787.1| PREDICTED: cytochrome b5 isoform E-like [Elaeis guineensis]
 ref|XP_010933788.1| PREDICTED: cytochrome b5 isoform E-like [Elaeis guineensis]
 ref|XP_010933789.1| PREDICTED: cytochrome b5 isoform E-like [Elaeis guineensis]
Length=134

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + +  + +EV+ HN  +DCW+II+ K YNVT F++EHPGG+DVLLAA GKDA+ +FED
Sbjct  2    ATDPKTYNFDEVAKHNVAEDCWLIISGKVYNVTPFMDEHPGGDDVLLAATGKDAANDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRII  637
             GH ++AR M+ ++++GE+D++TI        P E P + D    +P++I
Sbjct  62   IGHSTSAREMMAKYFIGELDSSTIPTKHTYAPPQEAPSNPD---KTPQLI  108



>ref|XP_010445931.1| PREDICTED: cytochrome b5 isoform A-like [Camelina sativa]
Length=134

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A ++++++  EVS HN  KDCW+II+ K Y+VT F+ +HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDRKVLTFEEVSQHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             GH   AR M+ ++++GE+D ++       Y+ P+QP
Sbjct  62   VGHSDTARDMMAKYHIGEID-SSSVPATRTYVAPQQP  97



>gb|ACG41888.1| cytochrome b5 [Zea mays]
Length=135

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP DCWVI++ K Y+VT +L +HPGG DVLL A GKDA+EEF+DAGH 
Sbjct  6    KLYSMEEAALHNTPDDCWVIVDGKIYDVTKYLEDHPGGADVLLEATGKDATEEFDDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ ++++GE+D
Sbjct  66   KSAKDLMQDYFIGELD  81



>gb|ACG49215.1| cytochrome b5 [Zea mays]
Length=135

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP DCWV+++ K Y+VT +L +HPGG DVLL A GKDA+EEF+DAGH 
Sbjct  6    KLYSMEEAALHNTPDDCWVVVDGKIYDVTKYLEDHPGGADVLLEATGKDATEEFDDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ ++++GE+D
Sbjct  66   KSAKELMQDYFIGELD  81



>emb|CDY59638.1| BnaAnng16110D [Brassica napus]
Length=134

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ + ++VS HN   DCW++IN K Y+VT FL +HPGG++VLL++ GKDA+++FED GH 
Sbjct  6    KIFTLSQVSEHNQAHDCWIVINGKVYDVTKFLEDHPGGDEVLLSSTGKDATDDFEDVGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
             +AR M++++ VGE+D  T       Y PP+QP
Sbjct  66   ESAREMMEQYCVGEID-PTTIPKKTKYTPPKQP  97



>ref|XP_009796903.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana sylvestris]
 ref|XP_009796904.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana sylvestris]
Length=134

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
             ++++    EVS HN  KDCW+II+ K Y+VT F+ +HPGG++VLL+A GKDA+ +FED 
Sbjct  3    SDQKVHVFEEVSKHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
            GH   AR M+D++Y+GE+D A+   +  AY+PP+Q
Sbjct  63   GHSDDARKMMDKYYIGEID-ASTVPLKHAYVPPQQ  96



>ref|XP_004981737.1| PREDICTED: cytochrome b5 isoform B-like [Setaria italica]
Length=133

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP+DCWV+++ K Y+VT +L +HPGG DVLL A GKDA EEF+DAGH 
Sbjct  6    KLYSMKEAALHNTPEDCWVVVDGKIYDVTKYLEDHPGGADVLLEATGKDAKEEFDDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ ++++GE+D
Sbjct  66   KSAKELMQDYFIGELD  81



>ref|XP_004960538.1| PREDICTED: cytochrome b5-like [Setaria italica]
Length=133

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EV+ HN+  DCW+II  K Y+VT FL +HPGG+DVLL++  KDA+++FED GH 
Sbjct  3    KVYTLEEVAKHNSKDDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTAKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            + AR M+DE+ +GE+D ++       Y+ P+QP
Sbjct  63   TTARAMMDEYLLGEID-SSTIPARTKYVAPKQP  94



>gb|AFK33484.1| unknown [Lotus japonicus]
Length=126

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  329  SCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHGSAA  508
            +  E SLHNT  DCW++++ K Y+VT +L++HPGG+DVL+AA GKDA+++FEDAGH   A
Sbjct  9    TMQEASLHNTKDDCWIVVDGKVYDVTQYLDDHPGGDDVLIAATGKDATDDFEDAGHSKTA  68

Query  509  RLMLDEFYVGEVD  547
            R ++ E+Y+GE+D
Sbjct  69   RELMAEYYIGELD  81



>ref|XP_009115356.1| PREDICTED: cytochrome b5 isoform A [Brassica rapa]
 emb|CDY16153.1| BnaA09g28870D [Brassica napus]
Length=135

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 76/113 (67%), Gaps = 14/113 (12%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ S  EV+ HN   DCW++I+ K Y+VT +++EHPGG+DVLLA  GKDA++EFEDAGH 
Sbjct  6    KIYSMEEVAAHNKQDDCWIVIDGKVYDVTPYMDEHPGGDDVLLAVTGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP-----KDGDPGESSPRIINV  643
              AR +++E+++GE+D A++         PE P     K  DP +S  +++++
Sbjct  66   KTARELMEEYFIGELDEASL---------PEIPELKIYKKEDPKDSVQKLVDL  109



>ref|XP_002466437.1| hypothetical protein SORBIDRAFT_01g007770 [Sorghum bicolor]
 gb|AAO17707.1| cytochrome b5 [Sorghum bicolor]
 gb|EER93435.1| hypothetical protein SORBIDRAFT_01g007770 [Sorghum bicolor]
Length=133

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E +LHNTP DCWV+++ K Y+VT +L +HPGG DVLL A GKDA+EEF+DAGH 
Sbjct  6    KLYSMEEAALHNTPDDCWVVVDGKIYDVTKYLEDHPGGADVLLEATGKDATEEFDDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +A+ ++ ++++GE+D
Sbjct  66   KSAKELMQDYFIGELD  81



>ref|XP_002300176.1| cytochrome b5 isoform 2 family protein [Populus trichocarpa]
 ref|XP_011045662.1| PREDICTED: cytochrome b5 isoform B-like [Populus euphratica]
 gb|EEE84981.1| cytochrome b5 isoform 2 family protein [Populus trichocarpa]
Length=134

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
            G+ ++ +  +V++HN PKDCW+IIN K Y+VT F+ +HPGG++VLL++ G+DA+++FED 
Sbjct  3    GDAKVFTFEDVTVHNKPKDCWLIINGKVYDVTKFMEDHPGGDEVLLSSTGQDATDDFEDV  62

Query  491  GHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            GH  +AR M+ E+ +G++D A+       Y  P+QP
Sbjct  63   GHSDSAREMMAEYCIGDID-ASTVPKKTKYKTPQQP  97



>ref|XP_009628358.1| PREDICTED: cytochrome b5 isoform B [Nicotiana tomentosiformis]
Length=133

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E S HNT  DCWV+I+ K Y+V+++L+EHPGG+DV+L+A GKDA++EFEDAGH 
Sbjct  6    KLFTMEEASQHNTKDDCWVVIDGKVYDVSSYLDEHPGGDDVVLSATGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
              AR ++++F++GE+D
Sbjct  66   KDARELMEKFFIGELD  81



>ref|XP_007039163.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
 ref|XP_007039164.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
 gb|EOY23664.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
 gb|EOY23665.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 1 [Theobroma cacao]
Length=134

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++ +  EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ATDPKMHTFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+ ++Y+G++D +        YIPP Q
Sbjct  62   VGHSDSARDMMKKYYIGDID-SKTVPAKRTYIPPLQ  96



>ref|XP_009798397.1| PREDICTED: cytochrome b5 isoform A-like [Nicotiana sylvestris]
Length=134

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDGKVHGFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+D++Y+G++D  +   +  +Y+PP+Q
Sbjct  62   VGHSDSAREMMDKYYIGDID-VSTVPLKRSYVPPQQ  96



>ref|XP_007136483.1| hypothetical protein PHAVU_009G048900g [Phaseolus vulgaris]
 gb|ESW08477.1| hypothetical protein PHAVU_009G048900g [Phaseolus vulgaris]
Length=134

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A +++  +  EV+ HN  KDCW++I+ K Y+VT F+ EHPGG++VLL+  GKDA+ +FED
Sbjct  2    ASDRKFHTFEEVAKHNQTKDCWLVISGKVYDVTPFMEEHPGGDEVLLSGTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH  +AR M+ ++Y+GE+D A+   +   Y+PP+Q
Sbjct  62   VGHSDSARDMMAKYYIGEID-ASTVPLKRTYVPPQQ  96



>ref|XP_009389266.1| PREDICTED: cytochrome b5 isoform A-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  311  GEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDA  490
             + ++   +EV+ H   KDCW+II+ K Y+VT F++EHPGG+DVLL A+GKDA+ +FED 
Sbjct  2    ADSKIYHFDEVAKHKGAKDCWLIISGKVYDVTQFMDEHPGGDDVLLTASGKDATNDFEDI  61

Query  491  GHGSAARLMLDEFYVGEVD  547
            GH +AAR M+D++Y+G++D
Sbjct  62   GHSNAAREMMDKYYIGKID  80



>ref|XP_010937875.1| PREDICTED: cytochrome b5 isoform A [Elaeis guineensis]
Length=133

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E S HNT +DCWV+I+ K Y+VT +L++HPGG+DVLL+AAGK+++EEFEDAGH 
Sbjct  6    KLYSMKEASQHNTQEDCWVVIDGKVYDVTKYLDDHPGGDDVLLSAAGKNSTEEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR ++ ++ +GE+D
Sbjct  66   KSARELMQDYCIGELD  81



>ref|XP_009351942.1| PREDICTED: cytochrome b5 isoform A-like [Pyrus x bretschneideri]
Length=134

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+I+  K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKVHVFEEVAKHNKTKDCWLIVAGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M++++Y+GEVD  +   +   YIPP Q +  +P ++S  +I +
Sbjct  62   VGHSDSAREMMEKYYIGEVD-QSTVPLKRTYIPPPQGR-YNPDKTSEFVIKI  111



>ref|XP_001764653.1| predicted protein [Physcomitrella patens]
 gb|EDQ70635.1| predicted protein [Physcomitrella patens]
Length=143

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QAMGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASE  475
             A    EK++ +  EVS HN  +DCW+II  K Y+VT FL +HPGG++VLL+A GKDA++
Sbjct  1    MADAGAEKKVYTLEEVSGHNHARDCWLIIGGKVYDVTKFLEDHPGGDEVLLSATGKDATD  60

Query  476  EFEDAGHGSAARLMLDEFYVGEVD  547
            +FED GH ++AR M+D++ VG++D
Sbjct  61   DFEDVGHSTSARSMMDDYLVGDID  84



>gb|AFK48600.1| unknown [Lotus japonicus]
Length=135

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +2

Query  302  MGAGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEF  481
            MG    +L +  E + H+  KD W++I+ K YNVT FL +HPGG+ VLL++ GKDAS +F
Sbjct  1    MGGEGTKLFTLAEAAEHSNVKDFWLVIHGKVYNVTKFLEDHPGGDAVLLSSTGKDASNDF  60

Query  482  EDAGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            +D GH ++A  M+DEFYVG++D  +    +  Y PP+QP+
Sbjct  61   DDIGHSTSAVSMMDEFYVGDID-TSTIPSSVKYTPPKQPQ  99



>ref|XP_002464365.1| hypothetical protein SORBIDRAFT_01g017020 [Sorghum bicolor]
 gb|EER91363.1| hypothetical protein SORBIDRAFT_01g017020 [Sorghum bicolor]
Length=134

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            AGE ++    EV+ HN  KDCW+II  K Y+VT F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    AGENKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGD  610
             GH  +AR M++++++G++D +TI A      P + P   D
Sbjct  62   IGHSDSARDMMEKYHIGQIDASTIPAKRTYVHPQQAPSHAD  102



>emb|CDX85016.1| BnaC05g20390D [Brassica napus]
Length=135

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ S  EV+ HN   DCW++I+ K Y+VT +++EHPGG+DVLLA  GKDA++EFEDAGH 
Sbjct  6    KIYSMEEVAAHNKQDDCWIVIDGKVYDVTPYMDEHPGGDDVLLAVTGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYI-PPEQPKDG  607
              AR +++E+++GE+D A++  +    I   E+PKD 
Sbjct  66   KTARELMEEYFIGELDEASLPEIPELKIYKKEEPKDS  102



>ref|XP_002264175.1| PREDICTED: cytochrome b5 isoform A [Vitis vinifera]
 emb|CBI27309.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E SLHN+  DCWV+I+ K Y+VT +L+EHPGG+DV+LA  GKDA+++FEDAGH 
Sbjct  6    KLFSMQEASLHNSKDDCWVVIDGKVYDVTTYLDEHPGGDDVILATTGKDATDDFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
            + AR ++  F VGE+D
Sbjct  66   NDARELMKSFCVGELD  81



>ref|XP_004982596.1| PREDICTED: cytochrome b5-like isoform X1 [Setaria italica]
 ref|XP_004982597.1| PREDICTED: cytochrome b5-like isoform X2 [Setaria italica]
Length=134

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A EK++    EV+ HN  KDCW+II  K Y+VT F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    ADEKKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGD  610
             GH  +AR M++++++G++D +TI A      P + P++ D
Sbjct  62   IGHSDSAREMMEKYHIGQIDASTIPAKRTYVNPQQVPRNVD  102



>gb|ADB85108.1| cytochrome b5 [Jatropha curcas]
Length=134

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    +V++HN PKDCW+II+ K Y+VT+F+++HPGG++VLL++ GKDA+ +FED
Sbjct  2    ASDPKIHKFEDVAVHNKPKDCWLIISGKVYDVTSFMDDHPGGDEVLLSSTGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVD  547
             GH  +AR M++++Y+GE+D
Sbjct  62   VGHSDSARDMMEKYYIGEID  81



>ref|XP_010100688.1| Cytochrome b5, seed isoform [Morus notabilis]
 gb|EXB83850.1| Cytochrome b5, seed isoform [Morus notabilis]
Length=134

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++ + +EV+ HN  KDCW+II+ K YNVT FL EHPGG++VLL AA KDA+++FED
Sbjct  2    ARDSKVFAFDEVAKHNHKKDCWIIISGKVYNVTEFLEEHPGGDEVLLLAAEKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVD  547
             GH   AR M++++YVG+VD
Sbjct  62   VGHSDTAREMMEKYYVGKVD  81



>emb|CDY47080.1| BnaA03g12180D [Brassica napus]
Length=134

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ + +EVS HN   DCW+II+ K Y+VT F++ HPGG+DVL A AGKDA+ +FED GH 
Sbjct  5    KVFTFDEVSQHNKRDDCWLIISGKVYDVTPFMDVHPGGDDVLFAVAGKDATIDFEDVGHS  64

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRII  637
              AR ++ E+Y+G +D++T    A  Y+ P QP      + +PR I
Sbjct  65   EDARELMKEYYIGGIDSSTTVPAARTYVAPVQPTFNQ--DKTPRFI  108



>ref|XP_002893406.1| B5 #6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69665.1| B5 #6 [Arabidopsis lyrata subsp. lyrata]
Length=135

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  EV+ HN   DCWV+I+ K Y+VT++++EHPGG+DVLLA  GKDA+++FEDAGH 
Sbjct  6    KLYSMEEVATHNKQDDCWVVIDGKVYDVTSYMDEHPGGDDVLLAVTGKDATDDFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
              AR +++++++GE+D
Sbjct  66   KDARELMEKYFIGELD  81



>ref|XP_010680659.1| PREDICTED: cytochrome b5 isoform A [Beta vulgaris subsp. vulgaris]
Length=130

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E + HNT +DCWV+I+ K Y+VT++++EHPGG+DV L A+GKDA E+FEDAGH 
Sbjct  6    KLFSMQETAEHNTKEDCWVVIDGKVYDVTSYMDEHPGGDDVFLTASGKDAKEDFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
              AR ++++++VGE+D
Sbjct  66   QDARDIMEKYFVGELD  81



>ref|XP_004239033.1| PREDICTED: cytochrome b5 isoform B [Solanum lycopersicum]
Length=133

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E S HNT  DCWV+I+ K Y+V+++L+EHPGG+DVLL   G+DA++EFEDAGH 
Sbjct  6    KLFTMEEASEHNTKDDCWVVIDGKVYDVSSYLDEHPGGDDVLLGVTGQDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR ++++F++GE+D
Sbjct  66   KSARELMEKFFIGELD  81



>gb|AAM28288.1| cytochrome b5 [Ananas comosus]
Length=134

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+II+ K Y+VT F++EHPGG++VLLAA GKDA+ +FED
Sbjct  2    ATDHKIYGFEEVAKHNATKDCWLIISGKVYDVTPFMDEHPGGDEVLLAATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH ++AR M+ ++ +GE+D A       AYI P+Q    +P +SS  +I +
Sbjct  62   VGHSNSAREMMAKYCIGEID-AATVPAKRAYIAPQQAS-YNPDKSSDFLIKI  111



>gb|EPS71800.1| hypothetical protein M569_02962, partial [Genlisea aurea]
Length=133

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++   +E++ H T KDCW+IIN K Y+VT F+ +HPGG++VLLAA GKDA+ +FED
Sbjct  2    ASDPKVFVFDEIAKHKTSKDCWLIINGKVYDVTAFMEDHPGGDEVLLAATGKDATTDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH   AR  + ++Y+GEVD A       +Y PP+Q
Sbjct  62   VGHSDGARETMAKYYIGEVD-ANTVPQKRSYTPPQQ  96



>ref|XP_010692750.1| PREDICTED: cytochrome b5-like [Beta vulgaris subsp. vulgaris]
Length=138

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  338  EVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHGSAARLM  517
            EV+ HNT  DCW+II+ K YNVT+FL++HPGG+DVLL A GKDA+++FED GH   AR M
Sbjct  12   EVAKHNTKDDCWLIISGKTYNVTSFLDDHPGGDDVLLTATGKDATDDFEDIGHSDTARDM  71

Query  518  LDEFYVGEVD  547
            L  +YVG++D
Sbjct  72   LKNYYVGDID  81



>gb|EPS63893.1| hypothetical protein M569_10892, partial [Genlisea aurea]
Length=132

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ S  E S HNT  DCW+++  K Y+V+++L+EHPGG+DVLL A GKDA+EEFEDAGH 
Sbjct  6    KIYSMLEASQHNTRGDCWIVVEGKVYDVSSYLDEHPGGDDVLLRATGKDATEEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
              AR ++++F++GE+D
Sbjct  66   KTARELMEKFFIGELD  81



>ref|XP_008791612.1| PREDICTED: cytochrome b5 isoform A [Phoenix dactylifera]
 ref|XP_008791613.1| PREDICTED: cytochrome b5 isoform A [Phoenix dactylifera]
Length=135

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A   +    +EV+ HN  KDCWV+I+ K ++VT F++EHPGG++VLLA  GKDA+++FED
Sbjct  2    AAASKTYHFDEVAKHNVTKDCWVVISGKVFDVTPFMDEHPGGDEVLLAVTGKDATDDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH ++A+ M+ ++ +GE+D ++       Y+PP+Q    +P ++S  +I +
Sbjct  62   VGHSTSAKEMMSKYCIGEID-SSSIPTKRMYVPPQQA-SYNPDKTSEFVIKI  111



>gb|KFK28993.1| hypothetical protein AALP_AA7G074900 [Arabis alpina]
Length=131

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L S  E + HN   DCW++I+ K Y+VT+++++HPGG+DVLLAA GKDA++EFEDAGH 
Sbjct  6    KLYSMEEAATHNKQDDCWLVIDGKVYDVTSYMDDHPGGDDVLLAATGKDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR +++++++GE+D
Sbjct  66   KSARELMEKYFIGELD  81



>ref|XP_006407869.1| hypothetical protein EUTSA_v10021984mg [Eutrema salsugineum]
 gb|ESQ49322.1| hypothetical protein EUTSA_v10021984mg [Eutrema salsugineum]
Length=148

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAK----------AYNVTNFLNEHPGGEDVLLAAA  457
            AG+ +++  +E+S H + +DCW++IN K           Y+VT FL++HPGG DVLL+A+
Sbjct  2    AGDGKVLDLSELSQHRSRQDCWLLINGKFCVIANIRKHVYDVTKFLDDHPGGVDVLLSAS  61

Query  458  GKDASEEFEDAGHGSAARLMLDEFYVGEVD  547
            GKDA++EFE+ GH S+A+ +LDEFYVG++D
Sbjct  62   GKDATDEFEEVGHSSSAKFLLDEFYVGDID  91



>ref|XP_008790560.1| PREDICTED: cytochrome b5 isoform A-like [Phoenix dactylifera]
 ref|XP_008790561.1| PREDICTED: cytochrome b5 isoform A-like [Phoenix dactylifera]
Length=134

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + +  + +EV+ HN  KDCW+II+ K Y+VT F++EHPGG+DVLLAA GKDA+ +FED
Sbjct  2    AADPKTYNFDEVAKHNVTKDCWLIISGKVYDVTPFMDEHPGGDDVLLAATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             GH ++AR M+ ++ +G++D ++       Y+P +Q
Sbjct  62   IGHSTSAREMMAKYCIGDID-SSTLQAKRTYVPAQQ  96



>ref|XP_010109733.1| Cytochrome b5 [Morus notabilis]
 gb|EXC24203.1| Cytochrome b5 [Morus notabilis]
Length=132

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  + C ++I+ K Y+VT FL +HPGG+DVLL++ GKDA+ +FED GH 
Sbjct  3    KVYTLAEVSQHNNREKCLLVIHGKVYDVTKFLEDHPGGDDVLLSSTGKDATNDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQP  598
            S+A+ ++DEFYVG++D          Y PP+QP
Sbjct  63   SSAKAVMDEFYVGDID-TATIPAKVQYTPPKQP  94



>ref|XP_004506597.1| PREDICTED: cytochrome b5-like [Cicer arietinum]
Length=132

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW++I  + Y+VT FL +HPGG++VLL++ GKDA+++F D GH 
Sbjct  4    KVFTLAEVSKHNNSKDCWLVIRGRVYDVTPFLEDHPGGDEVLLSSTGKDATDDFNDVGHS  63

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQPK  601
            S+A  M+DE+Y+G++D  +       Y  P+QP+
Sbjct  64   SSASAMMDEYYIGDID-VSTIPSKVDYTAPKQPQ  96



>gb|ACG48334.1| cytochrome b5 [Zea mays]
Length=134

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A E ++    EV+ HN  KDCW+II  K Y+VT F++EHPGG++VLLA  GKDA+ +FED
Sbjct  2    ASENKVFGFEEVAKHNVTKDCWIIIAGKVYDVTPFMDEHPGGDEVLLAVTGKDATADFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSP  628
             GH  +AR M++++++G++D +TI A  A   P + P   D     P
Sbjct  62   IGHSDSARDMMEKYHIGQIDASTIPAKRAHVQPQQAPSHADKDNDLP  108



>gb|EPS57444.1| hypothetical protein M569_17373, partial [Genlisea aurea]
Length=137

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + +L S  E++ HN  +DCW+II+ K Y+VT F+ +HPGG+DVLL++ GKDA+ +F D
Sbjct  2    ASDLKLFSFEEIAKHNRSEDCWLIIDGKVYDVTEFMEDHPGGDDVLLSSTGKDATNDFLD  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRII  637
             GH   AR  +++F VGEVD +TI +      P +Q  D +  +++PR +
Sbjct  62   VGHSDNARETMEKFCVGEVDASTIPSKLTHASPRQQQSDYNHDKTTPRFV  111



>ref|XP_008437642.1| PREDICTED: cytochrome b5 isoform A [Cucumis melo]
Length=134

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW++I+ K Y+VT F+ +HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKVRLFEEVAKHNKTKDCWLVISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M+D++Y+GE+D  +   +   YIP +Q +  +P ++   +I +
Sbjct  62   VGHSDSAREMMDKYYIGEID-PSTVPLKKIYIPSQQTQ-HNPDKTPEFVIKI  111



>ref|XP_007039165.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 3, partial [Theobroma 
cacao]
 gb|EOY23666.1| Cytochrome B5, n2,ATCB5-E,CB5-E isoform 3, partial [Theobroma 
cacao]
Length=160

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ +  EVS HN  KDCW+II+ K Y+VT F+++HPGG++VLL+A GKDA+ +FED GH 
Sbjct  32   KMHTFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFEDVGHS  91

Query  500  SAARLMLDEFYVGEVDtatiaavaaaYIPPEQ  595
             +AR M+ ++Y+G++D +        YIPP Q
Sbjct  92   DSARDMMKKYYIGDID-SKTVPAKRTYIPPLQ  122



>ref|NP_001281054.1| cytochrome b5-like [Malus domestica]
 gb|ABR04092.2| cytochrome b5 [Malus domestica]
Length=134

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +2

Query  308  AGEKRLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFED  487
            A + ++    EV+ HN  KDCW+II  K Y+VT F+++HPGG++VLL+A GKDA+ +FED
Sbjct  2    ASDPKVHVFEEVAKHNKTKDCWLIIAGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFED  61

Query  488  AGHGSAARLMLDEFYVGEVDtatiaavaaaYIPPEQPKDGDPGESSPRIINV  643
             GH  +AR M++++Y+GEVD  +   +   YIPP   +  +P ++S  +I +
Sbjct  62   VGHSDSARDMMEKYYIGEVD-QSTVPLKRTYIPPPHGQ-YNPDKTSEFVIKI  111



>ref|XP_006348668.1| PREDICTED: cytochrome b5 isoform B-like [Solanum tuberosum]
Length=133

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            +L +  E + HNT  DCWV+I+ K Y+V+++L+EHPGG+DVLL   G+DA++EFEDAGH 
Sbjct  6    KLFTMEEAAEHNTKDDCWVVIDGKVYDVSSYLDEHPGGDDVLLGVTGQDATDEFEDAGHS  65

Query  500  SAARLMLDEFYVGEVD  547
             +AR ++++F++GE+D
Sbjct  66   KSARELMEKFFIGELD  81



>ref|XP_009803510.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
 ref|XP_009803511.1| PREDICTED: cytochrome b5-like [Nicotiana sylvestris]
Length=131

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  320  RLVSCNEVSLHNTPKDCWVIINAKAYNVTNFLNEHPGGEDVLLAAAGKDASEEFEDAGHG  499
            ++ + NEV+ HN   DCW+II  K YNVT+FL++HPGG+DVLL A GKDA+++FED GH 
Sbjct  3    KVHAFNEVAEHNKKDDCWLIIFGKVYNVTSFLDDHPGGDDVLLTATGKDATDDFEDVGHS  62

Query  500  SAARLMLDEFYVGEVD  547
              AR M+ ++YVGE+D
Sbjct  63   DDAREMMKKYYVGEID  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2245478025683