BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32397_g1_i1 len=1007 path=[1:0-1006]

Length=1007
                                                                      Score     E

ref|XP_009796370.1|  PREDICTED: bidirectional sugar transporter S...    332   5e-109   
ref|XP_009630970.1|  PREDICTED: bidirectional sugar transporter S...    332   6e-109   
ref|XP_006344692.1|  PREDICTED: bidirectional sugar transporter S...    322   3e-105   
ref|XP_004230255.1|  PREDICTED: bidirectional sugar transporter S...    321   8e-105   
ref|XP_011092096.1|  PREDICTED: bidirectional sugar transporter S...    306   3e-99    
ref|XP_007031036.1|  Nodulin MtN3 family protein isoform 1              300   1e-96    
ref|XP_010259506.1|  PREDICTED: bidirectional sugar transporter S...    301   4e-96    
emb|CDP17204.1|  unnamed protein product                                296   2e-95    
ref|XP_007031037.1|  Nodulin MtN3 family protein isoform 2              295   1e-94    
gb|KDP23461.1|  hypothetical protein JCGZ_23294                         288   8e-92    
ref|XP_002279031.1|  PREDICTED: bidirectional sugar transporter S...    280   7e-89    Vitis vinifera
ref|XP_007031034.1|  Nodulin MtN3 family protein isoform 1              275   1e-86    
ref|XP_002512453.1|  conserved hypothetical protein                     274   2e-86    Ricinus communis
ref|XP_007031035.1|  Nodulin MtN3 family protein isoform 2              269   9e-85    
ref|XP_006433450.1|  hypothetical protein CICLE_v10001944mg             269   3e-84    
gb|KDO39196.1|  hypothetical protein CISIN_1g021755mg                   267   1e-83    
ref|XP_010025255.1|  PREDICTED: bidirectional sugar transporter S...    266   1e-83    
ref|XP_007031038.1|  Nodulin MtN3 family protein isoform 3              262   3e-82    
ref|XP_002318982.2|  hypothetical protein POPTR_0013s01550g             259   5e-81    Populus trichocarpa [western balsam poplar]
ref|XP_009391486.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    259   2e-80    
ref|XP_004135601.1|  PREDICTED: bidirectional sugar transporter S...    259   2e-80    
ref|XP_011023917.1|  PREDICTED: bidirectional sugar transporter S...    259   2e-80    
ref|XP_002318981.2|  hypothetical protein POPTR_0013s01540g             255   3e-79    Populus trichocarpa [western balsam poplar]
gb|KHG24498.1|  Bidirectional sugar transporter SWEET16                 251   3e-77    
ref|XP_004984436.1|  PREDICTED: bidirectional sugar transporter S...    248   4e-76    
gb|KDO71717.1|  hypothetical protein CISIN_1g026722mg                   245   4e-76    
ref|XP_006419536.1|  hypothetical protein CICLE_v10005737mg             243   3e-75    
ref|XP_006840479.1|  hypothetical protein AMTR_s00045p00186460          244   5e-75    
ref|XP_008784881.1|  PREDICTED: uncharacterized protein LOC103703710    252   1e-74    
ref|XP_010099962.1|  Bidirectional sugar transporter SWEET16            243   2e-74    
ref|XP_011023714.1|  PREDICTED: bidirectional sugar transporter S...    240   3e-73    
ref|XP_003561653.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-71    
ref|XP_006651362.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    236   4e-71    
ref|XP_004296854.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-70    
ref|XP_002467883.1|  hypothetical protein SORBIDRAFT_01g035840          233   6e-70    Sorghum bicolor [broomcorn]
ref|XP_007035630.1|  Nodulin MtN3 family protein                        228   2e-69    
ref|XP_009136730.1|  PREDICTED: bidirectional sugar transporter S...    228   4e-69    
ref|XP_009352289.1|  PREDICTED: bidirectional sugar transporter S...    227   7e-69    
ref|XP_009786119.1|  PREDICTED: uncharacterized protein LOC104234284    231   2e-68    
emb|CDX90555.1|  BnaA03g42260D                                          226   2e-68    
ref|NP_001288522.1|  bidirectional sugar transporter SWEET16            227   4e-68    
emb|CDY09729.1|  BnaC07g33320D                                          225   5e-68    
tpg|DAA45288.1|  TPA: cytochrome c oxidoreductase                       227   6e-68    
ref|XP_007031029.1|  Nodulin MtN3 family protein                        224   1e-67    
ref|NP_001050071.2|  Os03g0341300                                       226   1e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006433449.1|  hypothetical protein CICLE_v10001944mg             223   2e-67    
ref|XP_009107869.1|  PREDICTED: bidirectional sugar transporter S...    223   3e-67    
gb|EEC75233.1|  hypothetical protein OsI_11516                          226   3e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_010674140.1|  PREDICTED: bidirectional sugar transporter S...    221   5e-67    
ref|XP_008360271.1|  PREDICTED: bidirectional sugar transporter S...    222   3e-66    
ref|XP_010259507.1|  PREDICTED: bidirectional sugar transporter S...    223   3e-66    
ref|XP_011003911.1|  PREDICTED: bidirectional sugar transporter S...    219   4e-66    
ref|XP_002269234.1|  PREDICTED: bidirectional sugar transporter S...    219   5e-66    Vitis vinifera
gb|AHG94617.1|  sugar transporter                                       219   5e-66    
gb|AAO22792.1|  putative cytochrome c oxidoreductase                    218   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092095.1|  PREDICTED: bidirectional sugar transporter S...    218   2e-65    
ref|NP_193327.5|  bidirectional sugar transporter SWEET17               218   3e-65    Arabidopsis thaliana [mouse-ear cress]
gb|EMS55881.1|  Bidirectional sugar transporter SWEET16                 221   3e-65    
sp|Q84WN3.2|SWT17_ARATH  RecName: Full=Bidirectional sugar transp...    218   3e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434908.1|  PREDICTED: bidirectional sugar transporter S...    217   6e-65    
ref|XP_002868174.1|  hypothetical protein ARALYDRAFT_493293             216   1e-64    
gb|EMT14265.1|  Protein RUPTURED POLLEN GRAIN 1                         218   2e-64    
gb|KFK33806.1|  hypothetical protein AALP_AA5G062600                    215   3e-64    
ref|XP_010524542.1|  PREDICTED: bidirectional sugar transporter S...    214   8e-64    
emb|CDP17203.1|  unnamed protein product                                214   8e-64    
ref|XP_010449877.1|  PREDICTED: bidirectional sugar transporter S...    214   1e-63    
ref|XP_010440232.1|  PREDICTED: bidirectional sugar transporter S...    214   1e-63    
ref|XP_010259509.1|  PREDICTED: bidirectional sugar transporter S...    213   1e-63    
gb|KDP27816.1|  hypothetical protein JCGZ_18896                         212   4e-63    
gb|EYU37279.1|  hypothetical protein MIMGU_mgv1a012972mg                211   5e-63    
ref|XP_008223214.1|  PREDICTED: bidirectional sugar transporter S...    212   6e-63    
ref|XP_011003912.1|  PREDICTED: bidirectional sugar transporter S...    209   5e-62    
ref|XP_004307262.1|  PREDICTED: bidirectional sugar transporter S...    209   6e-62    
gb|ADE76959.1|  unknown                                                 211   1e-61    
ref|XP_007227546.1|  hypothetical protein PRUPE_ppa010394mg             209   1e-61    
ref|XP_009411666.1|  PREDICTED: bidirectional sugar transporter S...    208   1e-61    
gb|ABK26262.1|  unknown                                                 207   2e-61    Picea sitchensis
ref|XP_011036889.1|  PREDICTED: bidirectional sugar transporter S...    207   2e-61    
ref|XP_010659797.1|  PREDICTED: bidirectional sugar transporter S...    207   3e-61    
ref|XP_008232337.1|  PREDICTED: bidirectional sugar transporter S...    207   3e-61    
ref|XP_006605261.1|  PREDICTED: bidirectional sugar transporter S...    207   7e-61    
ref|XP_006419537.1|  hypothetical protein CICLE_v10005737mg             206   1e-60    
ref|XP_002516944.1|  conserved hypothetical protein                     205   2e-60    Ricinus communis
ref|NP_001241100.1|  uncharacterized protein LOC100776607               205   3e-60    
ref|XP_009375397.1|  PREDICTED: bidirectional sugar transporter S...    204   3e-60    
gb|KCW61870.1|  hypothetical protein EUGRSUZ_H04550                     204   3e-60    
emb|CDX75890.1|  BnaC03g39730D                                          204   4e-60    
ref|XP_009772929.1|  PREDICTED: bidirectional sugar transporter S...    204   6e-60    
ref|XP_002278982.1|  PREDICTED: bidirectional sugar transporter S...    204   6e-60    Vitis vinifera
ref|XP_002885162.1|  nodulin MtN3 family protein                        203   1e-59    
ref|XP_009796371.1|  PREDICTED: bidirectional sugar transporter S...    203   1e-59    
ref|XP_011036888.1|  PREDICTED: bidirectional sugar transporter S...    203   1e-59    
ref|XP_010693605.1|  PREDICTED: bidirectional sugar transporter S...    203   1e-59    
ref|NP_188291.2|  bidirectional sugar transporter SWEET16               202   3e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406815.1|  hypothetical protein EUTSA_v10021447mg             201   4e-59    
ref|XP_009114620.1|  PREDICTED: bidirectional sugar transporter S...    201   4e-59    
ref|XP_009382526.1|  PREDICTED: bidirectional sugar transporter S...    201   8e-59    
ref|XP_006586695.1|  PREDICTED: uncharacterized protein LOC100808...    199   4e-58    
ref|XP_009625472.1|  PREDICTED: bidirectional sugar transporter S...    199   6e-58    
gb|KHN26542.1|  Bidirectional sugar transporter SWEET17                 198   8e-58    
ref|XP_009589632.1|  PREDICTED: bidirectional sugar transporter S...    198   9e-58    
ref|XP_002318986.1|  hypothetical protein POPTR_0013s01600g             197   2e-57    Populus trichocarpa [western balsam poplar]
ref|XP_010465690.1|  PREDICTED: bidirectional sugar transporter S...    197   2e-57    
ref|XP_011092671.1|  PREDICTED: bidirectional sugar transporter S...    198   2e-57    
ref|XP_004158758.1|  PREDICTED: bidirectional sugar transporter S...    197   2e-57    
emb|CBI39543.3|  unnamed protein product                                207   3e-57    
ref|XP_008454147.1|  PREDICTED: bidirectional sugar transporter S...    197   3e-57    
gb|KFK39012.1|  hypothetical protein AALP_AA3G189200                    196   4e-57    
ref|XP_004134220.1|  PREDICTED: bidirectional sugar transporter S...    196   5e-57    
ref|XP_009382525.1|  PREDICTED: bidirectional sugar transporter S...    196   5e-57    
gb|KDP25811.1|  hypothetical protein JCGZ_22533                         196   7e-57    
ref|XP_006298433.1|  hypothetical protein CARUB_v10014504mg             196   7e-57    
ref|XP_004487835.1|  PREDICTED: bidirectional sugar transporter S...    195   1e-56    
gb|KEH37225.1|  bidirectional sugar transporter                         195   2e-56    
emb|CDO98848.1|  unnamed protein product                                195   3e-56    
ref|XP_010921652.1|  PREDICTED: bidirectional sugar transporter S...    194   3e-56    
ref|XP_002531929.1|  conserved hypothetical protein                     193   9e-56    Ricinus communis
ref|XP_007220167.1|  hypothetical protein PRUPE_ppa017165mg             192   9e-56    
ref|XP_010504546.1|  PREDICTED: bidirectional sugar transporter S...    192   1e-55    
ref|XP_006433440.1|  hypothetical protein CICLE_v10002302mg             192   2e-55    
ref|XP_010487533.1|  PREDICTED: bidirectional sugar transporter S...    191   3e-55    
ref|XP_010099969.1|  Bidirectional sugar transporter SWEET16            194   7e-55    
gb|ACJ84783.1|  unknown                                                 191   7e-55    Medicago truncatula
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    191   7e-55    
ref|XP_007031032.1|  Nodulin MtN3 family protein                        191   1e-54    
ref|XP_006495099.1|  PREDICTED: bidirectional sugar transporter S...    190   2e-54    
ref|XP_010025254.1|  PREDICTED: bidirectional sugar transporter S...    190   2e-54    
ref|XP_008673994.1|  PREDICTED: bidirectional sugar transporter S...    189   3e-54    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       189   7e-54    
ref|XP_006285439.1|  hypothetical protein CARUB_v10006856mg             186   2e-53    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    187   2e-53    
ref|XP_004967517.1|  PREDICTED: bidirectional sugar transporter S...    187   2e-53    
ref|XP_006344691.1|  PREDICTED: bidirectional sugar transporter S...    184   2e-52    
ref|XP_010449878.1|  PREDICTED: bidirectional sugar transporter S...    184   2e-52    
ref|XP_010440233.1|  PREDICTED: bidirectional sugar transporter S...    184   2e-52    
ref|XP_010105148.1|  Bidirectional sugar transporter SWEET17            187   2e-52    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    184   3e-52    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    184   4e-52    
ref|XP_009135494.1|  PREDICTED: bidirectional sugar transporter S...    182   6e-52    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    184   1e-51    
ref|NP_001242234.1|  uncharacterized protein LOC100808537               181   1e-51    
ref|XP_010927277.1|  PREDICTED: bidirectional sugar transporter S...    182   1e-51    
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    184   1e-51    
ref|XP_011023712.1|  PREDICTED: bidirectional sugar transporter S...    182   1e-51    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    183   2e-51    
ref|XP_010315469.1|  PREDICTED: bidirectional sugar transporter S...    182   3e-51    
ref|XP_002318985.1|  hypothetical protein POPTR_0013s01590g             181   4e-51    Populus trichocarpa [western balsam poplar]
ref|XP_010924221.1|  PREDICTED: bidirectional sugar transporter S...    181   4e-51    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    182   5e-51    
dbj|BAK03081.1|  predicted protein                                      181   5e-51    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    181   7e-51    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    181   8e-51    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    181   1e-50    
emb|CDP09549.1|  unnamed protein product                                181   2e-50    
dbj|BAJ96341.1|  predicted protein                                      180   2e-50    
ref|XP_008800934.1|  PREDICTED: bidirectional sugar transporter S...    179   3e-50    
dbj|BAJ85375.1|  predicted protein                                      179   4e-50    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 179   5e-50    
emb|CAN77271.1|  hypothetical protein VITISV_022055                     178   5e-50    Vitis vinifera
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    179   8e-50    
gb|ACG28395.1|  cytochrome c oxidoreductase                             177   1e-49    Zea mays [maize]
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             177   1e-49    
ref|XP_006433444.1|  hypothetical protein CICLE_v10003933mg             177   2e-49    
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    178   2e-49    
ref|XP_008655823.1|  PREDICTED: bidirectional sugar transporter S...    176   2e-49    
emb|CDP11998.1|  unnamed protein product                                176   3e-49    
gb|ACG37138.1|  cytochrome c oxidoreductase                             176   3e-49    Zea mays [maize]
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    176   3e-49    
ref|XP_010105312.1|  Bidirectional sugar transporter SWEET17            176   5e-49    
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    178   5e-49    
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    177   5e-49    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    176   6e-49    
ref|XP_010548982.1|  PREDICTED: bidirectional sugar transporter S...    174   7e-49    
ref|XP_006344690.1|  PREDICTED: bidirectional sugar transporter S...    175   7e-49    
ref|XP_007138928.1|  hypothetical protein PHAVU_009G249700g             175   8e-49    
ref|XP_010693601.1|  PREDICTED: bidirectional sugar transporter S...    174   1e-48    
ref|XP_010519561.1|  PREDICTED: bidirectional sugar transporter S...    174   2e-48    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    174   2e-48    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    175   2e-48    
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    175   2e-48    
ref|XP_003565716.1|  PREDICTED: bidirectional sugar transporter S...    174   2e-48    
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    174   3e-48    
ref|XP_010045563.1|  PREDICTED: bidirectional sugar transporter S...    173   3e-48    
gb|KHG21873.1|  Bidirectional sugar transporter SWEET1 -like protein    174   3e-48    
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    174   3e-48    
ref|XP_010999825.1|  PREDICTED: bidirectional sugar transporter S...    173   4e-48    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    175   4e-48    
ref|XP_010539700.1|  PREDICTED: bidirectional sugar transporter S...    172   5e-48    
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    175   5e-48    
ref|XP_007137524.1|  hypothetical protein PHAVU_009G134300g             173   5e-48    
ref|XP_007031030.1|  Nodulin MtN3 family protein isoform 1              174   5e-48    
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    174   6e-48    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         175   6e-48    
ref|XP_006446472.1|  hypothetical protein CICLE_v10016451mg             172   7e-48    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               173   8e-48    
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         174   9e-48    
ref|XP_010529025.1|  PREDICTED: bidirectional sugar transporter S...    173   9e-48    
ref|XP_006470352.1|  PREDICTED: bidirectional sugar transporter S...    172   1e-47    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    172   1e-47    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 175   1e-47    
ref|XP_006586696.1|  PREDICTED: uncharacterized protein LOC100808...    171   1e-47    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    172   2e-47    
ref|XP_002283068.1|  PREDICTED: bidirectional sugar transporter S...    171   2e-47    Vitis vinifera
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          172   2e-47    
ref|XP_010921651.1|  PREDICTED: bidirectional sugar transporter S...    171   2e-47    
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    172   2e-47    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    171   2e-47    
ref|XP_009375095.1|  PREDICTED: bidirectional sugar transporter S...    171   3e-47    
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    172   3e-47    
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    171   3e-47    Petunia x hybrida [garden petunia]
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    172   3e-47    
ref|XP_006476341.1|  PREDICTED: bidirectional sugar transporter S...    171   3e-47    
ref|XP_004952303.1|  PREDICTED: bidirectional sugar transporter S...    171   4e-47    
dbj|BAJ85621.1|  predicted protein                                      172   4e-47    
ref|XP_009110184.1|  PREDICTED: bidirectional sugar transporter S...    171   4e-47    
emb|CDY67972.1|  BnaCnng57120D                                          171   5e-47    
ref|NP_001237418.1|  N3 protein                                         171   5e-47    
ref|XP_008341461.1|  PREDICTED: bidirectional sugar transporter S...    170   5e-47    
ref|NP_001043522.1|  Os01g0605700                                       171   6e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    169   6e-47    
ref|XP_004150723.1|  PREDICTED: bidirectional sugar transporter S...    170   6e-47    
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          172   6e-47    Sorghum bicolor [broomcorn]
ref|NP_567366.1|  bidirectional sugar transporter SWEET7                170   7e-47    Arabidopsis thaliana [mouse-ear cress]
gb|KDO71716.1|  hypothetical protein CISIN_1g026722mg                   168   7e-47    
emb|CDP11997.1|  unnamed protein product                                170   7e-47    
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 171   7e-47    
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    171   8e-47    
ref|XP_010062171.1|  PREDICTED: bidirectional sugar transporter S...    170   9e-47    
emb|CDY24854.1|  BnaA08g14560D                                          171   9e-47    
ref|XP_004961041.1|  PREDICTED: bidirectional sugar transporter S...    169   9e-47    
ref|XP_006305555.1|  hypothetical protein CARUB_v10010111mg             170   9e-47    
ref|XP_002873602.1|  nodulin MtN3 family protein                        171   1e-46    
ref|XP_007031434.1|  Nodulin MtN3 family protein, putative              169   1e-46    
ref|XP_002511125.1|  conserved hypothetical protein                     171   1e-46    Ricinus communis
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      170   1e-46    
ref|XP_010270425.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-46    
ref|XP_011027388.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-46    
ref|XP_006644347.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-46    
ref|XP_011027387.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-46    
ref|XP_010496503.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-46    
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    171   1e-46    
gb|KHG09976.1|  Bidirectional sugar transporter SWEET1 -like protein    171   1e-46    
ref|XP_007019365.1|  Nodulin MtN3 family protein                        169   2e-46    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 170   2e-46    
ref|XP_006434359.1|  hypothetical protein CICLE_v10002276mg             169   2e-46    
ref|XP_006439288.1|  hypothetical protein CICLE_v10024343mg             169   2e-46    
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 171   2e-46    
gb|EMS47629.1|  Bidirectional sugar transporter SWEET6b                 169   2e-46    
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    170   2e-46    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         170   2e-46    
ref|XP_011101820.1|  PREDICTED: bidirectional sugar transporter S...    169   2e-46    
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    170   2e-46    
gb|KEH35409.1|  bidirectional sugar transporter                         169   2e-46    
ref|XP_004969103.1|  PREDICTED: bidirectional sugar transporter S...    169   3e-46    
ref|NP_001043523.2|  Os01g0606000                                       169   3e-46    Oryza sativa Japonica Group [Japonica rice]
sp|A2WSD8.1|SWT6A_ORYSI  RecName: Full=Bidirectional sugar transp...    169   3e-46    Oryza sativa Indica Group [Indian rice]
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    170   3e-46    
gb|AAM65389.1|  senescence-associated protein (SAG29)                   170   3e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      170   3e-46    
ref|NP_001149028.1|  LOC100282648                                       170   3e-46    Zea mays [maize]
ref|XP_009625474.1|  PREDICTED: bidirectional sugar transporter S...    167   4e-46    
gb|AFK48645.1|  unknown                                                 168   4e-46    
ref|XP_010064812.1|  PREDICTED: bidirectional sugar transporter S...    168   4e-46    
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    169   4e-46    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    169   4e-46    
ref|XP_010679833.1|  PREDICTED: bidirectional sugar transporter S...    168   4e-46    
ref|XP_010436689.1|  PREDICTED: bidirectional sugar transporter S...    168   4e-46    
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             168   5e-46    
ref|XP_006419535.1|  hypothetical protein CICLE_v10005737mg             166   5e-46    
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    169   5e-46    
ref|XP_002453768.1|  hypothetical protein SORBIDRAFT_04g015420          168   5e-46    Sorghum bicolor [broomcorn]
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          169   5e-46    Sorghum bicolor [broomcorn]
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    169   5e-46    
ref|XP_010498603.1|  PREDICTED: bidirectional sugar transporter S...    167   6e-46    
ref|NP_001046944.1|  Os02g0513100                                       170   6e-46    Oryza sativa Japonica Group [Japonica rice]
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    170   6e-46    Oryza sativa Indica Group [Indian rice]
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    169   6e-46    
ref|XP_010459857.1|  PREDICTED: bidirectional sugar transporter S...    167   6e-46    
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    169   6e-46    
gb|AAM65058.1|  MtN3-like protein                                       169   6e-46    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    170   6e-46    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    169   6e-46    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    169   7e-46    
sp|A2WSD3.1|SWT6B_ORYSI  RecName: Full=Bidirectional sugar transp...    167   7e-46    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               169   7e-46    
ref|XP_010064811.1|  PREDICTED: bidirectional sugar transporter S...    167   8e-46    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    168   8e-46    
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    169   9e-46    
ref|XP_010455476.1|  PREDICTED: bidirectional sugar transporter S...    167   9e-46    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    167   9e-46    
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    168   9e-46    
ref|NP_196821.1|  senescence-associated protein 29                      168   9e-46    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    167   9e-46    
ref|XP_010528263.1|  PREDICTED: bidirectional sugar transporter S...    167   9e-46    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             168   1e-45    
ref|XP_006472908.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45    
gb|KCW44925.1|  hypothetical protein EUGRSUZ_L01492                     167   1e-45    
emb|CDX71659.1|  BnaC09g27000D                                          168   1e-45    
dbj|BAK04274.1|  predicted protein                                      169   1e-45    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    168   1e-45    
ref|XP_010555891.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45    
emb|CDY40867.1|  BnaC09g25980D                                          167   1e-45    
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      167   1e-45    
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-45    
ref|XP_011036890.1|  PREDICTED: bidirectional sugar transporter S...    165   1e-45    
ref|XP_004952305.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45    
ref|XP_009108217.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    168   1e-45    
gb|KDP25260.1|  hypothetical protein JCGZ_20416                         167   2e-45    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    168   2e-45    
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-45    
ref|XP_009130234.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-45    
gb|AFK35161.1|  unknown                                                 166   2e-45    
ref|XP_002526178.1|  conserved hypothetical protein                     166   2e-45    
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         167   2e-45    
ref|XP_010667981.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-45    
gb|KEH20983.1|  bidirectional sugar transporter                         166   2e-45    
ref|XP_009625473.1|  PREDICTED: bidirectional sugar transporter S...    165   2e-45    
ref|XP_003526670.1|  PREDICTED: bidirectional sugar transporter S...    166   2e-45    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-45    
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-45    
ref|XP_006281467.1|  hypothetical protein CARUB_v10027550mg             166   2e-45    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-45    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-45    
ref|XP_007155413.1|  hypothetical protein PHAVU_003G199300g             165   2e-45    
ref|XP_002865824.1|  nodulin MtN3 family protein                        167   3e-45    
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             167   3e-45    
ref|XP_006394345.1|  hypothetical protein EUTSA_v10004842mg             166   3e-45    
ref|XP_004502575.1|  PREDICTED: bidirectional sugar transporter S...    166   3e-45    
emb|CDX86834.1|  BnaA09g22240D                                          166   3e-45    
emb|CAN71371.1|  hypothetical protein VITISV_023352                     167   3e-45    
ref|XP_002453747.1|  hypothetical protein SORBIDRAFT_04g012910          166   3e-45    
emb|CDP12369.1|  unnamed protein product                                165   3e-45    
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    166   3e-45    
ref|XP_006396996.1|  hypothetical protein EUTSA_v10029447mg             166   4e-45    
ref|XP_010422008.1|  PREDICTED: bidirectional sugar transporter S...    166   4e-45    
ref|XP_002872539.1|  nodulin MtN3 family protein                        166   4e-45    
ref|XP_003523404.1|  PREDICTED: bidirectional sugar transporter S...    166   4e-45    
emb|CDY03395.1|  BnaC01g16870D                                          166   4e-45    
ref|XP_006416299.1|  hypothetical protein EUTSA_v10008590mg             166   4e-45    
ref|NP_001149011.1|  LOC100282631                                       165   4e-45    
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    167   4e-45    
emb|CDY45751.1|  BnaC02g42310D                                          165   4e-45    
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    167   4e-45    
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    166   4e-45    
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    166   4e-45    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                166   4e-45    
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             166   5e-45    
ref|XP_002274582.1|  PREDICTED: bidirectional sugar transporter S...    165   5e-45    
ref|XP_006289873.1|  hypothetical protein CARUB_v10003485mg             166   5e-45    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             166   6e-45    
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    166   6e-45    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             166   6e-45    
ref|XP_004300894.1|  PREDICTED: bidirectional sugar transporter S...    164   6e-45    
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    166   7e-45    
ref|XP_002866519.1|  hypothetical protein ARALYDRAFT_496468             164   7e-45    
emb|CDX92666.1|  BnaC07g39240D                                          166   7e-45    
emb|CDY50241.1|  BnaA06g15180D                                          165   7e-45    
ref|XP_004489295.1|  PREDICTED: bidirectional sugar transporter S...    164   7e-45    
emb|CDP14988.1|  unnamed protein product                                166   8e-45    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    165   8e-45    
ref|NP_001168479.1|  uncharacterized protein LOC100382256               165   8e-45    
ref|XP_002893163.1|  nodulin MtN3 family protein                        164   9e-45    
ref|XP_006858415.1|  hypothetical protein AMTR_s00071p00055180          164   9e-45    
emb|CDY34333.1|  BnaA01g14360D                                          165   9e-45    
ref|XP_011028586.1|  PREDICTED: bidirectional sugar transporter S...    164   9e-45    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    165   9e-45    
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    166   1e-44    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    166   1e-44    
gb|ACU19281.1|  unknown                                                 164   1e-44    
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             166   1e-44    
ref|XP_004152552.1|  PREDICTED: bidirectional sugar transporter S...    164   1e-44    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          166   1e-44    
ref|XP_004952304.1|  PREDICTED: bidirectional sugar transporter S...    165   1e-44    
emb|CDJ26295.1|  unnamed protein product                                165   1e-44    
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    166   1e-44    
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               165   1e-44    
ref|XP_002862913.1|  nodulin MtN3 family protein                        166   1e-44    
ref|XP_006366752.1|  PREDICTED: bidirectional sugar transporter S...    164   1e-44    
ref|XP_011023713.1|  PREDICTED: bidirectional sugar transporter S...    164   1e-44    
ref|XP_010483997.1|  PREDICTED: bidirectional sugar transporter S...    164   1e-44    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               164   1e-44    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    165   2e-44    
emb|CDY56741.1|  BnaC09g50910D                                          164   2e-44    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    164   2e-44    
dbj|BAJ94374.1|  predicted protein                                      164   2e-44    
ref|XP_010065109.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44    
emb|CAC44123.1|  N3 like protein                                        164   2e-44    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    165   2e-44    
emb|CDY08093.1|  BnaA06g16330D                                          165   2e-44    
ref|NP_564140.1|  bidirectional sugar transporter SWEET1                164   2e-44    
ref|XP_008443506.1|  PREDICTED: bidirectional sugar transporter S...    163   2e-44    
ref|XP_009399164.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            165   2e-44    
ref|XP_002321585.1|  hypothetical protein POPTR_0015s08560g             163   2e-44    
gb|KEH40468.1|  bidirectional sugar transporter                         163   2e-44    
ref|XP_003564773.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44    
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             164   2e-44    
ref|XP_002279850.1|  PREDICTED: bidirectional sugar transporter S...    163   2e-44    
ref|XP_004970789.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44    
ref|XP_008230949.1|  PREDICTED: bidirectional sugar transporter S...    163   3e-44    
gb|AFK47472.1|  unknown                                                 163   3e-44    
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                165   3e-44    
dbj|BAK07340.1|  predicted protein                                      164   3e-44    
ref|XP_010444139.1|  PREDICTED: bidirectional sugar transporter S...    163   3e-44    
ref|XP_004171106.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    163   3e-44    
ref|XP_002300945.1|  nodulin MtN3 family protein                        163   3e-44    
ref|XP_010459386.1|  PREDICTED: bidirectional sugar transporter S...    162   4e-44    
ref|XP_010921715.1|  PREDICTED: bidirectional sugar transporter S...    163   4e-44    
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    164   4e-44    
gb|ACU23483.1|  unknown                                                 163   4e-44    
gb|EMT16545.1|  Protein RUPTURED POLLEN GRAIN 1                         162   4e-44    
ref|XP_011081454.1|  PREDICTED: bidirectional sugar transporter S...    162   4e-44    
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    164   5e-44    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             163   5e-44    
ref|XP_002511126.1|  conserved hypothetical protein                     164   5e-44    
ref|XP_004305773.1|  PREDICTED: bidirectional sugar transporter S...    162   5e-44    
ref|XP_009149662.1|  PREDICTED: bidirectional sugar transporter S...    162   5e-44    
ref|NP_001056475.1|  Os05g0588500                                       162   6e-44    
ref|XP_002455919.1|  hypothetical protein SORBIDRAFT_03g027260          162   6e-44    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               162   6e-44    
gb|KFK28013.1|  hypothetical protein AALP_AA8G460200                    162   6e-44    
ref|XP_010537332.1|  PREDICTED: bidirectional sugar transporter S...    162   6e-44    
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             164   6e-44    
ref|XP_009788248.1|  PREDICTED: bidirectional sugar transporter S...    162   6e-44    
ref|XP_004487836.1|  PREDICTED: bidirectional sugar transporter S...    161   6e-44    
ref|XP_003569319.1|  PREDICTED: bidirectional sugar transporter S...    162   7e-44    
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         163   7e-44    
ref|XP_009112036.1|  PREDICTED: bidirectional sugar transporter S...    162   7e-44    
ref|XP_002991789.1|  hypothetical protein SELMODRAFT_25860              161   7e-44    
ref|XP_007200590.1|  hypothetical protein PRUPE_ppa010181mg             162   7e-44    
emb|CDY16757.1|  BnaA09g06250D                                          162   8e-44    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    162   8e-44    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    163   8e-44    
ref|XP_001781625.1|  predicted protein                                  162   8e-44    
gb|KEH24860.1|  bidirectional sugar transporter                         162   8e-44    
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    163   8e-44    
ref|XP_011074778.1|  PREDICTED: bidirectional sugar transporter S...    162   8e-44    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    163   8e-44    
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 166   8e-44    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    162   9e-44    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               163   9e-44    
ref|XP_010034633.1|  PREDICTED: bidirectional sugar transporter S...    162   9e-44    
emb|CDY05867.1|  BnaC08g20440D                                          163   1e-43    
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    164   1e-43    
gb|EMS58275.1|  Bidirectional sugar transporter SWEET17                 162   1e-43    
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               163   1e-43    
ref|XP_002989691.1|  hypothetical protein SELMODRAFT_25849              160   1e-43    
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            163   1e-43    
ref|NP_201091.2|  bidirectional sugar transporter SWEET5                161   1e-43    
gb|KEH24858.1|  bidirectional sugar transporter                         161   1e-43    
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             162   1e-43    
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    162   1e-43    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    163   1e-43    
ref|XP_006356306.1|  PREDICTED: bidirectional sugar transporter S...    161   1e-43    
ref|XP_009615359.1|  PREDICTED: bidirectional sugar transporter S...    161   1e-43    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    162   1e-43    
gb|KDO66230.1|  hypothetical protein CISIN_1g043313mg                   161   1e-43    
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             162   2e-43    
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    162   2e-43    
ref|XP_002511128.1|  conserved hypothetical protein                     162   2e-43    
ref|XP_010260493.1|  PREDICTED: bidirectional sugar transporter S...    161   2e-43    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    162   2e-43    
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-43    
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             161   2e-43    
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             163   2e-43    
ref|XP_009625661.1|  PREDICTED: bidirectional sugar transporter S...    161   2e-43    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                161   2e-43    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    162   2e-43    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    162   2e-43    
ref|XP_008438271.1|  PREDICTED: bidirectional sugar transporter S...    160   2e-43    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    162   2e-43    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               162   2e-43    
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             162   2e-43    
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    162   2e-43    
ref|XP_008237695.1|  PREDICTED: bidirectional sugar transporter S...    161   2e-43    
gb|KHN03192.1|  Bidirectional sugar transporter N3                      161   2e-43    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    162   3e-43    
ref|NP_001141654.1|  hypothetical protein                               162   3e-43    
ref|XP_002867630.1|  nodulin MtN3 family protein                        161   3e-43    
ref|XP_004237722.1|  PREDICTED: bidirectional sugar transporter S...    160   3e-43    
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    162   3e-43    
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                162   3e-43    
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    162   3e-43    
ref|XP_008357046.1|  PREDICTED: bidirectional sugar transporter S...    160   3e-43    
emb|CDX83046.1|  BnaA01g20460D                                          162   3e-43    
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    162   3e-43    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    161   3e-43    
ref|XP_008366545.1|  PREDICTED: bidirectional sugar transporter S...    160   3e-43    
ref|XP_009382528.1|  PREDICTED: bidirectional sugar transporter S...    159   3e-43    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 161   3e-43    
ref|NP_001067955.1|  Os11g0508600                                       162   3e-43    
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    162   4e-43    
gb|KDP43062.1|  hypothetical protein JCGZ_25248                         160   4e-43    
gb|KDP31116.1|  hypothetical protein JCGZ_11492                         160   4e-43    
gb|EPS64389.1|  hypothetical protein M569_10392                         160   4e-43    
gb|KCW69242.1|  hypothetical protein EUGRSUZ_F02750                     161   4e-43    
emb|CBI32263.3|  unnamed protein product                                163   4e-43    
gb|KHN24976.1|  Bidirectional sugar transporter N3                      161   4e-43    
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                161   4e-43    



>ref|XP_009796370.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Nicotiana 
sylvestris]
Length=298

 Score =   332 bits (851),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 212/248 (85%), Gaps = 6/248 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+ SFI+GIIGNVISILMF AP+KTFKRI++KKSTE+FKGIPYITTLLSTSLW+FYGLL
Sbjct  1    MANFSFILGIIGNVISILMFAAPIKTFKRIIKKKSTEDFKGIPYITTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVNGTG +LHI+YV+LFLIYA K +KI+S+K+V II++AFLGAV+A+TL  +
Sbjct  61   KPGGLLVVTVNGTGAILHIVYVTLFLIYATKTLKIQSIKLVAIIDIAFLGAVIAITLLAV  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG T+L  VGLL  GL + MYASPLSA RTVIKMKSVEYMPF+LSFFQ LNGG+WA+YA+
Sbjct  121  HGNTRLTLVGLLAAGLNVVMYASPLSATRTVIKMKSVEYMPFFLSFFQFLNGGVWAAYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK------EEEDPAHLVKGGIEMANDV  802
            LV+D YIG+PNGIGFLLGSAQ+ILYFIYY+STP K      E+E  AHLV+ GI+M +  
Sbjct  181  LVKDYYIGVPNGIGFLLGSAQLILYFIYYKSTPTKSIDEKEEKEGSAHLVRTGIQMNDLD  240

Query  803  AFKSNGKD  826
                N K+
Sbjct  241  GAHENDKN  248



>ref|XP_009630970.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   332 bits (850),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 212/248 (85%), Gaps = 6/248 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+ SFI+GIIGNVISILMF AP+KTFKRI++KKSTE+FKGIPYITTLLSTSLW+FYGLL
Sbjct  1    MANFSFILGIIGNVISILMFAAPIKTFKRIIKKKSTEDFKGIPYITTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVNGTG +LHI+YV+LFLIYAPK +KI+S+K+V II++AFLGAV+A+TL  +
Sbjct  61   KPGGLLVVTVNGTGAILHIVYVTLFLIYAPKTLKIQSIKLVAIIDIAFLGAVIAITLLAV  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG T+L  VGLL  GL I MYASPLSA RTVIKMKSVEYMPF+LSFFQ LNGG+WA+YA+
Sbjct  121  HGNTQLTLVGLLAAGLNIVMYASPLSATRTVIKMKSVEYMPFFLSFFQFLNGGVWAAYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK------EEEDPAHLVKGGIEMANDV  802
             V+D YIG+PNGIGFLLGSAQ+ILYFIYY+STP K      E+E  AHLV+ GI++ +  
Sbjct  181  FVKDYYIGVPNGIGFLLGSAQLILYFIYYKSTPTKSTDQKEEKEGSAHLVRRGIQLNDLD  240

Query  803  AFKSNGKD  826
                N K+
Sbjct  241  GAHENDKN  248



>ref|XP_006344692.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Solanum 
tuberosum]
Length=291

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/245 (71%), Positives = 210/245 (86%), Gaps = 6/245 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+ SFI+GIIGNVISILMF AP+KTFKRI++KKSTE+FKGIPYITTLLST LW+FYGLL
Sbjct  1    MANFSFILGIIGNVISILMFAAPIKTFKRIMKKKSTEDFKGIPYITTLLSTCLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVNGTG + HIIYV+LFLIYAPK +KI+S+K+V IIN+AFLGAV+A+TL  +
Sbjct  61   KPGGLLVVTVNGTGAIFHIIYVTLFLIYAPKPLKIQSMKLVAIINIAFLGAVIAITLLAV  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG T+L  VG LC  L IGMYA+PL+A RTVIKMKSVEYMPF+LSFFQ LNGG+W +YA+
Sbjct  121  HGTTRLTLVGFLCAALNIGMYAAPLAATRTVIKMKSVEYMPFFLSFFQFLNGGVWTAYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            LV+D +IG+PNGIGF+LG+AQ+ILYF+YY+S+P  EE+  AHL+K  I+M  DV    NG
Sbjct  181  LVKDYFIGVPNGIGFILGAAQLILYFMYYKSSPT-EEKGSAHLMKREIQM-KDV----NG  234

Query  821  KDPSE  835
               +E
Sbjct  235  AHENE  239



>ref|XP_004230255.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Solanum 
lycopersicum]
Length=293

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 212/247 (86%), Gaps = 7/247 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+ SFI+GIIGNVISILMF AP+KTFKRI++KKSTE+FKGIPYITTLLST LW+FYGLL
Sbjct  1    MANFSFILGIIGNVISILMFAAPIKTFKRIMKKKSTEDFKGIPYITTLLSTCLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVNG+G +LHIIYV+LFLIYAP+ +KI+S+K+V II++AFLGAV+A+TL  +
Sbjct  61   KPGGLLVVTVNGSGAILHIIYVTLFLIYAPEPLKIQSMKLVAIIDIAFLGAVIAITLVAV  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG T+L  VG LC  L IGMYA+PL+A RTVIKMKSVEYMPF+LSFFQ LNGG+W +YA+
Sbjct  121  HGTTRLTLVGFLCAALNIGMYAAPLAATRTVIKMKSVEYMPFFLSFFQFLNGGVWTAYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK--EEEDPAHLVKGGIEMANDVAFKS  814
            LV+D +IG+PNGIGF+LG+AQ+ILYF+YY+S+P K  EE+  AHL+K  I+M  DV    
Sbjct  181  LVKDYFIGVPNGIGFILGAAQLILYFMYYKSSPTKSTEEKGSAHLMKREIQM-KDV----  235

Query  815  NGKDPSE  835
            NG   +E
Sbjct  236  NGAHENE  242



>ref|XP_011092096.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Sesamum 
indicum]
Length=295

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 207/256 (81%), Gaps = 7/256 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M SLSFI+G+IGNVISILMF++PVKTFK++V+KKSTEN+KGIPYITTLLSTSLW+FYGLL
Sbjct  1    MGSLSFILGVIGNVISILMFISPVKTFKQVVKKKSTENYKGIPYITTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVN  G  LH++YV +FL+YAPKNIK+RS+K+V  +NV FLGAV+ VTL  L
Sbjct  61   KPGGLLVVTVNTVGAALHVVYVLIFLVYAPKNIKVRSVKLVAALNVGFLGAVITVTLLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G T +  VGLLC GLTIGMYA+PLSAMRTV+KMKSV+YMPF LSFFQ LNG +W++YA+
Sbjct  121  RGATHITLVGLLCAGLTIGMYAAPLSAMRTVMKMKSVKYMPFLLSFFQFLNGAVWSAYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQST------PAKEEEDPAHLVKGGIEMANDV  802
            L +D YIG+PNGIGFLLGSAQ+ILY+IY   T         E+E  AHL KG I+M   +
Sbjct  181  LEKDYYIGVPNGIGFLLGSAQLILYWIYKSKTMPEESEERMEDEGSAHLFKGAIQM-QGI  239

Query  803  AFKSNGKDPSEARAHT  850
              ++N K+ S  + ++
Sbjct  240  DEETNMKNRSLNKGNS  255



>ref|XP_007031036.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
 gb|EOY11538.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
Length=293

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 213/273 (78%), Gaps = 11/273 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFIVGIIGNVISIL+F +P+KTF  +V+KKSTEN+KG+PYITTLLSTSLW+FYG++
Sbjct  1    MASLSFIVGIIGNVISILVFASPIKTFWWVVKKKSTENYKGVPYITTLLSTSLWTFYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLV TVNG G +  +IYV+LFLIYAPK+ KI++ K+V +++V FLGAV+AVTL  +
Sbjct  61   NPDGLLVTTVNGAGAIFQLIYVTLFLIYAPKDKKIKTAKLVAVLDVGFLGAVIAVTLLAI  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC GLTIGMYASPLSAMRTVI+ KSVEYMPF  SFF  LN G+W++Y++
Sbjct  121  HGSMRLTFVGILCAGLTIGMYASPLSAMRTVIRTKSVEYMPFLFSFFLFLNAGVWSAYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIY------YQSTPAKEEEDPAHLVKGGIEM---A  793
            LV+D+YIG+PN IGF+LGSAQ+ILYFI+       +S  A EEE  AHLVKGGIEM    
Sbjct  181  LVKDIYIGVPNAIGFVLGSAQLILYFIFKNKSASAKSPEAMEEEGSAHLVKGGIEMHSLE  240

Query  794  NDVAFKSNGKDPSEARAHT*LSRTNHPRNTLRN  892
            +D+  +S  K  S  + H  +SR N  +N ++ 
Sbjct  241  DDLKNRSLNKGKSLPKPH--VSRQNSLQNIMKT  271



>ref|XP_010259506.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X1 [Nelumbo nucifera]
Length=358

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 207/268 (77%), Gaps = 18/268 (7%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFIVGIIGN+ISIL+F +P+ TF+R+V+KKSTE+FKG+PYI TLLSTSLWSFYGLL
Sbjct  54   MASLSFIVGIIGNIISILVFTSPIGTFRRVVKKKSTESFKGLPYICTLLSTSLWSFYGLL  113

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+VTVNGTG VL  IYV+LFLIYAPK+ K++ +K+V ++NV  LG V+AVTL  +
Sbjct  114  KPGGLLIVTVNGTGAVLQFIYVTLFLIYAPKDTKVKLMKLVALLNVGCLGLVIAVTLLAI  173

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG LC GLT+GMYASPL AMR VI+ KSV+YMPF LSFF  LNGG+W+ YA+
Sbjct  174  HGSLRLTVVGFLCAGLTLGMYASPLVAMRMVIRTKSVDYMPFSLSFFLFLNGGVWSVYAV  233

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQ------STPAKEEEDPAHLVKGGIEMA---  793
            LV+DL+IG+PN IGF+LGSAQ+ILY +Y +      ST AKEEE  AHLV+G +EM+   
Sbjct  234  LVKDLFIGVPNAIGFVLGSAQLILYAVYRRKSASQKSTEAKEEEGSAHLVRGNVEMSEYE  293

Query  794  NDVAFKSNGKD---------PSEARAHT  850
            +   FK+  +           S AR H+
Sbjct  294  DSSEFKTKNRSLNKGMSLPKSSVARQHS  321



>emb|CDP17204.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 206/248 (83%), Gaps = 10/248 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MAS S I+GIIGNVISILMFL+PVKTF+RIV+KKS E+FKG+PYITTLLSTSLWSFYG+L
Sbjct  1    MASFSVILGIIGNVISILMFLSPVKTFRRIVKKKSIEDFKGVPYITTLLSTSLWSFYGIL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV+TVNG G +LHIIYV+LFLIYAPK++K++SLK+V I++V F G VVAVTL  L
Sbjct  61   KPGGLLVLTVNGAGAILHIIYVTLFLIYAPKDVKVKSLKLVAIVDVGFFGVVVAVTLLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VGLLCTG+TIGMYASPLS MRTVIKMKSVEYMPF+LSFFQ LNGG+WA+YA+
Sbjct  121  HGSLRLTVVGLLCTGMTIGMYASPLSVMRTVIKMKSVEYMPFFLSFFQFLNGGVWAAYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIY---YQSTPAKEEED----PAHLVKGGIEMAND  799
            LV+D+Y+G+PNGIGF+LG AQ++LY  Y   Y S   +  ED     AH +KG I+M + 
Sbjct  181  LVKDIYLGVPNGIGFILGLAQLLLYVFYKNKYASKSKEAMEDGGGGSAHPIKGVIQMED-  239

Query  800  VAFKSNGK  823
              F +N K
Sbjct  240  --FDNNEK  245



>ref|XP_007031037.1| Nodulin MtN3 family protein isoform 2, partial [Theobroma cacao]
 gb|EOY11539.1| Nodulin MtN3 family protein isoform 2, partial [Theobroma cacao]
Length=288

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/278 (61%), Positives = 213/278 (77%), Gaps = 16/278 (6%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFIVGIIGNVISIL+F +P+KTF  +V+KKSTEN+KG+PYITTLLSTSLW+FYG++
Sbjct  1    MASLSFIVGIIGNVISILVFASPIKTFWWVVKKKSTENYKGVPYITTLLSTSLWTFYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLV TVNG G +  +IYV+LFLIYAPK+ KI++ K+V +++V FLGAV+AVTL  +
Sbjct  61   NPDGLLVTTVNGAGAIFQLIYVTLFLIYAPKDKKIKTAKLVAVLDVGFLGAVIAVTLLAI  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC GLTIGMYASPLSAMRTVI+ KSVEYMPF  SFF  LN G+W++Y++
Sbjct  121  HGSMRLTFVGILCAGLTIGMYASPLSAMRTVIRTKSVEYMPFLFSFFLFLNAGVWSAYSL  180

Query  641  LVRDLYIGI-----PNGIGFLLGSAQIILYFIY------YQSTPAKEEEDPAHLVKGGIE  787
            LV+D+YIGI     PN IGF+LGSAQ+ILYFI+       +S  A EEE  AHLVKGGIE
Sbjct  181  LVKDIYIGIHTFQVPNAIGFVLGSAQLILYFIFKNKSASAKSPEAMEEEGSAHLVKGGIE  240

Query  788  M---ANDVAFKSNGKDPSEARAHT*LSRTNHPRNTLRN  892
            M    +D+  +S  K  S  + H  +SR N  +N ++ 
Sbjct  241  MHSLEDDLKNRSLNKGKSLPKPH--VSRQNSLQNIMKT  276



>gb|KDP23461.1| hypothetical protein JCGZ_23294 [Jatropha curcas]
Length=305

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 207/275 (75%), Gaps = 12/275 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFIVGIIGN+ISIL+F +P+KTF  +V+KKSTEN+KG+PYITTLLSTSLW+FYG+L
Sbjct  1    MASLSFIVGIIGNIISILVFASPIKTFWTVVKKKSTENYKGVPYITTLLSTSLWTFYGIL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLVVTVNGTG V   +YV+LFLIYAPK+  I++ K+V ++NV FLGAV+AVTL  L
Sbjct  61   NPDGLLVVTVNGTGTVFQFVYVTLFLIYAPKDKMIKTAKLVALLNVVFLGAVIAVTLLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYA+PLSAMRTVIK KSVEYMPF LSFF  LNGG+W+ YA+
Sbjct  121  HGNIRLTFVGILCAALTIGMYAAPLSAMRTVIKTKSVEYMPFLLSFFLFLNGGVWSVYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYY------QSTPAKEEEDPAHLVKGGIEMA---  793
            LV+D YIG+PN  GF+LGSAQ+ILY +Y       +ST A EEE   HLVKGGIEM    
Sbjct  181  LVKDFYIGVPNATGFVLGSAQLILYAMYKNKTVSPKSTEAIEEEGSTHLVKGGIEMGAYN  240

Query  794  ---NDVAFKSNGKDPSEARAHT*LSRTNHPRNTLR  889
               ++   K+   D  ++     ++R N  +  LR
Sbjct  241  NEDDEGDVKNRSLDKGKSLPKPAINRQNSLQKILR  275



>ref|XP_002279031.1| PREDICTED: bidirectional sugar transporter SWEET16 [Vitis vinifera]
 emb|CAN65683.1| hypothetical protein VITISV_022457 [Vitis vinifera]
 emb|CBI39541.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   280 bits (717),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 200/248 (81%), Gaps = 10/248 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFI+GIIGNVISIL+F +P+ TF+R+V+KKSTEN+KGIPYITTLLSTSLWSFYG+L
Sbjct  1    MASLSFIIGIIGNVISILVFASPIGTFRRVVKKKSTENYKGIPYITTLLSTSLWSFYGIL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV+TVNG G ++  IYV+LFLIYAP+++KI+S+K+  +++V FLGAV+A+TL   
Sbjct  61   KPGGLLVLTVNGAGAIMQFIYVTLFLIYAPRDVKIKSMKVAAVLDVGFLGAVIALTLLAF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG ++L+ VG+ C GLTI MYASPLSAMR VIK KSVE+MPF+LSFF  LNGG+W+ YA+
Sbjct  121  HGSSRLICVGIFCAGLTIVMYASPLSAMRMVIKTKSVEFMPFFLSFFLFLNGGVWSVYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYY-QSTPAK------EEEDPAHLVKGGIEMAND  799
            LV D +IG+PN +GF+LGSAQ+ILY +Y  +S P+       EEE  AH VK  +EM   
Sbjct  181  LVTDFFIGVPNAVGFVLGSAQLILYAVYRNKSRPSATSEERVEEEGSAHTVKRAVEMQ--  238

Query  800  VAFKSNGK  823
               K +GK
Sbjct  239  -VSKDDGK  245



>ref|XP_007031034.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
 gb|EOY11536.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
Length=299

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 197/250 (79%), Gaps = 9/250 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFI+GIIGNVISIL+F +P+KTF  +V+KKSTEN+ G+PYITTLLSTSLW+FYG +
Sbjct  1    MASLSFIIGIIGNVISILVFASPIKTFWWVVKKKSTENYNGVPYITTLLSTSLWTFYGTM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLVVT+N TG +  +IYV+LFLIYAPK+ KI++ K+V +++V F G ++AVTL  +
Sbjct  61   NPDGLLVVTLNVTGAIFQLIYVTLFLIYAPKDKKIKTAKLVAVLDVGFPGVLIAVTLLAI  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG T+L  VG+LC  LTIGMYAS LS MRTVI+ KSVEYMPF LSFF  LN G+W++Y++
Sbjct  121  HGNTRLAFVGILCAVLTIGMYASHLSVMRTVIRTKSVEYMPFLLSFFLFLNAGVWSAYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYY------QSTPAKEEEDPAHLVKGGIEM---A  793
            LV+D+YIG+PN IGF+LGSAQ+ILY IY       +S  A EEE  AHLVKGGIEM    
Sbjct  181  LVKDIYIGVPNAIGFVLGSAQLILYVIYKNKSASAKSPEAMEEEGSAHLVKGGIEMHSLE  240

Query  794  NDVAFKSNGK  823
            +D+  +S  K
Sbjct  241  DDLKNRSLNK  250



>ref|XP_002512453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49905.1| conserved hypothetical protein [Ricinus communis]
Length=288

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 195/241 (81%), Gaps = 8/241 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+LSFIVGI+GN+ISIL+F +P+KTF  +++KKSTEN+KG+PYITTLLSTSLW+FYGLL
Sbjct  1    MANLSFIVGILGNIISILVFASPIKTFWIVMKKKSTENYKGVPYITTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLVVTVNGTGVV   +YV+LFLIYAPK+ KI+S K+V ++NV F+GAV+AVTL  +
Sbjct  61   NPDGLLVVTVNGTGVVFQSVYVTLFLIYAPKDKKIKSAKLVALLNVGFVGAVIAVTLLAM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG++C  LTIGMYA+PLSAMR VIK KSVEYMPF LSFF  LNGGIW+ YA+
Sbjct  121  HGHLRLTFVGIVCAALTIGMYAAPLSAMRMVIKTKSVEYMPFLLSFFLFLNGGIWSIYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDP-----AHLVKGGIEM---AN  796
            LV+D+YIG+PN  GF+LGS Q+ILY IY   +P+ + +D      AH VKG IEM   +N
Sbjct  181  LVKDIYIGVPNATGFVLGSVQLILYAIYKSKSPSTKPQDAIGEGSAHSVKGDIEMDAYSN  240

Query  797  D  799
            D
Sbjct  241  D  241



>ref|XP_007031035.1| Nodulin MtN3 family protein isoform 2, partial [Theobroma cacao]
 gb|EOY11537.1| Nodulin MtN3 family protein isoform 2, partial [Theobroma cacao]
Length=288

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 198/258 (77%), Gaps = 14/258 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFI+GIIGNVISIL+F +P+KTF  +V+KKSTEN+ G+PYITTLLSTSLW+FYG +
Sbjct  1    MASLSFIIGIIGNVISILVFASPIKTFWWVVKKKSTENYNGVPYITTLLSTSLWTFYGTM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLVVT+N TG +  +IYV+LFLIYAPK+ KI++ K+V +++V F G ++AVTL  +
Sbjct  61   NPDGLLVVTLNVTGAIFQLIYVTLFLIYAPKDKKIKTAKLVAVLDVGFPGVLIAVTLLAI  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG T+L  VG+LC  LTIGMYAS LS MRTVI+ KSVEYMPF LSFF  LN G+W++Y++
Sbjct  121  HGNTRLAFVGILCAVLTIGMYASHLSVMRTVIRTKSVEYMPFLLSFFLFLNAGVWSAYSL  180

Query  641  LVRDLYIGI-----PNGIGFLLGSAQIILYFIYY------QSTPAKEEEDPAHLVKGGIE  787
            LV+D+YIGI     PN IGF+LGSAQ+ILY IY       +S  A EEE  AHLVKGGIE
Sbjct  181  LVKDIYIGIHSFQVPNAIGFVLGSAQLILYVIYKNKSASAKSPEAMEEEGSAHLVKGGIE  240

Query  788  M---ANDVAFKSNGKDPS  832
            M    +D+  +S  K  S
Sbjct  241  MHSLEDDLKNRSLNKCRS  258



>ref|XP_006433450.1| hypothetical protein CICLE_v10001944mg [Citrus clementina]
 ref|XP_006472131.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Citrus 
sinensis]
 gb|ESR46690.1| hypothetical protein CICLE_v10001944mg [Citrus clementina]
Length=308

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 193/251 (77%), Gaps = 6/251 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSF VGIIGNVIS+L+F +P+KTF +IV+KKSTE++KG+PYITTL+STSLW+FYG++
Sbjct  1    MASLSFFVGIIGNVISLLVFASPIKTFWQIVKKKSTESYKGVPYITTLMSTSLWTFYGVM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV TVNG G  L  IYVSL+LIYAPK+ K+++ K+V I++V FLGAV+A+TL  +
Sbjct  61   KPGGLLVATVNGAGAALQFIYVSLYLIYAPKDKKVKTAKLVAILDVGFLGAVIAITLLAM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYASPL+ M TVI+ KSV+YMPF LSFF  LN G+W+ Y++
Sbjct  121  HGNLRLTFVGILCAALTIGMYASPLAVMTTVIRTKSVKYMPFLLSFFLFLNAGVWSVYSV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP------AKEEEDPAHLVKGGIEMANDV  802
            LV+D+YIG+PN +GF+LG+AQ+ILY IY   TP         +E  AH VK GIEM    
Sbjct  181  LVKDIYIGVPNAVGFVLGAAQLILYMIYKNKTPLPTKSMDSVKERSAHKVKDGIEMGARG  240

Query  803  AFKSNGKDPSE  835
                N +D  E
Sbjct  241  DDHDNQEDDLE  251



>gb|KDO39196.1| hypothetical protein CISIN_1g021755mg [Citrus sinensis]
Length=308

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 192/251 (76%), Gaps = 6/251 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSF VGIIGNVIS+L+F +P+KTF +IV+KKSTE++KG+PYITTL+ST LW+FYG++
Sbjct  1    MASLSFFVGIIGNVISLLVFASPIKTFWQIVKKKSTESYKGVPYITTLMSTCLWTFYGVM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGL+V TVNG G  L  IYVSL+LIYAPK+ K+++ K+V I++V FLGAV+A+TL  +
Sbjct  61   KPGGLVVATVNGAGAALQFIYVSLYLIYAPKDKKVKTAKLVAILDVGFLGAVIAITLLAM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYASPL+ M TVI+ KSV+YMPF LSFF  LN G+W+ Y++
Sbjct  121  HGNLRLTFVGILCAALTIGMYASPLAVMTTVIRTKSVKYMPFLLSFFLFLNAGVWSVYSV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP------AKEEEDPAHLVKGGIEMANDV  802
            LV+D+YIG+PN +GF+LG+AQ+ILY IY   TP         +E  AH VK GIEM    
Sbjct  181  LVKDIYIGVPNAVGFVLGAAQLILYMIYKNKTPLPTKSMDSVKERSAHKVKDGIEMGARG  240

Query  803  AFKSNGKDPSE  835
                N +D  E
Sbjct  241  DDHDNQEDDLE  251



>ref|XP_010025255.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Eucalyptus 
grandis]
 gb|KCW61871.1| hypothetical protein EUGRSUZ_H04550 [Eucalyptus grandis]
Length=283

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 201/260 (77%), Gaps = 10/260 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSF+VGI GN+ISIL+F +P+KTF ++V+K+ TEN+KG+PYITTLLSTSLWSFYG+L
Sbjct  1    MASLSFMVGIFGNIISILVFTSPIKTFWQVVKKRCTENYKGVPYITTLLSTSLWSFYGIL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV+TVN  G ++  IYV+LFLIYAPK+ +I+ +K+V +++V F G VVAVTL  +
Sbjct  61   KPGGLLVLTVNAAGAIMQFIYVTLFLIYAPKDKRIQLMKLVALLDVGFPGVVVAVTLLAI  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYASPL+ MRTVIK KSV+YMPF+LSFF  LN  +W+ YA+
Sbjct  121  HGNMRLTVVGILCAALTIGMYASPLAVMRTVIKTKSVKYMPFFLSFFLFLNATVWSIYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE---------EEDPAHLVKGGIEMA  793
            LV+D YIG+PNGIGF+LGSAQ+ILY IY   + A +         E+  AHLVKG +E+ 
Sbjct  181  LVKDFYIGVPNGIGFILGSAQLILYAIYKNQSAASKLEESTEEAEEDGSAHLVKGDVEIG  240

Query  794  N-DVAFKSNGKDPSEARAHT  850
            + +V  ++  K+ + AR  +
Sbjct  241  SYNVEDENQLKNRTIARGRS  260



>ref|XP_007031038.1| Nodulin MtN3 family protein isoform 3, partial [Theobroma cacao]
 gb|EOY11540.1| Nodulin MtN3 family protein isoform 3, partial [Theobroma cacao]
Length=274

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 190/248 (77%), Gaps = 11/248 (4%)
 Frame = +2

Query  173  KTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgvvlHIIYVSL  352
            KTF  +V+KKSTEN+KG+PYITTLLSTSLW+FYG++ P GLLV TVNG G +  +IYV+L
Sbjct  16   KTFWWVVKKKSTENYKGVPYITTLLSTSLWTFYGIINPDGLLVTTVNGAGAIFQLIYVTL  75

Query  353  FLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASP  532
            FLIYAPK+ KI++ K+V +++V FLGAV+AVTL  +HG  +L  VG+LC GLTIGMYASP
Sbjct  76   FLIYAPKDKKIKTAKLVAVLDVGFLGAVIAVTLLAIHGSMRLTFVGILCAGLTIGMYASP  135

Query  533  LSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIIL  712
            LSAMRTVI+ KSVEYMPF  SFF  LN G+W++Y++LV+D+YIG+PN IGF+LGSAQ+IL
Sbjct  136  LSAMRTVIRTKSVEYMPFLFSFFLFLNAGVWSAYSLLVKDIYIGVPNAIGFVLGSAQLIL  195

Query  713  YFIYY------QSTPAKEEEDPAHLVKGGIEM---ANDVAFKSNGKDPSEARAHT*LSRT  865
            YFI+       +S  A EEE  AHLVKGGIEM    +D+  +S  K  S  + H  +SR 
Sbjct  196  YFIFKNKSASAKSPEAMEEEGSAHLVKGGIEMHSLEDDLKNRSLNKGKSLPKPH--VSRQ  253

Query  866  NHPRNTLR  889
            N  +N ++
Sbjct  254  NSLQNIMK  261



>ref|XP_002318982.2| hypothetical protein POPTR_0013s01550g, partial [Populus trichocarpa]
 gb|EEE94905.2| hypothetical protein POPTR_0013s01550g, partial [Populus trichocarpa]
Length=269

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 181/236 (77%), Gaps = 7/236 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSF VGI+GN+IS+L+F++P+KTF  +V+KKSTEN+KG+PYITTLLSTSLW+FYGL+
Sbjct  1    MASLSFFVGIMGNIISLLLFVSPIKTFWGVVKKKSTENYKGVPYITTLLSTSLWTFYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  L+V       +    IYV+LFLIYAPK+ K+   K V I+NV FLGAV+ V L  +
Sbjct  61   KPDILVVSVNGVGAIF-QFIYVTLFLIYAPKDTKVTMAKFVAILNVGFLGAVIMVALLAI  119

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  ++  VG+LC  LTIGMYA+PLSAMR VIK KSVEYMPF LSFF  LNGG+W++Y++
Sbjct  120  HGNLRITFVGILCAALTIGMYAAPLSAMRRVIKTKSVEYMPFLLSFFLFLNGGVWSAYSV  179

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIY-YQSTPAK-----EEEDPAHLVKGGIEM  790
            LV+D YIG+PN +GF+LGSAQ+ILY +Y  +S  AK     EE+    LVKG +++
Sbjct  180  LVKDFYIGVPNVVGFVLGSAQLILYLMYKNKSASAKTMKAIEEDGSVQLVKGSVDI  235



>ref|XP_009391486.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET16-like [Musa acuminata subsp. malaccensis]
Length=295

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 185/237 (78%), Gaps = 8/237 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA +SF VGI+GNVISIL+F +P+ TF+RIV+ KSTE+FKG+PYITTLLSTSLW+FYGLL
Sbjct  1    MADVSFFVGILGNVISILVFASPIGTFRRIVKTKSTESFKGLPYITTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVNG G VL  IY+ LFLIYAP + + +  K+VG++NV F GAVV VTL  +
Sbjct  61   KPGGLLVVTVNGVGTVLQAIYIILFLIYAPNDTRAKMAKLVGMLNVCFFGAVVVVTLLSV  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            H   +L+ VG LC  LT+GMYASP++AM TV+K KSVEYMPF+LSFF  LNGG+W+ Y++
Sbjct  121  HASMRLLVVGFLCAALTVGMYASPMAAMSTVVKTKSVEYMPFFLSFFLFLNGGVWSIYSV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPA-------KEEEDPAHLVKGGIEM  790
            LVRD +IG+PN IGF LGSAQ++L  +Y +  PA        EEE  AHLV G +EM
Sbjct  181  LVRDFFIGVPNAIGFALGSAQLVLXAVYRRKKPAAKATELEAEEEGSAHLV-GHVEM  236



>ref|XP_004135601.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Cucumis 
sativus]
 ref|XP_004169768.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Cucumis 
sativus]
 gb|KGN66051.1| hypothetical protein Csa_1G569280 [Cucumis sativus]
Length=295

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 190/238 (80%), Gaps = 6/238 (3%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            ASLSF++GIIGNVISIL+F +P+KTF  IV+KKSTEN+KGIPY+TTLLSTSLW+FYG+LK
Sbjct  3    ASLSFVMGIIGNVISILVFASPMKTFIGIVKKKSTENYKGIPYVTTLLSTSLWTFYGILK  62

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            PGGLLV TVNG GV+  + YV+LF+++APK  K+ ++K+VG+ NV F G+V+  TL V+H
Sbjct  63   PGGLLVATVNGVGVLFQLFYVTLFIVFAPKQKKVTTIKLVGLFNVLFYGSVIGATLLVMH  122

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
            G  +L  VG++C  LTIGMYASPL+AM+ VI+ KSVEYMPF LSFF  LN GIW++YA+L
Sbjct  123  GPLRLTFVGIICAALTIGMYASPLAAMKNVIRTKSVEYMPFLLSFFLFLNAGIWSAYALL  182

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIY------YQSTPAKEEEDPAHLVKGGIEMAND  799
            V+D+YIG+PNGIGF+LG AQ+ILY IY       +ST   E+E  A LV+ G+   +D
Sbjct  183  VKDIYIGVPNGIGFVLGLAQLILYGIYKNKSKSTKSTEMMEDEGSAQLVEMGMNGEDD  240



>ref|XP_011023917.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Populus 
euphratica]
Length=325

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 192/286 (67%), Gaps = 15/286 (5%)
 Frame = +2

Query  35   IHHFFHCIYLQAKLIKFLEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTEN  214
            I     C+++ ++         MASLSF VGIIGN+IS+L+F++P+KTF  +V+KKSTEN
Sbjct  7    IESLLLCVFIPSRTSLRSIALFMASLSFFVGIIGNIISLLLFVSPIKTFWGVVKKKSTEN  66

Query  215  FKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSL  394
            +KG+PYITTLLSTSLW+FYGL+KP  L+V       +    IYV+LFLIYAPK+ K+   
Sbjct  67   YKGVPYITTLLSTSLWTFYGLIKPDILVVSVNGVGAIS-QFIYVTLFLIYAPKDTKVTMA  125

Query  395  KMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVE  574
            K+  I+NV FLGAV+ V L  +HG  ++  VG+LC  LTIGMYA+PLSAMR VIK KSVE
Sbjct  126  KLAAILNVGFLGAVIVVALLAIHGNLRITIVGILCAALTIGMYAAPLSAMRRVIKTKSVE  185

Query  575  YMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIY-YQSTPAK--  745
            YMPF LSFF  LNGG+W++YA+LV+D YIG+PN +GF+LGSAQ+ILY IY  +S  AK  
Sbjct  186  YMPFLLSFFLFLNGGVWSAYAVLVKDFYIGVPNAVGFVLGSAQLILYLIYKNKSASAKAM  245

Query  746  ---EEEDPAHLVK-------GGIEMANDVAFKSNG-KDPSEARAHT  850
               EE+   H  K           + N    K N    PS  R H+
Sbjct  246  KAIEEDGSVHRNKDDEDDGDDEGNLKNRSLSKGNSLPKPSVNREHS  291



>ref|XP_002318981.2| hypothetical protein POPTR_0013s01540g [Populus trichocarpa]
 gb|EEE94904.2| hypothetical protein POPTR_0013s01540g [Populus trichocarpa]
Length=293

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 186/248 (75%), Gaps = 9/248 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA +SF +GI+GN+IS+L+F +P+KTF ++V++KSTEN+KG PYITTLLSTSLW+FYGLL
Sbjct  1    MAKISFFIGIVGNIISLLVFTSPIKTFWKVVKRKSTENYKGAPYITTLLSTSLWAFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  L+V       +   + YV+LFL+YAPK+ KI++ K+V I+N  FLG V+A+TL  +
Sbjct  61   KPDILVVTVNGAGAIF-QLTYVTLFLMYAPKDKKIKTAKLVAILNAGFLGVVIAITLLAM  119

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +   VG+LC  LTIGMYA+PLSAM+ V++ KSV+YMPF+LSFF  LNGG+W+ YA+
Sbjct  120  HGSLQTTFVGVLCAALTIGMYAAPLSAMKRVMRTKSVQYMPFFLSFFLFLNGGVWSVYAV  179

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK-EEEDPAHL-VKGGIEMANDVAFKS  814
            L++D YIG+PN +GF+LGSAQ+ILY IY   + A  EE+ P H+  K G+EM       +
Sbjct  180  LIKDYYIGVPNVVGFVLGSAQLILYIIYRNKSAAMIEEKGPVHIEAKEGVEMP------A  233

Query  815  NGKDPSEA  838
             G++  EA
Sbjct  234  KGENDEEA  241



>gb|KHG24498.1| Bidirectional sugar transporter SWEET16 [Gossypium arboreum]
Length=300

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 202/266 (76%), Gaps = 16/266 (6%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFI+GIIGN+ISIL+F +P+KTF  +V+KKST+N+KG+PYITTLLSTSLW+FYG++
Sbjct  1    MASLSFIIGIIGNIISILVFASPIKTFWWVVKKKSTKNYKGVPYITTLLSTSLWTFYGIM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P GLLVVTVNG G +  +IYV LFL+YAPK+ K+++ K+V I++V FLGAV+AVTL   
Sbjct  61   NPDGLLVVTVNGAGAIFQLIYVILFLVYAPKDKKVKTAKLVAILDVGFLGAVIAVTLLAF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG++C GLTIGMYASPLS MRTVIK KSVEYMPF LSFF  LN G+W++YA+
Sbjct  121  HGTMRLTFVGIICAGLTIGMYASPLSVMRTVIKTKSVEYMPFLLSFFLFLNAGVWSAYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE--------EEDPAHLVKGGIEM--  790
            LV+D+YIG+PN IGF+LGSAQ+ILY +Y     A+             AHLVKGGIEM  
Sbjct  181  LVKDIYIGVPNAIGFILGSAQLILYLMYNNKKSAEAVEEEEGGGGGGSAHLVKGGIEMHS  240

Query  791  -ANDVAFKSNGK-----DPSEARAHT  850
              +++  +S  K      P+ +R H+
Sbjct  241  VEDNLNNRSLNKWKSLPKPNFSRQHS  266



>ref|XP_004984436.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Setaria 
italica]
Length=311

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            A  SF+VGIIGNVISIL+F +P+KTF+RIV+ +STE+F+ +PY+TTLLSTSLW+FYGLLK
Sbjct  3    ADPSFVVGIIGNVISILVFASPIKTFRRIVRNRSTEDFRWLPYVTTLLSTSLWTFYGLLK  62

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            PGGLLVVTVNG G  L   YV+L+LIYAP+  K + +K+V  +NV FL AVV VTL+ LH
Sbjct  63   PGGLLVVTVNGAGAALEAAYVTLYLIYAPRETKAKMVKLVLAVNVGFLAAVVVVTLAALH  122

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
            G  +L++VG+LC  LTIGMYA+PL AMRTV+K +SVEYMPF LSFF  LNGG+W+ Y++L
Sbjct  123  GGARLLTVGVLCAVLTIGMYAAPLGAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSVL  182

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE  748
            V+D +IG+PN IGF+LG+AQ++LY  Y ++ PA++
Sbjct  183  VKDYFIGVPNAIGFVLGTAQLVLYMAYRKAAPARK  217



>gb|KDO71717.1| hypothetical protein CISIN_1g026722mg [Citrus sinensis]
Length=234

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 173/228 (76%), Gaps = 6/228 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGN+IS+LMFLAPV+TF RI++ +STE F+ +PYI TLL++SLW++YG+ 
Sbjct  1    MKDLSFYVGVIGNIISVLMFLAPVRTFWRIIKHRSTEEFQSLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAP-KNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            +PG  LV TVNG G+++  +YV+LF IYAP K ++ ++  + GI++V FLGA +A T   
Sbjct  61   RPGSYLVATVNGFGILVEAVYVTLFFIYAPTKAMRAKTAIIFGILDVGFLGAAIAATRLA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L G+ ++ ++G +C GL I MYASPLSAM+TV+  KSVE+MPF LSFF  LNGGIWA YA
Sbjct  121  LEGEARIDAIGFMCAGLNIIMYASPLSAMKTVVTTKSVEFMPFMLSFFFFLNGGIWAFYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EEDPAH  766
            +LVRD+++G+PNG GFLLG+AQ++LY IY  + P+K      EE   H
Sbjct  181  LLVRDIFLGVPNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQH  228



>ref|XP_006419536.1| hypothetical protein CICLE_v10005737mg [Citrus clementina]
 ref|XP_006489052.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Citrus 
sinensis]
 gb|ESR32776.1| hypothetical protein CICLE_v10005737mg [Citrus clementina]
Length=234

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 173/228 (76%), Gaps = 6/228 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IG++IS+LMFLAPV+TF RI++ +STE F+ +PYI TLL++SLW++YG+ 
Sbjct  1    MKDLSFYVGVIGSIISVLMFLAPVRTFWRIIKHRSTEEFQSLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAP-KNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            +PG  LV TVNG G+++  +YV+LF IYAP K ++ ++  + GI++V FLGA +A T   
Sbjct  61   RPGSYLVATVNGFGILVEAVYVTLFFIYAPTKAMRAKTAIIFGILDVGFLGAAIAATRLA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L G+ ++ ++G +C GL I MYASPLSAM+TV+  KSVE+MPF LSFF  LNGGIWA YA
Sbjct  121  LEGEARIDAIGFMCAGLNIIMYASPLSAMKTVVTTKSVEFMPFMLSFFFFLNGGIWAFYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EEDPAH  766
            +LVRD+++G+PNG GFLLG+AQ++LY IY  + P+K      EE   H
Sbjct  181  LLVRDIFLGVPNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQH  228



>ref|XP_006840479.1| hypothetical protein AMTR_s00045p00186460 [Amborella trichopoda]
 gb|ERN02154.1| hypothetical protein AMTR_s00045p00186460 [Amborella trichopoda]
Length=271

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 178/249 (71%), Gaps = 11/249 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF  GI+GNVISIL+F +P+ TF+R+V+KKSTENFKG+P++ TLLSTSLWS+YGLL
Sbjct  1    MEDLSFFFGILGNVISILVFASPIGTFQRVVKKKSTENFKGLPFVCTLLSTSLWSYYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV+TVNG GV +  IYVSLFL YAPKN+K+++  +V ++NV FLG V+ VT+ +L
Sbjct  61   KPGGLLVLTVNGVGVAMEAIYVSLFLFYAPKNVKVKTAMLVLVLNVGFLGLVIMVTMLLL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            H   +L  VG L   LT+GMYASP++ MR VI  KSVEYMPF+L     LNGG+W  Y++
Sbjct  121  HAPLRLQVVGFLSAALTLGMYASPMAVMRRVIVTKSVEYMPFFL----FLNGGVWFLYSL  176

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQS-----TPAKEEEDPAHLVKGGIEMANDVA  805
            LV D +IG+PNGIGF+LG+ Q+I+Y +Y  S      P  EE D  H  +  IEM     
Sbjct  177  LVGDFFIGVPNGIGFILGATQLIVYAVYRNSKSTDQKPDMEELDTKHCFE--IEMPRTDK  234

Query  806  FKSNGKDPS  832
                 +D S
Sbjct  235  NLEKAEDNS  243



>ref|XP_008784881.1| PREDICTED: uncharacterized protein LOC103703710 [Phoenix dactylifera]
Length=574

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 195/272 (72%), Gaps = 18/272 (7%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            SFIVGI+GNVISIL+F +P+ TF+R+V+KKSTE+FK  PY+TTLLSTSLW+FYGLLKPGG
Sbjct  6    SFIVGIVGNVISILVFASPIGTFRRVVKKKSTESFKWQPYVTTLLSTSLWTFYGLLKPGG  65

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            LLVVTVNG G VL  IYV+L+L+YAP++ +++  K+V ++NV FLG V+ VTL  +HG  
Sbjct  66   LLVVTVNGIGSVLQAIYVTLYLVYAPRDTRVKMAKLVAVLNVGFLGLVILVTLLAIHGSV  125

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +L  +G LC  LT+GMYASPL+AMR V+K  SVEYMPF+LSFF  LNGG+W+ Y++LV+D
Sbjct  126  RLTVIGFLCAALTVGMYASPLAAMRMVVKTMSVEYMPFFLSFFLFLNGGVWSVYSLLVQD  185

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTP------AKEEEDPAHLVKGGIEMANDVAFKS  814
             +IG+PN +GF LGS Q++LY IY + TP        EEE  AHLV G +EM        
Sbjct  186  YFIGVPNCVGFALGSVQLVLYAIYKRKTPLAKAAETDEEEGSAHLV-GEVEMQG-----Y  239

Query  815  NGKDPSEARAHT*LSRTNH------PRNTLRN  892
             GK+   A     L++ +       PR T  N
Sbjct  240  EGKNSFHAAQQRHLNKGSSLPKPSIPRQTSLN  271


 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  98   VMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL  277
            +M +L F +G++GNVIS+L+F +P+KTF RIV+  STE F+  PY+ TLLS+SLW +YG+
Sbjct  327  IMEALLFFIGVVGNVISVLVFASPIKTFWRIVKSGSTEGFEPAPYVATLLSSSLWVYYGI  386

Query  278  LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVT-LS  454
             KP G LV TVNG G+VL  IYV+LFLIYA  +++ ++  +V ++++   GAVV VT L 
Sbjct  387  TKPDGFLVATVNGVGIVLEAIYVTLFLIYAAPSLRAKTAILVALLDLGIFGAVVLVTRLV  446

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            V+   T+++ +G +C  L + MY SPL+AM+TVI  KSVEYMPF+LSFF  LNGGIW  Y
Sbjct  447  VIEETTRVIVIGAICACLNVFMYGSPLAAMKTVIATKSVEYMPFFLSFFLFLNGGIWTVY  506

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            A+L RD+++GIPNGIGF LG+ Q++LY IY  +  +K   +
Sbjct  507  AVLDRDIFLGIPNGIGFFLGTIQLVLYMIYMNTKVSKHSGE  547



>ref|XP_010099962.1| Bidirectional sugar transporter SWEET16 [Morus notabilis]
 gb|EXB81008.1| Bidirectional sugar transporter SWEET16 [Morus notabilis]
Length=311

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 182/242 (75%), Gaps = 10/242 (4%)
 Frame = +2

Query  104  ASLSFIVGII--------GNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSL  259
            ASLS I+GII        GN+ISIL+F +P+KTF  +V+KKSTEN++GIPYITTLLSTSL
Sbjct  3    ASLSLIIGIIDKIYTSFAGNIISILVFTSPIKTFWVVVKKKSTENYQGIPYITTLLSTSL  62

Query  260  WSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVV  439
            W+FYGLL P GLL++TVNG G  L +IYV+ FLIYAP++ K+++ K++ ++NV F G+++
Sbjct  63   WTFYGLLNPQGLLILTVNGAGAFLQLIYVTFFLIYAPRDKKVQTAKLIAMLNVGFPGSII  122

Query  440  AVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGG  619
            A+TL  +  + KL  VG+LC  LTIGMYASPLSAM  VIKMKSVEYMPF  SFF  LNGG
Sbjct  123  ALTLLAVREEIKLTFVGILCAALTIGMYASPLSAMGMVIKMKSVEYMPFLFSFFLFLNGG  182

Query  620  IWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQST--PAKEEEDPAHLVKGGIEMA  793
            IW+ YA LV+D ++GIPN IGF+LGS+Q+I+Y IY   +    KEE     LVK  +EM 
Sbjct  183  IWSIYAALVKDFFVGIPNAIGFVLGSSQLIIYAIYKNKSKKSTKEEGSDVTLVKRAVEMQ  242

Query  794  ND  799
             +
Sbjct  243  AN  244



>ref|XP_011023714.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Populus 
euphratica]
Length=294

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 188/256 (73%), Gaps = 7/256 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA +SF +GIIGN+IS+L+F +P+KTF ++V++KSTEN+KG PYITTLLSTSLW+FYG+L
Sbjct  1    MAKISFFIGIIGNIISLLVFTSPIKTFWKVVKRKSTENYKGAPYITTLLSTSLWTFYGIL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  L+V       +   + YV+LFL+YAP++ KI++ K+V I+N  FLG V+A+TL  +
Sbjct  61   KPDILVVTVNGAGAIF-QLTYVTLFLMYAPRDKKIKTAKLVAILNAGFLGVVIAITLLAM  119

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +   VG+LC  LTIGMYA+PLSAM+ VI+ +SV+YMPF+LSFF  LNGG+W+ YA+
Sbjct  120  HGSLQTTFVGVLCAALTIGMYAAPLSAMKRVIRTRSVQYMPFFLSFFLFLNGGVWSVYAV  179

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK-EEEDPAHL-VKGGIEM----ANDV  802
            LV+D YIG+PN +GF+LGSAQ+ILY IY   + A  EE+ P H+  K G+EM     NDV
Sbjct  180  LVKDYYIGVPNVVGFVLGSAQLILYIIYRNKSAAMIEEKGPVHIEAKEGVEMPAKGDNDV  239

Query  803  AFKSNGKDPSEARAHT  850
                N K  S A   T
Sbjct  240  EAAGNLKSRSLAEGKT  255



>ref|XP_003561653.1| PREDICTED: bidirectional sugar transporter SWEET16 [Brachypodium 
distachyon]
 ref|XP_010228639.1| PREDICTED: bidirectional sugar transporter SWEET16 [Brachypodium 
distachyon]
 ref|XP_010228640.1| PREDICTED: bidirectional sugar transporter SWEET16 [Brachypodium 
distachyon]
 ref|XP_010228641.1| PREDICTED: bidirectional sugar transporter SWEET16 [Brachypodium 
distachyon]
Length=312

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 177/249 (71%), Gaps = 11/249 (4%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            A  SF VGI+GN+ISIL+F +P+ TF+R+V+ KSTE F+ +PY+TTLL+TSLW+FYGLLK
Sbjct  3    ADPSFFVGIVGNIISILVFTSPIGTFRRVVRNKSTEEFRWLPYVTTLLATSLWAFYGLLK  62

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            PGGLL+V VNG G  L  IYV L+L YAP+  KI+  K+V  +N+ F  AV+ V L  LH
Sbjct  63   PGGLLIVPVNGAGAALQAIYVVLYLAYAPRETKIKMAKVVLAVNIVFFAAVIVVGLVALH  122

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
            G  +L +VGLLC  LT+GMYA+P++AMRTV+K +SVEYMPF+LSFF  LNGGIW+ Y+ML
Sbjct  123  GAVRLFAVGLLCAALTVGMYAAPMAAMRTVVKTRSVEYMPFFLSFFLFLNGGIWSVYSML  182

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQS----------TPAKEEEDPAHLVKGGIEMA  793
            V+D +IGIPN IGF +GSAQ++LY  Y                 EE+   HL+ G +E++
Sbjct  183  VKDYFIGIPNAIGFAMGSAQLVLYMAYRNKKKAAAGALKVDEEDEEKGVVHLM-GQVELS  241

Query  794  NDVAFKSNG  820
               A    G
Sbjct  242  QRKASLKKG  250



>ref|XP_006651362.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET16-like [Oryza brachyantha]
Length=328

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 179/240 (75%), Gaps = 8/240 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VGI+GNVISIL+F +P+ TF+RIV+ KSTE F+ +PY+TTLL TSLW+FYGLL
Sbjct  1    MADPSFFVGIVGNVISILVFASPIGTFRRIVRSKSTEEFRWLPYVTTLLCTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+VTVNG G  L  +YV+L+L YAP+  K +  K+V  +NV  L AVVAV L+ L
Sbjct  61   KPGGLLIVTVNGAGAALEAVYVALYLAYAPRETKAKMGKVVLAVNVGALAAVVAVALTAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYA+P++AMRTV+K +SVEYMPF LSFF  LNGG+W+ Y++
Sbjct  121  HGGVRLFVVGVLCAALTIGMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPA-----KEEEDPAHLVK---GGIEMAN  796
            LV+D +IG+PN IGF LG+AQ+ LY  Y +  PA     +E+E+ A  V    G +EMA 
Sbjct  181  LVKDFFIGVPNAIGFALGTAQLALYMAYRRKKPAAARKGEEDEEEAQGVARLIGQVEMAQ  240



>ref|XP_004296854.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Fragaria 
vesca subsp. vesca]
Length=241

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 170/232 (73%), Gaps = 5/232 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+LSF VG+IGN+IS+LMFLAPV TF RIV+ +STE F  +PY+ T L++ LW++YG++
Sbjct  1    MAALSFYVGVIGNLISVLMFLAPVYTFARIVKNRSTEEFTSLPYVCTFLNSFLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GV+  I+Y+SLFL YA  N +  ++  + I++V F  A + VT   L
Sbjct  61   KPGAYLVSTVNGFGVLAEIVYISLFLTYATANKRANTVIWISILDVGFPAAAILVTWLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G T++ ++G L  GL I MYASPL+AM+TV+  KSVEYMPFWLSFF  LNGG+W  YA 
Sbjct  121  KGDTRISAIGFLGAGLNIIMYASPLAAMKTVVTTKSVEYMPFWLSFFFFLNGGVWLFYAW  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE---DPAHLVKGGIE  787
            L +D ++G+PNG+GFLLG+ Q++LY+IY +  PAK+E+     A LV+ G E
Sbjct  181  LEQDYFLGVPNGMGFLLGAVQLVLYWIYKK--PAKKEDKSLSSALLVEEGSE  230



>ref|XP_002467883.1| hypothetical protein SORBIDRAFT_01g035840 [Sorghum bicolor]
 gb|EER94881.1| hypothetical protein SORBIDRAFT_01g035840 [Sorghum bicolor]
Length=329

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 181/259 (70%), Gaps = 19/259 (7%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M + SF+VGI GNVISIL+F +P+ TF+RIV+ KST +F  +PY+TTLLSTSLW+FYGLL
Sbjct  1    MTTPSFLVGIAGNVISILVFASPIATFRRIVRNKSTGDFTWLPYVTTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP GLLVVTVNG G  L  +YV+L+L+YAP+  K +  K+V  +NV FL  VVAV L  L
Sbjct  61   KPKGLLVVTVNGAGAALEAVYVTLYLVYAPRETKAKMGKLVLAVNVGFLAVVVAVALLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L +VGLLC  +TIGMYA+PL +MRTV+K +SVEYMPF LSFF  LNGG+W+ Y++
Sbjct  121  HGGARLDAVGLLCAAITIGMYAAPLGSMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK------------------EEEDPAH  766
            LVRD +IG+PN +GF+LG+AQ++LY  +      +                  EEE  AH
Sbjct  181  LVRDYFIGVPNAVGFVLGTAQLVLYLAFRNKAAERKDDDDEKEAAAAAPSSGDEEEGLAH  240

Query  767  LVKGGIEMANDVAFKSNGK  823
            L+ G  ++  ++  +  G+
Sbjct  241  LM-GPPQVEMEMTAQQRGR  258



>ref|XP_007035630.1| Nodulin MtN3 family protein [Theobroma cacao]
 gb|EOY06556.1| Nodulin MtN3 family protein [Theobroma cacao]
Length=237

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M   SFIVG++GNVIS+L+FL+P+ TF RI++++STE+F+ +PYI TLL++SLW++YG+ 
Sbjct  1    MVGSSFIVGVVGNVISVLVFLSPIGTFWRIIKRQSTEDFESLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV TVNG G+++  +YV LFLIYAPK +++++  +VGI++V FL A + VT   L
Sbjct  61   KPGGLLVATVNGFGILVEAVYVVLFLIYAPKKMRVKTGILVGILDVGFLAAAIVVTQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T++ ++G +C GL I MY SPL+AM+TV+  KSVEYMPF+LSFF  LNGGIWA YA+
Sbjct  121  TGETRIDAIGFMCAGLNIIMYGSPLAAMKTVVTTKSVEYMPFFLSFFLFLNGGIWAFYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKG  778
            LV+D ++GIPNGIGFLLG+AQ++LY IY    P+        + +G
Sbjct  181  LVQDYFLGIPNGIGFLLGTAQLLLYAIYRNGKPSSNNISEGLMEQG  226



>ref|XP_009136730.1| PREDICTED: bidirectional sugar transporter SWEET17 [Brassica 
rapa]
Length=240

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 167/234 (71%), Gaps = 8/234 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV++KSTE++K +PYI TLL +SLW++YG++
Sbjct  1    MAETSFYIGVIGNVISVLVFLSPVETFWKIVKRKSTEDYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G  + IIYVSLFLIYAP+++K+ ++ +V ++NV F  A +A T S  
Sbjct  61   TPGEYLVSTVNGFGSFVEIIYVSLFLIYAPRHLKLNTIVVVALLNVFFPIAAIAATRSAF  120

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +C GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  KDEKMRSQSMGFICAGLNIVMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
             L  D+++ +PNG+GF+ G+ Q+ILY IY           PA L  G  E+A D
Sbjct  181  SLQHDVFLLVPNGVGFVFGTIQLILYGIY-------RNAKPAGLSNGSSEIAAD  227



>ref|XP_009352289.1| PREDICTED: bidirectional sugar transporter SWEET17 [Pyrus x bretschneideri]
Length=239

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 169/226 (75%), Gaps = 0/226 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGN+IS+LMFLAPV TF RIV+ +STE+F+ +PY+ TLL++SLW++YG++
Sbjct  1    MEGLSFFVGVIGNIISVLMFLAPVPTFWRIVKHRSTEDFQSLPYVCTLLNSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG LLV TVNG G  + IIY+ LFLIYAP+ +++++  ++G ++V FL   +  T   L
Sbjct  61   KPGELLVATVNGFGATVEIIYLCLFLIYAPEKMRVKTAILIGTLDVGFLAVAILATWLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G T++ ++G +C GL I MY SPL AM+TV+  KSVEYMPF+LSFF  LNGG+W  YA 
Sbjct  121  LGDTRIDAIGFICAGLNIIMYGSPLVAMKTVVTTKSVEYMPFFLSFFFFLNGGVWTFYAW  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKG  778
            L +D+++G+PNGIGFLLG+ Q++LY IY  + P+ +  D   L +G
Sbjct  181  LFQDVFLGVPNGIGFLLGTTQLVLYAIYRNAKPSNQISDGEQLEEG  226



>ref|XP_009786119.1| PREDICTED: uncharacterized protein LOC104234284 [Nicotiana sylvestris]
Length=398

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  SILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgv  325
             +LMF+AP+KTFKRI+QKKSTE+FKGIPYIT LLSTSLW+FYGLLKPGGLLVV VNGT  
Sbjct  7    DVLMFVAPIKTFKRIIQKKSTEDFKGIPYITALLSTSLWTFYGLLKPGGLLVVIVNGTSA  66

Query  326  vlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTG  505
            +LHI+YV+LFLIYAPK +K +SLK+V II++AFLGAV+ +TL  +HG T+L  VGLL  G
Sbjct  67   ILHIVYVTLFLIYAPKILKNQSLKLVEIIDIAFLGAVIEITLLAVHGNTQLTLVGLLAAG  126

Query  506  LTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIG  664
            L I MYAS LSA+RTVIKMKSVEYMPF+LSFFQ LNGG+WA+Y +LV+D YIG
Sbjct  127  LNIVMYASLLSAVRTVIKMKSVEYMPFFLSFFQFLNGGVWAAYEVLVKDYYIG  179



>emb|CDX90555.1| BnaA03g42260D [Brassica napus]
Length=240

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 166/234 (71%), Gaps = 8/234 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV++KSTE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRKSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G  + IIYVSLFLIYAP+++K+ ++ +V ++NV F  A +A T S  
Sbjct  61   TPGEYLVSTVNGFGSFVEIIYVSLFLIYAPRHLKLNTIVVVALLNVFFPIAAIAATRSAF  120

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +C GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  KDEKMRSQSMGFICAGLNIVMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
             L  D+++ +PNG+GF+ G+ Q+ILY IY           PA L  G  E+A D
Sbjct  181  SLQHDVFLLVPNGVGFVFGTIQLILYGIY-------RNAKPAGLSNGSSEIAAD  227



>ref|NP_001288522.1| bidirectional sugar transporter SWEET16 [Zea mays]
 gb|ACG38480.1| cytochrome c oxidoreductase [Zea mays]
Length=317

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF+VGI+GNVISIL+F +P+ TF+RIV+ +STE+F+ +PY+TTLLSTSLW+FYGLL
Sbjct  1    MADPSFLVGIVGNVISILVFASPIATFRRIVRSRSTEDFRWLPYVTTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG LLVVTVNG G  L   YV+L+L+YAP+  K +  K+V  +NVAFL AVVAV L  L
Sbjct  61   KPGCLLVVTVNGAGAALEAAYVALYLVYAPRETKAKMAKVVVAVNVAFLAAVVAVALLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L +VGLLC  LT+GMYA+PL AMRTV+K +SVEYMPF LSFF  LNGG+W+ Y++
Sbjct  121  HGGARLFAVGLLCAALTVGMYAAPLGAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSIYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
            LV+D +IG+PN IG +LG+AQ++LY  Y ++  +K
Sbjct  181  LVKDYFIGVPNAIGLVLGTAQLLLYLAYRKAPASK  215



>emb|CDY09729.1| BnaC07g33320D [Brassica napus]
Length=240

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 167/234 (71%), Gaps = 8/234 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV++KSTE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRKSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G ++ IIYVSLFL YAP+++K+ ++ +V ++NV F  A +A T S  
Sbjct  61   TPGEYLVSTVNGFGSLVEIIYVSLFLFYAPRHLKLNTIVVVALLNVFFPIAAIAATRSAF  120

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +C GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  KDEKMRSQSMGFICAGLNIIMYGSPLSAMKTVVATKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
             L  D+++ +PNG+GF+ G+ Q+ILY IY  +        PA L  G  E+A D
Sbjct  181  SLQHDVFLLVPNGVGFVFGTIQLILYGIYRNA-------KPAGLSNGSSEIAED  227



>tpg|DAA45288.1| TPA: cytochrome c oxidoreductase [Zea mays]
Length=317

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF+VGI+GNVISIL+F +P+ TF+RIV+ +STE+F+ +PY+TTLLSTSLW+FYGLL
Sbjct  1    MADPSFLVGIVGNVISILVFASPIATFRRIVRSRSTEDFRWLPYVTTLLSTSLWTFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLVVTVNG G  L   YV+L+L+YAP+  K +  K+V  +NVAFL AVVAV L  L
Sbjct  61   KPGGLLVVTVNGAGAALEAAYVALYLVYAPRETKAKMAKVVVAVNVAFLAAVVAVALLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L +VGLLC  LT+GMYA+PL AMRTV+K +SVEYMPF LSFF  LNGG+W+ Y++
Sbjct  121  HGGARLFAVGLLCAALTVGMYAAPLGAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSIYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
            LV+D +IG+PN IG +LG+AQ++LY  Y ++  +K
Sbjct  181  LVKDYFIGVPNAIGLVLGTAQLLLYLAYRKAPASK  215



>ref|XP_007031029.1| Nodulin MtN3 family protein [Theobroma cacao]
 gb|EOY11531.1| Nodulin MtN3 family protein [Theobroma cacao]
Length=245

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 164/216 (76%), Gaps = 1/216 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSFIVG++GN+IS+L+FL+PV TF+R+++ +STE F+ +PYI TLL+++LW++YG+ 
Sbjct  1    MTRLSFIVGVVGNIISVLLFLSPVGTFRRVLRNRSTEEFESLPYICTLLNSALWTYYGVT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GVV+ +IYV+LFLI+AP  ++ ++  + G+++V F  A V  T  +L
Sbjct  61   KPGSFLVATVNGFGVVVEMIYVTLFLIFAPPTMRAKTGMLFGLLDVGFPAATVLATQLIL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G  ++  +G LC GL I MY SPL+AM+TV+  KSVEYMPF LSFF  LNG +W  YA+
Sbjct  121  KGDLRIDVIGFLCAGLNIVMYGSPLAAMKTVVTTKSVEYMPFLLSFFVFLNGVVWTFYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIY-YQSTPAK  745
            LV D ++G+PNGIGFLLG+AQ++LY IY  +  P+K
Sbjct  181  LVEDYFLGVPNGIGFLLGTAQLLLYAIYSRRQRPSK  216



>ref|NP_001050071.2| Os03g0341300 [Oryza sativa Japonica Group]
 sp|Q10LN5.1|SWT16_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET16; Short=OsSWEET16 
[Oryza sativa Japonica Group]
 gb|ABF95863.1| MtN3/saliva family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59038.1| hypothetical protein OsJ_10795 [Oryza sativa Japonica Group]
 dbj|BAF11985.2| Os03g0341300 [Oryza sativa Japonica Group]
Length=328

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VGI+GNVISIL+F +P+ TF+RIV+ KSTE F+ +PY+TTLLSTSLW+FYGL 
Sbjct  1    MADPSFFVGIVGNVISILVFASPIATFRRIVRSKSTEEFRWLPYVTTLLSTSLWTFYGLH  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+VTVNG+G  L  IYV+L+L YAP+  K + +K+V  +NV  L AVVAV L  L
Sbjct  61   KPGGLLIVTVNGSGAALEAIYVTLYLAYAPRETKAKMVKVVLAVNVGALAAVVAVALVAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYA+P++AMRTV+K +SVEYMPF LSFF  LNGG+W+ Y++
Sbjct  121  HGGVRLFVVGVLCAALTIGMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQS  733
            LV+D +IGIPN IGF LG+AQ+ LY  Y ++
Sbjct  181  LVKDYFIGIPNAIGFALGTAQLALYMAYRRT  211



>ref|XP_006433449.1| hypothetical protein CICLE_v10001944mg [Citrus clementina]
 gb|ESR46689.1| hypothetical protein CICLE_v10001944mg [Citrus clementina]
Length=231

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSF VGIIGNVIS+L+F +P+KTF +IV+KKSTE++KG+PYITTL+STSLW+FYG++
Sbjct  1    MASLSFFVGIIGNVISLLVFASPIKTFWQIVKKKSTESYKGVPYITTLMSTSLWTFYGVM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV TVNG G  L  IYVSL+LIYAPK+ K+++ K+V I++V FLGAV+A+TL  +
Sbjct  61   KPGGLLVATVNGAGAALQFIYVSLYLIYAPKDKKVKTAKLVAILDVGFLGAVIAITLLAM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYASPL+ M TVI+ KSV+YMPF LSFF  LN G+W+ Y++
Sbjct  121  HGNLRLTFVGILCAALTIGMYASPLAVMTTVIRTKSVKYMPFLLSFFLFLNAGVWSVYSV  180

Query  641  LVRDLYIGI  667
            LV+D+YIG+
Sbjct  181  LVKDIYIGV  189



>ref|XP_009107869.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Brassica 
rapa]
Length=240

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 165/225 (73%), Gaps = 1/225 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G++GNVIS+L+FL+PV+TF +IV++KSTE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEASFYIGVVGNVISVLVFLSPVETFWKIVKRKSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G ++ IIYVSLF++YAP+++K+ ++ +V ++NV F  A +A T S  
Sbjct  61   TPGEYLVSTVNGFGALVEIIYVSLFVLYAPRHLKLHTIVVVSMLNVLFPIAAIAATRSAF  120

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               KT+  S+G +C GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IW  YA
Sbjct  121  KDEKTRSQSMGFICAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWTVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLV  772
             L  D+++ +PNG+GF+ G+ Q+ILY IY  + P    +  + +V
Sbjct  181  SLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGSRKGSSDIV  225



>gb|EEC75233.1| hypothetical protein OsI_11516 [Oryza sativa Indica Group]
Length=331

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VGI+GNVISIL+F +P+ TF+RIV+ KSTE F+ +PY+TTLLSTSLW+FYGL 
Sbjct  1    MADPSFFVGIVGNVISILVFASPIATFRRIVRSKSTEEFRWLPYVTTLLSTSLWTFYGLH  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+VTVNG+G  L  IYV+L+L YAP+  K + +K+V  +NV  L AVVAV L  L
Sbjct  61   KPGGLLIVTVNGSGAALEAIYVTLYLAYAPRETKAKMVKVVLAVNVGALAAVVAVALVAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYA+P++AMRTV+K +SVEYMPF LSFF  LNGG+W+ Y++
Sbjct  121  HGGVRLFVVGVLCAALTIGMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQS  733
            LV+D +IGIPN IGF LG+AQ+ LY  Y ++
Sbjct  181  LVKDYFIGIPNAIGFALGTAQLALYMAYRRT  211



>ref|XP_010674140.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Beta 
vulgaris subsp. vulgaris]
Length=223

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 166/218 (76%), Gaps = 2/218 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSFI+G+IGN+IS+L+FL+P+ TF RIV+KKST+ F+ +PY+ TLLST LW++YG++
Sbjct  1    MDKLSFIIGVIGNIISVLLFLSPLNTFIRIVRKKSTDGFESMPYVCTLLSTCLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            +PG LLV TVNG G ++ ++YV+LF+ +AP  +K ++ K+  I++V FLGAV+ ++  +L
Sbjct  61   RPGALLVATVNGFGALVELVYVALFITFAPPTMKAKTAKLAAILDVGFLGAVILISNLML  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T++  +G +  GL I MY SPL A++TVIK +SVEYMPF LS F  LNGGIW  YA 
Sbjct  121  EGETRINMIGTIGAGLNIIMYGSPLVALKTVIKTRSVEYMPFLLSLFSFLNGGIWTVYAA  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE  754
            LV+D ++ +PN IGF+LG+ Q+++Y  Y    P+KE++
Sbjct  181  LVKDFFLLVPNAIGFILGTIQLVVYVCYMN--PSKEQQ  216



>ref|XP_008360271.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Malus 
domestica]
Length=283

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = +2

Query  86   LEGPV----MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLST  253
            L GP     M  LSF VG+IGN+IS+LMFLAPV TF RIV+ +STE+F+ +PY+ TLL++
Sbjct  36   LRGPSNSINMEGLSFFVGVIGNIISVLMFLAPVPTFWRIVKHRSTEDFESLPYVCTLLNS  95

Query  254  SLWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGA  433
            SLW++YG++K G LLV T+NG G  + IIY+ LFL YAP  ++++++ ++G ++V FL  
Sbjct  96   SLWTYYGIIKSGELLVATINGFGATVEIIYLCLFLKYAPAKMRVKTVILIGTLDVGFLAV  155

Query  434  VVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLN  613
             +  T   L G T++ ++G +C GL I MYASPL  M+TV+  KSVEYMPF+LSFF  +N
Sbjct  156  AILATWLALVGDTRIDAIGFICAGLNIIMYASPLVVMKTVVTTKSVEYMPFFLSFFFFIN  215

Query  614  GGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKG  778
            GG+W  YA L++D+++G+PNGIGFLLG+ Q++LY IY  + P+ +  D   L +G
Sbjct  216  GGVWTFYAWLLQDVFLGVPNGIGFLLGTTQLVLYAIYRNAKPSNQISDGEQLEEG  270



>ref|XP_010259507.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X2 [Nelumbo nucifera]
Length=318

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 173/268 (65%), Gaps = 58/268 (22%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSFIVGIIGN+ISIL+F +P+ TF+R+V+KKSTE+FKG+PYI TLLSTSLWSFYGLL
Sbjct  54   MASLSFIVGIIGNIISILVFTSPIGTFRRVVKKKSTESFKGLPYICTLLSTSLWSFYGLL  113

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+VTVNGTG VL  IYV+LFLIYAPK+ K++ +K+V ++NV  LG V+AVTL  +
Sbjct  114  KPGGLLIVTVNGTGAVLQFIYVTLFLIYAPKDTKVKLMKLVALLNVGCLGLVIAVTLLAI  173

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG LC GLT+GMYASPL AM                                
Sbjct  174  HGSLRLTVVGFLCAGLTLGMYASPLVAM--------------------------------  201

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQ------STPAKEEEDPAHLVKGGIEMA---  793
                    +PN IGF+LGSAQ+ILY +Y +      ST AKEEE  AHLV+G +EM+   
Sbjct  202  --------VPNAIGFVLGSAQLILYAVYRRKSASQKSTEAKEEEGSAHLVRGNVEMSEYE  253

Query  794  NDVAFKSNGKD---------PSEARAHT  850
            +   FK+  +           S AR H+
Sbjct  254  DSSEFKTKNRSLNKGMSLPKSSVARQHS  281



>ref|XP_011003911.1| PREDICTED: bidirectional sugar transporter SWEET17 isoform X1 
[Populus euphratica]
Length=238

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 166/219 (76%), Gaps = 0/219 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M SL F +G+IGNVIS+ MFL+PV TF RI++ +STE+F+ +PY+ TLLS+SLW++YG++
Sbjct  1    MESLIFYIGVIGNVISVFMFLSPVGTFWRIIKHRSTEDFESLPYVCTLLSSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG G+V+ IIYVSLFLIYAP  ++ ++  + GI+++  L AV+  T   L
Sbjct  61   KPGAYLVATVNGFGIVVEIIYVSLFLIYAPVKMRNKTAILAGILDMGVLAAVILATRLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG+ ++ ++G +C GL I MY SPL+AM+TV+  KSVEYMPF+LSFF  LNGGIW  YA+
Sbjct  121  HGEVRIDAIGFMCAGLNIIMYGSPLAAMKTVVTTKSVEYMPFFLSFFFFLNGGIWTFYAI  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            L +D ++G+PNG GFLLG AQ++LY IY  + P+    +
Sbjct  181  LTQDYFLGVPNGAGFLLGIAQLVLYVIYMNAKPSSNVSE  219



>ref|XP_002269234.1| PREDICTED: bidirectional sugar transporter SWEET17 isoform X1 
[Vitis vinifera]
 emb|CBI22993.3| unnamed protein product [Vitis vinifera]
Length=233

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 168/216 (78%), Gaps = 0/216 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M SLSF  G+IGN+IS+L+FLAP+ TF RIV+ +ST++F+ +PY+ TLL++SLW++YG++
Sbjct  1    MESLSFFAGVIGNIISVLVFLAPIGTFWRIVKHRSTQDFESLPYVCTLLNSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG +LV TVNG GVV+   YV+LFLIYAP  ++ +++ +V +++V FL A + VT   L
Sbjct  61   KPGEILVATVNGFGVVVEAAYVTLFLIYAPAKMRAKTVALVSLLDVGFLAAAILVTRLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G T++ ++G +C+GL I MY SPL+AM+TV+  KSVE+MPF+LSFF  LNGGIW  YA+
Sbjct  121  QGDTRIDALGFICSGLNIVMYGSPLAAMKTVVTTKSVEFMPFFLSFFLFLNGGIWTIYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE  748
            LVRD ++ +PNG G +LG+AQ++LY IY  S P+ +
Sbjct  181  LVRDYFLAVPNGTGLVLGTAQLVLYAIYRNSKPSNK  216



>gb|AHG94617.1| sugar transporter [Camellia sinensis]
Length=240

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGN++S+L+FL+P+ TF R+++ +STE F+ +PYI TLL++SLW++YG+ 
Sbjct  1    MEGLSFFVGVIGNIVSVLVFLSPIGTFWRVIKHRSTEEFESLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG +LV TVNG G+V+  +YV+LFLIYAPK ++ ++  +VGI++V  L   +AVT   +
Sbjct  61   KPGEILVATVNGFGIVVEAVYVTLFLIYAPKGMRAKTAILVGILDVGLLAVAIAVTQLAM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            +   ++ ++G +   L I MYASPL+AM+TV+  KSVEYMPF+LSF   LNGGIWA YA+
Sbjct  121  NRDVRIDAIGFMGAALNIIMYASPLAAMKTVVTTKSVEYMPFFLSFTLFLNGGIWAFYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEE  751
            LV DL++G+PNG GF+LG AQ++LY IY +  P+++ 
Sbjct  181  LVHDLFLGVPNGTGFILGIAQLVLYAIYIE-MPSQQR  216



>gb|AAO22792.1| putative cytochrome c oxidoreductase [Arabidopsis thaliana]
Length=241

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 167/230 (73%), Gaps = 11/230 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G ++  IYVSLFL YAP+++K++++ +V ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVVVVAMLNVFFPIAAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP----------AKEEED  757
            +L  D+++ +PNG+GF+ G+ Q+ILY IY  + P          A++EE+
Sbjct  181  LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEE  230



>ref|XP_011092095.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Sesamum 
indicum]
Length=239

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L F+VG IGN+IS L+FL+PVKTF RI +  STE F  +PYI TLLS+SLW++YG++
Sbjct  1    MDGLVFLVGFIGNIISFLVFLSPVKTFVRIAKSGSTEEFDSLPYICTLLSSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV T+NG GVV+ IIYV+LFL++AP   K R+  ++G++++ F  A ++VT  +L
Sbjct  61   KPGSYLVATINGFGVVVEIIYVALFLLFAPPWNKRRTAILLGVVDIGFFAAALSVTYLLL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  ++ ++G +C+GL I MYASPL+AM+TV+  KSVEYMPF L FF  LNGG+W  YA+
Sbjct  121  HGDMRINAIGFMCSGLNIIMYASPLAAMKTVVTTKSVEYMPFLLFFFFFLNGGVWTFYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEE  751
            LV+D ++G+PNG GF+LG+ Q++LY IY  S P K  
Sbjct  181  LVKDWFLGVPNGTGFVLGTLQLVLYAIYTNSRPQKHS  217



>ref|NP_193327.5| bidirectional sugar transporter SWEET17 [Arabidopsis thaliana]
 gb|AEE83666.1| bidirectional sugar transporter SWEET17 [Arabidopsis thaliana]
Length=241

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 166/230 (72%), Gaps = 11/230 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G ++  IYVSLFL YAP+++K++++ +  ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVDVEAMLNVFFPIAAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP----------AKEEED  757
            +L  D+++ +PNG+GF+ G+ Q+ILY IY  + P          A++EE+
Sbjct  181  LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEE  230



>gb|EMS55881.1| Bidirectional sugar transporter SWEET16 [Triticum urartu]
Length=351

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 172/246 (70%), Gaps = 11/246 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VGIIGN+ISIL+F +P+     +V+ KSTE F+ +PY+TTLL TSLW+FYGLL
Sbjct  1    MADPSFFVGIIGNIISILVFTSPM-----VVRNKSTEEFRWLPYVTTLLCTSLWAFYGLL  55

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL++TVN  G  L   YV+L+L YAP++ K++  K+V  +N+ F  AVV V L  L
Sbjct  56   KPGGLLIITVNAAGAALQATYVALYLAYAPRDTKVKMAKVVVGVNICFFAAVVVVGLVAL  115

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L +VG+LC+ LTI MYA+P+ AMRTV+K +SVEYMPF LSFF  LNGGIW+ Y++
Sbjct  116  HGAVRLFAVGVLCSALTIAMYAAPMVAMRTVVKTRSVEYMPFSLSFFLFLNGGIWSVYSL  175

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP--AKEEEDPAHLVKGGIEMANDVAFKS  814
            LV+D +IGIPN +GF++G+AQ+ LY  Y       A +EED     KG + +   V    
Sbjct  176  LVKDYFIGIPNAMGFVMGTAQLALYMAYRNKKKLVALKEEDEE---KGAVHLMGQVEL-G  231

Query  815  NGKDPS  832
              K PS
Sbjct  232  QAKVPS  237



>sp|Q84WN3.2|SWT17_ARATH RecName: Full=Bidirectional sugar transporter SWEET17; Short=AtSWEET17 
[Arabidopsis thaliana]
Length=241

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 166/230 (72%), Gaps = 11/230 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G ++  IYVSLFL YAP+++K++++ +  ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVDVDAMLNVFFPIAAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP----------AKEEED  757
            +L  D+++ +PNG+GF+ G+ Q+ILY IY  + P          A++EE+
Sbjct  181  LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEE  230



>ref|XP_010434908.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Camelina 
sativa]
Length=241

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 164/234 (70%), Gaps = 8/234 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G  +  IYVSLFL YAP+++K+ ++ +V ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGAFVETIYVSLFLFYAPRHLKLNTIIVVAMLNVFFPIVAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
             L  D+++ +PNG+GF+ G+ Q+ILY IY           P  L  GG E+A D
Sbjct  181  SLQHDVFLLVPNGVGFVFGTMQLILYGIY-------RNAKPVGLSNGGSEIAQD  227



>ref|XP_002868174.1| hypothetical protein ARALYDRAFT_493293 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44433.1| hypothetical protein ARALYDRAFT_493293 [Arabidopsis lyrata subsp. 
lyrata]
Length=241

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 166/230 (72%), Gaps = 11/230 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG+ 
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIA  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G ++  IYVSLFL YAP+++K+ ++ +V ++NV F + A+VA  ++ 
Sbjct  61   TPGEYLVSTVNGFGAIVETIYVSLFLFYAPRHLKLNTVVVVAMLNVFFPIAAIVATRIAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  KDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP----------AKEEED  757
            +L  D+++ +PNG+GF+ G+ Q+ILY IY  + P          +++EE+
Sbjct  181  LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEISQDEEE  230



>gb|EMT14265.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=299

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 174/237 (73%), Gaps = 5/237 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VGI+GN+ISIL+F +P+ TF+R+V+ KSTE F+ +PY+TTLL TSLW+FYGLL
Sbjct  1    MADPSFFVGIVGNIISILVFTSPIATFRRVVRNKSTEEFRWLPYVTTLLCTSLWAFYGLL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP GLL++TVN  G  L   YV+L+L YAP++ K++  K+V  +N+ F  AVV V L  L
Sbjct  61   KPSGLLIITVNAAGAALQATYVALYLAYAPRDTKVKMAKVVVGVNICFFAAVVVVGLVAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L +VG+LC+ LTI MYA+P++AMRTV+K +SVEYMPF LSFF  LNGGIW+ Y++
Sbjct  121  HGAVRLFAVGVLCSALTIAMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGIWSVYSL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQS---TPAKEEEDPAHLVK--GGIEMAN  796
            LV+D +IGIPN +GF++G+AQ+ LY  Y         KEE++   +V   G +E+  
Sbjct  181  LVKDYFIGIPNAMGFVMGTAQLALYMAYQNKKKLAALKEEDEEKGVVHLMGQVELGQ  237



>gb|KFK33806.1| hypothetical protein AALP_AA5G062600 [Arabis alpina]
Length=241

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 157/212 (74%), Gaps = 1/212 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+P +TF +IV++KSTE +K +PYI TLLS+SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPAETFWKIVKRKSTEEYKSLPYICTLLSSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G ++  IYVSLFL YAP+NIK+ ++ +V ++NV F  A +A T S  
Sbjct  61   TPGEYLVSTVNGFGALVETIYVSLFLFYAPRNIKLNTILVVVMLNVFFPIAAIAATRSAF  120

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +C GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IW  YA
Sbjct  121  KDEKMRYQSMGFICAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGVIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQS  733
             L  D+++ +PNG+GF+ G+ Q+ILY IY  +
Sbjct  181  SLQHDVFLLVPNGVGFVFGTMQLILYGIYRNA  212



>ref|XP_010524542.1| PREDICTED: bidirectional sugar transporter SWEET17 [Tarenaya 
hassleriana]
Length=242

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVISIL+FL+PV+TF RIV++++TE ++ +PY+ TLL +SLW++YG++
Sbjct  1    MADLSFYVGVIGNVISILVFLSPVETFWRIVRRRTTEEYRSLPYVCTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G ++ + YVSLFL++ P   K+ +  +VG++NV F    +A T +  
Sbjct  61   TPGEYLVATVNGFGAIVELFYVSLFLLFVPPPYKLNTALLVGMLNVFFPATAIAATRTAF  120

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               KT+  ++G +C GL I MYASPLSAM+TV+K KSV YMPFWLSFF  LNG IWA YA
Sbjct  121  KDEKTRSHAMGFICAGLNIIMYASPLSAMKTVVKTKSVRYMPFWLSFFLFLNGAIWAIYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
             L+ D+++ +PNG+GF+LG+ Q+ILY IY  + P    + 
Sbjct  181  SLLHDVFLLVPNGVGFVLGTMQLILYGIYRNAKPINRTQS  220



>emb|CDP17203.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L   VGIIGN+IS+LMFL+P KTF RIV++KSTE+F+ +PYI TLL++SLW++YG+ 
Sbjct  1    METLILFVGIIGNIISVLMFLSPAKTFWRIVKRKSTEDFESLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            +PG  LV TVNG GVV+ IIYVSLFLI+AP  +K ++  + G ++V FL A +  T  + 
Sbjct  61   RPGSYLVATVNGFGVVVEIIYVSLFLIFAPPKMKGKTAVLAGALDVGFLAAAILATQFLT  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G T++  +G + +GL I MY SPL+AM+TV+  KSVEYMPF LSFF  LNGGIW  YA+
Sbjct  121  TGDTRIDVIGYMSSGLNIIMYGSPLAAMKTVVTTKSVEYMPFLLSFFLFLNGGIWTIYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPA  742
            LV+D ++G+PNGIGF+LG+AQ++LY IY  + P+
Sbjct  181  LVQDWFLGVPNGIGFVLGTAQLVLYAIYRNAKPS  214



>ref|XP_010449877.1| PREDICTED: bidirectional sugar transporter SWEET17-like isoform 
X1 [Camelina sativa]
Length=241

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 164/230 (71%), Gaps = 11/230 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G  +  IYVSLFL YAP+++K+ ++ +V ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGAFVETIYVSLFLFYAPRHLKLNTIIVVAMLNVFFPIVAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP----------AKEEED  757
             L  D+++ +PNG+GF+ G+ Q+ILY IY  + P          A++EE+
Sbjct  181  SLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGVSEIAQDEEE  230



>ref|XP_010440232.1| PREDICTED: bidirectional sugar transporter SWEET17 isoform X1 
[Camelina sativa]
Length=241

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 164/230 (71%), Gaps = 11/230 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G  +  IYVSLFL YAP+++K+ ++ +V ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGAFVETIYVSLFLFYAPRHLKLNTIIVVAMLNVFFPIVAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP----------AKEEED  757
             L  D+++ +PNG+GF+ G+ Q+ILY IY  + P          A++EE+
Sbjct  181  SLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGVSEIAQDEEE  230



>ref|XP_010259509.1| PREDICTED: bidirectional sugar transporter SWEET17-like isoform 
X1 [Nelumbo nucifera]
Length=248

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 167/225 (74%), Gaps = 5/225 (2%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
            S+ FI+G+IGN+IS+L+FL+P+ TF RIV+ +STE+F+ +PYI TLL+++LW++YG++KP
Sbjct  6    SVGFIIGVIGNIISVLVFLSPIGTFWRIVKNRSTEDFESLPYICTLLNSALWTYYGIVKP  65

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
            G +LV TVNG GVV   IY+ +FLI+AP  I+  +  ++GI++V  L A + VT   +HG
Sbjct  66   GAILVATVNGFGVVAETIYILIFLIFAPAKIRANTAILLGIMDVGSLAAAIGVTRFAMHG  125

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++  +G++C GL I MYASPL+ M+TV+  KSVEYMPF+LSFF  LNGG WA YA L+
Sbjct  126  DLRIDVIGIMCAGLNIVMYASPLAVMKTVVTTKSVEYMPFFLSFFLFLNGGTWAVYAALM  185

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EEDPAH  766
             D ++GIPNG GF+LG+AQ++LY IY  + P+K      EE   H
Sbjct  186  GDYFVGIPNGTGFILGAAQLMLYAIYRNAKPSKSKLERLEEGRQH  230



>gb|KDP27816.1| hypothetical protein JCGZ_18896 [Jatropha curcas]
Length=238

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 164/228 (72%), Gaps = 6/228 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L   VG+IGN+IS+LMFL+PV TF RI++ +STE+F+ +PY+ TLL+ +LW++YG++
Sbjct  1    MEGLILFVGVIGNIISVLMFLSPVGTFWRIIKNRSTEDFESVPYVCTLLNAALWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG G+++ II+V+LFLIYAP  +K ++  +VG+++V FL   + VT   L
Sbjct  61   KPGAFLVATVNGFGILVEIIFVTLFLIYAPPKMKAKTWILVGLLDVGFLATAIVVTRLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+ ++ + G +C+GL I MYASPL+ M+TV+  KSVE+MPF+LSFF  LNG +W  YA 
Sbjct  121  KGEVRIDATGFICSGLNIVMYASPLAVMKTVVTTKSVEFMPFFLSFFLFLNGAVWTLYAF  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE------EEDPAH  766
            L  D ++G+PNG GFLLG+AQ++LY IY  + PA        EE   H
Sbjct  181  LTSDYFLGVPNGTGFLLGTAQLVLYAIYRNAKPAPRNVSDGLEEGSQH  228



>gb|EYU37279.1| hypothetical protein MIMGU_mgv1a012972mg [Erythranthe guttata]
Length=234

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 164/226 (73%), Gaps = 6/226 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L+F+VG+IGN+IS+ MF++P  TF RIV+KKSTE F+ IPYI TLLS+ LW++YG+ 
Sbjct  1    MERLAFLVGVIGNIISVFMFVSPGMTFVRIVKKKSTEEFESIPYICTLLSSCLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVT-LSV  457
            KPG  LV TVNG GV++ II+V LFLI+AP + + ++  +VGI+N+  LG  + V    V
Sbjct  61   KPGSFLVATVNGFGVLVQIIFVVLFLIFAPPHKRGKTAVLVGIVNIGLLGGGITVCKYLV  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L  + ++  +GL+C+ L I MYASPLSAM+ +++ KSVEYMPF +SF   LNGGIW  YA
Sbjct  121  LDEELRIDIIGLMCSALNIVMYASPLSAMKRMVRRKSVEYMPFLVSFSLFLNGGIWTFYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIY-----YQSTPAKEEEDP  760
            +LV+D ++G+PN IG +LG+ Q+ILYFIY      ++T     +DP
Sbjct  181  VLVQDWFLGVPNAIGLMLGTLQLILYFIYKYLLSSKTTNCGCHKDP  226



>ref|XP_008223214.1| PREDICTED: bidirectional sugar transporter SWEET17 [Prunus mume]
Length=252

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 160/229 (70%), Gaps = 7/229 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L   +G+IGN+IS+LMFLAPV TF RIV+ +STE+F+ +PY+ T L++ LW++YG++
Sbjct  1    MEGLILFIGVIGNIISVLMFLAPVGTFWRIVKHRSTEDFESLPYVCTFLNSFLWTYYGII  60

Query  281  KPggllvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            +P G  +V       VV+ IIY+ LFL+YAP  ++ ++  ++G ++V FL A +  T   
Sbjct  61   RPNGGFLVATVNGFGVVVEIIYLILFLVYAPAKMRAKTAILIGTLDVGFLAAAILATWLA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L GKT++ ++G +C GL I MY SPL AM+TVI  KSVEYMPF+LSFF  LNGG+W  YA
Sbjct  121  LQGKTRIAALGFICAGLNILMYGSPLVAMKTVITTKSVEYMPFFLSFFFFLNGGVWTLYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE------EEDPAH  766
             L+RD+++G+PNGIGFLLG+ Q++LY IY  + PA        EE   H
Sbjct  181  WLIRDVFLGVPNGIGFLLGTTQLVLYAIYRNAKPADNISSGLLEEGRQH  229



>ref|XP_011003912.1| PREDICTED: bidirectional sugar transporter SWEET17 isoform X2 
[Populus euphratica]
Length=238

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 157/205 (77%), Gaps = 0/205 (0%)
 Frame = +2

Query  134  GNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvn  313
            GNVIS+ MFL+PV TF RI++ +STE+F+ +PY+ TLLS+SLW++YG++KPG  LV TVN
Sbjct  12   GNVISVFMFLSPVGTFWRIIKHRSTEDFESLPYVCTLLSSSLWTYYGIIKPGAYLVATVN  71

Query  314  gtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGL  493
            G G+V+ IIYVSLFLIYAP  ++ ++  + GI+++  L AV+  T   LHG+ ++ ++G 
Sbjct  72   GFGIVVEIIYVSLFLIYAPVKMRNKTAILAGILDMGVLAAVILATRLALHGEVRIDAIGF  131

Query  494  LCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPN  673
            +C GL I MY SPL+AM+TV+  KSVEYMPF+LSFF  LNGGIW  YA+L +D ++G+PN
Sbjct  132  MCAGLNIIMYGSPLAAMKTVVTTKSVEYMPFFLSFFFFLNGGIWTFYAILTQDYFLGVPN  191

Query  674  GIGFLLGSAQIILYFIYYQSTPAKE  748
            G GFLLG AQ++LY IY  + P+  
Sbjct  192  GAGFLLGIAQLVLYVIYMNAKPSSN  216



>ref|XP_004307262.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Fragaria 
vesca subsp. vesca]
Length=235

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 156/213 (73%), Gaps = 0/213 (0%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggll  298
            I G++GN++S L++L+P   F RI +++STE F+ IPY++ LL+   W +YG +KP  +L
Sbjct  8    IFGVLGNIMSGLVYLSPANVFVRIAKRRSTEEFESIPYVSKLLNAYFWVYYGFIKPNSVL  67

Query  299  vvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKL  478
            V TVN  G  + I+++++FL++AP  +KIR+  +V +++VAF GA + +T  +L G+T++
Sbjct  68   VATVNVFGAAVEIVFLTIFLLFAPPRMKIRTAILVVVLDVAFPGATILLTHFLLDGETRI  127

Query  479  MSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLY  658
               G+ C   ++  YASPLSAM+TV+ +KSVEYMPF LSF   LNGG+W  YA+L +DL+
Sbjct  128  DVAGIWCVIFSMIAYASPLSAMKTVVALKSVEYMPFLLSFILFLNGGVWTLYAILAKDLF  187

Query  659  IGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +GIPNG GFLLG+AQ+ILYFIY++   +K+  D
Sbjct  188  VGIPNGSGFLLGTAQLILYFIYWKPKSSKQASD  220



>gb|ADE76959.1| unknown [Picea sitchensis]
Length=335

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 183/249 (73%), Gaps = 2/249 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA +SFI+G++GNVIS+L+F++PVKTF RIV+ KST++FK +PYI TLLSTSLW++YGL+
Sbjct  1    MADVSFIIGVVGNVISLLLFISPVKTFWRIVKNKSTQDFKPLPYICTLLSTSLWTYYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+VTVNG G  L  +YV LF+ YA K  K++++ +V +++V F  AV  VT  VL
Sbjct  61   KPGGLLIVTVNGAGAALEAVYVILFIFYATKEHKLKTIVLVLLVDVVFFAAVFLVTFLVL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            +   +L+ VG LC  +T+ MY +PL+ MR+V+  KSVE+MPF+LSFF  LNGG+WA +A+
Sbjct  121  NQHIRLIVVGSLCVCVTLSMYVAPLAVMRSVMVTKSVEFMPFFLSFFLFLNGGVWAVWAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            L RD+++GIPNG GF LG+AQ+++  IY +  P +E      +   G ++  D+     G
Sbjct  181  LERDVFVGIPNGTGFGLGAAQLLVCMIYGKGKPRREGIREEDVKTEGFKLVGDIEM--GG  238

Query  821  KDPSEARAH  847
            +D +++++H
Sbjct  239  EDGADSKSH  247



>ref|XP_007227546.1| hypothetical protein PRUPE_ppa010394mg [Prunus persica]
 gb|EMJ28745.1| hypothetical protein PRUPE_ppa010394mg [Prunus persica]
Length=251

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 161/229 (70%), Gaps = 7/229 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L   +G+IGN+IS+LMFLAPV TF RIV+ +STE+F+ +PY+ T L++ LW++YG++
Sbjct  1    MEGLIIFIGVIGNIISVLMFLAPVGTFWRIVKHRSTEDFESLPYVCTFLNSFLWTYYGII  60

Query  281  KPggllvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            +P G L+V       VV+ IIY+ LFL+YAP  ++ ++  ++G ++V FL A +  T   
Sbjct  61   RPAGGLLVATVNGFGVVVEIIYLILFLVYAPAKMRAKTAILIGTLDVGFLVAAILATWLA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L G+T++ ++G +C GL I MY SPL AM+TVI  KSVEYMPF+LSFF  LNGG+W  YA
Sbjct  121  LQGETRIDALGFICAGLNIIMYGSPLVAMKTVITTKSVEYMPFFLSFFFFLNGGVWTLYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE------EEDPAH  766
             L+RD+++G+PNGIGFLLG+ Q++LY IY  + PA        EE   H
Sbjct  181  WLIRDVFLGVPNGIGFLLGTTQLVLYAIYRNAKPADNISSGLLEEGRQH  229



>ref|XP_009411666.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=245

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 170/244 (70%), Gaps = 5/244 (2%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggl  295
             +VG+IGN+IS+L+F +P+KTF RI +  STE+F+  PY+ TLLS+SLW +YG+ KPGGL
Sbjct  6    LVVGVIGNIISVLVFASPIKTFWRIARSGSTEDFESAPYVVTLLSSSLWVYYGITKPGGL  65

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
            LV TVNG GVV+  +YV+LFL++A   ++ ++  +V  ++V FLGAVV VT   +HG  +
Sbjct  66   LVATVNGVGVVMEAVYVTLFLLFATPQLRAKTAVLVAALDVGFLGAVVLVTSLAVHGSLR  125

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
            +M +G +C  L + MY SPL+AM+TVI  KSVEYMPF+LSFF  LNGGIW  YA+L +D+
Sbjct  126  VMVIGTICACLNVFMYGSPLAAMKTVITTKSVEYMPFFLSFFLFLNGGIWIVYAILDKDI  185

Query  656  YIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDPSE  835
            ++GIPNGIG +LG+ Q+ILY IY  +  +K+  D         E  +     SN +  ++
Sbjct  186  FLGIPNGIGLILGTIQLILYLIYVNAKASKQLGDSHEE-----EWQHQQLINSNSEHEAD  240

Query  836  ARAH  847
              AH
Sbjct  241  EEAH  244



>gb|ABK26262.1| unknown [Picea sitchensis]
Length=228

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 166/216 (77%), Gaps = 0/216 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA++SFI+G+IGNVIS+L+FL+P KTF RIV+  STE+F  +PYI TLLSTSLW++YGL+
Sbjct  1    MANVSFILGVIGNVISLLVFLSPAKTFWRIVRNNSTEDFHYLPYICTLLSTSLWTYYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLL+ TVNG G VL  +YV LFLIY PK +KI++  +V ++++    +V  VT   L
Sbjct  61   KPGGLLISTVNGAGAVLESVYVILFLIYCPKELKIKAAVLVVLVDIIAFTSVFLVTFLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
              + ++  +G+LC  L++ MY SPL+  R+VI  KSVE+MPF+LSFF  LNGGIWA++A+
Sbjct  121  DQQIRITVIGVLCVCLSLTMYGSPLAITRSVIVTKSVEFMPFFLSFFLFLNGGIWAAWAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE  748
            L +D+++GIPNGIGF LG++Q+ILY IY +  P  E
Sbjct  181  LKQDVFVGIPNGIGFGLGASQLILYLIYRKGKPKAE  216



>ref|XP_011036889.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X2 [Populus euphratica]
Length=238

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+  FIVG++GN+IS L +L+P++TF RIV+K+STE+F  IPYI TL++  LW +YG+ 
Sbjct  1    MANTIFIVGVLGNIISSLAYLSPLRTFWRIVKKRSTEDFSSIPYICTLMNAILWIYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP   L+ T+NG G V  I+Y+ +FL++    ++ ++  +VG+++VAF+ A ++ T  + 
Sbjct  61   KPDSFLIATINGFGAVTQIVYILIFLVFISPRMRAKTALLVGLLDVAFVAAAISFTHFMF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G  ++  VG +C   ++ +YASPL+AM+TVI  KSVE+MPF LSF  +LNGG W  YA+
Sbjct  121  QGDVRIDVVGFICDCSSMLVYASPLAAMKTVITTKSVEFMPFLLSFSILLNGGFWTLYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            L +D+ +GIPNGIG LLG AQ+ILY IY++  P KE  D
Sbjct  181  LAKDILVGIPNGIGLLLGIAQLILYGIYHRYKPLKEASD  219



>ref|XP_010659797.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Vitis 
vinifera]
Length=238

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 165/223 (74%), Gaps = 4/223 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGN+IS+ + L+P+KTF RIV+ +STE+F+  PY+  LL TSLW +YG++
Sbjct  1    MEGLSFFVGVIGNIISVTVVLSPIKTFLRIVKHRSTEDFESFPYVIALLGTSLWCYYGVI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGG ++ T NG G+++ ++YV+LF+IYAP  ++ ++   +GI+NVA    V+ +TL  +
Sbjct  61   KPGGFILATTNGLGIIIELVYVTLFIIYAPLRVRAKTAIYLGILNVAVPAIVILITLFTM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  ++  +G +C GL+I MY SPL  ++ V+  KSVEYMPF LSFF  LNGGIW  YA+
Sbjct  121  HGDLRIDVLGFVCAGLSIVMYGSPLVVVKRVLTTKSVEYMPFLLSFFFFLNGGIWTVYAI  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK----EEED  757
            LV+D ++G+PNGIGFLLG+AQ++LY +Y++S  ++    E ED
Sbjct  181  LVKDFFLGVPNGIGFLLGTAQMVLYAMYWKSKSSQNISEELED  223



>ref|XP_008232337.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Prunus 
mume]
Length=244

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 157/214 (73%), Gaps = 1/214 (0%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggll  298
            I G++GNV+S L++++P   F RI++++STE F+ +PY++ LL+   W +YGL+KP  +L
Sbjct  8    IFGVLGNVMSGLVYVSPANVFVRILRRRSTEEFESVPYVSKLLNAYFWVYYGLIKPNSVL  67

Query  299  vvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKL  478
            V TVN  G V+ I+++++FL++AP  +K R+  +V  +NVAF  A + +T  +LHG  ++
Sbjct  68   VATVNIFGAVVEIVFLTIFLLFAPPRMKARTAMLVVALNVAFPAAAILLTQFLLHGDQRI  127

Query  479  MSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLY  658
             + GLLC+  ++  YASPLSAM+TV+ +KSVEYMPF LSF   LNGGIW  Y++L +DL+
Sbjct  128  DAAGLLCSIFSMIAYASPLSAMKTVVALKSVEYMPFLLSFILFLNGGIWTLYSILAKDLF  187

Query  659  IGIPNGIGFLLGSAQIILYFIYYQ-STPAKEEED  757
            +GIPNG GFL G+AQ+ILY IY++ S P K+  D
Sbjct  188  VGIPNGTGFLFGTAQLILYAIYWKPSKPPKQVSD  221



>ref|XP_006605261.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Glycine 
max]
 gb|KHN43311.1| Bidirectional sugar transporter SWEET16 [Glycine soja]
Length=281

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = +2

Query  173  KTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgvvlHIIYVSL  352
            KTF R+V+KKSTEN+KG PYITT L TSLW+ YG+LKPGG  +  VNG G V H  Y+ L
Sbjct  4    KTFCRVVKKKSTENYKGAPYITTFLCTSLWTSYGVLKPGGFQIAIVNGAGAVFHCTYIIL  63

Query  353  FLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASP  532
            FL+Y+P++ K+++   V I++V FLG V++VTL  LHG  +L  +G+ C+GLTI MYASP
Sbjct  64   FLVYSPQDQKVKTALWVAILDVGFLGTVISVTLFALHGTIQLSVLGMFCSGLTIIMYASP  123

Query  533  LSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIIL  712
            L +M+ VI+ KSVEYMPF LSFF  LN G+WA Y+ LV+D +IGIPN IG +LGS Q+ +
Sbjct  124  LLSMKMVIQTKSVEYMPFLLSFFMFLNAGVWALYSFLVKDFFIGIPNLIGLILGSTQLTV  183

Query  713  YFIYYQSTP  739
            Y +Y +  P
Sbjct  184  YVVYKKKQP  192



>ref|XP_006419537.1| hypothetical protein CICLE_v10005737mg [Citrus clementina]
 gb|ESR32777.1| hypothetical protein CICLE_v10005737mg [Citrus clementina]
Length=243

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 149/194 (77%), Gaps = 1/194 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IG++IS+LMFLAPV+TF RI++ +STE F+ +PYI TLL++SLW++YG+ 
Sbjct  1    MKDLSFYVGVIGSIISVLMFLAPVRTFWRIIKHRSTEEFQSLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAP-KNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            +PG  LV TVNG G+++  +YV+LF IYAP K ++ ++  + GI++V FLGA +A T   
Sbjct  61   RPGSYLVATVNGFGILVEAVYVTLFFIYAPTKAMRAKTAIIFGILDVGFLGAAIAATRLA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L G+ ++ ++G +C GL I MYASPLSAM+TV+  KSVE+MPF LSFF  LNGGIWA YA
Sbjct  121  LEGEARIDAIGFMCAGLNIIMYASPLSAMKTVVTTKSVEFMPFMLSFFFFLNGGIWAFYA  180

Query  638  MLVRDLYIGIPNGI  679
            +LVRD+++G    I
Sbjct  181  LLVRDIFLGKCKAI  194



>ref|XP_002516944.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45558.1| conserved hypothetical protein [Ricinus communis]
Length=244

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  122  VGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllv  301
            VGIIGNVIS+LMFL+PV TF RI++ +STE F+ +PY+ TLL+ +LW++YG++KPG  LV
Sbjct  8    VGIIGNVISVLMFLSPVGTFWRIIKNESTEEFESLPYVCTLLNAALWTYYGIIKPGAYLV  67

Query  302  vtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLM  481
             TVNG G+V+ I+YV+LFLIYAP  ++ ++  +V +++V FL A + VT   L G+ ++ 
Sbjct  68   ATVNGFGIVVEIVYVALFLIYAPAKMRAKTAILVALLDVGFLAAAILVTRLALKGEVRID  127

Query  482  SVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYI  661
            + G +C GL I MY SPL+AM+TV+  KSVE+MPF+LSFF  LNGGIW  YA+L RD ++
Sbjct  128  ATGFMCAGLNIIMYGSPLAAMKTVVTTKSVEFMPFFLSFFFFLNGGIWTFYAILTRDYFL  187

Query  662  GIPNGIGFLLGSAQIILYFIYYQSTPAKEE-EDPAHLVKGGIEMAN  796
            G+PNG GF LG  Q++LY IY  + P K    D  + ++ G +  N
Sbjct  188  GVPNGTGFCLGITQLVLYAIYKNAKPCKTRVSDHRNGLEEGSQYEN  233



>ref|NP_001241100.1| uncharacterized protein LOC100776607 [Glycine max]
 gb|ACU23550.1| unknown [Glycine max]
Length=245

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 158/225 (70%), Gaps = 3/225 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF +I ++ STE+F  +PYI TLL+ SLW++YG++
Sbjct  1    MADASFFVGVIGNIISILMFLSPVPTFWKIKKQGSTEDFSSLPYICTLLNCSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
                 LV TVNG G+V+  IYV LFLIYAPK  + R+  +  I++VA L A V +T    
Sbjct  61   NAREYLVATVNGFGIVVETIYVILFLIYAPKGRRGRTAILAVILDVAILAAAVVITQLAF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             GK +  +VG++  GL I MY SPLSAM+TV+K KSVEYMPF LSFF  LNGG+W  YA+
Sbjct  121  QGKARSGAVGVMGAGLNIVMYFSPLSAMKTVVKTKSVEYMPFLLSFFFFLNGGVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE---EEDPAH  766
            LVRD+ +G+PNG GFLLG+ Q++LY IY    P+     EE   H
Sbjct  181  LVRDVILGVPNGTGFLLGAMQLVLYAIYRNGKPSSNNRLEEGLQH  225



>ref|XP_009375397.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Pyrus 
x bretschneideri]
Length=238

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = +2

Query  107  SLSFIV--GIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            ++SFIV  G++GN++S L++++P   F RIV+++STE F+ IPY++ LL+   WS+YGL+
Sbjct  2    AVSFIVLFGVLGNIMSGLVYISPANVFVRIVKRRSTEEFESIPYVSKLLNAYFWSYYGLV  61

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            +P  +LV +VN  G  + I+++++FL++A   +K R+  +V  ++VAF  A + +T  +L
Sbjct  62   EPNSVLVASVNIFGAGVEIVFLTIFLLFATPRMKARTAMLVAALDVAFPAAAILLTQFLL  121

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  ++   GL C   ++  YASPLSAM+TV+ +KSVEYMPF LSF   LNGG+W  Y++
Sbjct  122  HGNKRIDVAGLFCVVFSMIAYASPLSAMKTVVILKSVEYMPFLLSFILFLNGGVWTLYSI  181

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            L +DL++GIPNGIGFLLG+AQ+ILY IY++ T   +  D
Sbjct  182  LAKDLFVGIPNGIGFLLGTAQLILYAIYWKPTKPNQVSD  220



>gb|KCW61870.1| hypothetical protein EUGRSUZ_H04550 [Eucalyptus grandis]
Length=243

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 168/260 (65%), Gaps = 50/260 (19%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASLSF+VGI GN+ISIL+F +P+KTF ++V+K+ TEN+KG+PYITTLLSTSLWSFYG+L
Sbjct  1    MASLSFMVGIFGNIISILVFTSPIKTFWQVVKKRCTENYKGVPYITTLLSTSLWSFYGIL  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGGLLV+TVN  G ++  IYV+LFLIYAPK+ +I+ +K+V +++V F G VVAVTL  +
Sbjct  61   KPGGLLVLTVNAAGAIMQFIYVTLFLIYAPKDKRIQLMKLVALLDVGFPGVVVAVTLLAI  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  +L  VG+LC  LTIGMYASPL+ M                                
Sbjct  121  HGNMRLTVVGILCAALTIGMYASPLAVM--------------------------------  148

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE---------EEDPAHLVKGGIEMA  793
                    +PNGIGF+LGSAQ+ILY IY   + A +         E+  AHLVKG +E+ 
Sbjct  149  --------VPNGIGFILGSAQLILYAIYKNQSAASKLEESTEEAEEDGSAHLVKGDVEIG  200

Query  794  N-DVAFKSNGKDPSEARAHT  850
            + +V  ++  K+ + AR  +
Sbjct  201  SYNVEDENQLKNRTIARGRS  220



>emb|CDX75890.1| BnaC03g39730D [Brassica napus]
Length=231

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 161/222 (73%), Gaps = 1/222 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+TF +IV+++STE ++ +PYI TL+ + LW++YG++
Sbjct  1    MAELSFYVGVIGNVISVLVFLSPVETFWKIVKRRSTEEYECLPYICTLMGSLLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG GV+   IYV +FL + PK   ++++ +V  +NV F   ++  T +  
Sbjct  61   TPGEYLVSTVNGFGVLAESIYVLIFLFFVPKPRILKTVALVLALNVIFPVIMIVGTRTAF  120

Query  461  -HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
             + KT+  S+G +C  L I MY SPLSA++TV+K +SV+YMPFWLSF   LNG IWA YA
Sbjct  121  GYAKTRSNSMGFICAALNIIMYGSPLSAIKTVVKTRSVKYMPFWLSFLLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            +L+ D+++ +PNG+GF LG+ Q+++Y  Y  + P KE+E+ A
Sbjct  181  LLLHDVFLLVPNGMGFFLGTVQLLIYTFYRNAKPNKEDEEEA  222



>ref|XP_009772929.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Nicotiana 
sylvestris]
Length=242

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 164/227 (72%), Gaps = 3/227 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  ++F++G+IGN+IS+LMFL+PV TF RIV+ +STE F  +PYI TLLS+SLW++YG++
Sbjct  1    MEIVAFVIGVIGNIISVLMFLSPVGTFIRIVKNQSTEEFDSLPYICTLLSSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV T NG GV + IIY+SLFL++AP  +++++  +V ++NV F    + +     
Sbjct  61   KQGSFLVSTTNGFGVAVEIIYLSLFLLFAPPKMRLKTAVLVVVLNVGFSATFILLAQFGC  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG+ ++  +G LC+ L I MY+SPLS ++TV+  KSVEYMPF LS F  LNGG+W  YA+
Sbjct  121  HGEMRIDFIGFLCSALNIVMYSSPLSVVKTVVTTKSVEYMPFLLSLFFFLNGGVWTLYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGG  781
            LVRD ++G+PNGIG LLG AQ+++Y IY +    K  +  A+L +GG
Sbjct  181  LVRDRFLGVPNGIGCLLGMAQLVIYAIYRK---GKSVKHIANLEEGG  224



>ref|XP_002278982.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Vitis 
vinifera]
Length=237

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 165/219 (75%), Gaps = 0/219 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+LSFI G+IGN+IS+L  L+PV TF RIV+ +STE F+ +PY+++L ++SLW FYGL+
Sbjct  1    MATLSFISGVIGNIISVLYMLSPVPTFSRIVKHRSTEEFESLPYVSSLATSSLWVFYGLM  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K GGLL+ TVNG G+++ ++YV LFLI+AP  ++ ++  +V  +NV F   VV +TL V+
Sbjct  61   KSGGLLIATVNGFGIIIELVYVILFLIFAPTRMRAKTAILVVTLNVGFPAGVVLITLIVM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G  +L  +G++C  L I MY SP +AM+ V+  KSVEYMPF LSFF +LNG IW  YA+
Sbjct  121  DGDLRLDVLGIVCAVLNILMYGSPFTAMKKVVMTKSVEYMPFLLSFFLLLNGAIWTFYAI  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            LV+D ++G+PNGIGF+LG+AQI+LY +Y++S  ++   D
Sbjct  181  LVKDFFVGVPNGIGFILGAAQIVLYAMYWKSKTSQNLSD  219



>ref|XP_002885162.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61421.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=230

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 156/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGNVIS+L+FL+PV+TF RIVQ++STE ++ +PYI TL+S+SLW++YG++
Sbjct  1    MVDLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECLPYICTLMSSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G +   IYV +FL + PK   ++++ +V  +NV F + A+V    + 
Sbjct  61   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKPRFLKTIVVVLALNVCFPVLAIVGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
                 +  S+G +C  L I MY SPLSA++TV+  +SV++MPFWLSFF  LNG IW  YA
Sbjct  121  EDENKRSSSMGFICATLNIAMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
             L+ D+++ +PNG+GFLLG+ Q+++Y  Y  + P  E+E+
Sbjct  181  FLLHDVFLLVPNGMGFLLGTMQLLIYAYYRNAQPNVEDEE  220



>ref|XP_009796371.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Nicotiana 
sylvestris]
Length=240

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L FI+G+IGN+ISILMFL+PV TF+RIV+ +STE+F  +PYI TLL+++LW++YGL+
Sbjct  1    MENLVFIIGVIGNIISILMFLSPVGTFRRIVRNQSTEDFDSLPYICTLLNSALWTYYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GV++ IIYV+LFL++A   ++ ++  + G++NV  L   +     +L
Sbjct  61   KPGSYLVSTVNGFGVIVEIIYVALFLLFANPKMRKKTAILAGVLNVGILATTLLYAQFLL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG+T++  +G L T L I MY+SPL  M+TV+  KSVEYMPF LS F  LNGG+W  YA+
Sbjct  121  HGETRINVIGFLSTCLNIVMYSSPLGVMKTVVTTKSVEYMPFLLSLFLFLNGGVWTFYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
            LV D ++G+PNG+G+LLG+ Q+++Y IY   + +K
Sbjct  181  LVADWFLGVPNGMGWLLGAVQLVIYAIYRNPSSSK  215



>ref|XP_011036888.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X1 [Populus euphratica]
Length=239

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 157/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA+  FIVG++GN+IS L +L+P++TF RIV+K+STE+F  IPYI TL++  LW +YG+ 
Sbjct  1    MANTIFIVGVLGNIISSLAYLSPLRTFWRIVKKRSTEDFSSIPYICTLMNAILWIYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP   L+ T+NG G V  I+Y+ +FL++    ++ ++  +VG+++VAF+ A ++ T  + 
Sbjct  61   KPDSFLIATINGFGAVTQIVYILIFLVFISPRMRAKTALLVGLLDVAFVAAAISFTHFMF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAM-RTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
             G  ++  VG +C   ++ +YASPL+AM +TVI  KSVE+MPF LSF  +LNGG W  YA
Sbjct  121  QGDVRIDVVGFICDCSSMLVYASPLAAMQKTVITTKSVEFMPFLLSFSILLNGGFWTLYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +L +D+ +GIPNGIG LLG AQ+ILY IY++  P KE  D
Sbjct  181  LLAKDILVGIPNGIGLLLGIAQLILYGIYHRYKPLKEASD  220



>ref|XP_010693605.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Beta 
vulgaris subsp. vulgaris]
Length=246

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 159/230 (69%), Gaps = 2/230 (1%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            A LSF VG+IGNVIS+LMFL+PV TFK IV+++ T+ F+ +PYI TLL+ SLW++YG++K
Sbjct  3    ADLSFYVGVIGNVISLLMFLSPVSTFKSIVEQRDTKEFESVPYICTLLNASLWTYYGIIK  62

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            P  L+        VV  ++YV LFLI+AP+ +K+++  +VGI++V F  A + V    L 
Sbjct  63   PELLVSTINGFGVVV-ELVYVILFLIFAPRRMKVKTWILVGILDVGFFAAAIVVPKLALQ  121

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
               ++ ++G++C GL I MY SPLSAM+TV+  KSVEYMPF LSFF  LNG  W  YA+L
Sbjct  122  VSHQVDALGIICAGLNIVMYGSPLSAMKTVVTTKSVEYMPFLLSFFLFLNGATWTLYAVL  181

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMA  793
              D+Y+ +PNG G  LG+ Q++LY IY  + PAK +    +L++ G + A
Sbjct  182  RWDIYLLVPNGTGCFLGAVQLVLYAIYRNAKPAKSDLS-ENLIEEGSQHA  230



>ref|NP_188291.2| bidirectional sugar transporter SWEET16 [Arabidopsis thaliana]
 sp|Q9LUR4.1|SWT16_ARATH RecName: Full=Bidirectional sugar transporter SWEET16; Short=AtSWEET16 
[Arabidopsis thaliana]
 dbj|BAB02761.1| cytochrome c oxidoreductase-like [Arabidopsis thaliana]
 gb|AAQ65151.1| At3g16690 [Arabidopsis thaliana]
 dbj|BAD95254.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AEE75852.1| bidirectional sugar transporter SWEET16 [Arabidopsis thaliana]
Length=230

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 157/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+TF RIVQ++STE ++  PYI TL+S+SLW++YG++
Sbjct  1    MADLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECFPYICTLMSSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             PG  LV TVNG G +   IYV +FL + PK+  ++++ +V  +NV F    +A T ++ 
Sbjct  61   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVVVVLALNVCFPVIAIAGTRTLF  120

Query  461  -HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
                ++  S+G +C  L I MY SPLSA++TV+  +SV++MPFWLSFF  LNG IW  YA
Sbjct  121  GDANSRSSSMGFICATLNIIMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +L+ D+++ +PNG+GF LG  Q+++Y  Y  + P  E+E+
Sbjct  181  LLLHDMFLLVPNGMGFFLGIMQLLIYAYYRNAEPIVEDEE  220



>ref|XP_006406815.1| hypothetical protein EUTSA_v10021447mg [Eutrema salsugineum]
 gb|ESQ48268.1| hypothetical protein EUTSA_v10021447mg [Eutrema salsugineum]
Length=231

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 157/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF +G+IGNVIS+L+FL+PV+TF RIV+++STE ++ +PYI TL+S SLW++YG++
Sbjct  1    MAELSFYIGVIGNVISVLVFLSPVETFWRIVKRRSTEEYECLPYICTLMSCSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G +   IYV +FL + PK   + ++ +V  +NV F + A+V    + 
Sbjct  61   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKPRLLNTVLVVLALNVIFPVIAIVGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +C  L I MY SPLSA++TV+  KSV+YMPFWLSFF  LNG IW  YA
Sbjct  121  GDAKMRSNSMGFICATLNIIMYGSPLSAIKTVVTTKSVKYMPFWLSFFLFLNGAIWGFYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +L+ D+++ +PNG+GFLLG+ Q+++Y  Y  + P  E+E+
Sbjct  181  LLLHDVFLLVPNGMGFLLGTIQLLIYAFYRNAKPNVEDEE  220



>ref|XP_009114620.1| PREDICTED: bidirectional sugar transporter SWEET16 [Brassica 
rapa]
 emb|CDY34967.1| BnaA01g27670D [Brassica napus]
Length=231

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 159/222 (72%), Gaps = 1/222 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+ F +IV+++STE ++ +PYI TLL +SLW++YG++
Sbjct  1    MAELSFYVGVIGNVISVLVFLSPVEAFWKIVKRRSTEEYECLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG GV+   IYV +FL + PK   ++++ +V  +N+ F + A+V    + 
Sbjct  61   TPGEYLVSTVNGFGVLAESIYVLIFLFFVPKPRFLKTITLVLALNILFPVIAIVGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               KT+  S+G +C  L I MY SPLSA++TV+  KSV+YMPFWLSFF  LNG IW  YA
Sbjct  121  GDAKTRSNSMGFICATLNIIMYGSPLSAIKTVVTTKSVKYMPFWLSFFLFLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            +LV D+++ +PNG+GF LG+ Q+++Y  Y  + P  ++E+ A
Sbjct  181  LLVHDVFLLVPNGMGFFLGTMQLLIYAFYRNAKPNVKDEEEA  222



>ref|XP_009382526.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=239

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            ASL F VGI+GNVIS+L+F +P+ TF+RIV+ +STE+F+  PY+ TLL++SLW +YG+ K
Sbjct  3    ASLLF-VGIVGNVISVLVFASPINTFRRIVRNRSTEDFEPSPYVITLLNSSLWVYYGITK  61

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            PGGLL+VTVNG GVV+  +YV+LFL+YA   +K ++  +V  ++V F GAV  VT   +H
Sbjct  62   PGGLLIVTVNGVGVVMEAVYVALFLLYAAPPLKAKTAVLVAALDVGFFGAVALVTRLAVH  121

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
            G ++++ +G +C  L + MY SPL AMR+VI  +SVEYMPF LSFF  LNGGIW  YA+L
Sbjct  122  GSSRVVVIGFVCAFLNVLMYGSPLCAMRSVITRRSVEYMPFLLSFFLFLNGGIWTLYAIL  181

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
             +D++IGIPNGIG +LG++Q+I+Y IY  S  + 
Sbjct  182  DKDIFIGIPNGIGLILGTSQLIMYMIYMNSEASN  215



>ref|XP_006586695.1| PREDICTED: uncharacterized protein LOC100808537 isoform X1 [Glycine 
max]
Length=244

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 166/247 (67%), Gaps = 5/247 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF +I +  STE+F  +PYI TLL+ SLW++YG++
Sbjct  1    MAEASFFVGVIGNIISILMFLSPVPTFWKIKKHGSTEDFSSLPYICTLLNCSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+++  IY+ LFLIYAPK I+ R+  +  I++V  L A++ +T   L
Sbjct  61   KAGEYLVATVNGFGILMETIYIILFLIYAPKGIRGRTAILALILDVVILTAIIIITQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T+  +VG++  GL I MY+SPLS M+TV+  KSVEYMPF LSFF   NG +W  YA+
Sbjct  121  EGETRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFFNGAVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            LVRD+ +G+PNG GFLLG+ Q++LY IY               ++ G++    ++  +N 
Sbjct  181  LVRDVILGVPNGTGFLLGAMQLVLYAIYRNGKRVSNNR-----LEEGLQHEPLISEPNNE  235

Query  821  KDPSEAR  841
               SE R
Sbjct  236  SHQSEDR  242



>ref|XP_009625472.1| PREDICTED: bidirectional sugar transporter SWEET17-like isoform 
X1 [Nicotiana tomentosiformis]
Length=240

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 164/227 (72%), Gaps = 3/227 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  ++ ++G+IGN+ISILMFL+PV TF RIV+ +STE F  +PYI TLLS+SLW++YG++
Sbjct  1    MEIVALVIGVIGNIISILMFLSPVGTFIRIVKNQSTEEFDSLPYICTLLSSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV T NG GV + IIY+SLFL++AP  +++++  +V ++NV F    + +     
Sbjct  61   KPGSFLVSTTNGFGVAVEIIYMSLFLLFAPPKMRLKTAVLVVVLNVVFSATAILLAHFGS  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG+ ++  +G LC+ L I MY+SPLS ++TV+  KSVEYMPF+LS F  LNGG+W  YA+
Sbjct  121  HGEMRIDVIGFLCSALNIVMYSSPLSVVKTVVTTKSVEYMPFFLSLFFFLNGGVWTLYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGG  781
            LVRD ++G+PNGIG LLG+AQ+++Y IY +    K   D   L +GG
Sbjct  181  LVRDWFLGVPNGIGCLLGTAQLVIYAIYRKGKSVKHTAD---LEEGG  224



>gb|KHN26542.1| Bidirectional sugar transporter SWEET17 [Glycine soja]
Length=244

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 166/247 (67%), Gaps = 5/247 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF +I +  STE+F  +PYI TLL+ SLW++YG++
Sbjct  1    MAEASFFVGVIGNIISILMFLSPVPTFWKIKKHGSTEDFSSLPYICTLLNCSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+++  IY+ LFLIYAPK I+ R+  +  I++V  L A++ +T   L
Sbjct  61   KAGEYLVATVNGFGILMETIYIILFLIYAPKGIRGRTAILALILDVVILTAILIITQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T+  +VG++  GL I MY+SPLS M+TV+  KSVEYMPF LSFF   NG +W  YA+
Sbjct  121  EGETRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFFNGAVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            LVRD+ +G+PNG GFLLG+ Q++LY IY               ++ G++    ++  +N 
Sbjct  181  LVRDVILGVPNGTGFLLGAMQLVLYAIYRNGKRVSNNR-----LEEGLQHEPLISEPNNE  235

Query  821  KDPSEAR  841
               SE R
Sbjct  236  SHQSEDR  242



>ref|XP_009589632.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Nicotiana 
tomentosiformis]
Length=238

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L FI+G+IGN+IS+LMFL+PV TF+RIV+ +STE+F  +PYI TLL+++LW++YGL+
Sbjct  1    MENLVFIIGVIGNIISVLMFLSPVGTFRRIVKNQSTEDFDSLPYICTLLNSALWTYYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GV++ I+YV+LFL++A   ++ ++  + G++NV  L   +     +L
Sbjct  61   KPGSYLVSTVNGFGVIVEIVYVALFLLFANPKMRKKTAILSGVLNVGILATTLLYAQFLL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG+T++  +G L T L I MY+SPL  + TV+  +SVEYMPF LSFF  LNGG+W  YA+
Sbjct  121  HGETRINVIGFLSTCLNIVMYSSPLGVLTTVVTTRSVEYMPFLLSFFLFLNGGVWTLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
            LV D ++G+PNG+G+LLG+ Q+++Y IY   + +K
Sbjct  181  LVADWFLGVPNGMGWLLGAVQLVIYAIYRNPSSSK  215



>ref|XP_002318986.1| hypothetical protein POPTR_0013s01600g [Populus trichocarpa]
 gb|EEE94909.1| hypothetical protein POPTR_0013s01600g [Populus trichocarpa]
Length=238

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 160/232 (69%), Gaps = 2/232 (1%)
 Frame = +2

Query  134  GNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvn  313
            GN+IS+L+FL+PV  F+RI++ +STE F+ +PYI TLL++SLW++YG++K G  LV T+N
Sbjct  6    GNIISVLLFLSPVGVFRRILKHRSTEEFESLPYICTLLNSSLWTYYGIIKTGEFLVATIN  65

Query  314  gtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGL  493
            G GVV+ I+ ++LFL++AP  I+ ++  ++GI++V FL A + V   +L G  K+  +G 
Sbjct  66   GFGVVVEIVLLTLFLVFAPPRIRAKTAMLIGILDVGFLAAAILVCQLLLQGDMKIDIIGF  125

Query  494  LCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPN  673
            L  GL + MY SPL+AM+TV++ KSVEYMPF LS F  LNGG+W  YA+L +D ++G+ N
Sbjct  126  LGAGLNVVMYGSPLAAMKTVVRTKSVEYMPFLLSLFVFLNGGVWTCYAVLKKDWFLGVAN  185

Query  674  GIGFLLGSAQIILYFIYYQSTPAKE--EEDPAHLVKGGIEMANDVAFKSNGK  823
              G  LG+AQ+ILY IY++   +K    +D  H  +    + +   F+ N +
Sbjct  186  VAGCFLGAAQLILYAIYWKPKSSKNTASKDSEHGSQHEHLLPSSSHFRENNE  237



>ref|XP_010465690.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Camelina 
sativa]
Length=232

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 159/225 (71%), Gaps = 1/225 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+TF +IV+ +ST++++ +PYI TL+ +SLW++YG++
Sbjct  1    MADLSFFVGVIGNVISVLVFLSPVETFWKIVKGRSTQDYECLPYICTLMGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G +   IYV +FL + PK+  ++++ +V  +NV F L A++    + 
Sbjct  61   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTILVVLALNVCFPLIAILGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
                ++  S+G +C  L I MY SPLS ++TV+  +SV++MPFWLSFF  LNG IW  YA
Sbjct  121  GDANSRSTSMGFICATLNIIMYGSPLSVIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLV  772
            +LV D+++ +PNG+GFLLG+ Q+++Y  Y  + P  E+ +   L+
Sbjct  181  LLVHDIFLLVPNGMGFLLGTIQLLIYAYYRNARPNVEDHEEEGLI  225



>ref|XP_011092671.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Sesamum 
indicum]
Length=256

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 165/246 (67%), Gaps = 5/246 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +  FIVGIIGN++SI+ F + + TF+ IV+KKS+EN+KG+PY+TTLLSTSLW+FYG L
Sbjct  1    MVASDFIVGIIGNIVSIISFASSIGTFREIVKKKSSENYKGVPYVTTLLSTSLWTFYGAL  60

Query  281  KPgg-llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
             P   +L+VTVN  GVV    Y+ LFL YA K  K +    + ++++ FLG V+A TL+ 
Sbjct  61   DPDDGVLIVTVNVVGVVSQAAYLVLFLFYASKERKTK-YLGLVLLDLLFLGIVIATTLTA  119

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
             HG  +   +G+LC   TI MYA+PLSA+R VI+ KSV+YMPF LSF  ++N  +W ++A
Sbjct  120  FHGSARRTFIGVLCATFTIAMYAAPLSAVRAVIRTKSVKYMPFLLSFSLLVNAAVWFTFA  179

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSN  817
            ML++D Y+ +PN +G +LGS Q+I+Y +Y   + +   +D    +  G ++AN     + 
Sbjct  180  MLLKDYYVLVPNAVGIVLGSLQLIVYIVYKNKSSSSAFKDT---LADGEKLANKAKCATE  236

Query  818  GKDPSE  835
             +D  +
Sbjct  237  TQDVEQ  242



>ref|XP_004158758.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Cucumis 
sativus]
Length=249

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 154/223 (69%), Gaps = 6/223 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L   VG+IGN+IS+L F++P+KTF R+++K+STE F  +PY++T L+ SLW++YGL+
Sbjct  1    MEPLPIFVGVIGNIISVLFFISPIKTFWRVLKKRSTEEFDSLPYVSTFLTASLWAYYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP G L+VTVN  G+ L I Y+++FL+++P ++K+R+  +V I +V F+G  ++++  +L
Sbjct  61   KPDGFLIVTVNIFGLSLQICYLTIFLLFSPPHMKVRTTTLVAIFDVGFVGGTISISYFML  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG +++  +G +C  L I    SPL   R V++ KSVEYMPF L+    LN G+W  YA+
Sbjct  121  HGNSRINVIGFICAALNIINCGSPLGIARKVVRSKSVEYMPFLLTLCIFLNSGVWTFYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHL  769
            LV+D +IG+PN IGFLLG  Q+++Y IY           P+H+
Sbjct  181  LVKDPFIGVPNFIGFLLGLMQLVIYVIYMNG------PQPSHI  217



>emb|CBI39543.3| unnamed protein product [Vitis vinifera]
Length=655

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 164/223 (74%), Gaps = 0/223 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGN+IS+ + L+P+KTF RIV+ +STE+F+  PY+  LL TSLW +YG++
Sbjct  1    MEGLSFFVGVIGNIISVTVVLSPIKTFLRIVKHRSTEDFESFPYVIALLGTSLWCYYGVI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPGG ++ T NG G+++ ++YV+LF+IYAP  ++ ++   +GI+NVA    V+ +TL  +
Sbjct  61   KPGGFILATTNGLGIIIELVYVTLFIIYAPLRVRAKTAIYLGILNVAVPAIVILITLFTM  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG  ++  +G +C GL+I MY SPL  ++ V+  KSVEYMPF LSFF  LNGGIW  YA+
Sbjct  121  HGDLRIDVLGFVCAGLSIVMYGSPLVVVKRVLTTKSVEYMPFLLSFFFFLNGGIWTVYAI  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHL  769
            LV+D ++G+PNGIGFLLG+AQ++LY +Y++S  ++   +   +
Sbjct  181  LVKDFFLGVPNGIGFLLGTAQMVLYAMYWKSKSSQNISEECQM  223


 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = +2

Query  137  NVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvng  316
            N+IS+L  L+PV TF RIV+ +STE F+ +PY+++L ++SLW FYGL+K GGLL+ TVNG
Sbjct  284  NIISVLYMLSPVPTFSRIVKHRSTEEFESLPYVSSLATSSLWVFYGLMKSGGLLIATVNG  343

Query  317  tgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLL  496
             G+++ ++YV LFLI+AP  ++ ++  +V  +NV F   VV +TL V+ G  +L  +G++
Sbjct  344  FGIIIELVYVILFLIFAPTRMRAKTAILVVTLNVGFPAGVVLITLIVMDGDLRLDVLGIV  403

Query  497  CTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNG  676
            C  L I MY SP +AM+ V+  KSVEYMPF LSFF +LNG IW  YA+LV+D ++G+PNG
Sbjct  404  CAVLNILMYGSPFTAMKKVVMTKSVEYMPFLLSFFLLLNGAIWTFYAILVKDFFVGVPNG  463

Query  677  IGFLLGSAQIILYFIYYQSTPAKEEED  757
            IGF+LG+AQI+LY +Y++S  ++   D
Sbjct  464  IGFILGAAQIVLYAMYWKSKTSQNLSD  490



>ref|XP_008454147.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Cucumis 
melo]
Length=250

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 155/223 (70%), Gaps = 6/223 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  L   VG+IGN+IS+L F++P+KTF R+++K+STE F  +PY++T L+ SLW++YGL+
Sbjct  1    MEPLPIFVGVIGNIISVLFFISPIKTFWRVLKKRSTEEFDSLPYVSTFLTASLWAYYGLI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP G L+VTVN  G+ L I Y+ +FL+ +P ++K+R+  +V I++V F+G  ++++  +L
Sbjct  61   KPDGFLIVTVNIFGLSLQICYLIIFLLLSPPHMKVRTATLVAILDVGFVGGTISISYFML  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG +++  +GL+C  L I   +SPL   R V++ KSVEYMPF L+    LN G+W  YA+
Sbjct  121  HGNSRINVIGLICAALNIINCSSPLGIARKVVRSKSVEYMPFLLTLCIFLNSGVWTFYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHL  769
            LV+D +IG+PN IGFLLG  Q+++Y IY           P+H+
Sbjct  181  LVKDPFIGVPNLIGFLLGVMQLVIYVIYMNG------PQPSHI  217



>gb|KFK39012.1| hypothetical protein AALP_AA3G189200 [Arabis alpina]
Length=231

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 156/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF  G++GNVIS+L+FL+PV TF  IV+++STE ++ +PYI TLL +SLW++YG++
Sbjct  1    MAELSFYAGVLGNVISLLVFLSPVDTFWTIVKRRSTEEYECLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV T+NG GV+   IYV +FL + P+   +++  +V ++NV F + A+V   ++ 
Sbjct  61   TPGEYLVSTINGFGVLAESIYVLIFLFFVPRPRLLKTSVLVLVLNVIFPVIAIVGTRIAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +C  L I MY SPLSA++TV+  +SV+YMPFWLSFF  LNG IW  YA
Sbjct  121  GDAKARSSSIGFVCATLNIIMYGSPLSAIKTVVTTRSVKYMPFWLSFFLFLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +L+ D+++ +PNG+GF LG+ Q+++Y  Y  + P  E+E+
Sbjct  181  LLMHDIFLLVPNGMGFFLGTMQLLIYAFYRNAKPIVEDEE  220



>ref|XP_004134220.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Cucumis 
sativus]
 ref|XP_004164707.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Cucumis 
sativus]
 gb|KGN57125.1| hypothetical protein Csa_3G159450 [Cucumis sativus]
Length=244

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGN+IS+LMFL+P  TF+RI++ KSTE F+  PY+ T L++SLW++YG++
Sbjct  1    MAELSFFVGVIGNIISVLMFLSPAGTFRRIIRNKSTEEFESFPYVCTWLNSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV T+N  GVV+   ++ +FLIYAP  +K ++  MVGI+++  L A + V+  VL
Sbjct  61   KPGAYLVATINSFGVVVQSFFLGVFLIYAPSLMKAKTGIMVGILDIGMLTAAIVVSELVL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+ ++ ++G +C GL I MYASPLS M+TVIK +SVEYMPF LS F  LNGGIW  YA 
Sbjct  121  EGEKRIEALGFVCAGLNIMMYASPLSVMKTVIKSRSVEYMPFMLSLFFSLNGGIWTFYAF  180

Query  641  LVRDLYIGIPN  673
            LV D ++ +PN
Sbjct  181  LVHDWFLAVPN  191



>ref|XP_009382525.1| PREDICTED: bidirectional sugar transporter SWEET16-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            ASL F VGI+GNVIS+L+F +P+ TF+RIV+ +STE+F+  PY+ TLL++SLW +YG+ K
Sbjct  3    ASLLF-VGIVGNVISVLVFASPINTFRRIVRNRSTEDFEPSPYVITLLNSSLWVYYGITK  61

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            PGGLL+VTVNG GVV+  +YV+LFL+YA   +K ++  +V  ++V F GAV  VT   +H
Sbjct  62   PGGLLIVTVNGVGVVMEAVYVALFLLYAAPPLKAKTAVLVAALDVGFFGAVALVTRLAVH  121

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAM-RTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            G ++++ +G +C  L + MY SPL AM R+VI  +SVEYMPF LSFF  LNGGIW  YA+
Sbjct  122  GSSRVVVIGFVCAFLNVLMYGSPLCAMQRSVITRRSVEYMPFLLSFFLFLNGGIWTLYAI  181

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
            L +D++IGIPNGIG +LG++Q+I+Y IY  S  + 
Sbjct  182  LDKDIFIGIPNGIGLILGTSQLIMYMIYMNSEASN  216



>gb|KDP25811.1| hypothetical protein JCGZ_22533 [Jatropha curcas]
Length=245

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 151/219 (69%), Gaps = 1/219 (0%)
 Frame = +2

Query  104  ASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLK  283
            ASL  I+G++GN+ + L++LAPVKTF RIV  +STE F+  PY+  LL+   W +YG++K
Sbjct  9    ASLVVILGLLGNITTGLVYLAPVKTFWRIVVNRSTEEFESAPYMFKLLNAYFWVYYGIIK  68

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            P  +LV TVNG G VL II+VSLFLI+ P  +++++  + G+++V F GAVV     +L 
Sbjct  69   PNSILVATVNGFGAVLEIIFVSLFLIFVPPRLRVKTAILAGVLDVVFPGAVVVAAQLLLK  128

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
             + ++   G  C   ++  Y SPLSAM+TVI  KSVEYMPF LSFF  +NGG+W  YA++
Sbjct  129  EEKRIDVAGFFCVCFSMAAYGSPLSAMKTVITSKSVEYMPFLLSFFLFINGGVWTFYAII  188

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQS-TPAKEEED  757
              D +IG+PNG GF LG+AQ+ILY IYY+   P K+  +
Sbjct  189  TNDWFIGLPNGTGFGLGTAQLILYAIYYKRPQPWKKSSN  227



>ref|XP_006298433.1| hypothetical protein CARUB_v10014504mg, partial [Capsella rubella]
 gb|EOA31331.1| hypothetical protein CARUB_v10014504mg, partial [Capsella rubella]
Length=242

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 157/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+TF +IV+ +STE ++ +PY+ TL+S+SLW++YG++
Sbjct  10   MADLSFYVGVIGNVISVLVFLSPVETFWKIVKGRSTEEYECLPYVCTLMSSSLWTYYGIV  69

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G +   IYV +FL + PK+  ++++ MV  +NV F + A++    + 
Sbjct  70   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVAMVLALNVCFPVIAILGTRTAF  129

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
                ++  S+G +C  L I MY SPLS ++TV+  +SV++MPFWLSFF  LNG IW  YA
Sbjct  130  GDANSRSTSMGFICATLNIIMYGSPLSVIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA  189

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +L+ D+++ +PNG+GFLLG+ Q+++Y  Y  + P  ++ +
Sbjct  190  LLLHDVFLLVPNGMGFLLGTVQLLIYAYYRNARPNVQDHE  229



>ref|XP_004487835.1| PREDICTED: bidirectional sugar transporter SWEET17-like isoform 
X1 [Cicer arietinum]
Length=235

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 160/227 (70%), Gaps = 5/227 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+P+ TF RI+++KSTE+F   PYI TLL++SLW++YG +
Sbjct  1    MADPSFFVGVIGNIISILMFLSPLPTFWRIIKQKSTEDFSSFPYICTLLNSSLWTYYGTI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+V+  IY+ LFLIYAPK I++++  + GI++V    A V  T   L
Sbjct  61   KDGEYLVATVNGFGIVVETIYILLFLIYAPKKIRVKTAIVGGILDVGVFAAAVVATQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+ +  +VG++   L I MYASPL+ M+TV+  KSVEY+PF LSFF  LNGG+W  YA+
Sbjct  121  QGEARSGAVGIMGAALNILMYASPLAVMKTVVTTKSVEYLPFLLSFFFFLNGGVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EEDPAH  766
            LVRD  +G+PNG GFLLG  Q++LY IY    P+K      EE+  H
Sbjct  181  LVRDCILGVPNGTGFLLGGVQLVLYGIYRNGKPSKHVSHKLEEECQH  227



>gb|KEH37225.1| bidirectional sugar transporter [Medicago truncatula]
Length=246

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 163/240 (68%), Gaps = 7/240 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF RI++KKSTE F   PYI TLL++SLW++YG +
Sbjct  1    MADPSFFVGVIGNIISILMFLSPVPTFWRIIKKKSTEEFSSFPYICTLLNSSLWTYYGTI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+V+  IY+ LFLIYAP  +++++  + GI++V  L A V  T   L
Sbjct  61   KAGEYLVATVNGFGIVVETIYILLFLIYAPPKMRVKTAILAGILDVLILAAAVVTTQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+ +  +VG++   L I MY SPL+ M+TV+K KSVEY+PF LSFF  LNGG+W  YA+
Sbjct  121  EGEARSGAVGIMGAALNILMYGSPLAVMKTVVKTKSVEYLPFLLSFFFFLNGGVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EE--DPAHLVKGGIEMAND  799
            LVRD  +G+PNG GF+LG+ Q++L+ IY     +K      EE     HL+      ++D
Sbjct  181  LVRDSILGVPNGTGFVLGAIQLVLHGIYRNGKQSKHVSNKLEEGWQHEHLISSSTTRSHD  240



>emb|CDO98848.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 139/202 (69%), Gaps = 0/202 (0%)
 Frame = +2

Query  149  ILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgvv  328
            +L+FLAP+ TFKRIV+ KSTE F  +PYI +LLS SLW++YG+++P   LV T+N  G V
Sbjct  1    MLVFLAPIDTFKRIVKNKSTEEFDSLPYICSLLSASLWTYYGIVQPSAFLVGTINAFGSV  60

Query  329  lHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGL  508
            L I+YV LFL YAP + K++   +VG +NV FL   +  T     G+ ++ S+G L  G 
Sbjct  61   LGIVYVGLFLFYAPPSNKVKIALIVGTLNVGFLAGAILFTRLAFKGEARVASMGFLAAGF  120

Query  509  TIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFL  688
             I  YASPLS+MRTV+  +SVEYMPF+LSFF  L+GG+WA Y  L+ D ++ +PNG G +
Sbjct  121  IIVTYASPLSSMRTVVMTRSVEYMPFYLSFFIFLSGGVWALYGWLIGDYFVSVPNGTGCI  180

Query  689  LGSAQIILYFIYYQSTPAKEEE  754
            LG+AQ++LY IY  + P   + 
Sbjct  181  LGTAQLVLYGIYRDTKPPARDS  202



>ref|XP_010921652.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Elaeis 
guineensis]
Length=245

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 157/216 (73%), Gaps = 1/216 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L   +G++GNVIS+L+F +P+KTF +IV+  STE+F+  PY+ TLLS+SLW +YG+ 
Sbjct  1    MEALLLFIGVVGNVISVLVFASPIKTFWKIVRNGSTEDFESAPYVVTLLSSSLWVYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVT-LSV  457
            KP G LV TVNG G++L  IYV+LFLIYA  +++ ++  +V +++V   G VV VT L  
Sbjct  61   KPDGFLVATVNGVGIILEAIYVTLFLIYATPSLRAKTAILVALLDVGIFGVVVLVTRLVA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            +   T++M +G +C  L + MY SPL AM+TVI  KSVEYMPF+LSFF  LNGG W  YA
Sbjct  121  IDETTRVMVIGAICACLNVFMYGSPLVAMKTVITTKSVEYMPFFLSFFLFLNGGTWTVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK  745
            +L RD+++GIPNGIGF LG+ Q++LY IY  +  +K
Sbjct  181  VLDRDIFLGIPNGIGFFLGTIQLVLYMIYMNTKVSK  216



>ref|XP_002531929.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30443.1| conserved hypothetical protein [Ricinus communis]
Length=249

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 152/230 (66%), Gaps = 4/230 (2%)
 Frame = +2

Query  68   AKLIKFLEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLL  247
            A L  F +  ++ +L    G++GN+ + L++LAPVKTF RIV  KSTE F+ +PYI  L+
Sbjct  2    ATLFSFSKSDIILTL----GVLGNITTGLVYLAPVKTFWRIVVNKSTEEFESMPYICKLI  57

Query  248  STSLWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFL  427
            +   W +YG+LKP  +LV TVNG G V  II+V LFL++AP  +K  +  + G+++V F 
Sbjct  58   NAYCWVYYGILKPNSILVATVNGFGAVCEIIFVLLFLLFAPPRMKFITAILAGVLDVGFP  117

Query  428  GAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQV  607
             AVV +T   L  + ++   G  C   ++  Y SPLSAM+TVI  KSVE+MPF LSFF  
Sbjct  118  AAVVIITQLFLKREAQIDVAGFFCVFFSMAAYGSPLSAMKTVITTKSVEFMPFLLSFFLF  177

Query  608  LNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +NGG+W  YA+L +D +IG+PNG GF LG+AQ+ILY IYY+    ++  D
Sbjct  178  INGGVWTLYAILAKDWFIGLPNGTGFGLGTAQMILYAIYYKRPQPQKHSD  227



>ref|XP_007220167.1| hypothetical protein PRUPE_ppa017165mg, partial [Prunus persica]
 gb|EMJ21366.1| hypothetical protein PRUPE_ppa017165mg, partial [Prunus persica]
Length=218

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 142/196 (72%), Gaps = 1/196 (1%)
 Frame = +2

Query  173  KTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgvvlHIIYVSL  352
              F RI++++STE F+ +PY++ LL+   W +YGL+KP  +LV TVN  G V+ I+++++
Sbjct  1    NVFVRILRRRSTEEFESVPYVSKLLNAYFWVYYGLIKPNSVLVATVNIFGAVVEIVFLTI  60

Query  353  FLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASP  532
            FL++AP  +K R+  +V  +NVAF  A + +T  +LHG  ++ + GLLC+  ++  YASP
Sbjct  61   FLLFAPPRMKARTAMLVVALNVAFPAAAILLTQFLLHGDQRIDAAGLLCSVFSMIAYASP  120

Query  533  LSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIIL  712
            LSAM+TV+ +KSVEYMPF LSF   LNGGIW  YA+L +DL++GIPNG GFL G+AQ+IL
Sbjct  121  LSAMKTVVALKSVEYMPFLLSFILFLNGGIWTLYAILAKDLFVGIPNGTGFLFGTAQLIL  180

Query  713  YFIYYQ-STPAKEEED  757
            Y IY++ S P K+  D
Sbjct  181  YAIYWKPSKPPKQVSD  196



>ref|XP_010504546.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Camelina 
sativa]
Length=232

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 159/225 (71%), Gaps = 1/225 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGN+IS+L+FL+PV+TF +IV+ +ST+ ++ +PYI TL+S+SLW++YG++
Sbjct  1    MADLSFYVGVIGNIISVLVFLSPVETFWKIVKGRSTKEYECLPYICTLMSSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G +   IYV +FL + PK+  ++++ +V  +NV F + A++    + 
Sbjct  61   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVLVVLALNVCFPVIAILGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
                ++  S+G +C  L I MY SPLS ++TV+  +SV++MPFWLSFF  LNG IW  YA
Sbjct  121  GDANSRSTSMGFICATLNIIMYGSPLSVIKTVVTTRSVQFMPFWLSFFLSLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLV  772
            +L+ D+++ +PNG+GFLLG+ Q+++Y  YY++     E+    L+
Sbjct  181  LLLHDIFLLVPNGMGFLLGTMQLLIYAYYYRNAKPNVEDHEEGLI  225



>ref|XP_006433440.1| hypothetical protein CICLE_v10002302mg [Citrus clementina]
 ref|XP_006472108.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Citrus 
sinensis]
 gb|ESR46680.1| hypothetical protein CICLE_v10002302mg [Citrus clementina]
Length=243

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 152/221 (69%), Gaps = 2/221 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASL+FI G++GN+ + L++L+P KTF  IVQ++STE F+ IPYI+ LL+   W +YG++
Sbjct  1    MASLNFIFGLLGNLTTGLVYLSPAKTFWHIVQRRSTEEFESIPYISKLLNAYFWVWYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  +LV +VNG G  L IIYV +FLI+AP  ++ R+  + G+ +V F G  V VT    
Sbjct  61   KPNSVLVASVNGFGAALEIIYVIIFLIFAPPMMRGRTAVLAGVCDVVFPGTTVLVTQIFF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
                ++   G L    ++  Y+SPLSAM+TV+  KSVEYMPF LSF   +NG +W  YA+
Sbjct  121  DRDVQIKVSGFLSLCFSMVAYSSPLSAMKTVVATKSVEYMPFLLSFILFINGAVWTVYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYY--QSTPAKEEED  757
            L +DL+IGIPNG GF+LG+AQ++LY +Y+  +S+  K  +D
Sbjct  181  LTKDLFIGIPNGSGFILGTAQLVLYAMYWKPKSSSMKISDD  221



>ref|XP_010487533.1| PREDICTED: bidirectional sugar transporter SWEET16 [Camelina 
sativa]
Length=231

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 156/220 (71%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+TF +IV+ +ST+ ++ +PYI TL+S+SLW++YG++
Sbjct  1    MADLSFYVGVIGNVISVLVFLSPVETFWKIVKGRSTKEYECLPYICTLMSSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G +   IYV +FL + PK+  ++++ +V  +NV F + A +    + 
Sbjct  61   TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTILVVLALNVCFPVIATLGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
                ++  S+G +C  L I MY SPLS ++TV+  +SV++MPFWLSFF  LNG IW  YA
Sbjct  121  GDANSRSNSMGFICATLNIIMYGSPLSVIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            +L+ D+++ +PNG+GFLLG+ Q+++Y  Y  + P  E+ +
Sbjct  181  LLLHDIFLLVPNGMGFLLGTMQLLIYAYYRNAKPIVEDHE  220



>ref|XP_010099969.1| Bidirectional sugar transporter SWEET16 [Morus notabilis]
 gb|EXB81015.1| Bidirectional sugar transporter SWEET16 [Morus notabilis]
Length=357

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 157/234 (67%), Gaps = 7/234 (3%)
 Frame = +2

Query  134  GNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvn  313
            GN++S L++++P   F RI ++ STE F+ IPY++ LL+   W +YGL+KP  LLV TVN
Sbjct  20   GNIMSGLVYISPANVFWRICKRGSTEEFESIPYVSKLLNAYFWIYYGLIKPDSLLVATVN  79

Query  314  gtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGL  493
              G V+ II++++FL++AP  +KIR+  +V +++V F  A +  T  +LHG T++   GL
Sbjct  80   MFGAVVEIIFLTIFLLFAPPRMKIRTAILVVVLDVVFPAAAILCTHFLLHGDTRIDVAGL  139

Query  494  LCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPN  673
            LC   ++  YASPLSA++T++  KSVEYMPF LSF   LNGG+W +YA+L +DL++G+PN
Sbjct  140  LCVAFSMVAYASPLSAIKTLLLTKSVEYMPFLLSFILFLNGGVWTAYALLAKDLFVGLPN  199

Query  674  GIGFLLGSAQIILYFIYYQSTPAK------EEEDPAH-LVKGGIEMANDVAFKS  814
            G GF LG+ Q+ILY IY++   ++      E +D    L+K   ++  D   ++
Sbjct  200  GTGFFLGTLQLILYAIYWKPKSSRRIVDDLEHQDKHEPLIKSSEQLQQDTHTRT  253



>gb|ACJ84783.1| unknown [Medicago truncatula]
 gb|AFK49610.1| unknown [Medicago truncatula]
Length=246

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 163/240 (68%), Gaps = 7/240 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF R+++KKSTE F   PYI TLL++SLW++YG +
Sbjct  1    MADPSFFVGVIGNIISILMFLSPVPTFWRMIKKKSTEEFSSFPYICTLLNSSLWTYYGTI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+V+  IY+ LFLIYAP  +++++  + GI++V  L A V  T   L
Sbjct  61   KAGEYLVATVNGFGIVVETIYILLFLIYAPPKMRVKTAILAGILDVLILVAAVVTTQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+ +  +VG++   L I MY SPL+ M+TV+K KSVEY+PF LSFF  LNGG+W  YA+
Sbjct  121  GGEARSGAVGIMGAALNILMYGSPLAVMKTVVKTKSVEYLPFLLSFFFFLNGGVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EE--DPAHLVKGGIEMAND  799
            LVRD  +G+PNG GF+LG+ Q++L+ IY     +K      EE     HL+      ++D
Sbjct  181  LVRDSILGVPNGTGFVLGAIQLVLHGIYRNGKQSKHVSNKLEEGWQHEHLISSSTTRSHD  240



>ref|XP_008441813.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis melo]
Length=264

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/257 (41%), Positives = 162/257 (63%), Gaps = 6/257 (2%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L FI G++GN+IS+++FLAPV TF RI +KK++E F+ IPY+  L+S  L  +Y +LK 
Sbjct  8    QLQFIFGLLGNIISLMVFLAPVPTFWRIYKKKTSEGFQCIPYVVALMSAMLLLYYAVLKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               L++++N  G V+ +IY++L+  YAPK +KI +LK++ I+N+   G +V  T+ +LHG
Sbjct  68   NAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGGTMLILHG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              +  +VG +C    + ++ASPL+ M+ VI+ KSVEYMPF+LSFF  L+  +W  Y   +
Sbjct  128  NKRTHAVGWICAAFNLAVFASPLTIMKRVIRTKSVEYMPFFLSFFLTLSATMWFFYGFFI  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGG--IEMANDVAFKSNG  820
            +DL+I +PN +GFLLG  Q+I+Y IY        EE    L +GG   E+ +    K   
Sbjct  188  KDLFIALPNIVGFLLGMVQMIMYMIYKDRKGNSLEEK---LEEGGKNYEVDDQSLSKVKK  244

Query  821  KDPSEARAHT*LSRTNH  871
             + SE +    +  TNH
Sbjct  245  SNQSETKEIN-MGETNH  260



>ref|XP_007031032.1| Nodulin MtN3 family protein [Theobroma cacao]
 gb|EOY11534.1| Nodulin MtN3 family protein [Theobroma cacao]
Length=265

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 159/237 (67%), Gaps = 8/237 (3%)
 Frame = +2

Query  68   AKLIKFL--EGPVMASLSFI----VGIIG-NVISILMFLAPVKTFKRIVQKKSTENFKGI  226
            ++L K L  EG   +   F+     G  G N++S L++L+P KTF RIV+ +STE+F+ I
Sbjct  2    SRLTKILVHEGKSQSVFGFVSKQTTGQCGCNIMSGLVYLSPTKTFWRIVKHRSTEDFESI  61

Query  227  PYITTLLSTSLWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVG  406
            PY+ TLL+   W +YGL+KP  LLV T+N  G+V   +Y++LFLI+AP  ++ R+  +V 
Sbjct  62   PYVCTLLNAYFWIYYGLIKPNSLLVATINCFGIVAETVYLTLFLIFAPPGLRARTATLVA  121

Query  407  IINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPF  586
            I++V F  A + +T S+LHG  ++   GLLC   ++  Y SPL+AM+TV++ KSVEYMPF
Sbjct  122  ILDVGFPVAAILLTHSMLHGYLRINVAGLLCVVFSMISYGSPLAAMKTVVRTKSVEYMPF  181

Query  587  WLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
             LS    +NGGIW  YA+L +D Y+G+PNGIGF LG+ Q++LY +Y++    K+  D
Sbjct  182  LLSLILFINGGIWTFYALLAKD-YVGVPNGIGFFLGTIQLLLYAMYWKPQKLKKMSD  237



>ref|XP_006495099.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Citrus 
sinensis]
Length=243

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 146/209 (70%), Gaps = 0/209 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASL+FI G++GN+ + L++L+P KTF  IVQ++STE F+ IPYI+ LL+   W +YG++
Sbjct  1    MASLNFIFGLLGNLTTGLVYLSPAKTFWHIVQRRSTEEFESIPYISKLLNAYFWVWYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  +LV +VNG G  L IIYV +FLI+AP  ++ R+  + G+ +V F G  V VT    
Sbjct  61   KPNSVLVASVNGFGAALEIIYVIIFLIFAPPMMRGRTAVLAGVCDVVFPGTTVLVTQIFF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
                ++   G L    ++  Y+SPLSAM+TV+  KSVEYMPF LSF   +NG +W  YA+
Sbjct  121  DRDVQIKVSGFLSLCFSMVAYSSPLSAMKTVVVTKSVEYMPFLLSFILFINGAVWTVYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYY  727
            L +DL+IGIPNG GF+LG+AQ++LY +Y+
Sbjct  181  LTKDLFIGIPNGSGFILGAAQLVLYVMYW  209



>ref|XP_010025254.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Eucalyptus 
grandis]
 gb|KCW61868.1| hypothetical protein EUGRSUZ_H04549 [Eucalyptus grandis]
Length=244

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 152/218 (70%), Gaps = 1/218 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
            ++SF  G++GNV + L++LAPVKTF  I++++STE F+ IPY+  LL+   W++YG++KP
Sbjct  2    TVSFFFGVLGNVTTGLIYLAPVKTFWHILKRRSTEEFESIPYVFKLLNAYFWTYYGIVKP  61

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
              ++V TVNG GVV+ II+V++FL+YAP  ++ R+  +    +V F  A + VT   L  
Sbjct  62   DSVVVATVNGFGVVVEIIFVAIFLLYAPPRMRKRTAILAVTCDVMFPAAAILVTQLTLDR  121

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
            + +++  GLL    ++  Y SPLSAM+TV+  KSVEYMPF LSF   +NGG+W  YA+L 
Sbjct  122  QMQIIVAGLLSAVFSMVAYGSPLSAMKTVVTTKSVEYMPFLLSFALFINGGVWTVYAILT  181

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQ-STPAKEEED  757
            +D +IGIPNG GF LG+AQ+ILY +YY+  T +   ED
Sbjct  182  QDYFIGIPNGTGFGLGTAQMILYAMYYKPRTKSSSAED  219



>ref|XP_008673994.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Zea 
mays]
 tpg|DAA54392.1| TPA: cytochrome c oxidoreductase [Zea mays]
Length=238

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 160/223 (72%), Gaps = 2/223 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+KTF RIV+  STE F+  PY+ TLL+  LW +YG  
Sbjct  1    MDSTLFIIGVIGNIISVLVFISPIKTFWRIVRSGSTEEFEPAPYVFTLLNALLWLYYGAT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKN-IKIRSLKMVGIINVAFLGAV-VAVTLS  454
            KP GLLV TVNG G  +  IYV LF++YA  +  ++++ K+   +++   G V VA T +
Sbjct  61   KPDGLLVATVNGFGAAMEAIYVVLFIVYAANHATRVKTAKLAAALDIGGFGVVFVATTFA  120

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +     ++M +G++C  L + MY SPL+AM+TVI  KSVE+MPF+LSFF  LNGGIWA+Y
Sbjct  121  INELNMRIMVIGMICACLNVLMYGSPLAAMKTVITTKSVEFMPFFLSFFLFLNGGIWATY  180

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            A+L RD+++GIPNGIGF+LG+ Q+I+Y IY  S  ++  ++ A
Sbjct  181  AVLDRDIFLGIPNGIGFILGTIQLIIYAIYMNSKVSQSSKEIA  223



>gb|KGN61326.1| hypothetical protein Csa_2G083730 [Cucumis sativus]
Length=262

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 159/264 (60%), Gaps = 5/264 (2%)
 Frame = +2

Query  86   LEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWS  265
            + G  +  L FI G++GN+IS L+FLAP+ TF  I +KK++E F+ IPY+  L+S  L  
Sbjct  1    MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  266  FYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAV  445
            +Y  LK    L+V++N  G V+ +IY++L+L YAPK  KI +LK+  I N+ F G +V  
Sbjct  61   YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG  120

Query  446  TLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIW  625
            T+  LHG  +  +VG +C    + ++ASPLS M+ VI  KSVEYMPF LSFF  L+  +W
Sbjct  121  TMFFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  626  ASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVA  805
              Y   ++DL+I +PN +GFLLG  Q+I+Y IY  S    EE+    L +G      D  
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEK----LEEGAKFCEEDDQ  236

Query  806  FKSNGKDPSEARAHT*LSRTNHPR  877
              S  K  SE +    ++ TNH +
Sbjct  237  TLSIVKTQSETKEIN-MAETNHYK  259



>ref|XP_006285439.1| hypothetical protein CARUB_v10006856mg, partial [Capsella rubella]
 gb|EOA18337.1| hypothetical protein CARUB_v10006856mg, partial [Capsella rubella]
Length=189

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G ++  IYVSLFL YAP+++K+ ++ +VG++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLNTIIVVGMLNVFFPIVAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYI  661
             L  D+++
Sbjct  181  SLQHDVFL  188



>ref|XP_004155149.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis sativus]
Length=262

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 158/264 (60%), Gaps = 5/264 (2%)
 Frame = +2

Query  86   LEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWS  265
            + G  +  L FI G++GN+IS L+FLAP+ TF  I +KK++E F+ IPY+  L+S  L  
Sbjct  1    MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  266  FYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAV  445
            +Y  LK    L+V++N  G V+ +IY++L+L YAPK  KI +LK+  I N+ F G +V  
Sbjct  61   YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG  120

Query  446  TLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIW  625
            T   LHG  +  +VG +C    + ++ASPLS M+ VI  KSVEYMPF LSFF  L+  +W
Sbjct  121  TXVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  626  ASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVA  805
              Y   ++DL+I +PN +GFLLG  Q+I+Y IY  S    EE+    L +G      D  
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEK----LEEGAKFCEEDDQ  236

Query  806  FKSNGKDPSEARAHT*LSRTNHPR  877
              S  K  SE +    ++ TNH +
Sbjct  237  TLSIVKTQSETKEIN-MAETNHYK  259



>ref|XP_004967517.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Setaria 
italica]
Length=238

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 159/224 (71%), Gaps = 2/224 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S+ FI+GIIGNVIS+L+F++P+KTF RIV+  STE F+  PY+ TLL+  LW +YGL 
Sbjct  1    MDSILFIIGIIGNVISVLLFISPIKTFWRIVRSGSTEEFEAAPYVFTLLNALLWLYYGLT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKN-IKIRSLKMVGIINVAFLGAV-VAVTLS  454
            KP GLL+ TVNG G V+  IYV LF++YA  +  +I++ K+   +++   G V  A T +
Sbjct  61   KPDGLLIATVNGFGAVMEAIYVVLFIVYAADHATRIKAAKLAAALDIGGFGVVFAATTFA  120

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +     ++M +G++C  L + MY SPL+AM+TVI  KSVE+MPF+LSFF  LNGGIWA+Y
Sbjct  121  ISELDLRIMVIGMICACLNVLMYGSPLAAMKTVITTKSVEFMPFFLSFFLFLNGGIWATY  180

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAH  766
            A+L RD+++GIPNGIGF+LGS Q+I+Y IY  S  +    +   
Sbjct  181  AVLDRDIFLGIPNGIGFILGSIQLIIYVIYMNSKVSHSSNETGE  224



>ref|XP_006344691.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Solanum 
tuberosum]
Length=237

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L FI+GIIGN+IS+LMFLAPV TF+RIVQ KSTE+F  +PYI TLL++SLW++YG++
Sbjct  1    METLPFIIGIIGNIISVLMFLAPVGTFRRIVQNKSTEDFDSLPYICTLLNSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GV++  IY++LFL +A K ++  +  + GI+NV  L  ++ +   +L
Sbjct  61   KPGSYLVSTVNGFGVIVETIYIALFLKFADKKMRKNTGILAGILNVGILATILLLAQFIL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            +G+ ++  +G L T L I MY+SPL  M+TV++ KSVE+MPF LSFF  LNGG+W  YA+
Sbjct  121  YGEMRINIIGFLSTCLNIIMYSSPLGVMKTVVRSKSVEFMPFLLSFFFFLNGGVWTLYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            LV D ++G+PNGIG+ LG+ Q+++Y IY   +P    ED
Sbjct  181  LVSDWFLGVPNGIGWFLGAVQLVIYVIY--RSPNSSVED  217



>ref|XP_010449878.1| PREDICTED: bidirectional sugar transporter SWEET17-like isoform 
X2 [Camelina sativa]
Length=218

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G  +  IYVSLFL YAP+++K+ ++ +V ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGAFVETIYVSLFLFYAPRHLKLNTIIVVAMLNVFFPIVAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYI  661
             L  D+++
Sbjct  181  SLQHDVFL  188



>ref|XP_010440233.1| PREDICTED: bidirectional sugar transporter SWEET17 isoform X2 
[Camelina sativa]
Length=218

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF +G+IGNVIS+L+FL+PV+TF +IV+++STE +K +PYI TLL +SLW++YG++
Sbjct  1    MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG G  +  IYVSLFL YAP+++K+ ++ +V ++NV F + A+VA   + 
Sbjct  61   TPGEYLVSTVNGFGAFVETIYVSLFLFYAPRHLKLNTIIVVAMLNVFFPIVAIVATRSAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
               K +  S+G +  GL I MY SPLSAM+TV+  KSV+YMPFWLSFF  LNG IWA YA
Sbjct  121  EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYI  661
             L  D+++
Sbjct  181  SLQHDVFL  188



>ref|XP_010105148.1| Bidirectional sugar transporter SWEET17 [Morus notabilis]
 gb|EXC03956.1| Bidirectional sugar transporter SWEET17 [Morus notabilis]
Length=348

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M   SF VG+IGN+IS+LMFL+PVKTF RIV+++STE+F  +PYI T+LSTSLW++YG+ 
Sbjct  1    MEDFSFFVGVIGNIISVLMFLSPVKTFWRIVKRRSTEDFDSLPYICTVLSTSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV T+NG G+V+  IYV+LFL+YAP  ++ ++  +VGI++V F  A + VT   L
Sbjct  61   KPGEYLVATINGFGIVVETIYVALFLLYAPLKMRAKTAILVGILDVGFFVAAILVTQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T++ ++G L  GL I MY SPL+A++TV+  KSVEYMPF+LSFF  LNGGIW  YA+
Sbjct  121  QGETRIDALGFLGAGLNIIMYVSPLAAIKTVVTTKSVEYMPFFLSFFFFLNGGIWTFYAL  180

Query  641  LVRDLYIG  664
            LVRD ++ 
Sbjct  181  LVRDYFLA  188



>ref|XP_008441812.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
melo]
Length=262

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/262 (40%), Positives = 157/262 (60%), Gaps = 5/262 (2%)
 Frame = +2

Query  86   LEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWS  265
            + G     L FI G++GN+IS L+FLAP+ TF  I +KK++E F+ IPY+  L+S  L  
Sbjct  1    MNGLSAHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  266  FYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAV  445
            +Y  LK    L++++N  G V+ +IY++L+L YAPK  KI +LK+  I N+   G +V  
Sbjct  61   YYAALKTDAYLLISINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGCSGVMVGG  120

Query  446  TLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIW  625
            T+  LHG  +  +VG +C    + ++ASPLS M+ VI+ KSVEYMPF+LSFF  L+  +W
Sbjct  121  TMVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVIRTKSVEYMPFFLSFFLTLSATMW  180

Query  626  ASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVA  805
              Y   ++DL+I +PN +GFLLG  Q+I+Y I Y+    K EE      K   E   +++
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMI-YKDRKGKVEEKLDEGAKFWEEDDQNLS  239

Query  806  FKSNGKDPSEARAHT*LSRTNH  871
                 ++  E      ++ TNH
Sbjct  240  IVKTQRETKEIN----MAETNH  257



>ref|XP_008802109.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=270

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 159/254 (63%), Gaps = 13/254 (5%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F VG++GN+IS L+ LAP+ TF R+ ++KSTE+F+ IPY+  L S  LW +YGLL    
Sbjct  11   AFGVGLLGNIISFLVVLAPMPTFYRVYKRKSTESFQSIPYVVALFSAQLWLYYGLLT-KD  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +L++T+N    ++  IY+S++L YAPK     +LK++ + NV   G++V  +L  + G+ 
Sbjct  70   VLLLTINSATCLIECIYLSIYLTYAPKKAMAFTLKLIFLFNVGLYGSLVLFSLIFVKGRW  129

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +  +VG +C    + ++ +PLS ++ VIK +SVEYMPF LSFF  LN   W  Y +L+++
Sbjct  130  RFQTVGWICATFAVSVFVAPLSIIKLVIKTRSVEYMPFPLSFFLTLNAVAWFCYGLLLKN  189

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQST-----PAKEEED----PAHLVKGGIEMANDVA  805
            +++ +PN +GF+ G AQ+I+YFIY  +      P    +D    PA  +   +E+A+   
Sbjct  190  IFVALPNVVGFVFGMAQMIIYFIYMNANKDEPKPEVTNQDMEAMPAATLNSDVELADK--  247

Query  806  FKSNGKDPSEARAH  847
             KS  + P+EA  H
Sbjct  248  -KSISEKPTEASEH  260



>ref|XP_009135494.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Brassica 
rapa]
 emb|CDX82395.1| BnaA03g34260D [Brassica napus]
Length=231

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 160/222 (72%), Gaps = 1/222 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA LSF VG+IGNVIS+L+FL+PV+TF +IV+++STE ++ +PYI TL+ +SLW++YG++
Sbjct  1    MAELSFYVGVIGNVISVLLFLSPVETFWKIVKRRSTEKYECLPYICTLMGSSLWTYYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAF-LGAVVAVTLSV  457
             PG  LV TVNG GV+   IYV +FL + PK   ++++ +V  +NV F +  +V    + 
Sbjct  61   TPGEYLVSTVNGFGVLAESIYVLIFLFFVPKPKFLKTVALVLALNVIFPVITIVGTRTAF  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
             + KT+  S+G +C  L I MY SPLSA++TV+  +SV+YMPF LSFF  LNG IWA YA
Sbjct  121  GYAKTRSNSMGFICAALNIIMYGSPLSAIKTVVTTRSVKYMPFLLSFFLFLNGAIWAVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            +L+ D+++ +PNG+GF+LG+ Q+++Y  Y  + P   +E+ A
Sbjct  181  LLLHDVFLLVPNGMGFVLGTIQLLIYAFYRNAKPNIVDEEEA  222



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 159/261 (61%), Gaps = 11/261 (4%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS ++FLAPV TF RI +KKSTE F+ IPY+  L S  LW +Y    P  
Sbjct  12   AFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNE  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G ++  IY+++F+++APK I++ +L+ V ++N      ++ VT  ++HG  
Sbjct  72   TLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  VG +C   +I ++A+PL+ +R VI+ KSVE+MPF+LSFF  L+   W  Y + ++D
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDPS  832
            +YI +PN  GF+ G AQ+ILY IY +   A E + P H         +++   S   +  
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQH-------STDNIVIVSAATNSD  244

Query  833  EARAHT*LSRTNHPRNTLRNA  895
            + + H+    ++ P N L  A
Sbjct  245  KQKQHS----SSLPSNNLVGA  261



>ref|NP_001242234.1| uncharacterized protein LOC100808537 [Glycine max]
 gb|ACU19773.1| unknown [Glycine max]
Length=201

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF +I +  STE+F  +PYI TLL+ SLW++YG++
Sbjct  1    MAEASFFVGVIGNIISILMFLSPVPTFWKIKKHGSTEDFSSLPYICTLLNCSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+++  IY+ LFLIYAPK I+ R+  +  I++V  L A++ +T   L
Sbjct  61   KAGEYLVATVNGFGILMETIYIILFLIYAPKGIRGRTAILALILDVVILTAIIIITQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T+  +VG++  GL I MY+SPLS M+TV+  KSVEYMPF LSFF   NG +W  YA+
Sbjct  121  EGETRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFFNGAVWLLYAV  180

Query  641  LVRDLYIGIPNGIGF  685
            LVRD+ +G+PNG GF
Sbjct  181  LVRDVILGVPNGTGF  195



>ref|XP_010927277.1| PREDICTED: bidirectional sugar transporter SWEET6b-like [Elaeis 
guineensis]
Length=246

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 146/217 (67%), Gaps = 2/217 (1%)
 Frame = +2

Query  122  VGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPggl  295
            VG++GNV+S  +FLAPV TF RI ++K+ E+F  +PY+ TLL+  LW FYGL  + PG +
Sbjct  11   VGVVGNVLSFGLFLAPVPTFVRIWKRKAVEDFSPLPYLVTLLNCMLWVFYGLPVVHPGTI  70

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
            LV T+NG GVVL  IY+ +F+ Y+P  +++R LK+V    V   G V+ V L       +
Sbjct  71   LVSTINGVGVVLEAIYLCIFIFYSPNRLRLRLLKIVAFEVVFMAGVVMGVILVAHTHHMR  130

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
             + VG+L      GMYASPLS +R VIK KSVEY+PF+L    + NG  WA+YA++  D+
Sbjct  131  QIIVGVLSVVFCTGMYASPLSILRLVIKTKSVEYLPFYLCLAGLFNGACWATYALIRFDI  190

Query  656  YIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAH  766
            ++ IPNG+G LLG+ Q+++YF YY+STP KE +   H
Sbjct  191  FVLIPNGLGALLGAVQVLIYFCYYRSTPKKEAKSEPH  227



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 159/261 (61%), Gaps = 11/261 (4%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS ++FLAPV TF RI +KKSTE F+ IPY+  L S  LW +Y    P  
Sbjct  12   AFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNE  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G ++  IY+++F+++APK I++ +L+ V ++N      ++ VT  ++HG  
Sbjct  72   TLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  VG +C   +I ++A+PL+ +R VI+ KSVE+MPF+LSFF  L+   W  Y + ++D
Sbjct  132  QVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDPS  832
            +YI +PN  GF+ G AQ+ILY IY +   A E + P H         +++   S   +  
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQH-------STDNIVIVSAATNSD  244

Query  833  EARAHT*LSRTNHPRNTLRNA  895
            + + H+    ++ P N L  A
Sbjct  245  KQKQHS----SSLPSNNLVGA  261



>ref|XP_011023712.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Populus 
euphratica]
Length=239

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 149/220 (68%), Gaps = 1/220 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S+  + GI+GN+ + L++L+P KTF RI + +STE F+ IPYI  LL+   W +YG++
Sbjct  1    MFSIIALFGILGNITTGLVYLSPAKTFWRIARNRSTEEFESIPYICKLLNAYQWVYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAP-KNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            KP  +LV T+NG G V+ ++++ +FL++A  + I++R+  + G++++ F      +   +
Sbjct  61   KPNSVLVATINGFGAVVELVFIVIFLMFASTQKIRVRTAILFGVLDLVFPAVSFLLMQLM  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            LHG+ ++   G+ C   ++  Y SPLSAM+TV+  KSVEYMP  LSFF  +NGG+W  YA
Sbjct  121  LHGQLRIDISGMFCVVFSMITYGSPLSAMKTVVATKSVEYMPLLLSFFLFINGGVWTVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
             L  D +IGIPNG GFLLG+AQ+ILY IY +  P+++  D
Sbjct  181  FLTDDYFIGIPNGTGFLLGTAQLILYVIYMKPKPSEKISD  220



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 144/218 (66%), Gaps = 0/218 (0%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS ++FLAPV TF RI +KKSTE F+ IPY+  L S  LW +Y    P  
Sbjct  12   AFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNE  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G ++  IY+++F+++APK I++ +L+ V ++N      ++ VT  ++HG  
Sbjct  72   TLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  VG +C   +I ++A+PL+ +R VI+ KSVE+MPF+LSFF  L+   W  Y + ++D
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAH  766
            +YI +PN  GF+ G AQ+ILY IY +   A E + P H
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQH  229



>ref|XP_010315469.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Solanum 
lycopersicum]
Length=261

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 163/227 (72%), Gaps = 5/227 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L FI+GIIGN+IS+LMFLAPV TF+RIVQ KSTE+F  +PYI TLL++SLW++YG++
Sbjct  1    METLPFIIGIIGNIISVLMFLAPVGTFRRIVQNKSTEDFDSLPYICTLLNSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GV++  IY++LFL +A + ++  +  + GI+NV  L  ++ +   +L
Sbjct  61   KPGSYLVSTVNGFGVIVETIYIALFLKFADQKMRKNTGILAGILNVGILATILLLAQFIL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            +G+ ++  +G L T L I MY+SPL  M+TV++ KSVEYMPF LSFF  LNGG+W  YA+
Sbjct  121  YGEMRINVIGFLATCLNIIMYSSPLGVMKTVVRSKSVEYMPFLLSFFFFLNGGVWTLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EEDPAH  766
            LVRD ++G+PN +G+ LG+ Q+++Y I      +K+     E+   H
Sbjct  181  LVRDWFLGVPNVVGWFLGAVQLVIYVINRNPNSSKQIVKQLEDQTDH  227



>ref|XP_002318985.1| hypothetical protein POPTR_0013s01590g [Populus trichocarpa]
 gb|EEE94908.1| hypothetical protein POPTR_0013s01590g [Populus trichocarpa]
Length=239

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 150/227 (66%), Gaps = 3/227 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S+  + GI+GN+ + L++L+P KTF RI + +STE F+ IPYI  LL+   W +YG++
Sbjct  1    MFSIITLFGILGNITTGLVYLSPAKTFWRIARNRSTEEFESIPYICKLLNAYQWVYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAP-KNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            KP  +LV T+NG G V+ ++++ +FL++A  + I++R+  + G++++ F      +   +
Sbjct  61   KPNSVLVATINGFGAVVELVFIVIFLMFASTQKIRVRTAILFGVLDLVFPAVSFLLMQLI  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            LHG+ ++   G+ C   ++  Y SPLSAM+TV+  KSVEYMPF LSFF  +NGG+W  YA
Sbjct  121  LHGQLRIDISGMFCVVFSMITYGSPLSAMKTVVATKSVEYMPFLLSFFLFINGGVWTVYA  180

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKG  778
             L  D +IGIPNG GFLLG+AQ+ILY  Y +  P   E+   +L  G
Sbjct  181  FLTEDYFIGIPNGTGFLLGTAQLILYVTYMK--PKSSEKISDNLEDG  225



>ref|XP_010924221.1| PREDICTED: bidirectional sugar transporter SWEET6a-like [Elaeis 
guineensis]
Length=251

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 150/220 (68%), Gaps = 4/220 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGIIGNV+S  +FL+P+ TF +I ++K+ E+F  IPY+ T+L+  LW FYGL  + P  
Sbjct  10   IVGIIGNVLSFGLFLSPLPTFVKITKRKAVEDFSAIPYLATVLNCMLWVFYGLPVVHPNS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG-K  469
            +L+VT+NG G+VL  IY+++F IYAP   +++ LK++    + F+GAV+A  ++  H  K
Sbjct  70   ILIVTINGVGLVLEAIYLAVFFIYAPNRSRLKVLKILAA-EMVFMGAVIAGVIAGAHTHK  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             +   VG+LC      MYASPLS MR VI+ KSV+YMPF+LS    LNG  W  YA+L  
Sbjct  129  ERTFIVGILCVIFGTCMYASPLSVMRLVIRTKSVKYMPFFLSLAAFLNGVCWTVYALLEF  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHL  769
            D+++ +PNG+G L G+ Q+ILYF YY+STP +E +    L
Sbjct  189  DIFVLLPNGLGALFGAMQLILYFCYYRSTPREETKAEVQL  228



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 147/215 (68%), Gaps = 0/215 (0%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS++++LAPV TF RI +KKSTE F+ +PY+  L S  LW +YGLLKP  
Sbjct  11   TFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLWIYYGLLKPDA  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G V+   Y+++F++YAPK  ++ ++K++ ++NV    +++  TL +  G  
Sbjct  71   HLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILLFTLFLAKGSN  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  +G +C   ++ ++A+PLS MR VI+ KSVE+MPF LSFF  L+  +W SY  L++D
Sbjct  131  RVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVMWFSYGFLLKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
             YI +PN +GF+ G AQ++LY IY  +  +  EE 
Sbjct  191  FYIALPNILGFIFGVAQMVLYAIYKDANRSNIEEQ  225



>dbj|BAK03081.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 162/224 (72%), Gaps = 7/224 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+ TF RIV+ +STE+F+  PY+ TLL+T LW +YGL 
Sbjct  1    MNSTLFIIGVIGNIISVLVFVSPIPTFWRIVRNRSTEDFEAAPYVLTLLNTLLWLYYGLT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIK-IRSLKMVGIINVAFLGAV-VAVTLS  454
            KP GLL+ TVNG G V+  IYV LFL+YA  N+K +++ K+V  +++ F G V VA T +
Sbjct  61   KPDGLLIATVNGFGAVMETIYVVLFLVYAADNVKRVKTAKLVAALDIGFFGIVFVATTFA  120

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +     K++ +GL+C  L++ MY SPL+A+RTVI  +SVEYMPF+LSFF  LNGG+WA Y
Sbjct  121  IGGLDMKIIVIGLICACLSVFMYGSPLAAVRTVIASRSVEYMPFFLSFFLFLNGGVWAMY  180

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQS-----TPAKEE  751
            A+L RD+++G+PNGIG  LG  Q+++Y  Y  S     +P  +E
Sbjct  181  AILDRDVFLGVPNGIGCFLGGIQLVIYAAYKNSKVGCQSPNNDE  224



>ref|XP_009379704.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 145/223 (65%), Gaps = 0/223 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+FI G++GN++S + FLAP+ TF  I +KKS++ F+ IPY+  LLS +L  +YG LK 
Sbjct  8    QLAFIFGLLGNIVSFMTFLAPIPTFYTIYKKKSSKGFQSIPYVIALLSATLLLYYGALKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               L++++N  G V+ + Y+ L+++YA KN KI +L  + ++NVA LG VVAVT  +L G
Sbjct  68   NAYLIISINSIGTVIEVTYLILYIVYASKNDKITTLIWILLVNVAALGLVVAVTFFLLGG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    I ++A+PLS MR VI+ KSVE+MPF LSFF  L   +W  Y +  
Sbjct  128  TVRISTVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSFFLTLCATMWFFYGLFT  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVK  775
            +D YI +PN +GFL G AQ+ILY  Y  S    EE+     +K
Sbjct  188  KDYYIALPNVLGFLFGIAQMILYMTYKNSGNNVEEKRSTQEMK  230



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 154/244 (63%), Gaps = 5/244 (2%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS +++LAP+ TF RI +KKSTE F+ +PY+  L S  LW +Y  LKP  
Sbjct  11   TFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLWIYYAFLKPDA  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G  +  +Y+ +F+IYA K ++I ++K++ ++NV     ++ +TL + HG  
Sbjct  71   HLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILLLTLFLAHGTK  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +   VG LC   ++ ++A+PLS MR VI+ KSVE+MPF LSFF  L+  +W SY  L +D
Sbjct  131  RAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVMWFSYGFLQKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDPS  832
            LY+ +PN +GF+ G  Q++LY IY  S     EE      K   E   DV   ++ ++P+
Sbjct  191  LYVALPNILGFIFGILQMLLYVIYKDSKKVIIEEQ-----KVNNEHIIDVRKLNSTENPA  245

Query  833  EARA  844
            E R+
Sbjct  246  EVRS  249



>ref|XP_004138979.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
sativus]
Length=274

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 152/238 (64%), Gaps = 3/238 (1%)
 Frame = +2

Query  86   LEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWS  265
            ++G  +  L FI G++GN+IS ++FLAPV TF  + +KK++E F+ IPY+  L+S  L  
Sbjct  1    MKGLSVHQLQFIFGLLGNIISFMVFLAPVPTFWTVYKKKTSEGFQCIPYVVALMSAMLLL  60

Query  266  FYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAV  445
            +Y +LK    L++++N  G V+ +IY++L+  YAPK +KI +LK++ I+N+   G +V  
Sbjct  61   YYAVLKTNAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGG  120

Query  446  TLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIW  625
            T+ +LHG  +  +VG +C    + ++ASPL+ M+ VI  KSVEYMPF LSFF  L+  +W
Sbjct  121  TMLILHGNKRTHAVGWICAAFNLAVFASPLAIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  626  ASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
              Y   ++DL+I +PN +GFLLG  Q+I+Y IY        EE    L +GG +   D
Sbjct  181  FFYGFFIKDLFIALPNIVGFLLGMVQMIMYMIYKDRKGNSLEEK---LEEGGKKYEVD  235



>emb|CDP09549.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 150/245 (61%), Gaps = 8/245 (3%)
 Frame = +2

Query  134  GNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvn  313
            GN+IS L+FLAP+ TF  I +KK++E F+ IPY+  L S SL  +Y  LK   LL+VT+N
Sbjct  27   GNIISFLVFLAPLPTFYTIYKKKTSEGFQSIPYVVALFSASLLLYYAFLKTNALLIVTIN  86

Query  314  gtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGL  493
              G ++  IY+S++++YAPK  K+ +LK++G  N+  LG +VAV+L++  G  ++  VG 
Sbjct  87   AIGCIIETIYLSMYVLYAPKTSKMFTLKLLGFFNIGCLGVIVAVSLALAKGAKRVSLVGW  146

Query  494  LCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPN  673
             C  + + ++A+PLS M  VI+ KSVEYMPF LSFF  L    W  Y   VRD YI +PN
Sbjct  147  FCAVINLAVFAAPLSIMAQVIRTKSVEYMPFTLSFFLTLCATSWFFYGFFVRDYYIAVPN  206

Query  674  GIGFLLGSAQIILYFIYYQSTPAKE---EEDPAHLVKGGIEM----ANDVAFKSNGKDPS  832
             +GFL G  Q+ILYFIY  +    E   + + A   K GI+M      D  F S  K P 
Sbjct  207  VMGFLFGIVQMILYFIYKNAKKDGEINTKLEGAMEQKEGIQMNIEGVEDKKFSSIEK-PK  265

Query  833  EARAH  847
             A AH
Sbjct  266  SAAAH  270



>dbj|BAJ96341.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 162/224 (72%), Gaps = 7/224 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+ TF RIV+ +STE+F+  PY+ TLL+T LW +YGL 
Sbjct  20   MNSTLFIIGVIGNIISVLVFVSPIPTFWRIVRNRSTEDFEAAPYVLTLLNTLLWLYYGLT  79

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIK-IRSLKMVGIINVAFLGAV-VAVTLS  454
            KP GLL+ TVNG G V+  IYV LFL+YA  N+K +++ K+V  +++ F G V VA T +
Sbjct  80   KPDGLLIATVNGFGAVMETIYVVLFLVYAADNVKRVKTAKLVAALDIGFFGIVFVATTFA  139

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +     K++ +GL+C  L++ MY SPL+A+RTVI  +SVEYMPF+LSFF  LNGG+WA Y
Sbjct  140  IGGLDMKIIVIGLICACLSVFMYGSPLAAVRTVIASRSVEYMPFFLSFFLFLNGGVWAMY  199

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQS-----TPAKEE  751
            A+L RD+++G+PNGIG  LG  Q+++Y  Y  S     +P  +E
Sbjct  200  AILDRDVFLGVPNGIGCFLGGIQLVIYAAYKNSKVGCQSPNNDE  243



>ref|XP_008800934.1| PREDICTED: bidirectional sugar transporter SWEET5-like [Phoenix 
dactylifera]
Length=251

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 156/242 (64%), Gaps = 9/242 (4%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGIIGNV+S  +FL+PV TF +I ++K+ E+F  IPY+ T L+  LW FYGL  + P  
Sbjct  10   IVGIIGNVLSFALFLSPVPTFVKIWKRKAVEDFSPIPYLATFLNCMLWVFYGLPVVHPNS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG-K  469
            +L+VT+NG G VL  IY+++F IYAP   +++ LK++ +  + F+G+VVA  ++  H  K
Sbjct  70   ILIVTINGIGFVLEAIYLTIFFIYAPNRSRLKVLKILAV-ELVFMGSVVAGVIAGEHTYK  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             +   VG+ C      MYASPLS MR VI+ KSV+YMPF+LS    LNG  W  YA L  
Sbjct  129  KRTFIVGIFCVIFGSCMYASPLSVMRLVIRTKSVKYMPFFLSLTAFLNGVCWTVYAFLKF  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDP  829
            D+++ IPNG+G LLG+ Q++LYF YY+STP +E +    L      ++  +A  +  K+P
Sbjct  189  DIFVVIPNGLGALLGAMQLLLYFCYYRSTPREETKGELQL-----PVSASMAPSAGHKEP  243

Query  830  SE  835
              
Sbjct  244  KN  245



>dbj|BAJ85375.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 169/244 (69%), Gaps = 5/244 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+ TF R+V+ +STE+F+  PY+ TLL+T LW +YGL 
Sbjct  20   MNSTLFIIGVIGNIISVLVFVSPIPTFWRLVRNRSTEDFEAAPYVLTLLNTLLWLYYGLT  79

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIK-IRSLKMVGIINVAFLGAV-VAVTLS  454
            KP GLL+ TVNG G V+  IYV LFL+YA  N+K +++ K+V  +++ F G V VA T +
Sbjct  80   KPDGLLIATVNGFGAVMETIYVVLFLVYAADNVKRVKTAKLVAALDIGFFGIVFVATTFA  139

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +     K++ +GL+C  L++ MY SPL+A+RTVI  +SVEYMPF+LSFF  LNGG+WA Y
Sbjct  140  IGGLDMKIIVIGLICACLSVFMYGSPLAAVRTVIASRSVEYMPFFLSFFLFLNGGVWAMY  199

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQS---TPAKEEEDPAHLVKGGIEMANDVA  805
            A+L RD+++G+PNGIG  LG  Q+++Y  Y  S     +   ++ A+     +  ++D  
Sbjct  200  AILDRDVFLGVPNGIGCFLGGIQLVIYAAYKNSKVGCQSPNNDEVAYDASTSLLSSDDRR  259

Query  806  FKSN  817
            +  N
Sbjct  260  YGQN  263



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 153/250 (61%), Gaps = 20/250 (8%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +FI G++GNVIS ++FLAP+ TF +I +KKST+ F+ +PYI  L S+ LW +Y L+K   
Sbjct  9    AFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKDA  68

Query  293  llvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             L++    +   V+  IY+++FLIYAP   ++ ++K++ ++NV   GA++  TL +  G 
Sbjct  69   SLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTGS  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             +L  +G +C  L I ++A+PL  M+ VIK KSVE+MPF LSFF  +N  +W  Y +L++
Sbjct  129  KRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLK  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE---------------DPAHLVKGG-  781
            D YI +PN +GFL G  Q++LY IY  + P   EE                P H+ K G 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNHVTKNGP  248

Query  782  ---IEMANDV  802
               IE A++V
Sbjct  249  VPVIETASNV  258



>emb|CAN77271.1| hypothetical protein VITISV_022055 [Vitis vinifera]
Length=245

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 158/228 (69%), Gaps = 8/228 (4%)
 Frame = +2

Query  101  MASLSFIVGIIGNV-----ISILMFLAPV---KTFKRIVQKKSTENFKGIPYITTLLSTS  256
            MA+LSFI G+IG           +FL  +    TF RIV+ +STE F+ +PY+++L ++S
Sbjct  1    MATLSFISGVIGKTPIQFSREYYLFLGHICAGPTFSRIVKHRSTEEFESLPYVSSLATSS  60

Query  257  LWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAV  436
            LW FYGL+K GGLL+ TVNG G+++ ++YV LFLI+AP  ++ ++  +V  +NV F   V
Sbjct  61   LWVFYGLMKSGGLLIATVNGFGIIIELVYVILFLIFAPTRMRAKTAILVVTLNVGFPAGV  120

Query  437  VAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNG  616
            V +TL  + G  +L  +G++C  L I MY SP +AM+ V+  KSVEYMPF LSFF +LNG
Sbjct  121  VLITLIAMDGDLRLDVLGIVCAVLNILMYGSPFTAMKKVVMTKSVEYMPFLLSFFLLLNG  180

Query  617  GIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDP  760
             IW  YA+LV+D ++G+PNGIGF+LG+AQI+LY +Y++S  ++   D 
Sbjct  181  AIWTFYAILVKDFFVGVPNGIGFILGAAQIVLYAMYWKSKTSQNLSDD  228



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 156/279 (56%), Gaps = 20/279 (7%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggl  295
            F  G++GN+IS ++FLAPV TF RI +KKSTE F+ +PY+  L S  LW +Y        
Sbjct  12   FAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNET  71

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
            L++T+N  G ++  +Y+++F+++APK I++ +L+ V ++N      ++ VT  ++HG  +
Sbjct  72   LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSNQ  131

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
            +  VG +C   ++ ++A+PL+ MR VI+ KSVE+MPF LSFF  L+   W  Y + ++D+
Sbjct  132  VKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKDI  191

Query  656  YIGIPNGIGFLLGSAQIILYFIY--YQSTPAKEEEDPAHLVKGGIEMAN-----------  796
            Y+ +PN +GF+ G AQ+ILY IY  Y+   AKE + P       I M             
Sbjct  192  YVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTKMDDIAMKQKQDSSVEAIEV  251

Query  797  -------DVAFKSNGKDPSEARAHT*LSRTNHPRNTLRN  892
                   ++   +   D  +   H  L   NH    L +
Sbjct  252  IITTNIEEIELGNGNNDDDDKHNHKTLEVINHQITDLNH  290



>gb|ACG28395.1| cytochrome c oxidoreductase [Zea mays]
Length=238

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 160/223 (72%), Gaps = 2/223 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+KTF RIV   STE F+  PY+ TLL+  LW +YG  
Sbjct  1    MDSTLFIIGVIGNIISVLVFISPIKTFWRIVWSGSTEEFEPAPYVLTLLNALLWLYYGAT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKN-IKIRSLKMVGIINVAFLGAV-VAVTLS  454
            KP GLLV TVNG G  +  IYV LF++YA  +  +++++K+   +++   G V VA T +
Sbjct  61   KPDGLLVATVNGFGAAMEAIYVVLFIVYAANHATRVKTVKLAAALDICGFGVVFVATTFA  120

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +     ++M +G++C  L + MY SPL+AM+TVI  KSVE+MPF+LSFF  LNGGIWA+Y
Sbjct  121  INELNLRIMVIGMICACLNVLMYGSPLAAMKTVITTKSVEFMPFFLSFFLFLNGGIWATY  180

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            A+L RD+++GIPNGIGF+LG+ Q+I+Y IY  S  ++  ++ A
Sbjct  181  AVLDRDIFLGIPNGIGFVLGTIQLIIYAIYMNSKVSQSSKEIA  223



>ref|XP_007205793.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
 gb|EMJ06992.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
Length=244

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 157/258 (61%), Gaps = 14/258 (5%)
 Frame = +2

Query  77   IKFLEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTS  256
            +KFL       L+F+ G++GN++S ++FLAP+ TF  I +KKS++ F+ IPY+  LLS  
Sbjct  1    MKFLSNE---QLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSAM  57

Query  257  LWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAV  436
            L  +YG+LK    L++++NG G V+ IIY+  ++++A K  KI ++ ++ ++NVA  G V
Sbjct  58   LLLYYGVLKTNAFLIISINGIGCVIEIIYLIFYIVHASKKDKITTMSLILLVNVAAFGLV  117

Query  437  VAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNG  616
            +AVTL +L    ++ +VG +C    I ++A+PLS +R VI+ KSVEYMPF LSFF  L  
Sbjct  118  MAVTLFLLGEAKRVSAVGWMCAVFNIAVFAAPLSIVRQVIRTKSVEYMPFSLSFFLTLCA  177

Query  617  GIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAN  796
             +W  Y +  +D YI +PN +GFLLG AQ+ILY  Y  S     E       KG  EM  
Sbjct  178  TMWFFYGLFTKDYYIALPNVLGFLLGVAQMILYLKYKNSGKNDAEN------KGSQEMK-  230

Query  797  DVAFKSNGKDPSEARAHT  850
                K +   P EA A  
Sbjct  231  ----KFHEPQPPEADAQC  244



>ref|XP_006433444.1| hypothetical protein CICLE_v10003933mg [Citrus clementina]
 gb|ESR46684.1| hypothetical protein CICLE_v10003933mg [Citrus clementina]
Length=265

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 146/231 (63%), Gaps = 22/231 (10%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MASL+FI G++GN+ + L++L+P KTF  IVQ++STE F+ IPYI+ LL+   W +YG++
Sbjct  1    MASLNFIFGLLGNLTTGLVYLSPAKTFWHIVQRRSTEEFESIPYISKLLNAYFWVWYGIV  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  +LV +VNG G  L IIYV +FLI+AP  ++ R+  + G+ +V F G  V VT    
Sbjct  61   KPNSVLVASVNGFGAALEIIYVIIFLIFAPPMMRGRTAVLAGVCDVVFPGTTVLVTQIFF  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAM----------------------RTVIKMKSVE  574
                ++   G L    ++  Y+SPLSAM                      +TV+  KSVE
Sbjct  121  DRDVQIKVSGFLSLCFSMVAYSSPLSAMCIQNFSPFHKIIVALIMEMKMQKTVVVTKSVE  180

Query  575  YMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYY  727
            YMPF LSF   +NG +W  YA+L +DL+IGIPNG GF+LG+AQ++LY +Y+
Sbjct  181  YMPFLLSFILFINGAVWTVYAVLTKDLFIGIPNGSGFILGAAQLVLYVMYW  231



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 156/261 (60%), Gaps = 11/261 (4%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggl  295
            F  G++GN+IS ++FLAPV TF RI +KKSTE F+ +PY+  L S  LW +Y        
Sbjct  12   FAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNET  71

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
            L++T+N  G ++  +Y+++F+++APK I++ +L+ V ++N      ++ VT  ++HG  +
Sbjct  72   LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSNQ  131

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
            +  VG +C   ++ ++A+PL+ MR VI+ KSVE+MPF LSFF  L+   W  Y + ++D+
Sbjct  132  VKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKDI  191

Query  656  YIGIPNGIGFLLGSAQIILYFIY--YQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDP  829
            Y+ +PN +GF+ G AQ+ILY IY  Y+   AKE + P        +   D+  K   K  
Sbjct  192  YVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPE-------QTTVDIVMKQ--KQD  242

Query  830  SEARAHT*LSRTNHPRNTLRN  892
            S   A   + +TN     L N
Sbjct  243  SSVEAIEVIIKTNIEEIELSN  263



>ref|XP_008655823.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Zea 
mays]
 gb|AFW80577.1| cytochrome c oxidoreductase [Zea mays]
Length=239

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 161/223 (72%), Gaps = 2/223 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+KTF RIV+  +TE F+  PY+ TLL+  LW +YGL 
Sbjct  1    MDSTLFIIGVIGNIISVLVFISPIKTFWRIVRGGTTEEFEPAPYVLTLLNALLWLYYGLT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKN-IKIRSLKMVGIINVAFLGAV-VAVTLS  454
            KP G LV TVNG G V+  IYV LF++YA  +  ++++ K+   +++   G V  A T +
Sbjct  61   KPDGFLVATVNGFGAVMEAIYVVLFIVYAANHATRVKTAKLAAALDIGGFGVVFAATTFA  120

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +   + ++M +G++C  L + MY SPL++M+TVI  KSVE+MPF+LSFF  LNGG+WA+Y
Sbjct  121  ISEFELRIMVIGMICACLNVLMYGSPLASMKTVITTKSVEFMPFFLSFFLFLNGGVWATY  180

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            A+L RD+++GIPNGIGF+LG+ Q+I+Y IY  S  ++  ++ A
Sbjct  181  AVLDRDIFLGIPNGIGFVLGTIQLIVYAIYMNSKASQCSKETA  223



>emb|CDP11998.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 154/241 (64%), Gaps = 3/241 (1%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LK  283
            L  + G+IGN   + +FLAP  TFKRI++K+STE+F G+PY   LL+  L+++YGL  + 
Sbjct  5    LHTVFGVIGNACGLFLFLAPTITFKRILRKRSTEDFSGVPYTMALLNCLLYAWYGLPFVS  64

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            P  +LV  +NGTG VL  IYV +FLI APK  K +   ++ ++   F  AVV V++  LH
Sbjct  65   PNNILVSIINGTGAVLESIYVLIFLILAPKKEKAKVFGILVLVLTTF-AAVVLVSMLALH  123

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
            GKT+ + VGL+ T  +I MYA+PLS MR VIK KSVEYMPF+LS F  L G  W  Y M+
Sbjct  124  GKTRKLFVGLIATIFSIAMYAAPLSVMRLVIKAKSVEYMPFFLSLFVFLTGTTWFIYGMI  183

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGK  823
             +D ++ +PNG G +LG+ Q++LY IY+++     +      ++ GIE ++     +N +
Sbjct  184  GKDPFLAVPNGFGCVLGAMQLMLYAIYHKNKGDNNKGVANGSLEMGIEQSHQQKHATNDR  243

Query  824  D  826
             
Sbjct  244  Q  244



>gb|ACG37138.1| cytochrome c oxidoreductase [Zea mays]
Length=240

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 161/223 (72%), Gaps = 2/223 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M S  FI+G+IGN+IS+L+F++P+KTF RIV+  +TE F+  PY+ TLL+  LW +YGL 
Sbjct  1    MDSTLFIIGVIGNIISVLVFISPIKTFWRIVRGGTTEEFEPAPYVLTLLNALLWLYYGLT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKN-IKIRSLKMVGIINVAFLGAV-VAVTLS  454
            KP G LV TVNG G V+  IYV LF++YA  +  ++++ K+   +++   G V  A T +
Sbjct  61   KPDGFLVATVNGFGAVMEAIYVVLFIVYAANHATRVKTAKLAAALDIGGFGVVFAATTFA  120

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
            +   + ++M +G++C  L + MY SPL++M+TVI  KSVE+MPF+LSFF  LNGG+WA+Y
Sbjct  121  ISEFELRIMVIGMICACLNVLMYGSPLASMKTVITTKSVEFMPFFLSFFLFLNGGVWATY  180

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            A+L RD+++GIPNGIGF+LG+ Q+I+Y IY  S  ++  ++ A
Sbjct  181  AVLDRDIFLGIPNGIGFVLGTIQLIVYAIYMNSKASQCSKETA  223



>ref|XP_004302124.1| PREDICTED: bidirectional sugar transporter NEC1-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 153/244 (63%), Gaps = 2/244 (1%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+F  G++GN++S ++FLAP+ TF RI +KKS+E F+ IPY+  LLS  L  +YG++K 
Sbjct  8    QLAFSFGLLGNIVSFMVFLAPMPTFYRIYKKKSSEGFQSIPYVVALLSAMLLLYYGVIKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
              +L++++N  G+V+ + Y+  +L YAPK  +I +L ++ ++NVAF G  +A T+ +L G
Sbjct  68   NAILIISINAFGIVIEVAYLIFYLTYAPKKQRIFTLNLILLVNVAF-GLTLAATIFLLSG  126

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    I ++A+PLS MR VI+ KSVE+MPF LS F  L    W  Y +  
Sbjct  127  TKRVAAVGWICAVFNIAVFAAPLSIMREVIRTKSVEFMPFGLSLFLTLCATTWFFYGLFT  186

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKG-GIEMANDVAFKSNGK  823
            +D YI +PN +GFL G AQ+ILY +Y  S    +E +      G  +EM   V  KS   
Sbjct  187  KDYYIALPNVLGFLFGIAQMILYMVYRNSGKDHDEVEAKTRTNGDDLEMRYKVISKSKTT  246

Query  824  DPSE  835
            + ++
Sbjct  247  NHNK  250



>ref|XP_010105312.1| Bidirectional sugar transporter SWEET17 [Morus notabilis]
 gb|EXC04309.1| Bidirectional sugar transporter SWEET17 [Morus notabilis]
Length=258

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 154/255 (60%), Gaps = 30/255 (12%)
 Frame = +2

Query  143  ISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtg  322
            +S L++++P   F RI ++ STE F+ IPY++ LL+   W +YGL+KP  LLV TVN  G
Sbjct  1    MSGLVYISPANVFWRICKRGSTEEFESIPYVSKLLNAYFWIYYGLIKPDSLLVATVNMFG  60

Query  323  vvlHIIYVSLFLIYAPKNIK-----------------------IRSLKMVGIINVAFLGA  433
             V+ II++++FL++AP  +K                       IR+  +V +++V F  A
Sbjct  61   AVVEIIFLTIFLLFAPPRMKVNLSSSSSSSSSSCLNPFNLLFQIRTAILVVVLDVVFPAA  120

Query  434  VVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLN  613
             +  T  +LHG T++   GLLC   ++  YASPLSA++T++  KSVEYMPF LSF   LN
Sbjct  121  AILCTHFLLHGDTRIDVAGLLCVAFSMVAYASPLSAIKTLLLTKSVEYMPFLLSFILFLN  180

Query  614  GGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAK------EEEDPAH-LV  772
            GG+W +YA+L +DL++G+PNG GF LG+ Q+ILY IY++   ++      E +D    L+
Sbjct  181  GGVWTAYALLAKDLFVGLPNGTGFFLGTLQLILYAIYWKPKSSRRIVDDLEHQDKREPLI  240

Query  773  KGGIEMANDVAFKSN  817
            K   ++  D   ++ 
Sbjct  241  KSSEQLQQDTHTRTT  255



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 150/225 (67%), Gaps = 6/225 (3%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN+IS+++FL+P+ TF R+ +KKSTE F+  PY+ TL S  LW FY LLK G 
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKTGA  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +L+VT+NG G V+  +Y++++L+YAP+  ++ + KM+  +NV   G V  VT+ + +G  
Sbjct  72   VLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVSLVTMVLSNGNL  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  +G +C  + + ++A+PLS MR VI+ KSVE+MPF LSFF VL+  IW +Y  L +D
Sbjct  132  RVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALKKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA------KEEEDPAHL  769
            +++  PN +GF+ G AQ+ LY  Y    PA      +E + P H+
Sbjct  192  VFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEHV  236



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 156/261 (60%), Gaps = 11/261 (4%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggl  295
            F  G++GN+IS ++FLAPV TF RI +KKSTE F+ +PY+  L S  LW +Y        
Sbjct  12   FAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNET  71

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
            L++T+N  G ++  +Y+++F+++APK I++ +L+ V ++N      ++ VT  ++HG  +
Sbjct  72   LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSNQ  131

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
            +  VG +C   ++ ++A+PL+ MR VI+ KSVE+MPF LSFF  L+   W  Y + ++D+
Sbjct  132  VKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKDI  191

Query  656  YIGIPNGIGFLLGSAQIILYFIY--YQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDP  829
            Y+ +PN +GF+ G AQ+ILY IY  Y+   AKE + P        +   D+  K   K  
Sbjct  192  YVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPE-------QTTVDIVMKQ--KQD  242

Query  830  SEARAHT*LSRTNHPRNTLRN  892
            S   A   + +TN     L N
Sbjct  243  SSVEAIEVIIKTNIEEIELSN  263



>ref|XP_010243612.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=270

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 143/206 (69%), Gaps = 0/206 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
            +L+F  G++GN++S +++LAPV TF RI +KKSTE F+ IPY+  LLS  LW +Y +LK 
Sbjct  9    TLAFAFGLLGNIVSFMVYLAPVPTFYRIYKKKSTEGFQSIPYVVALLSAMLWIYYAMLKN  68

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
             G ++ T+NG G  +  IY++++L+YAPK  ++ +LK++ ++NV   G ++ +T  + +G
Sbjct  69   EGAMLETINGIGCSIEAIYITIYLVYAPKEARVFTLKLLLLLNVGAYGLILLLTFLLTNG  128

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++M VG +C G +I ++ASPLS MR VI+ KSVE+MPF LSFF  L   +W  Y +L 
Sbjct  129  SRQVMVVGWICAGFSISVFASPLSIMRQVIRTKSVEFMPFLLSFFLTLCAVLWFCYGLLK  188

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIY  724
             DLYI IPN +GF  G  Q+ILY +Y
Sbjct  189  NDLYIAIPNVLGFAFGITQMILYMVY  214



>ref|XP_010548982.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Tarenaya 
hassleriana]
Length=218

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 131/176 (74%), Gaps = 1/176 (1%)
 Frame = +2

Query  134  GNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvn  313
            GNVIS+L+FL+PV+TF RIV+++STE ++ +PYI TLL +SLW+FYG++ PG  LV TVN
Sbjct  12   GNVISVLVFLSPVETFWRIVRRRSTEEYESLPYICTLLGSSLWTFYGMVTPGEYLVATVN  71

Query  314  gtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK-TKLMSVG  490
            G G ++  IYVSLFL+YAP   K+++  +VG++NV F    +A T      + T+  ++G
Sbjct  72   GFGALVESIYVSLFLLYAPPPKKLKTALLVGMLNVCFPATAIAATRIAFREENTRSHAMG  131

Query  491  LLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLY  658
             +C GL I MY SPLSAM+TV+  KSVEYMPFWLSFF  LNG IWA+YA L+ D++
Sbjct  132  FICAGLNILMYGSPLSAMKTVVTTKSVEYMPFWLSFFLFLNGAIWAAYASLLHDVF  187



>ref|XP_006344690.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Solanum 
tuberosum]
Length=230

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 157/224 (70%), Gaps = 0/224 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L FI+G +GN+ S L+FL+PV TF RIV+  STE+F  +PYI TLL++SLW++YG++
Sbjct  1    MENLPFIIGFLGNIFSGLVFLSPVGTFNRIVKNGSTEDFDSLPYICTLLNSSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG GV++  IY++LFL +A   ++ ++  + G++N+  LG ++ +   +L
Sbjct  61   KPGSYLVSTVNGFGVIVETIYIALFLQFAHPKMRNKTASLAGVLNLGILGTILLLGQLLL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            HG+ ++  +G L  GLTI MY+SP   ++TV+  KSVEYMPF+LSFF  LNGG+W  YA+
Sbjct  121  HGQMRINVIGFLTAGLTIIMYSSPFGVVKTVVTTKSVEYMPFFLSFFLFLNGGVWTLYAL  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLV  772
            LV D ++G+ NG G  LG+ Q+I+Y IY     +K+ ED    +
Sbjct  181  LVGDWFVGVSNGTGCFLGAVQLIIYVIYRNPNSSKQLEDQTECL  224



>ref|XP_007138928.1| hypothetical protein PHAVU_009G249700g [Phaseolus vulgaris]
 gb|ESW10922.1| hypothetical protein PHAVU_009G249700g [Phaseolus vulgaris]
Length=245

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 161/226 (71%), Gaps = 4/226 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M   SFI G+IGN+ISILMFL+PV TF +I+++KSTE+F  +PYI TLL+ SLW++YG +
Sbjct  1    MEDASFIFGVIGNIISILMFLSPVPTFWKIIKQKSTEDFSSLPYICTLLNCSLWTYYGTI  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KPG  LV TVNG G+++ IIY+ LFLIYA K+I++R+  +  I++V    A VA TL  L
Sbjct  61   KPGEYLVATVNGFGILVEIIYIILFLIYAQKSIRVRTAILAVILDVVIFAAAVATTLLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G  +  +VG++  GL I MY+SPLS M+TV+  KSVEYMPF LSFF  LNGG+W  YA+
Sbjct  121  QGDGRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFLNGGVWLLYAV  180

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQS----TPAKEEEDPAH  766
            LVRD+ +G+PNG GFLLG+ Q+ LY IY       +  + EE   H
Sbjct  181  LVRDVILGVPNGTGFLLGAMQLGLYCIYRNGGRKVSEKRLEEGMQH  226



>ref|XP_010693601.1| PREDICTED: bidirectional sugar transporter SWEET17-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=241

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 134/202 (66%), Gaps = 1/202 (0%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggll  298
            + G +G ++S L +++PV TF RIV+ KSTE F+ +PYI T+L+++LW++YG++KP   +
Sbjct  8    VFGSLGTILSFLQYVSPVPTFYRIVKNKSTEEFESLPYICTVLNSALWTYYGIIKPDYFV  67

Query  299  vvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKL  478
                     +   IYV LF+ YAP   K ++  M  I+N+  +GA + VT   +HG+ + 
Sbjct  68   SAVNGFGAAL-EAIYVLLFIKYAPPKKKAKTATMASILNIGVVGAAILVTYFGVHGQLRT  126

Query  479  MSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLY  658
              VGL+C    + MYASPL+ + TVI  KSVEYMPF LSF   + GG+W  YA+LV D +
Sbjct  127  QVVGLICLTPMVAMYASPLAVLETVITTKSVEYMPFGLSFVLFVTGGVWTVYAILVHDYF  186

Query  659  IGIPNGIGFLLGSAQIILYFIY  724
            +G+PNGIGFL G+ Q+I+Y IY
Sbjct  187  LGVPNGIGFLFGAIQLIVYCIY  208



>ref|XP_010519561.1| PREDICTED: bidirectional sugar transporter SWEET5 [Tarenaya hassleriana]
Length=245

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 154/231 (67%), Gaps = 4/231 (2%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--L  280
            S+  IVGI+GNVIS  +F +P+ TF +I + ++   FK  PY+ T+L+  +WSFYG+  +
Sbjct  6    SVRTIVGIVGNVISFGLFCSPIPTFMKIWKARTVGEFKPDPYVATVLNCMMWSFYGMPFV  65

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
             P  LLV+T+N TG+++ ++YV++F  ++P   + + + M  +I V F+  V+  T+ +L
Sbjct  66   HPDSLLVITINATGLLMELVYVAIFFYFSPWPSR-KKITMALVIEVVFMATVILCTMYLL  124

Query  461  HG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            H  K + M +G++C    I MYASPL+ M+TVI+ KSV+YMPF+LS    +NG +WA YA
Sbjct  125  HTTKARSMLIGIMCIVFNIIMYASPLTVMKTVIRTKSVKYMPFFLSIANFMNGCVWAVYA  184

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEM  790
            +L  D YI IPNG+G + G+ Q+ILY +YY++T   +EE+  H  K   E+
Sbjct  185  LLQFDPYILIPNGLGTISGAIQLILYALYYKTTRWTDEEEEEHKRKMDAEL  235



>ref|XP_009337947.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 147/223 (66%), Gaps = 0/223 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+FI G++GN++S ++FLAP+ TF  I +KKS++ F+ IPY+  LLS +L  +YG+LK 
Sbjct  8    QLAFIFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               L+V++NG G+V+ + Y+ L+++YA K  KI +L ++ ++NVA  G V+AVT+ +L G
Sbjct  68   NAYLIVSINGIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVATFGLVLAVTVFLLGG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    I ++A+PLS MR VI+ KSVE+MPF LS F  L   +W  Y +  
Sbjct  128  TARICAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLFT  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVK  775
            +D YI +PN +GFL G AQ+ILY  Y  S    E +     +K
Sbjct  188  KDYYIALPNVLGFLFGVAQMILYMTYKNSGKDVEAKKSTMEMK  230



>ref|XP_010027132.1| PREDICTED: bidirectional sugar transporter NEC1-like [Eucalyptus 
grandis]
Length=268

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/246 (39%), Positives = 154/246 (63%), Gaps = 1/246 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+FI G++GN++S L+FLAP+ TF  I +KKS++ ++ IPY+  L S SL  +YG+LK 
Sbjct  8    ELAFIFGLLGNIVSFLVFLAPIPTFYAIFKKKSSDGYQSIPYVVALSSASLLLYYGVLKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               +++++N  G+V+ + Y+ LFLIYA    K+   K++ + NV   G ++A+T+ +L G
Sbjct  68   NATMIISINAIGIVIELTYLILFLIYASTKEKMYVAKLMLVFNVGGFGVMMALTIFLLKG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    + ++A+PLS MR VIK KSVE+MPF LSFF  L    W  Y + V
Sbjct  128  PQRVDAVGWICAAFNLAVFAAPLSIMRRVIKTKSVEFMPFTLSFFLTLCATAWFFYGLFV  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIY-YQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGK  823
            +D++I +PN +GFL G AQ+ILY IY Y +    E +  ++  +  ++M    +  S  +
Sbjct  188  KDMFIALPNTLGFLFGIAQMILYMIYKYGNKKLAETDKGSNQQEVSLDMEKMASISSAQQ  247

Query  824  DPSEAR  841
             P+   
Sbjct  248  HPTSQH  253



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 155/261 (59%), Gaps = 12/261 (5%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
            +L F  GI+GN++S  ++LAPV TF RI +KKSTE F+ IPY+  L S  LW +Y LLK 
Sbjct  8    TLVFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWIYYALLKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               +++T+NG G  +  IY++L+L+YAPK  KI ++K++ ++N+   G ++ ++     G
Sbjct  68   NVTMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILLLSFLFFKG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++  VG +C G ++ ++A+PLS MR VI+ KSVE+MP  LSFF  L    W  Y +L+
Sbjct  128  FGRVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVFWFFYGILM  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTP------AKEEEDPAHLVKGGIEMANDVAF  808
            +DLYI IPN +GF LG AQ+ILY IY  S           E DP+ +     E       
Sbjct  188  KDLYIAIPNVLGFALGVAQMILYIIYRDSKKHLIVELKLPELDPSIIKPSTTEAPKT---  244

Query  809  KSNGKDPSEARAHT*LSRTNH  871
            +S    P+    H   + TNH
Sbjct  245  QSTINLPAAEPQH---NETNH  262



>ref|XP_003565716.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Brachypodium 
distachyon]
Length=255

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 147/207 (71%), Gaps = 5/207 (2%)
 Frame = +2

Query  146  SILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvvtvngtgv  325
            S+L+F++PV TF RIV+  STE F+  PY+ TLL+  LW +YGL KP GLL+ TVNG G 
Sbjct  16   SVLVFISPVTTFWRIVRGGSTEEFEPAPYVMTLLNALLWLYYGLTKPDGLLIATVNGFGA  75

Query  326  vlHIIYVSLFLIYAPKN-IKIRSLKMVGIINVAFLGAVVAVT-LSVLHGKTKLMSVGLLC  499
            ++  IYV LFLIYA  +  ++++ K+V  +++AF G V A T  ++     K+M VGL+C
Sbjct  76   LMEAIYVVLFLIYANDHGTRVKTAKLVAALDIAFFGVVFATTTFAIAELDMKIMVVGLIC  135

Query  500  TGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGI  679
              L++ MY SPL+AMRTVI  +SVEYMPF+LSFF  LNGG+WA YA+L RD+++G+PNG 
Sbjct  136  ACLSVFMYGSPLAAMRTVITTRSVEYMPFFLSFFLFLNGGVWAFYALLDRDVFLGVPNGF  195

Query  680  GFLLGSAQIILYFIYYQ---STPAKEE  751
            G +LG  Q+I+Y +Y      +P+ +E
Sbjct  196  GCVLGGIQLIIYAVYKNCKVDSPSSDE  222



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/256 (39%), Positives = 154/256 (60%), Gaps = 14/256 (5%)
 Frame = +2

Query  101  MASLS------FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLW  262
            MAS S      F  G++GN +S ++FLAP+ TF RI +KKSTE F+ +PY+  L S  +W
Sbjct  1    MASFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIW  60

Query  263  SFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVA  442
             +Y  LK   LL++T+N  G  + IIY++L++ YAPK  +I +L+++ ++N     AV+ 
Sbjct  61   LYYASLKSDALLLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLL  120

Query  443  VTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGI  622
            ++   + G  ++  +G +C   ++ ++A+PLS MR VI+ +SVE+MPF LSFF  L+  +
Sbjct  121  LSHFFVKGSNRVKVLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIM  180

Query  623  WASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPA--------KEEEDPAHLVKG  778
            W  Y +L++D YI IPN +GF+ G  Q++LY IY  S  A        +   D A L   
Sbjct  181  WLFYGVLLKDFYIAIPNILGFIFGVLQMVLYVIYKNSKTAVPMEPTLPQNSNDIAKLSSI  240

Query  779  GIEMANDVAFKSNGKD  826
              EM   V  +SN +D
Sbjct  241  SCEMKPAVCPQSNEED  256



>ref|XP_010045563.1| PREDICTED: bidirectional sugar transporter SWEET5-like [Eucalyptus 
grandis]
 gb|KCW83438.1| hypothetical protein EUGRSUZ_B00360 [Eucalyptus grandis]
Length=234

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 148/222 (67%), Gaps = 4/222 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGI+GNVIS  +FL+P+ TF  I +KK+   FK  PY+ T+L+ ++W FYG+  + P  
Sbjct  10   IVGIVGNVISFGLFLSPIPTFITIWKKKTASGFKPDPYVATVLNCAMWVFYGMPFVHPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            LLVVT+NG G  L +IYV +F IY+P   + R++ +  ++ + F+ AVVA+TL VLH   
Sbjct  70   LLVVTINGFGFCLELIYVGIFFIYSPWKRR-RNILLALLVELIFMVAVVAITLLVLHTTG  128

Query  473  KLMS-VGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            +  + VG+LC    IGMY SPL+ MR VI+ KSV+YMPF+LS    LNG IWA YA+L  
Sbjct  129  RRSTLVGILCIIFNIGMYTSPLTIMRRVIQTKSVKYMPFFLSLTNFLNGVIWAVYALLKF  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVK  775
            D ++ +PNG+G L G  Q+ILY  YY++T   E E P   V+
Sbjct  189  DPFVLVPNGLGALSGLVQLILYATYYRTTKWDEPEKPTSEVE  230



>gb|KHG21873.1| Bidirectional sugar transporter SWEET1 -like protein [Gossypium 
arboreum]
Length=250

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 149/249 (60%), Gaps = 8/249 (3%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL-  277
            M  L FI G+ GN  ++ +FLAP  TF RI++ KSTE F GIPY+ TLL+  L ++YGL 
Sbjct  1    MEVLHFIFGVFGNATALFLFLAPTITFTRIIRSKSTEQFSGIPYVMTLLNCLLSAWYGLP  60

Query  278  -LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLS  454
             +    LLV T+NGTG  +  IYV +F+ YAPK  K R L +   +   F  AV  ++L 
Sbjct  61   FVSKNNLLVSTINGTGAGIETIYVLVFIFYAPKTEKARILGLFACVLTVF-SAVALISLF  119

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
             LHG  + +  GL  T  +I MYASPLS MR VIK KSVE+MPF+LS F  L G  W  Y
Sbjct  120  ALHGNGRKLFCGLAATIFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVY  179

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKS  814
             +L RD ++ IPNG G  LG  Q+ILY IY  +  + + + P     G +EM  +   KS
Sbjct  180  GLLGRDAFVAIPNGFGCGLGFMQLILYSIYRNNKGSGQAKKPT--ANGTVEMGAE---KS  234

Query  815  NGKDPSEAR  841
            + + P+ A+
Sbjct  235  HQEKPTNAK  243



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 145/223 (65%), Gaps = 1/223 (0%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L F  G++GN+IS ++FLAP+ TF R+ +KKSTE F  +PY+  L S  LW +Y  +K  
Sbjct  10   LPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLWIYYAFVKTN  69

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +L++T+N  G+ +  IY++++LIYAPK  +I  +++  +++V    A+V +T  V  G 
Sbjct  70   SMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVLLTQLVFKGS  129

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             ++  +G +C G +I ++A+PLS +R VI+ KSVE+MPF+LSFF  L+   W  Y +  +
Sbjct  130  NRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIAWFGYGLFTK  189

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED-PAHLVK  775
            D+Y+ +PN +GF+ G AQ++LY IY +      E   P H++K
Sbjct  190  DIYVQLPNVLGFVFGIAQMLLYIIYKKKKNVVVEPTVPEHILK  232



>ref|XP_010999825.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Populus 
euphratica]
Length=248

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/248 (43%), Positives = 150/248 (60%), Gaps = 4/248 (2%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL-  277
            M  L F+ G+ GN  ++ +FLAP  TFKRI++ KSTE F GIPY+ TLL+  L ++YGL 
Sbjct  1    MDVLHFLFGVFGNATALFLFLAPTITFKRIIRSKSTEQFSGIPYVMTLLNCLLSAWYGLP  60

Query  278  -LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLS  454
             +    +LV T+NG G  +  IYV +FLIYAPK  K + L ++ ++   F G V  V+L 
Sbjct  61   FVSKNNVLVSTINGAGSAIETIYVLIFLIYAPKKEKAKVLGLLTLVITIFTG-VALVSLF  119

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
             LHG  + +  G      +I MY SPLS MRTVIK KSVEYMPF+LS F  L G  W  Y
Sbjct  120  ALHGNARKLFCGCAAAVFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVY  179

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVK-GGIEMANDVAFK  811
             ++ RD ++ +PNG+G  LG+ Q+ILYFIY  +    ++  P H ++ G  ++  +    
Sbjct  180  GLVGRDPFVAVPNGVGCGLGALQLILYFIYRNNKGEAKKPIPTHSLEIGPGKVHQEKKLV  239

Query  812  SNGKDPSE  835
            +NG    +
Sbjct  240  ANGSHDEQ  247



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 145/245 (59%), Gaps = 3/245 (1%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggl  295
            F  G++GN+ S ++FLAPV TF R+ +KKSTE F+ IPY+  L S  L  +Y  L     
Sbjct  13   FAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYSTLNADEF  72

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
             ++T+N  G  +  IY++L++ YAPK  +I +++ V +++V    +++ VT  ++    +
Sbjct  73   FLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQFLVKRAYR  132

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
               +G +C GL++ ++A+PLS M+ VI+ +SVEYMPF LSFF  L+  +W  Y + ++DL
Sbjct  133  ARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSAVMWLCYGLFLKDL  192

Query  656  YIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED-PAHLVKGGIEMANDVAFKSNGKDPS  832
            Y+ +PN +GF  G AQ+ILY IY  + P   EE  P H  K  IE    +       D  
Sbjct  193  YVALPNTLGFTFGMAQMILYAIYRNAKPLPSEEKLPQH--KADIETQIVITATPTNPDDH  250

Query  833  EARAH  847
            +   H
Sbjct  251  QGDEH  255



>ref|XP_010539700.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Tarenaya 
hassleriana]
Length=235

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 145/232 (63%), Gaps = 8/232 (3%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            I G++GN  ++ +FLAP  TFKRIV+ +STE F GIPY  TLL+  L ++YGL  +    
Sbjct  7    IFGVLGNATALFLFLAPTITFKRIVKNRSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKNN  66

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIIN--VAFLGAVVAVTLSVLHG  466
             LV T+NGTG  + IIYV +FL++APK  K    K+ GI    +    AV  V+L  LHG
Sbjct  67   TLVSTINGTGAAIEIIYVLIFLVFAPKKEKA---KIFGIFTCVITLFSAVALVSLFALHG  123

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
             ++ +  GL  T  +I MYASPLS MR VIK KSVEYMPF+LS F  L G  W  Y +L 
Sbjct  124  NSRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEYMPFFLSLFVFLCGTSWFIYGLLG  183

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDV  802
            RD ++ IPNG G  LG+ Q+ILY IYY +   K EE  +  +KG  EM + +
Sbjct  184  RDPFVAIPNGFGCGLGATQLILYLIYYGNKGEKAEEKKSVEMKGE-EMQHQL  234



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 158/248 (64%), Gaps = 12/248 (5%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN+IS+++FL+P+ TF R+ +KKSTE F+  PY+ TL S  LW +Y  LK G 
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLLWMYYAFLKSGA  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+NG G  +  +Y++++LIYAPK+ ++ + K+   ++V   G +  VT+ V  G  
Sbjct  72   ELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIALVTMLVSAGTL  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  VG +C  + +G++A+PLS +R VI+ KSVE+MP  LSFF VL+  IW +Y +L +D
Sbjct  132  RVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAVIWFAYGLLKKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA-----KEEEDPAHLVKGGIEMANDVAFKSN  817
            +++ +PN +GF+ G AQ+ LY  Y   +PA     +E + P H VK   E+  +      
Sbjct  192  VFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEH-VK---EVTTNTKL---  244

Query  818  GKDPSEAR  841
            G  P+E R
Sbjct  245  GGAPTEGR  252



>ref|XP_007137524.1| hypothetical protein PHAVU_009G134300g [Phaseolus vulgaris]
 gb|ESW09518.1| hypothetical protein PHAVU_009G134300g [Phaseolus vulgaris]
Length=247

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 145/219 (66%), Gaps = 3/219 (1%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ GI GNV ++ +FLAPV TFKRI++ +STE F GIPY+ TLL+  L ++YGL  + P 
Sbjct  6    FLFGIFGNVSALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSPH  65

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +LV TVNGTG ++ I+YV +F++ APK  K++ L +   + ++   AVV V+L  LHG 
Sbjct  66   NILVSTVNGTGSLIEIVYVLIFIVLAPKKEKVKILGLFTFV-LSVFSAVVFVSLFALHGN  124

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            ++ +  G      +I MY SPLS MR VIK KSVE+MPF+LS F  L G  W  + +L R
Sbjct  125  SRKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAH  766
            D ++ +PNG+G  LG+ Q+ILYFIY  +  A  ++ PA 
Sbjct  185  DPFVAVPNGVGSALGTMQLILYFIYRDNKGAARKQTPAE  223



>ref|XP_007031030.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
 gb|EOY11532.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
Length=302

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 155/249 (62%), Gaps = 3/249 (1%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M +L  I G++GN+ + L++L+P KTF  IVQ+ STE F  +PY+  LL+  +W +YGL+
Sbjct  56   MVTLVTIFGLLGNITTGLVYLSPAKTFWHIVQRGSTEEFDSLPYVVKLLNGYMWVYYGLV  115

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            KP  +LV T+NG G VL +IYV +FLI AP  +++ +  + GI++V F  AVV ++    
Sbjct  116  KPNSILVATINGFGAVLELIYVIIFLILAPPRMRVITAILFGILDVVFPVAVVLISQLSF  175

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
            + + ++   G L    ++  Y SPLS M+TV+  KSVEYMPF LSF   +NG  W  YA+
Sbjct  176  NREMQINISGFLSLLFSVATYGSPLSIMKTVVTTKSVEYMPFLLSFILFINGLTWTVYAV  235

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            L RD +IGIPNG GF+LG+AQ++LY +Y++    K   D    V+   +  + +A     
Sbjct  236  LTRDWFIGIPNGSGFVLGTAQLVLYAMYWKPKQPKRTSDN---VEDDWQHEHLIADSGPS  292

Query  821  KDPSEARAH  847
               +E+RA 
Sbjct  293  LKNNESRAD  301



>ref|XP_008370771.1| PREDICTED: bidirectional sugar transporter NEC1-like [Malus domestica]
Length=267

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 142/214 (66%), Gaps = 0/214 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+F+ G++GN++S ++FLAP+ TF  I +KKS++ F+ IPY+  LLS +L  +YG+LK 
Sbjct  8    QLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKT  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               L+V++N  G+ + + Y+ L+++YA K  KI +L ++ ++NVA  G V+AVT+ +L G
Sbjct  68   NAYLIVSINVIGIXIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVTVFLLGG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    I ++A+PLS MR VI+ KSVE+MPF LS F  L   +W  Y +  
Sbjct  128  TARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLFT  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE  748
            +D YI +PN +GFL G AQ+ILY  Y  S    E
Sbjct  188  KDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVE  221



>gb|EMT09236.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=310

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/266 (38%), Positives = 159/266 (60%), Gaps = 18/266 (7%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN+IS+++FL+P+ TF R+ +KKSTE  +  PY+ TL S  LW +Y  LK G 
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGVQPTPYLVTLFSCLLWMYYAFLKSGS  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G V+  +Y++++L+YAPK+ ++ + K+   ++V   G +  VT+   +G  
Sbjct  72   ELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVTMLASYGPL  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  VG +C  + +G++A+PLS +R VI+ KSVE+MPF LSFF VL+  IW +Y  L +D
Sbjct  132  RVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALKKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA------KEEEDPAHL--VKGGIEMANDVAF  808
            +++ +PN +G L G AQ+ LY  Y    PA      +E + P H+  V GG         
Sbjct  192  IFVAMPNVLGLLFGVAQMALYMAYRNKKPATVVLVHEEMKLPEHVKEVAGGA--------  243

Query  809  KSNGKDPSEARAHT*LSRTNHPRNTL  886
            K  G  P+E R         HP + L
Sbjct  244  KPQGGAPTEGRISC--GAEVHPIDVL  267



>ref|XP_006446472.1| hypothetical protein CICLE_v10016451mg [Citrus clementina]
 gb|ESR59712.1| hypothetical protein CICLE_v10016451mg [Citrus clementina]
Length=242

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 5/227 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGIIGNVIS  +F +P+ TF +I +K+S E FK  PY+ T+++ SLW FYGL  + P  
Sbjct  10   IVGIIGNVISFFLFASPIPTFVKIYKKRSVEEFKPDPYLATIMNCSLWVFYGLPFVTPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +LVVT+N TG+ + I Y+++F ++A K  +++ + +  II + FLG V A T+   H  T
Sbjct  70   ILVVTINCTGLAMEIAYITVFFVFAKKKGRLK-VTLWIIIELIFLGIVAACTILFFHTHT  128

Query  473  KLMS-VGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            K    VG+LC      MYASPL+ M+ +IK KSV+YMPF+LS    LNG +W +YA++  
Sbjct  129  KRSRIVGILCVIFGALMYASPLTIMQKLIKTKSVKYMPFYLSLANFLNGVVWVTYALIRF  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEE-EDPAHLVKGGIE  787
            DLYI I NG+G + G+ Q+ILY  YY STP  EE E P  +   G  
Sbjct  189  DLYILIGNGLGAISGAIQLILYACYYSSTPKDEENEKPTEVQLSGCN  235



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 151/250 (60%), Gaps = 20/250 (8%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +FI G++GNVIS ++FLA + T  +I +KKST+ F+ +PYI  L S+ LW +Y L+K   
Sbjct  9    AFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKDA  68

Query  293  llvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             L++    +   V+  IY+++FLIYAP   ++ ++K++ ++NV   GA++  TL +  G 
Sbjct  69   SLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTGS  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             +L  +G +C  L I ++A+PL  M+ VIK KSVE+MPF LSFF  +N  +W  Y +L++
Sbjct  129  KRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLK  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE---------------DPAHLVKGG-  781
            D YI +PN +GFL G  Q++LY IY  + P   EE                P H+ K G 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNHVTKNGP  248

Query  782  ---IEMANDV  802
               IE A++V
Sbjct  249  VPVIETASNV  258



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 147/229 (64%), Gaps = 3/229 (1%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS    LAP+ TF RI + KSTE F+ +PY+  L S  LW FY L+K G 
Sbjct  11   AFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++++N  G V+  +Y+ ++L+YAP+  KI + K+V ++NVA  G ++ +TL   HG+T
Sbjct  71   GLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILLLTLFAFHGET  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +++S+G +C G ++ ++ +PLS +  VIK KSVEYMPF LS    L+  +W  Y +L++D
Sbjct  131  RVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVVWFLYGLLIKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
             Y+ +PN +GF  G  Q++LY  Y  +TP   +       K G++M+ +
Sbjct  191  KYVALPNILGFTFGMIQMVLYMFYMNATPVVSDLKEG---KEGLKMSAE  236



>ref|XP_010529025.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Tarenaya 
hassleriana]
Length=284

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 102/238 (43%), Positives = 160/238 (67%), Gaps = 3/238 (1%)
 Frame = +2

Query  59   YLQAKLIKFLEGPVMASLSFIV--GIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPY  232
            + QA    +++  ++A LS +V  G++GN+ + L++++P+KTF  I++++STE F+ +PY
Sbjct  34   FSQASSAAWVDHLLLAMLSLVVLFGLLGNLTTGLVYISPLKTFWHIIERRSTEEFESLPY  93

Query  233  ITTLLSTSLWSFYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLK-MVGI  409
            +  LL+   W +YG++KP  +LV TVNG G V  II++ +FLI+A    +  S   MVG+
Sbjct  94   VCKLLNAYQWVYYGVIKPNSVLVATVNGFGAVCEIIFLIIFLIFASSPSRRMSAGIMVGV  153

Query  410  INVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFW  589
            ++V F GA V V   ++ G+T++ + G +    ++  Y SPLSAM+TV+  KSVEYMPF 
Sbjct  154  LDVVFPGAAVLVMQFMMEGETRINAAGFMSLTFSMVCYGSPLSAMKTVVTTKSVEYMPFL  213

Query  590  LSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            LSFF  +NGG+W +YA L  D +IGIPNG+GFLLG+AQ++LY  Y++  P      P+
Sbjct  214  LSFFLFINGGVWTTYAFLTADWFIGIPNGVGFLLGTAQMVLYATYWKPKPKHTSLSPS  271



>ref|XP_006470352.1| PREDICTED: bidirectional sugar transporter SWEET4-like [Citrus 
sinensis]
Length=242

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 146/227 (64%), Gaps = 5/227 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGIIGNVIS  +F +P+ TF +I +K+S E FK  PY+ T+++ SLW FYGL  + P  
Sbjct  10   IVGIIGNVISFFLFASPLPTFVKIFKKRSVEEFKPDPYLATIMNCSLWVFYGLPFVTPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +LVVT+N TG+ + I Y+++F ++A K  +++ + +  I  + FLG V A T+   H  T
Sbjct  70   ILVVTINSTGLAMEIAYITIFFVFAQKKGRLK-VTLWIITELIFLGIVAACTMLFFHTHT  128

Query  473  KLMS-VGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            K    VG+LC      MYASPL+ M+ VIK KSV+YMPF+LS    LNG +W +YA++  
Sbjct  129  KRSRIVGILCVIFGALMYASPLTIMQQVIKTKSVKYMPFYLSLANFLNGVVWVTYALIRF  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEE-EDPAHLVKGGIE  787
            DLYI I NG+G + G+ Q+ILY  YY STP  EE E P  +   G  
Sbjct  189  DLYILIGNGLGAISGAIQLILYACYYSSTPKDEENEKPTEVQLSGCN  235



>ref|XP_006479044.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Citrus 
sinensis]
 gb|KDO45545.1| hypothetical protein CISIN_1g042377mg [Citrus sinensis]
Length=255

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/248 (38%), Positives = 152/248 (61%), Gaps = 1/248 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+FI G++GN++S L+FLAPV TF  I +KKS+E +  IPY+  L S +L  +YGLLK 
Sbjct  8    QLAFIFGLLGNIVSFLVFLAPVPTFLIIYKKKSSEGYHSIPYVIALSSATLLLYYGLLKS  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
              +L++T+N  G V+ +IY+ L+LIYAP+  K  ++K++ + NV     ++ +    + G
Sbjct  68   NAVLIITINSIGCVIEVIYLMLYLIYAPQKQKSFTIKLILVFNVGAFALMMVIVNFFVKG  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    + ++++PLS MR VIK KSVEYMPF LSFF  L   +W  Y + V
Sbjct  128  PNRVTAVGCVCAVYNVAVFSAPLSIMRRVIKTKSVEYMPFSLSFFLTLCATMWFFYGLFV  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMA-NDVAFKSNGK  823
            +D+ I +PN +GFL G AQ+ILY +Y      +  +      +  + +  +D A+  +  
Sbjct  188  KDMVIALPNVLGFLFGIAQMILYLVYKGKKGNESNQKQQECTEMKMNLTEDDKAYTKDNN  247

Query  824  DPSEARAH  847
             P++ + +
Sbjct  248  QPTDLQTN  255



>gb|EMS46194.1| Bidirectional sugar transporter SWEET15 [Triticum urartu]
Length=345

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 142/210 (68%), Gaps = 0/210 (0%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN+IS+++FL+P+ TF R+ +KKSTE F+  PY+ TL S  LW +Y  LK G 
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLLWMYYAFLKSGS  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G V+  +Y++++L+YAPK+ ++ + K+   ++V   G +  VT+   HG  
Sbjct  72   ELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVTMLASHGPL  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  VG +C  + +G++A+PLS +R VI+ KSVE+MPF LSFF VL+  IW +Y  L +D
Sbjct  132  RVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALKKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA  742
            +++ +PN +GFL G AQ+ LY  Y    PA
Sbjct  192  IFVAMPNVLGFLFGVAQMALYMAYRNKKPA  221



>ref|XP_006586696.1| PREDICTED: uncharacterized protein LOC100808537 isoform X2 [Glycine 
max]
Length=218

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            MA  SF VG+IGN+ISILMFL+PV TF +I +  STE+F  +PYI TLL+ SLW++YG++
Sbjct  1    MAEASFFVGVIGNIISILMFLSPVPTFWKIKKHGSTEDFSSLPYICTLLNCSLWTYYGII  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL  460
            K G  LV TVNG G+++  IY+ LFLIYAPK I+ R+  +  I++V  L A++ +T   L
Sbjct  61   KAGEYLVATVNGFGILMETIYIILFLIYAPKGIRGRTAILALILDVVILTAIIIITQLAL  120

Query  461  HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
             G+T+  +VG++  GL I MY+SPLS M+TV+  KSVEYMPF LSFF   NG +W  YA+
Sbjct  121  EGETRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFFNGAVWLLYAV  180

Query  641  LVRDLYIGIPNG  676
            LVRD+ +G+ +G
Sbjct  181  LVRDVILGVGSG  192



>ref|XP_009391576.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=262

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 141/212 (67%), Gaps = 3/212 (1%)
 Frame = +2

Query  125  GIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggllvv  304
            G++GN+IS L+ LAPV TF RI +KKSTE+F  +PY+  L S  LW FYGLL    +L++
Sbjct  15   GLLGNIISFLVVLAPVPTFYRIYKKKSTESFDSVPYVVALFSAMLWVFYGLLT-LDVLLL  73

Query  305  tvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMS  484
            T+N    ++ +IY++++LIYA K  +  +LK++ ++NV   G++V  T   + GK ++  
Sbjct  74   TINTGACIIEMIYLTIYLIYASKKPRAFTLKLISLVNVGIYGSLVLFTTLFVKGKRRIDV  133

Query  485  VGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIG  664
             G +C    + ++A+PLS +R VI+ KSVEYMPF LSFF  L+   W SY +L+ DL++ 
Sbjct  134  TGWICASFAVSVFAAPLSIIRLVIRTKSVEYMPFSLSFFLTLSAVAWFSYGILLGDLFVA  193

Query  665  IPNGIGFLLGSAQIILYFIYYQSTPAKEEEDP  760
            +PN +GF+ G AQII+YF+Y  S   K E  P
Sbjct  194  LPNVVGFMFGIAQIIIYFMYVNSK--KAETKP  223



>ref|XP_002283068.1| PREDICTED: bidirectional sugar transporter SWEET5 [Vitis vinifera]
 emb|CBI15051.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 149/216 (69%), Gaps = 5/216 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGIIGNVIS  +F +P+ TF +IV+KK+   FK  PY+ T+L+  +W  YGL  ++P  
Sbjct  10   IVGIIGNVISFGLFASPIPTFIQIVKKKTVGEFKPDPYLATVLNCMMWVLYGLPFVRPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG-K  469
            LLV+T+NG G+V+ +IYV++F +YA  ++K + + +  +  V F+  + A+T+ + HG K
Sbjct  70   LLVITINGGGLVIELIYVTIFFVYA-DSLKRKKIALWLLFEVIFMAIIAAITMLLFHGTK  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             + + VGLLC    + MYASPL+ MR VI+ KSV+YMPF LS     NG +W+ YA++  
Sbjct  129  NRSLFVGLLCVVFNVIMYASPLTVMRQVIRTKSVKYMPFTLSLANFANGIVWSIYALIKF  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
            D YI IPNG+G L G+ Q+ILY  YY+STP K+EED
Sbjct  189  DPYILIPNGLGSLSGAVQLILYATYYKSTP-KDEED  223



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 156/244 (64%), Gaps = 5/244 (2%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS +++L+P+ TF R+ +KKSTE F+ +PY+  L S  LW +Y LLK  G
Sbjct  11   AFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLWIYYALLKTDG  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G ++  IY+++++IYAPK  KI + K+V ++N+     ++ +TL  + G  
Sbjct  71   YLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILLLTLFFVQGPK  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  +G +C   ++ ++A+PLS MR VI+ KSVE+MPF LSF   L+  +W SY +L +D
Sbjct  131  RVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVMWFSYGLLTKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA----KEEEDPAHLVKGGIEMANDVAFKSNG  820
             YI +PN +GF+ G  Q++LY IY  +  A    K  E   ++VK     ++DV F  NG
Sbjct  191  FYIALPNVLGFIFGIIQMVLYIIYKGTKKAFIDKKLPEQVVNIVKISTLGSSDV-FPING  249

Query  821  KDPS  832
            +  S
Sbjct  250  QAVS  253



>ref|XP_010921651.1| PREDICTED: bidirectional sugar transporter SWEET16-like [Elaeis 
guineensis]
Length=223

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 121/173 (70%), Gaps = 12/173 (7%)
 Frame = +2

Query  338  IYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTKLMSVGLLCTGLTIG  517
            IYV+L+LIYAP++ +++  K V I+NV FLG V+ VTL  +HG  +L  +G +C  LT+G
Sbjct  8    IYVTLYLIYAPRDTRVKMAKFVAILNVGFLGLVILVTLLAIHGSHRLTVIGSMCAALTVG  67

Query  518  MYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDLYIGIPNGIGFLLGS  697
            MYASPL+AMR V+K +SVEYMPF+LSFF  LNGG+W+SY++LV+D +IG+PNGIGF LG 
Sbjct  68   MYASPLAAMRMVVKTRSVEYMPFFLSFFLFLNGGVWSSYSLLVQDYFIGVPNGIGFALGL  127

Query  698  AQIILYFIYYQSTP------AKEEEDPAHLVKGGIEMANDVAFKSNGKDPSEA  838
             Q++LY IY + TP      A EEE   HLV G +EM         GKD   A
Sbjct  128  VQLVLYAIYRRKTPLVKAAAAYEEEGSTHLV-GEVEMQG-----CEGKDSFHA  174



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 148/226 (65%), Gaps = 2/226 (1%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
            SL+ + GI+GN+IS+L+FLAPV TF RI +KKSTE+F+ +PY   L S  LW +Y L+K 
Sbjct  9    SLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLWLYYALIKK  68

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
            G  L++T+N  G V+  IY+S+FL YA KN ++ ++K+   +N+     ++ +T  +L  
Sbjct  69   GAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFILILTHFLLKS  128

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++  +G +C  +++ ++A+PL+ M  VI+ KSVE+MPF LSFF  L+  +W +Y + +
Sbjct  129  SIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAVMWFAYGLFI  188

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED--PAHLVKG  778
            +DL + +PN +GF+LG  Q++LY IY  S     EE   PA  +K 
Sbjct  189  KDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKS  234



>ref|XP_004138978.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
sativus]
Length=236

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 134/206 (65%), Gaps = 0/206 (0%)
 Frame = +2

Query  86   LEGPVMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWS  265
            + G  +  L FI G++GN+IS L+FLAP+ TF  I +KK++E F+ IPY+  L+S  L  
Sbjct  1    MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  266  FYGLLKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAV  445
            +Y  LK    L+V++N  G V+ +IY++L+L YAPK  KI +LK+  I N+ F G +V  
Sbjct  61   YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG  120

Query  446  TLSVLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIW  625
            T+  LHG  +  +VG +C    + ++ASPLS M+ VI  KSVEYMPF LSFF  L+  +W
Sbjct  121  TMFFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  626  ASYAMLVRDLYIGIPNGIGFLLGSAQ  703
              Y   ++DL+I +PN +GFLLG  Q
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQ  206



>ref|XP_009375095.1| PREDICTED: bidirectional sugar transporter SWEET6b-like [Pyrus 
x bretschneideri]
Length=245

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 151/233 (65%), Gaps = 7/233 (3%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            +VGIIGNVIS  +FL+PV TF +I++KK TE FK  PY+ T+L+   W FYG+  + P  
Sbjct  10   VVGIIGNVISFGLFLSPVPTFWKIIKKKDTEEFKPDPYMATVLNCLFWIFYGMPFVHPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYA-PKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG-  466
             LVVT+N  G+ L +IY+++F++YA  K  K   L + G   V F  AVV +TL  +HG 
Sbjct  70   TLVVTINAVGLALELIYLTIFVVYASAKGRKKVGLWLAG--EVIFFAAVVLITLLCVHGT  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
            K + M VG++C    I MY+SPL+ M  VIK KSVEYMPF+LS    LNG IW +YA++ 
Sbjct  128  KNRSMVVGIICDIFNIIMYSSPLTIMAKVIKTKSVEYMPFYLSLTNFLNGLIWTAYALIK  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVA  805
             D+YI I N +G L G  Q++LY  YY+STP K+ +D A      +++++  A
Sbjct  188  FDIYILISNSLGALSGLVQLVLYAWYYKSTP-KDSKDVAGKPTTEVQLSDHTA  239



>ref|XP_009109231.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brassica 
rapa]
Length=272

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 147/249 (59%), Gaps = 3/249 (1%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L+F  GI+GN+IS ++FLAPV TF RI +KKSTE F+ +PY++ L S  LW +Y + K G
Sbjct  6    LAFTFGIMGNIISFIVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIYYAMQKDG  65

Query  290  gllvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               ++    +    +  IY+ LF+ YA K  +I +LK++G++N     A++ V   +  G
Sbjct  66   SGFLLITINSVGCFIETIYIVLFITYANKKARISTLKVLGLLNFLGFAAIILVCELLTKG  125

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              +   +G +C G ++ ++A+PLS MR VI+ KSVE+MPF LS F  L+   W  Y + +
Sbjct  126  SNREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTLSAITWLFYGLAI  185

Query  647  RDLYIGIPNGIGFLLGSAQIILYFI--YYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            +D Y+ +PN +G  LG+ Q+ILY I  YY++    + E P  +    I+M    +  ++G
Sbjct  186  KDFYVALPNIMGAFLGAVQMILYIIYKYYKAPKTDDTEKPKTVSGHSIDMVKLASTPASG  245

Query  821  KDPSEARAH  847
               +  + H
Sbjct  246  DLKAPPQTH  254



>sp|Q9FPN0.1|NEC1_PETHY RecName: Full=Bidirectional sugar transporter NEC1; AltName: 
Full=NEC1 [Petunia x hybrida]
 gb|AAG34696.1| NEC1 [Petunia x hybrida]
Length=265

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/256 (40%), Positives = 154/256 (60%), Gaps = 12/256 (5%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             LSFI G++GN++S ++FLAPV TF +I ++KS+E ++ IPY+  L S  L  +Y  L+ 
Sbjct  8    DLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLLYYAYLRK  67

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               L+V++NG G  + + Y+SLFL YAP+  KI +  ++ ++ +  LG V+ +T  +  G
Sbjct  68   NAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLM-LLELGALGMVMPITYLLAEG  126

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++M VG +C  + + ++A+PLS MR VIK KSVE+MPF LS F  L   +W  Y    
Sbjct  127  SHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFFYGFFK  186

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE-DP---AHLVKGGIEM-------A  793
            +D YI  PN +GFL G  Q++LYF+Y  S    +E+ DP   A   K G+E+        
Sbjct  187  KDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIIINIEDDN  246

Query  794  NDVAFKSNGKDPSEAR  841
            +D A +S  KD S  R
Sbjct  247  SDNALQSMEKDFSRLR  262



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 147/245 (60%), Gaps = 6/245 (2%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPggl  295
            F  G++GN+ S ++FLAPV TF R+ +KKSTE F+ IPY+  L S  L  +Y  L     
Sbjct  13   FAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYSTLNADEF  72

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKTK  475
             ++T+N  G  +  +Y++L++ YAPK  +I +++ V +++V    +++ VT  ++    +
Sbjct  73   FLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQFLVKRAYR  132

Query  476  LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRDL  655
               +G +C GL++ ++A+PLS M+ VI+ +SVEYMPF LSFF  L+  +W  Y + ++DL
Sbjct  133  ARVIGFICGGLSVSVFAAPLSIMKKVIRTRSVEYMPFSLSFFLTLSAVMWLCYGLFLKDL  192

Query  656  YIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED-PAHLVKGGIEMANDVAFKSNGKDPS  832
            Y+ +PN +GF  G AQ+ILY IY  + P   EE  P H  K  IE    +   +N   P 
Sbjct  193  YVALPNTLGFTFGMAQMILYAIYRNAKPLPNEEKLPQH--KADIETQIVITTTTN---PD  247

Query  833  EARAH  847
            +   H
Sbjct  248  QGDEH  252



>ref|XP_006476341.1| PREDICTED: bidirectional sugar transporter SWEET7-like [Citrus 
sinensis]
Length=258

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 162/249 (65%), Gaps = 7/249 (3%)
 Frame = +2

Query  98   VMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL  277
            V+ ++  +VGIIGN+IS+ +FL+PV TF  IV+K + E +   PY+ TLL+  +W  YGL
Sbjct  5    VVNTIRNVVGIIGNIISLFLFLSPVPTFVEIVKKGTVEQYSAAPYLATLLNCMVWVLYGL  64

Query  278  --LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTL  451
              + P  +LV+T+NGTG  + ++Y+ LF++Y+ K  +I+ + +V ++ V F+  V  + L
Sbjct  65   PMVHPHSILVITINGTGTAIEVVYIILFVLYSDKKKRIKVM-LVVLVEVIFVALVALLVL  123

Query  452  SVLHG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWA  628
            ++LH  K + M+VG++C    I MYASPLS M+ VI  KSVEYMPF+LS   + NG  W 
Sbjct  124  TLLHSTKQRSMAVGIICILFNIMMYASPLSVMKLVITTKSVEYMPFFLSLMSLANGVAWT  183

Query  629  SYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAF  808
            +YA L  D +I IPNG+G LLG AQ+ILY  YY+ST   + +  A   KG ++++  V  
Sbjct  184  TYAFLPFDQFIAIPNGLGTLLGVAQVILYACYYKST---KRQMAARQGKGQVDLSAVVVS  240

Query  809  KSNGKDPSE  835
            +S+  D  +
Sbjct  241  ESDSGDSKK  249



>ref|XP_004952303.1| PREDICTED: bidirectional sugar transporter SWEET4-like [Setaria 
italica]
Length=252

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 155/244 (64%), Gaps = 12/244 (5%)
 Frame = +2

Query  122  VGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPggl  295
            +G+IGN  ++++FL+PV TF RI +K++ E +  IPY+ TLL+  +W  YGL  + P  +
Sbjct  11   IGVIGNGTALVLFLSPVPTFYRIWKKRAVEQYSAIPYVATLLNCMMWVLYGLPVVHPHSM  70

Query  296  lvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG-KT  472
            LV+T+NGTG+ + + YV+LFL+Y+    + R + ++    VAF+GAV A+ L++ H  + 
Sbjct  71   LVITINGTGMAIQLTYVTLFLLYSTGAAR-RKVMLLLAAEVAFVGAVAALVLTLAHTHER  129

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + M VG+LC     GMYA+PL+ M+ VI+ KSVEYMP +LS   ++NG  W +YA++  D
Sbjct  130  RSMIVGVLCVLFGTGMYAAPLAVMKMVIQTKSVEYMPLFLSLASLVNGICWTAYALIKFD  189

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDPS  832
            LYI IPNG+G L   AQ+ILY IYY+ST          +++     A+ +A      D +
Sbjct  190  LYITIPNGLGVLFAVAQLILYAIYYKSTQ--------EIIEARKRKADQIAMTEVVVDAT  241

Query  833  EARA  844
              RA
Sbjct  242  TTRA  245



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 143/220 (65%), Gaps = 5/220 (2%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GN+IS    LAP+ TF RI + KSTE F+ +PY+  L S  LW FY L+K G 
Sbjct  11   AFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++T+N  G V+  +Y+ ++L+YAP+  KI + K+V ++NVA  G +  +TL   HG+T
Sbjct  71   GLLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFLLTLFAFHGET  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +++S+G +C G ++ ++ +PLS +  VIK KSVEYMPF LS    L+  +W  Y +L++D
Sbjct  131  RVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVVWFLYGLLIKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTP-----AKEEED  757
             Y+ +PN +GF  G  Q++LY  Y  +TP     AKE ++
Sbjct  191  KYVALPNILGFTFGMIQMVLYMFYMNATPVVASDAKEGKE  230



>ref|XP_009110184.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Brassica 
rapa]
 emb|CDX96591.1| BnaA08g21340D [Brassica napus]
Length=251

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 140/235 (60%), Gaps = 3/235 (1%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            I G+ GN  ++ +FLAP  TFKRI++ KSTE F GIPY  TLL+  L ++YGL  +    
Sbjct  7    IFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDN  66

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             LV T+NGTG  +  IYV +FL YAP+  K +   +   + +A    V  V+L  LHG  
Sbjct  67   TLVSTINGTGAAIETIYVLIFLFYAPRKEKAKIFAIFAAV-LAVFATVALVSLFALHGNG  125

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + +  G+  T  +I MYASPLS MR V+K KSVEYMPF+LS F  L G  W  Y ++ RD
Sbjct  126  RKLFCGIAATVFSIIMYASPLSIMRLVVKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGRD  185

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSN  817
             ++ IPNG G  LG+ Q+ILYFIY  +   K  +D     K  +EM ++   K N
Sbjct  186  PFVAIPNGFGCALGTVQLILYFIYCGNKGEKSTDDAEKDEKKTVEMKDEEKKKQN  240



>emb|CDY67972.1| BnaCnng57120D [Brassica napus]
Length=251

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 140/235 (60%), Gaps = 3/235 (1%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            I G+ GN  ++ +FLAP  TFKRI++ KSTE F GIPY  TLL+  L ++YGL  +    
Sbjct  7    IFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDN  66

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             LV T+NGTG  +  IYV +FL YAP+  K +   +   + +A    V  V+L  LHG  
Sbjct  67   TLVSTINGTGAAIETIYVLIFLFYAPRKEKAKIFAIFAAV-LAVFATVALVSLFALHGNG  125

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + +  G+  T  +I MYASPLS MR V+K KSVEYMPF+LS F  L G  W  Y ++ RD
Sbjct  126  RKLFCGIAATVFSIIMYASPLSIMRLVVKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGRD  185

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSN  817
             ++ IPNG G  LG+ Q+ILYFIY  +   K  +D     K  +EM ++   K N
Sbjct  186  PFVAIPNGFGCALGTVQLILYFIYCGNKGDKSTDDAEKDEKKTVEMKDEEKKKQN  240



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 152/251 (61%), Gaps = 14/251 (6%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F+ G++GNVIS ++FLAP+ TF +I +KKSTE F+ +PY+  L S+ LW +Y L+K   
Sbjct  9    AFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIYYALVKKDA  68

Query  293  llvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             L++    +   V+  IY+++FLIYAP   ++ ++K++ ++NV   GA++  TL +  G 
Sbjct  69   SLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTGS  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             +L  +G +C    I ++A+PL  ++ VIK KSVE+MPF LSFF  +N  +W  Y +L++
Sbjct  129  KRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLK  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQST----PAKEEEDPAHLVKGGIEMANDVAFKSN  817
            D Y+ +PN +GFL    Q++LY IY  +     P K +E  +H +  G         K +
Sbjct  189  DYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDLPMKLQELNSHTIDVG---------KLS  239

Query  818  GKDPSEARAHT  850
              +PSE    T
Sbjct  240  RMEPSEPNHVT  250



>ref|XP_008341461.1| PREDICTED: bidirectional sugar transporter SWEET6a [Malus domestica]
Length=244

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 145/219 (66%), Gaps = 7/219 (3%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            +VGIIGNVIS  +FL+PV TF +I++KK TE FK  PY+ T+L+   W FYG+  + P  
Sbjct  10   VVGIIGNVISFGLFLSPVPTFWKIIKKKDTEEFKPDPYMATVLNCLFWIFYGMPFVHPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYA-PKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG-  466
             LVVT+N  G+ L +IY+++F++YA  K  K   L + G   V F  AVV +TL  +HG 
Sbjct  70   TLVVTINAVGLALEVIYLTIFVVYASAKGRKKVGLWLAG--EVIFFAAVVLITLLCVHGT  127

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
            K + M VG++C    I MY+SPL+ M  VIK KSVEYMPF+LS    LNG IW +YA++ 
Sbjct  128  KNRSMVVGIICDIFNIIMYSSPLTIMAKVIKTKSVEYMPFYLSLTNFLNGLIWTAYALIK  187

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
             D+YI I N +G L G  Q++LY  YY+STP K+ +D A
Sbjct  188  FDIYILISNSLGALSGLVQLVLYAWYYKSTP-KDSKDVA  225



>ref|NP_001043522.1| Os01g0605700 [Oryza sativa Japonica Group]
 sp|Q8W0K2.1|SWT6B_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET6b; Short=OsSWEET6b 
[Oryza sativa Japonica Group]
 dbj|BAB78664.1| MtN3-like [Oryza sativa Japonica Group]
 dbj|BAB92461.1| MtN3-like [Oryza sativa Japonica Group]
 dbj|BAF05436.1| Os01g0605700 [Oryza sativa Japonica Group]
 gb|EAZ12625.1| hypothetical protein OsJ_02536 [Oryza sativa Japonica Group]
 dbj|BAG94129.1| unnamed protein product [Oryza sativa Japonica Group]
Length=254

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 144/222 (65%), Gaps = 7/222 (3%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            +VGIIGNVIS  +FL+PV TF RI ++K  E FK  PY+ TLL+  LW FYG+  + P  
Sbjct  10   VVGIIGNVISFGLFLSPVPTFWRICKRKDVEQFKADPYLATLLNCMLWVFYGIPIVHPNS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +LVVT+NG G+++   Y+ +F +Y+P   ++R L ++G+  V  L  ++ V LS    K 
Sbjct  70   ILVVTINGIGLIVEGTYLFIFFLYSPNKKRLRMLAVLGVELVFMLAVILGVLLSAHTHKK  129

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + M VG+LC      MY SPL+ M  VIK KSVEYMPF+LS    LNG  W +YA++  D
Sbjct  130  RSMIVGILCVFFGSIMYFSPLTIMGKVIKTKSVEYMPFFLSLVCFLNGVCWTAYALIRFD  189

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTP-----AKEEEDPA  763
            +Y+ IPNG+G + G+ Q+ILY  YY++TP     AK+ E P+
Sbjct  190  IYVTIPNGLGAIFGAIQLILYACYYRTTPKKTKAAKDVEMPS  231



>ref|XP_008234052.1| PREDICTED: bidirectional sugar transporter NEC1-like [Prunus 
mume]
Length=213

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 136/206 (66%), Gaps = 0/206 (0%)
 Frame = +2

Query  107  SLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKP  286
             L+FI G+IGN++S+++FLAP+ TF +I + KS+E F+  PY+  LLS  L  FYG+LK 
Sbjct  6    QLAFIFGLIGNIVSVMVFLAPIPTFYKIYKNKSSEGFQSTPYVVALLSAMLLLFYGVLKT  65

Query  287  ggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               L++++N  G V+ I Y+  + +YA K  KI ++  + ++NVA  G VVAVT  ++  
Sbjct  66   NAALIISINVIGCVIEITYLIFYFVYASKKDKITTMIQILVLNVAVFGLVVAVTFLLVGE  125

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              ++ +VG +C    + ++A+PL  MR VI+ KSVEYMPF+LSF   +   +W  Y + V
Sbjct  126  DKRVSTVGWICAVFGVAVFAAPLLIMRIVIQTKSVEYMPFYLSFSLTICATLWFLYGLFV  185

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIY  724
            +D YI  PN +GFLLG AQ+ILYF Y
Sbjct  186  KDYYIAFPNVLGFLLGIAQMILYFKY  211



>ref|XP_004150723.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis 
sativus]
 ref|XP_004167649.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis 
sativus]
 gb|KGN47489.1| hypothetical protein Csa_6G343690 [Cucumis sativus]
Length=252

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 147/228 (64%), Gaps = 4/228 (2%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ G++GN  ++ +FL+P+ TFKRI++ KSTE F GIPY+ T+L+  L ++YGL  + P 
Sbjct  6    FLFGVLGNATALFLFLSPMVTFKRIIRSKSTEEFSGIPYVMTMLNCLLSAWYGLPFVSPH  65

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +LV T+NGTG V+ +IYV +F+IYAPK  K +   + G    AF  AV  V++  L GK
Sbjct  66   NILVSTINGTGAVIELIYVMVFIIYAPKKEKGKIGGLFGFAMGAFT-AVALVSVFALEGK  124

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             + +  GL  +  +I MY SPLS MRTVIK KSVEYMPF LS F  L G  W  Y +L R
Sbjct  125  IRKLFCGLAASVFSIIMYGSPLSIMRTVIKTKSVEYMPFLLSLFVFLCGTSWFIYGLLGR  184

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMA  793
            D ++ +PNG G  LG+ Q+ILYFIY    PA +E+ P +     +EM 
Sbjct  185  DPFVAVPNGFGCGLGALQLILYFIYRAPRPAPDEK-PTNNDGPNMEMG  231



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 141/210 (67%), Gaps = 0/210 (0%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN+IS+++FL+P+ TF R+ +KKSTE F+  PY+ TL S  LW FY LLK G 
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKSGA  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L+VT+NG G V+  +Y+ ++L+YAPK  ++ + KM+  +NV   G V  VT+ + +G  
Sbjct  72   ELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVALVTMVLSNGGL  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  +G +C  + + ++A+PLS MR VI+ KSVE+MP  LSFF VL+  IW +Y  L +D
Sbjct  132  RVKVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVIWFAYGALKKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA  742
            +++  PN +GF+ G AQ+ LY  Y    PA
Sbjct  192  VFVAAPNVLGFVFGLAQMALYMAYRNKKPA  221



>ref|NP_567366.1| bidirectional sugar transporter SWEET7 [Arabidopsis thaliana]
 sp|Q8LBF7.1|SWET7_ARATH RecName: Full=Bidirectional sugar transporter SWEET7; Short=AtSWEET7 
[Arabidopsis thaliana]
 gb|AAM64793.1| contains similarity to Medicago truncatula MtN3 (GB:Y08726) [Arabidopsis 
thaliana]
 gb|ABK32158.1| At4g10850 [Arabidopsis thaliana]
 gb|AEE82936.1| bidirectional sugar transporter SWEET7 [Arabidopsis thaliana]
Length=258

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 152/249 (61%), Gaps = 7/249 (3%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LK  283
            L  IVGIIGN I++ +FL+P  TF RIV+KKS E +  IPY+ TL++  +W  YGL  + 
Sbjct  9    LRKIVGIIGNFIALCLFLSPTPTFVRIVKKKSVEEYSPIPYLATLINCLVWVLYGLPTVH  68

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
            P   LV+T+NGTG+++ I+++++F +Y  +  +   +  V     AF+  +  + L++ H
Sbjct  69   PDSTLVITINGTGILIEIVFLTIFFVYCGRQKQRLIISAVIAAETAFIAILAVLVLTLQH  128

Query  464  GKTK-LMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAM  640
               K  MSVG++C    + MYASPLS M+ VIK KSVE+MPFWLS    LN G+W  YA+
Sbjct  129  TTEKRTMSVGIVCCVFNVMMYASPLSVMKMVIKTKSVEFMPFWLSVAGFLNAGVWTIYAL  188

Query  641  LVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTP---AKEEEDPAHL-VKGGIEMANDVAF  808
            +  D ++ IPNGIG L G AQ+ILY  YY+ST    A+ E  P ++ +   I        
Sbjct  189  MPFDPFMAIPNGIGCLFGLAQLILYGAYYKSTKRIMAERENQPGYVGLSSAIARTGSEKT  248

Query  809  KSNGKDPSE  835
             +  ++P+ 
Sbjct  249  ANTNQEPNN  257



>gb|KDO71716.1| hypothetical protein CISIN_1g026722mg [Citrus sinensis]
Length=194

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 139/228 (61%), Gaps = 46/228 (20%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLL  280
            M  LSF VG+IGN+IS+LMFLAPV+TF RI++ +STE F+ +PYI TLL++SLW++YG+ 
Sbjct  1    MKDLSFYVGVIGNIISVLMFLAPVRTFWRIIKHRSTEEFQSLPYICTLLNSSLWTYYGIT  60

Query  281  KPggllvvtvngtgvvlHIIYVSLFLIYAP-KNIKIRSLKMVGIINVAFLGAVVAVTLSV  457
            +PG  LV TVNG G+++  +YV+LF IYAP K ++ ++  + GI++V FLGA +A T   
Sbjct  61   RPGSYLVATVNGFGILVEAVYVTLFFIYAPTKAMRAKTAIIFGILDVGFLGAAIAATRLA  120

Query  458  LHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
            L G+ ++ ++G +C GL I MYASPLSAM                               
Sbjct  121  LEGEARIDAIGFMCAGLNIIMYASPLSAM-------------------------------  149

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKE-----EEDPAH  766
                     +PNG GFLLG+AQ++LY IY  + P+K      EE   H
Sbjct  150  ---------VPNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQH  188



>emb|CDP11997.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 151/245 (62%), Gaps = 13/245 (5%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ G+ GN  ++ +FLAPV TF+RI+ K+STE F G+PY+ TLL+  L ++YGL  + P 
Sbjct  7    FVFGVFGNASALFLFLAPVITFRRIIIKRSTEQFSGVPYVMTLLNCLLSAWYGLPFVSPH  66

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             L V T+NGTG  +  IYV +FLI+APK  K +   ++ ++  AF  AV  V+L VLHG+
Sbjct  67   NLPVSTINGTGAAIEFIYVLIFLIFAPKKEKTKIFSILVLVITAF-AAVALVSLFVLHGQ  125

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            ++ +  GL  T  +I MYASPL+ +R VIK KSVE+MPF+LS F  L G  W  + +L R
Sbjct  126  SRKLFCGLAATIFSITMYASPLTIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  185

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQST-PAKEEEDPAHLVKGGIEMANDVAFKSNGKD  826
            D ++ IPNG G  LG+ Q+ILY IY+ +  P K E   A      +E         NGK 
Sbjct  186  DPFVAIPNGFGSGLGTVQLILYAIYHDNKGPGKREVSDASSQLKDLE---------NGKP  236

Query  827  PSEAR  841
              E +
Sbjct  237  QEEKQ  241



>gb|EMS51422.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=290

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 147/238 (62%), Gaps = 11/238 (5%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GNVIS    LAP+ TF RI + KSTE F+ +PY+  L S  LW FY L+K G 
Sbjct  11   AFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++++N  G V+  +Y+ ++L+YAP+  KI + K+V ++N+   G +  +TL   HG+T
Sbjct  71   GLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNITGFGLIFLLTLFAFHGET  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +++S+G +C G ++ ++ +PLS +  VIK KSVEYMPF LS    L+  +W  Y +L++D
Sbjct  131  RVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGLLIKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKD  826
             Y+ +PN +GF  G  Q++LY  Y   TP   E      VK G E     A+K+  +D
Sbjct  191  KYVALPNILGFTFGVIQMVLYVFYMNKTPVASE------VKEGKE-----AWKAPAED  237



>ref|XP_010419882.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 148/227 (65%), Gaps = 1/227 (0%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L+FI GI+GN IS L+FLAPV TF RI +KKSTE+F+ +PY  +L S  LW +Y L+K  
Sbjct  10   LAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQD  69

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
              L++T+N  G V+  IY+++F  YA ++ +I ++K+   INVAF   ++ VT  V+   
Sbjct  70   AFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFIAINVAFFSMILMVTHFVVRTP  129

Query  470  TKLMSV-GLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
            T  +SV G +C  +++ ++A+PL  +  VIK KSVE+MPF LSFF  ++  +W +Y + +
Sbjct  130  TIQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFL  189

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIE  787
             D+ I IPN +GF+LG  Q++LY +Y  S+   E E   +L +  ++
Sbjct  190  HDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKINLSEQQLK  236



>ref|XP_010062171.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
 gb|KCW69241.1| hypothetical protein EUGRSUZ_F02749 [Eucalyptus grandis]
Length=256

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 154/260 (59%), Gaps = 15/260 (6%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL-  277
            M  L F+ GI GN  ++ +FLAP  TFKRI++ +STE F GIPY+ TLL+  L ++YGL 
Sbjct  1    MDVLHFVFGIFGNATALFLFLAPAITFKRIIKSRSTEEFSGIPYVMTLLNCLLSAWYGLP  60

Query  278  -LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLS  454
             + P  LLV T+NGTG  +  +YV +FLI+AP+  K + L ++  +   F  AV  V+L 
Sbjct  61   FVSPNNLLVSTINGTGAAIEFVYVVIFLIFAPRKEKAKILGLLTFVLTVF-AAVALVSLL  119

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
             LHG  + +  G+  T  +I MYASPLS MR VIK KSVEYMPF+LS F  L G  W  Y
Sbjct  120  ALHGNKRKLFCGVAATVFSIIMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIY  179

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYY--QSTPAKEEEDPAHLVKGGIEMANDVAF  808
             +L  D ++ +PNG G  LG+ Q+ILY IY   +  P K+  +      G +EM      
Sbjct  180  GLLGHDPFVAVPNGFGSGLGAMQLILYAIYRNNKGEPKKKVNN-----DGSMEMMGGTG-  233

Query  809  KSNGKDPSEARAHT*LSRTN  868
            K   +DP + +    LS TN
Sbjct  234  KDADRDPVKHQ----LSSTN  249



>emb|CDY24854.1| BnaA08g14560D [Brassica napus]
Length=271

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 147/249 (59%), Gaps = 3/249 (1%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L+F  GI+GN+IS ++FLAPV TF RI +KKSTE F+ +PY++ L S  LW +Y + K G
Sbjct  6    LAFTFGIMGNIISFIVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIYYAMQKDG  65

Query  290  gllvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHG  466
               ++    +    +  IY+ LF+ YA K  +I +LK++G++N     A++ V   +  G
Sbjct  66   SGFLLITINSVGCFIETIYIVLFITYANKKARISTLKVLGLLNFLGFAAIILVCELLTKG  125

Query  467  KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
              +   +G +C G ++ ++A+PLS MR VI+ KSVE+MPF LS F  L+   W  Y + +
Sbjct  126  LNREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTLSAITWLFYGLAI  185

Query  647  RDLYIGIPNGIGFLLGSAQIILYFI--YYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            +D Y+ +PN +G  LG+ Q+ILY I  YY++    + E P  +    I+M    +  ++G
Sbjct  186  KDFYVALPNIMGAFLGAVQMILYIIYKYYKAPKTNDTEKPKTVSGHSIDMVKLASTPASG  245

Query  821  KDPSEARAH  847
               +  + H
Sbjct  246  DLKAPPQTH  254



>ref|XP_004961041.1| PREDICTED: bidirectional sugar transporter SWEET5-like [Setaria 
italica]
Length=236

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 144/219 (66%), Gaps = 12/219 (5%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGI GN+IS  +FL+P+ TF +IV+K+  E F   PY+ T L+ +LW FYGL  + P  
Sbjct  10   IVGICGNIISFGLFLSPLPTFVQIVKKRDVEQFVPDPYLATFLNCALWVFYGLPIVHPNS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVL----  460
            +LVVT+NGTG+ + ++Y+S+F  YAP+    + LKM+G++ V  L  VVA+   VL    
Sbjct  70   ILVVTINGTGLAIEVVYLSVFFAYAPRP---KRLKMLGVLAVE-LVFVVAIAAGVLLGAH  125

Query  461  -HGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYA  637
             H K  L+ VG +C      MYA+PL+ M+ VI  KSVEYMPF LSF   LNG  W +YA
Sbjct  126  THEKRSLI-VGSVCIFFGTLMYAAPLTVMKRVITTKSVEYMPFTLSFVSFLNGICWTTYA  184

Query  638  MLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE  754
            ++  D++I IPNGIG  L SAQ+ILYF YY STP  ++ 
Sbjct  185  LIRFDIFITIPNGIGTFLSSAQLILYFCYYGSTPKNDKS  223



>ref|XP_006305555.1| hypothetical protein CARUB_v10010111mg [Capsella rubella]
 gb|EOA38453.1| hypothetical protein CARUB_v10010111mg [Capsella rubella]
Length=248

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 148/243 (61%), Gaps = 6/243 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            I G+ GN  ++ +FLAP  TFKRI++ KSTE F GIPY  TLL+  L ++YGL  +    
Sbjct  7    IFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDN  66

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             LV T+NGTG V+  IYV +FL YAPK  K++   +   + +A  G V  V+L  LHG  
Sbjct  67   TLVSTINGTGAVIETIYVLIFLFYAPKKEKVKIFGIFSCV-LAVFGTVALVSLFALHGNG  125

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + +  GL  T  +I MYASPLS MR VIK KSVE+MPF+LS F  L G  W  Y ++ RD
Sbjct  126  RKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGRD  185

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKS--NGKD  826
             ++ IPNG G  LG+ Q+ILYFIY  +   K+  D A   +  +EM ++   ++  NGK 
Sbjct  186  PFVAIPNGFGCALGTLQLILYFIYCGNKGEKKSGD-AEKDEKTVEMKDEEKKQTVVNGKQ  244

Query  827  PSE  835
              +
Sbjct  245  DQQ  247



>ref|XP_002873602.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49861.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=295

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 143/216 (66%), Gaps = 1/216 (0%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L+FI GI+GNVIS L+FLAPV TF RI +KKSTE+F+ +PY  +L S  LW +Y L+K  
Sbjct  10   LAFIFGILGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKKD  69

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
              L++T+N  G V+  +Y+++F  YA K+ +I +LK+   +NVAF   ++ VT  V+   
Sbjct  70   AFLLITINSFGCVVETLYIAMFFAYATKDKRISALKLFIAMNVAFFSLILMVTHFVVETP  129

Query  470  TKLMSV-GLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLV  646
            T  +SV G +C  +++ ++A+PL  +  VIK KSVE+MPF LSFF  ++  +W +Y + +
Sbjct  130  TLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFL  189

Query  647  RDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEE  754
             D+ I IPN +GF+LG  Q++LY +Y  S    E E
Sbjct  190  NDICIAIPNVVGFVLGLLQMVLYGVYRNSNEKPEME  225



>ref|XP_007031434.1| Nodulin MtN3 family protein, putative [Theobroma cacao]
 gb|EOY02360.1| Nodulin MtN3 family protein, putative [Theobroma cacao]
Length=247

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 154/246 (63%), Gaps = 16/246 (7%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGIIGNVIS L+F +P+ TF  I ++K+ E FK  PYI T ++  LW  YGL  + P  
Sbjct  10   IVGIIGNVISFLLFASPIPTFVNIYKRKAVEEFKPDPYIATAMNCMLWILYGLPLVHPDS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVG--IINVAFLGAVVAVTLSVLHG  466
             LVVT+N  G+ + +IY+++F IYA K  +   LK++G   + +AFLG V + TL +   
Sbjct  70   TLVVTINSIGLAMELIYLTIFFIYAQKKGR---LKVIGWLCVEIAFLGVVASCTLLLRKT  126

Query  467  KTKLMS-VGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
              +  + VG+LC    + MYASPL+ MR VIK KSVEYMPF+LS    LNG IW +YA++
Sbjct  127  HAQRSAPVGILCVIFGVLMYASPLTIMRKVIKTKSVEYMPFYLSLTNFLNGVIWLTYALI  186

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGK  823
              DLYI I NG+G L G+ Q+ILY  Y  STP  E+++   +VK      +++    NG 
Sbjct  187  RFDLYILIGNGLGTLSGAIQLILYACYCSSTPKYEDDE--VVVK-----PSELQLSDNG-  238

Query  824  DPSEAR  841
             P+ AR
Sbjct  239  GPARAR  244



>ref|XP_002511125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51727.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/256 (39%), Positives = 156/256 (61%), Gaps = 13/256 (5%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L F  G++GN+ISILMFL+P+ TF R+ +KKSTE F+ IPY+  L S  LW +Y +LK G
Sbjct  9    LIFTFGVLGNIISILMFLSPMFTFIRVYKKKSTEGFQSIPYVVALFSCMLWIYYAMLKSG  68

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
              L++++N  G ++  IY+ LF+ YA K  KI +L+++ ++N A   A+VA+T     G 
Sbjct  69   DYLLLSINSFGCLVQTIYIVLFIFYAEKKAKILTLQLLFLMNFAGFLAIVALTRFFAKGS  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            ++L  VG  C  ++  ++A+PLS +R V++ KSVE+MPF LS F  L+  +W  Y +L++
Sbjct  129  SRLHIVGWFCVAVSAVLFAAPLSVIRLVVRTKSVEFMPFTLSLFLTLSAIMWLLYGVLLK  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQ-----STPAKEEED------PAHLVKGGIEMAN  796
            DLYI +PN  G + G+ Q++LY IY         P K + D        H     + + +
Sbjct  189  DLYIALPNIFGLVFGAIQMVLYVIYRDGKKVIELPEKIDMDSPIKTFEVHAAVVSLPIPD  248

Query  797  DVAFKSNGKD-PSEAR  841
            D  ++ N +D P+E R
Sbjct  249  D-NYQVNKEDNPNEQR  263



>ref|XP_003615405.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES98363.1| bidirectional sugar transporter [Medicago truncatula]
Length=269

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 143/217 (66%), Gaps = 0/217 (0%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPg  289
            L+FI GI+GN+IS +++LAP+ TF RI +KKSTE F+ +PY+  L S+ LW +YG +K  
Sbjct  9    LAFIFGILGNIISSMVYLAPLPTFYRIWKKKSTEGFQSLPYLVALFSSMLWLYYGFVKKH  68

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
              L++T+N  G V+  IY+  +LIYA K+ +I ++K+   +NVA    +V  T   +HGK
Sbjct  69   AFLLITINSAGCVIETIYIVTYLIYATKDARILTIKLFMAMNVACSVLIVLTTQLAMHGK  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             ++  +G +CT   I ++A+PL+ M  VI+ KSVE+MP  LSFF  L+  +W  Y +L+ 
Sbjct  129  LRVHVLGWICTSFAICVFAAPLTIMAKVIRTKSVEFMPINLSFFLTLSAIVWFFYGLLLH  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDP  760
            D+ I IPN +GF+LG  Q++LY IY +S   +   +P
Sbjct  189  DICIAIPNVLGFILGLLQMLLYAIYNKSVKEEYALEP  225



>ref|XP_010270425.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Nelumbo nucifera]
Length=243

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 142/218 (65%), Gaps = 3/218 (1%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ GI GN  ++ +FLAP  TF+RI++ KSTE F G+PY+ TLL+  L ++YGL  + P 
Sbjct  6    FLFGIFGNATALFLFLAPTITFRRIIKNKSTEKFSGLPYVMTLLNCLLSAWYGLPFVSPH  65

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +LV T+NGTG  +  +YV +F+IYAPK  K + L ++  + +A   AV  V+L  LHG 
Sbjct  66   NILVSTINGTGSAIESVYVLIFIIYAPKKEKAKILALLSFV-LAVFSAVAVVSLCALHGS  124

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            ++ +  GL  T  +I MYASPLS +R VIK KSVE+MPF+LS F  L G  W  + +L R
Sbjct  125  SRKLFCGLAATIFSIIMYASPLSIVRMVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPA  763
            D ++ +PNG G  LG+ Q+ILY IY ++    + +D +
Sbjct  185  DPFVAVPNGFGCALGTVQLILYAIYRKNKGGAKADDDS  222



>ref|XP_011027388.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Populus 
euphratica]
Length=249

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 152/239 (64%), Gaps = 5/239 (2%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ GI GN  ++ +FLAP  TF+RI++ KSTE F GIPY+ TLL+  L ++YG+  +   
Sbjct  6    FLFGIFGNATALFLFLAPTITFRRIIRSKSTELFSGIPYVMTLLNCLLSAWYGMPFVSKN  65

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +LV T+NGTG ++  IYV  F+IYAPK  K + + ++ ++   F G V  V+L VLHGK
Sbjct  66   NILVSTINGTGALIEAIYVLTFIIYAPKKDKAKFIGLLTVVLTTFAG-VALVSLVVLHGK  124

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            ++ +  G      +I MY SPLS MRTVIK KSVEYMPF+LS F  L G  W  + +L  
Sbjct  125  SREIFCGFAAAIFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVFGLLGS  184

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQST-PAKEEEDPAHLVKGGI-EMANDVAFKSNG  820
            DL++ +PNG+G  LG+ Q+ILYFIY  +   AK+   P   ++ GI ++  +    SNG
Sbjct  185  DLFVAVPNGVGCGLGALQLILYFIYRNNKGEAKKPALPVQSMQMGIAKLHQEKQLVSNG  243



>ref|XP_006644347.1| PREDICTED: bidirectional sugar transporter SWEET6b-like [Oryza 
brachyantha]
Length=254

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 139/219 (63%), Gaps = 2/219 (1%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            +VGIIGNVIS  +FL+PV TF RI ++K  E FK  PY+ TLL+  LW FYGL  + P  
Sbjct  10   VVGIIGNVISFGLFLSPVPTFWRICKRKDVEEFKADPYLATLLNCMLWVFYGLPIVHPNS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +LVVT+NG G+V+  IY+ +F +Y+P   ++R + ++ +  V  +  V+ V +     + 
Sbjct  70   ILVVTINGVGLVVEGIYLIIFFLYSPNKKRLRMMAVLAVEAVFMVAVVLGVLMGAHTHEK  129

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + M VG+LC      MY SPL+ M  VIK KSVEYMPF+LS    LNG  W +YA++  D
Sbjct  130  RSMIVGILCVFFGSIMYFSPLTIMGKVIKTKSVEYMPFFLSLVCFLNGVCWTAYALIRFD  189

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHL  769
            LY+ IPN +G L G+ Q+ILY  YY+STP K+      L
Sbjct  190  LYVTIPNSLGALFGAVQLILYACYYKSTPKKQATKDVEL  228



>ref|XP_011027387.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Populus 
euphratica]
Length=249

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 152/241 (63%), Gaps = 5/241 (2%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ GI GN  ++ +FLAP  TF+RI++ KSTE F GIPY+ TLL+  L ++YG+  +   
Sbjct  6    FLFGIFGNATALFLFLAPTITFRRIIRSKSTELFSGIPYVMTLLNCLLSAWYGMPFVSKN  65

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +LV T+NGTG ++  IYV  F+IYAPK  K + + ++ ++   F G V  V+L VLHGK
Sbjct  66   NILVSTINGTGALIEAIYVLTFIIYAPKKDKAKFIGLLTVVLTTFAG-VALVSLVVLHGK  124

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
            ++ +  G      +I MY SPLS MRTVIK KSVEYMPF+LS F  L G  W  + +L  
Sbjct  125  SREIFCGFAAAIFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVFGLLGS  184

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQST-PAKEEEDPAHLVKGGI-EMANDVAFKSNGK  823
            DL++ +PNG+G  LG+ Q+ILYFIY  +   AK+   P   ++ GI ++  +    SNG 
Sbjct  185  DLFVAVPNGVGCGLGALQLILYFIYRNNKGEAKKPALPVQSMQMGIAKLHQEKQLVSNGS  244

Query  824  D  826
             
Sbjct  245  H  245



>ref|XP_010496503.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Camelina sativa]
Length=248

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 144/235 (61%), Gaps = 5/235 (2%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            I G+ GN  ++ +FLAP  TFKRI++ KSTE F GIPY  TLL+  L ++YGL  +    
Sbjct  7    IFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDN  66

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             LV T+NGTG V+  IYV +FLIYAPK  K++   +   + +A  G V  V+L  LHG  
Sbjct  67   TLVSTINGTGAVIETIYVFIFLIYAPKKEKVKIFGIFSCV-LAVFGTVALVSLFALHGNA  125

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            + +  GL  T  +I MYASPLS MR VIK KSVE+MPF+LS F  L G  W  Y ++ RD
Sbjct  126  RKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGRD  185

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSN  817
             ++ IPNG G  LG+ Q+ILYFIY  +    E+   A   +  +EM ++   K N
Sbjct  186  PFVAIPNGFGCALGTLQLILYFIYCGN--KGEKSGDAEKDEKMVEMKDEEKKKQN  238



>ref|XP_004962649.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=300

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/245 (39%), Positives = 146/245 (60%), Gaps = 18/245 (7%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GNVIS + FLAP+ TF RI + KSTE F+ +PY+  L S  LW FY L+K   
Sbjct  11   AFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALIKSNE  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +L++T+N  G V+  IYV L+ +YA K  +  + K++  +NV F GA++  TL V HG  
Sbjct  71   VLLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILLFTLLVFHGDK  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +++++G +C   ++G++ +PLS ++ VI+ +SVEYMPF LS    L+  +W  Y +L++D
Sbjct  131  RIVTLGWICVAFSVGVFVAPLSIIKRVIQTRSVEYMPFSLSLTLTLSAVVWFLYGLLIKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKDPS  832
             Y+ +PN +GF  G  Q++LY  Y   TP         +V  G         K  GK P+
Sbjct  191  KYVALPNILGFTFGVVQMVLYVFYMNKTP---------VVADG---------KEAGKLPT  232

Query  833  EARAH  847
             A  H
Sbjct  233  AADEH  237



>gb|KHG09976.1| Bidirectional sugar transporter SWEET1 -like protein [Gossypium 
arboreum]
Length=316

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 149/251 (59%), Gaps = 12/251 (5%)
 Frame = +2

Query  101  MASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL-  277
            M  L F+ G+ GN  ++ +FL+P  TFKRI++ KSTE F GIPY+ TLL+  L ++YGL 
Sbjct  65   MEVLHFVFGVFGNATALFLFLSPTITFKRIIRSKSTEQFSGIPYVMTLLNCLLSAWYGLP  124

Query  278  -LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLS  454
             +    +LV T+NGTG  +  IYV +F+IYAPK  K +   +   +   F  AV  ++L 
Sbjct  125  FVSKNNILVSTINGTGAAIESIYVLIFIIYAPKKEKAKIFGLFTFVLTVF-TAVALISLF  183

Query  455  VLHGKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASY  634
             LHG  + +  GL  T  +I MYASPLS MR VIK KSVE+MPF+LS F  L G  W  Y
Sbjct  184  ALHGNGRKLFCGLAATIFSIIMYASPLSIMRLVIKSKSVEFMPFFLSLFVFLCGTSWFIY  243

Query  635  AMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKS  814
             +L RD ++ +PNG G  LG+ Q+ILYFIY  +  ++E + P+          N  + + 
Sbjct  244  GLLGRDAFVAVPNGFGCGLGTMQLILYFIYRNNKGSQEIKKPS---------GNGTSIEI  294

Query  815  NGKDPSEARAH  847
              K P + + H
Sbjct  295  GEKKPHQDKQH  305



>ref|XP_007019365.1| Nodulin MtN3 family protein [Theobroma cacao]
 gb|EOY16590.1| Nodulin MtN3 family protein [Theobroma cacao]
Length=252

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 150/244 (61%), Gaps = 5/244 (2%)
 Frame = +2

Query  110  LSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LK  283
            L F+ GI GN  +  +FL+P  TF R+++ KSTE F GIPY+ TLL+  L ++YGL  + 
Sbjct  5    LHFMFGIFGNATAAFLFLSPTITFWRVIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPFVS  64

Query  284  PggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLH  463
               +LVVT+NG G  L  IYV +F+ +APK  KI+ L + G + +A   AV  V++  LH
Sbjct  65   ENNILVVTINGAGSGLEFIYVLIFIYHAPKKEKIKVLALFGFV-LAVFSAVALVSVLALH  123

Query  464  GKTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
            G  + +  G++    ++ MYASPLS MR VIK KSVE+MPF+LS F  L G  W  Y +L
Sbjct  124  GTGRKVFCGVVAAVFSVAMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGIL  183

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGK  823
             RD +I +PNG G  LG+ Q+ILY IY+++  +KE + P     G +EM  +       +
Sbjct  184  GRDAFIAVPNGFGCTLGTMQLILYSIYHKNKGSKETKKPT--ANGTVEMGPEKPPHQEKQ  241

Query  824  DPSE  835
            + S+
Sbjct  242  ENSQ  245



>ref|XP_010090683.1| Bidirectional sugar transporter N3 [Morus notabilis]
 gb|EXB40347.1| Bidirectional sugar transporter N3 [Morus notabilis]
Length=286

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 155/239 (65%), Gaps = 3/239 (1%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN+IS+L++LAPV TF R+ +KKSTE+F  +PY+  L S+ LW +Y LLK   
Sbjct  11   TFTFGILGNIISVLVYLAPVTTFYRVYRKKSTEDFHSLPYLVALFSSMLWLYYALLKTDA  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
            +L++T+N  G V+ +IY+++F++YAP + K  ++K   ++NV     +  VT   +    
Sbjct  71   MLLITINSFGCVIEMIYITMFIVYAPSHAKKLTIKFFALMNVGMFSLIFLVTQFAVGHSY  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  +G +C  +++ ++A+PLS +  VI+ +SVE+MPF LSFF  L+   W +Y +L++D
Sbjct  131  RVQVLGWICVAISVSVFAAPLSIVAQVIRTRSVEFMPFTLSFFLTLSAITWFAYGLLLKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIY--YQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGK  823
            + I +PN +GF+LG  Q++LY IY  Y++   +E++   H+ +  +  ++ V    N K
Sbjct  191  ICIAVPNVLGFVLGLLQMLLYAIYRNYKTEEDQEKKLSEHM-RNTLATSDQVHPVDNAK  248



>ref|XP_006434359.1| hypothetical protein CICLE_v10002276mg [Citrus clementina]
 gb|ESR47599.1| hypothetical protein CICLE_v10002276mg [Citrus clementina]
 gb|KDO83581.1| hypothetical protein CISIN_1g025686mg [Citrus sinensis]
Length=249

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 143/230 (62%), Gaps = 7/230 (3%)
 Frame = +2

Query  116  FIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPg  289
            F+ G+ GN  ++ +FLAP  TF+RIV++KSTE F GIPY+ TLL+  L ++YGL  +   
Sbjct  6    FLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSKN  65

Query  290  gllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             +LV T+NGTG  + IIYV +FL++APK  K +   +  ++   F  AV  V+L   HG 
Sbjct  66   NILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVF-AAVALVSLLAFHGN  124

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             + +  G   T  +I MYASPLS MR VIK KSVE+MPF+LS F  L G  W  + +L R
Sbjct  125  ARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFVFGLLGR  184

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMAND  799
            D ++ +PNG G  LG+ Q+ILYFIY++    K E +      G +EM  +
Sbjct  185  DPFVAVPNGFGCGLGTMQLILYFIYHK----KGEPEKPSAANGSVEMGQE  230



>ref|XP_006439288.1| hypothetical protein CICLE_v10024343mg [Citrus clementina]
 gb|ESR52528.1| hypothetical protein CICLE_v10024343mg [Citrus clementina]
Length=258

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 162/249 (65%), Gaps = 7/249 (3%)
 Frame = +2

Query  98   VMASLSFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL  277
            V+ ++  +VGIIGN+IS+ +FL+PV TF  IV+K + E +   PY+ TLL+  +W  YGL
Sbjct  5    VVNTIRNVVGIIGNIISLFLFLSPVPTFVEIVKKGTVEQYSAAPYLATLLNCMVWVLYGL  64

Query  278  --LKPggllvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTL  451
              + P  +LV+T+NG+G  + ++Y+ LF++++ K  +I+ + +V ++ V F+  V  + L
Sbjct  65   PMVHPHSILVITINGSGTAIEVVYIILFVLHSDKKKRIKVM-LVVLVEVIFVALVALLVL  123

Query  452  SVLHG-KTKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWA  628
            ++LH  K + M+VG++C    I MYASPLS M+ VI  KSVEYMPF+LS   + NG  W 
Sbjct  124  TLLHSTKQRSMAVGIICILFNIMMYASPLSVMKLVITTKSVEYMPFFLSLMSLANGIAWT  183

Query  629  SYAMLVRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAF  808
            +YA L  D +I IPNG+G LLG AQ+ILY  YY+ST   + +  A   KG ++++  V  
Sbjct  184  TYAFLPFDQFIAIPNGLGTLLGVAQVILYACYYKST---KRQMAARQGKGQVDLSAVVVS  240

Query  809  KSNGKDPSE  835
            +S+  D  +
Sbjct  241  ESDSGDSKK  249



>ref|XP_008677256.1| PREDICTED: LOC100282648 isoform X1 [Zea mays]
 gb|AFW62434.1| MTN3 isoform 1 [Zea mays]
 gb|AFW62435.1| MTN3 isoform 2 [Zea mays]
Length=304

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 148/234 (63%), Gaps = 8/234 (3%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  GI+GN++S+++FL+P+ TF R+ + KSTE F+  PY+ TL S  LW  Y LLKPG 
Sbjct  12   AFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYALLKPGA  71

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L+VT+NG G V+  +Y++++L+YAPK  ++ + KM+  +NVA  G V  VT+ +     
Sbjct  72   ELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVTMLLSDAGL  131

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            ++  +G +C  +++ ++A+PLS MR VI+ KSVE+MP  LSFF VL+  +W +Y  L +D
Sbjct  132  RVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVVWFAYGALKKD  191

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPA--------KEEEDPAHLVKGGIEM  790
            +++  PN +GF+ G AQ+ LY  Y +   A        KEE        GG E+
Sbjct  192  VFVAFPNVLGFVFGLAQMALYMAYRKPAAALVIIPEQSKEEVAEGKASCGGAEV  245



>gb|EMS47629.1| Bidirectional sugar transporter SWEET6b [Triticum urartu]
Length=247

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 144/218 (66%), Gaps = 9/218 (4%)
 Frame = +2

Query  119  IVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGL--LKPgg  292
            IVGI+GNVIS  +FL+PV TF RI++ K  E FK  PY+ TLL+  LW FYGL  + P  
Sbjct  10   IVGIVGNVISFGLFLSPVPTFWRIIKAKDVEEFKPDPYLATLLNCMLWVFYGLPIVHPNS  69

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVA--FLGAVVAVTLSVLHG  466
            +LVVT+NG G+V+   Y+ +F IYA +N +   LKM+G++ V   F+ AVVA  L   H 
Sbjct  70   ILVVTINGIGLVIESAYLIIFFIYATRNTR---LKMLGVLAVEALFMVAVVAGVLLGAHT  126

Query  467  KTKL-MSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAML  643
              K  M VG+LC      MYASPL+ M  VIK +SVEYMPF LS    LNG  W +YA++
Sbjct  127  HEKRSMIVGILCVIFGSVMYASPLTIMGKVIKTRSVEYMPFVLSLVNFLNGCCWTAYALI  186

Query  644  VRDLYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEED  757
              DLYI IPNG+G + G AQ+ILY  YY+STP KE ++
Sbjct  187  KFDLYITIPNGLGAVFGLAQLILYGCYYRSTP-KEGKN  223



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 152/250 (61%), Gaps = 13/250 (5%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F+ G++GNVIS ++FLAP+ TF +I +KKS+E F+ +PY+  L S+ LW +Y  +K   
Sbjct  9    AFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFVKKDA  68

Query  293  llvvtvngtg-vvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGK  469
             L++    +   V+  IY+++FL+YAP   ++ ++K++ ++NV   GA++  TL +  G 
Sbjct  69   SLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTGS  128

Query  470  TKLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVR  649
             +L  +G +C    I ++A+PL  M+ VIK KSVE+MPF LSF   +N  +W  Y +L++
Sbjct  129  KRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMWFFYGLLLK  188

Query  650  DLYIGIPNGIGFLLGSAQIILYFIYY---QSTPAKEEEDPAHLVKGGIEMANDVAFKSNG  820
            D YI +PN +GFL G  Q++LY IY    +  P K EE  +H++  G         K + 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAKKDEPMKLEELNSHIINVG---------KLSR  239

Query  821  KDPSEARAHT  850
             +PSE    T
Sbjct  240  MEPSEPNHAT  249



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 148/238 (62%), Gaps = 11/238 (5%)
 Frame = +2

Query  113  SFIVGIIGNVISILMFLAPVKTFKRIVQKKSTENFKGIPYITTLLSTSLWSFYGLLKPgg  292
            +F  G++GNVIS    LAP+ TF RI + KSTE F+ +PY+  L S  LW FY L+K G 
Sbjct  11   AFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  293  llvvtvngtgvvlHIIYVSLFLIYAPKNIKIRSLKMVGIINVAFLGAVVAVTLSVLHGKT  472
             L++++N  G V+  +Y+ ++L+YAP+  KI + K+V ++N+A  G +  +TL   HG+T
Sbjct  71   GLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNIAGFGLIFLLTLFAFHGET  130

Query  473  KLMSVGLLCTGLTIGMYASPLSAMRTVIKMKSVEYMPFWLSFFQVLNGGIWASYAMLVRD  652
            +++++G +C G ++ ++ +PLS +  VIK KSVEYMPF LS    L+  +W  Y +L++D
Sbjct  131  RVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGLLIKD  190

Query  653  LYIGIPNGIGFLLGSAQIILYFIYYQSTPAKEEEDPAHLVKGGIEMANDVAFKSNGKD  826
             Y+ +PN +GF  G  Q++LY  Y   TP   +      VK G E     A+K+  +D
Sbjct  191  KYVALPNILGFTFGVIQMVLYVFYMNKTPMASQ------VKEGKE-----AWKAPAED  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2307507805398