BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32387_g1_i1 len=1187 path=[1165:0-1186]

Length=1187
                                                                      Score     E

ref|XP_009771248.1|  PREDICTED: probable 2-oxoglutarate-dependent...    543   0.0      
ref|XP_004241720.1|  PREDICTED: probable 2-oxoglutarate-dependent...    532   0.0      
ref|XP_009588351.1|  PREDICTED: probable 2-oxoglutarate-dependent...    529   0.0      
ref|XP_006356178.1|  PREDICTED: probable 2-oxoglutarate-dependent...    528   0.0      
ref|XP_007216862.1|  hypothetical protein PRUPE_ppa021358mg             517   2e-180   
emb|CDP08458.1|  unnamed protein product                                517   2e-180   
ref|XP_008228619.1|  PREDICTED: probable 2-oxoglutarate-dependent...    513   1e-178   
ref|XP_002284968.1|  PREDICTED: probable 2-oxoglutarate-dependent...    506   3e-176   Vitis vinifera
ref|XP_003528366.1|  PREDICTED: probable 2-oxoglutarate-dependent...    504   1e-175   
gb|KHN01361.1|  Gibberellin 20 oxidase 1                                502   1e-174   
emb|CAN80138.1|  hypothetical protein VITISV_028512                     502   1e-174   Vitis vinifera
gb|KHG05406.1|  2'-deoxymugineic-acid 2'-dioxygenase                    499   2e-173   
ref|XP_004302952.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     496   2e-172   
ref|XP_009339603.1|  PREDICTED: probable 2-oxoglutarate-dependent...    496   5e-172   
gb|KDP37168.1|  hypothetical protein JCGZ_06224                         494   1e-171   
ref|XP_008377588.1|  PREDICTED: probable 2-oxoglutarate-dependent...    493   3e-171   
ref|XP_002298129.1|  2-oxoglutarate-dependent dioxygenase-related...    493   4e-171   Populus trichocarpa [western balsam poplar]
ref|XP_010033902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    493   5e-171   
ref|XP_010110312.1|  Gibberellin 3-beta-dioxygenase 4                   492   9e-171   
ref|XP_004152262.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         489   1e-169   
ref|XP_008454372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    488   3e-169   
ref|XP_006465423.1|  PREDICTED: probable 2-oxoglutarate-dependent...    487   8e-169   
ref|XP_007135717.1|  hypothetical protein PHAVU_010G152300g             484   1e-167   
ref|XP_002517541.1|  Gibberellin 20 oxidase, putative                   480   5e-166   Ricinus communis
ref|XP_006427127.1|  hypothetical protein CICLE_v10027219mg             479   9e-166   
gb|KEH28749.1|  2-oxoglutarate-dependent dioxygenase                    479   1e-165   
ref|XP_011045369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    478   4e-165   
gb|KDO58204.1|  hypothetical protein CISIN_1g038676mg                   477   5e-165   
gb|AFK40822.1|  unknown                                                 476   3e-164   
gb|AFK47428.1|  unknown                                                 474   2e-163   
ref|XP_004241718.1|  PREDICTED: probable 2-oxoglutarate-dependent...    470   3e-162   
ref|XP_004506878.1|  PREDICTED: S-norcoclaurine synthase 1-like         470   4e-162   
ref|NP_175691.1|  putative 2-oxoglutarate-dependent dioxygenase         469   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147658.1|  PREDICTED: probable 2-oxoglutarate-dependent...    469   1e-161   
ref|XP_007024009.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    468   3e-161   
emb|CDY26044.1|  BnaC06g05800D                                          466   2e-160   
ref|XP_006305391.1|  hypothetical protein CARUB_v10009783mg             466   3e-160   
ref|XP_011072273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    464   1e-159   
ref|XP_010542274.1|  PREDICTED: probable 2-oxoglutarate-dependent...    460   3e-158   
ref|XP_006367751.1|  PREDICTED: probable 2-oxoglutarate-dependent...    460   3e-158   
gb|KEH28750.1|  2-oxoglutarate-dependent dioxygenase                    460   4e-158   
ref|XP_006392865.1|  hypothetical protein EUTSA_v10011667mg             459   8e-158   
ref|XP_006367749.1|  PREDICTED: probable 2-oxoglutarate-dependent...    459   1e-157   
emb|CDP08459.1|  unnamed protein product                                459   1e-157   
ref|XP_004241719.1|  PREDICTED: probable 2-oxoglutarate-dependent...    459   1e-157   
ref|XP_010033901.1|  PREDICTED: probable 2-oxoglutarate-dependent...    458   2e-157   
ref|XP_006356185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    456   1e-156   
ref|XP_010462134.1|  PREDICTED: probable 2-oxoglutarate-dependent...    454   1e-155   
ref|XP_010500907.1|  PREDICTED: probable 2-oxoglutarate-dependent...    452   5e-155   
ref|XP_007216816.1|  hypothetical protein PRUPE_ppa023108mg             452   8e-155   
ref|XP_008228620.1|  PREDICTED: probable 2-oxoglutarate-dependent...    449   1e-153   
ref|XP_010500906.1|  PREDICTED: probable 2-oxoglutarate-dependent...    448   1e-153   
ref|XP_010479810.1|  PREDICTED: probable 2-oxoglutarate-dependent...    444   7e-152   
ref|XP_006365982.1|  PREDICTED: probable 2-oxoglutarate-dependent...    439   1e-149   
ref|XP_004506877.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    437   3e-149   
ref|XP_010462135.1|  PREDICTED: probable 2-oxoglutarate-dependent...    429   4e-146   
ref|XP_010500908.1|  PREDICTED: probable 2-oxoglutarate-dependent...    427   2e-145   
emb|CDP14980.1|  unnamed protein product                                424   8e-144   
ref|XP_006598543.1|  PREDICTED: probable 2-oxoglutarate-dependent...    419   1e-142   
gb|KHN45675.1|  Gibberellin 20 oxidase 1                                417   3e-142   
ref|XP_007024010.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    412   3e-139   
ref|XP_003554143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    409   3e-138   
gb|KHN14924.1|  Gibberellin 20 oxidase 3                                405   1e-136   
ref|XP_008784635.1|  PREDICTED: probable 2-oxoglutarate-dependent...    398   6e-134   
ref|XP_002515914.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    395   2e-132   Ricinus communis
ref|XP_007024016.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    393   1e-131   
ref|XP_009771249.1|  PREDICTED: probable 2-oxoglutarate-dependent...    390   1e-131   
ref|XP_007162139.1|  hypothetical protein PHAVU_001G127400g             383   5e-128   
emb|CDY22099.1|  BnaA09g01280D                                          373   7e-124   
gb|EYU21580.1|  hypothetical protein MIMGU_mgv1a010552mg                372   1e-123   
emb|CDY21938.1|  BnaC09g00440D                                          372   1e-123   
ref|XP_009122188.1|  PREDICTED: probable 2-oxoglutarate-dependent...    368   6e-122   
ref|XP_006289716.1|  hypothetical protein CARUB_v10003282mg             367   2e-121   
gb|AAL14687.1|  2-oxoglutarate-dependent dioxygenase                    363   2e-120   Arabidopsis halleri
ref|XP_011045372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    364   2e-120   
sp|Q945B6.1|AOP1L_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    364   2e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AAL14645.1|AF417857_1  AOP1                                          364   2e-120   Arabidopsis lyrata [lyrate rockcress]
ref|NP_192216.1|  oxidoreductase AOP1                                   362   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    362   1e-119   Vitis vinifera
emb|CAN80139.1|  hypothetical protein VITISV_028513                     361   2e-119   Vitis vinifera
gb|KFK30903.1|  hypothetical protein AALP_AA6G041100                    361   2e-119   
gb|EYU21579.1|  hypothetical protein MIMGU_mgv1a010719mg                360   4e-119   
gb|AAL14683.1|  2-oxoglutarate-dependent dioxygenase                    360   7e-119   Arabidopsis thaliana [mouse-ear cress]
emb|CAN77851.1|  hypothetical protein VITISV_030994                     360   8e-119   Vitis vinifera
ref|XP_006396533.1|  hypothetical protein EUTSA_v10028799mg             360   1e-118   
gb|AAL14686.1|  2-oxoglutarate-dependent dioxygenase                    359   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298124.1|  hypothetical protein POPTR_0001s17580g             358   5e-118   Populus trichocarpa [western balsam poplar]
ref|XP_002280670.1|  PREDICTED: probable 2-oxoglutarate-dependent...    357   8e-118   Vitis vinifera
gb|KFK30901.1|  hypothetical protein AALP_AA6G040900                    357   1e-117   
gb|AAL14698.1|  2-oxoglutarate-dependent dioxygenase                    356   2e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AAL14701.1|  2-oxoglutarate-dependent dioxygenase                    355   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515925.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    355   5e-117   Ricinus communis
ref|XP_009134375.1|  PREDICTED: probable 2-oxoglutarate-dependent...    354   1e-116   
gb|AAL14699.1|  2-oxoglutarate-dependent dioxygenase                    352   7e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CBI36206.3|  unnamed protein product                                357   1e-115   
ref|XP_002284983.1|  PREDICTED: probable inactive 2-oxoglutarate-...    352   1e-115   Vitis vinifera
gb|KDP40825.1|  hypothetical protein JCGZ_24824                         351   2e-115   
ref|XP_009799663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    351   3e-115   
ref|XP_008377592.1|  PREDICTED: probable 2-oxoglutarate-dependent...    350   6e-115   
gb|KHN47795.1|  hypothetical protein glysoja_029213                     346   2e-114   
sp|Q944Z5.1|AOP1V_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    348   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467243.1|  PREDICTED: probable 2-oxoglutarate-dependent...    349   2e-114   
gb|KDP40827.1|  hypothetical protein JCGZ_24826                         348   5e-114   
gb|KDO58207.1|  hypothetical protein CISIN_1g037660mg                   347   6e-114   
ref|XP_006427130.1|  hypothetical protein CICLE_v10027182mg             347   9e-114   
emb|CDY17965.1|  BnaC03g30370D                                          347   9e-114   
ref|XP_002517544.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    347   1e-113   Ricinus communis
ref|XP_002298131.1|  hypothetical protein POPTR_0001s17670g             347   1e-113   Populus trichocarpa [western balsam poplar]
gb|EYU41035.1|  hypothetical protein MIMGU_mgv1a013300mg                342   2e-113   
emb|CDO98090.1|  unnamed protein product                                345   3e-113   
gb|KFK30904.1|  hypothetical protein AALP_AA6G041200                    345   4e-113   
ref|XP_009616143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    345   5e-113   
ref|XP_009339601.1|  PREDICTED: probable 2-oxoglutarate-dependent...    344   1e-112   
ref|XP_011045368.1|  PREDICTED: probable 2-oxoglutarate-dependent...    343   2e-112   
emb|CDY17969.1|  BnaC03g30410D                                          343   5e-112   
ref|XP_007215723.1|  hypothetical protein PRUPE_ppa008973mg             342   7e-112   
emb|CDY21937.1|  BnaC09g00430D                                          342   8e-112   
ref|XP_006356186.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    342   8e-112   
ref|XP_004241716.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    342   9e-112   
emb|CDP17011.1|  unnamed protein product                                342   1e-111   
gb|KDP40826.1|  hypothetical protein JCGZ_24825                         342   1e-111   
ref|XP_009122199.1|  PREDICTED: probable 2-oxoglutarate-dependent...    341   3e-111   
ref|XP_004302943.1|  PREDICTED: gibberellin 20 oxidase 1-like           340   3e-111   
emb|CDY22098.1|  BnaA09g01270D                                          340   4e-111   
ref|XP_002298127.1|  oxidoreductase family protein                      340   6e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011045371.1|  PREDICTED: probable 2-oxoglutarate-dependent...    339   8e-111   
ref|XP_002517546.1|  Gibberellin 20 oxidase, putative                   340   9e-111   Ricinus communis
ref|XP_006465516.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    339   1e-110   
ref|XP_006427128.1|  hypothetical protein CICLE_v10027501mg             339   3e-110   
ref|XP_008228621.1|  PREDICTED: probable 2-oxoglutarate-dependent...    338   3e-110   
ref|XP_002517543.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    338   5e-110   Ricinus communis
gb|KHG07058.1|  hypothetical protein F383_33647                         337   6e-110   
gb|KHG05318.1|  2'-deoxymugineic-acid 2'-dioxygenase                    336   2e-109   
ref|XP_007024003.1|  2-oxoglutarate-dependent dioxygenase               335   3e-109   
ref|XP_010110313.1|  Gibberellin 3-beta-dioxygenase 4                   335   4e-109   
gb|AAL14685.1|  2-oxoglutarate-dependent dioxygenase                    333   1e-108   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52785.1|  hypothetical protein Csa_4G001530                       331   1e-108   
gb|KHG17593.1|  2'-deoxymugineic-acid 2'-dioxygenase                    333   1e-108   
ref|XP_002517548.1|  Gibberellin 20 oxidase, putative                   332   5e-108   Ricinus communis
ref|XP_010047771.1|  PREDICTED: probable 2-oxoglutarate-dependent...    332   5e-108   
gb|AAL14696.1|  2-oxoglutarate-dependent dioxygenase                    330   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007024008.1|  2-oxoglutarate-dependent dioxygenase, putative     330   2e-107   
gb|AAL14702.1|  2-oxoglutarate-dependent dioxygenase                    328   4e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAL14700.1|  2-oxoglutarate-dependent dioxygenase                    328   8e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339306.1|  PREDICTED: probable 2-oxoglutarate-dependent...    329   9e-107   
gb|AAL14684.1|  2-oxoglutarate-dependent dioxygenase                    326   4e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAL14692.1|  2-oxoglutarate-dependent dioxygenase                    325   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    326   2e-105   
ref|XP_011072310.1|  PREDICTED: probable 2-oxoglutarate-dependent...    325   2e-105   
gb|AAL14680.1|  2-oxoglutarate-dependent dioxygenase                    324   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011072270.1|  PREDICTED: probable 2-oxoglutarate-dependent...    325   3e-105   
ref|XP_006465514.1|  PREDICTED: probable 2-oxoglutarate-dependent...    325   4e-105   
gb|KHG02339.1|  2'-deoxymugineic-acid 2'-dioxygenase                    325   4e-105   
ref|XP_010455020.1|  PREDICTED: probable 2-oxoglutarate-dependent...    324   5e-105   
emb|CDP10326.1|  unnamed protein product                                325   5e-105   
ref|XP_008228622.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    324   7e-105   
gb|KEH28751.1|  2-oxoglutarate-dependent dioxygenase                    322   1e-104   
ref|XP_006427131.1|  hypothetical protein CICLE_v10027420mg             323   1e-104   
gb|AAL14681.1|  2-oxoglutarate-dependent dioxygenase                    321   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21585.1|  hypothetical protein MIMGU_mgv1a010381mg                322   4e-104   
gb|AFC36356.1|  2-oxoglutarate-dependent dioxygenase                    322   4e-104   
gb|AAL14678.1|  2-oxoglutarate-dependent dioxygenase                    320   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392866.1|  hypothetical protein EUTSA_v10011658mg             322   9e-104   
gb|KDP37163.1|  hypothetical protein JCGZ_06219                         320   2e-103   
ref|XP_006427132.1|  hypothetical protein CICLE_v10027083mg             320   2e-103   
ref|XP_010110322.1|  Gibberellin 20 oxidase 1                           322   3e-103   
gb|AAL14691.1|  2-oxoglutarate-dependent dioxygenase                    318   4e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02338.1|  Flavonol synthase/flavanone 3-hydroxylase -like p...    320   4e-103   
ref|XP_004233542.1|  PREDICTED: probable 2-oxoglutarate-dependent...    320   4e-103   
gb|KDP37165.1|  hypothetical protein JCGZ_06221                         320   5e-103   
ref|XP_007217562.1|  hypothetical protein PRUPE_ppa021035mg             319   7e-103   
ref|XP_004233539.1|  PREDICTED: probable 2-oxoglutarate-dependent...    319   8e-103   
ref|XP_004233541.1|  PREDICTED: probable 2-oxoglutarate-dependent...    319   8e-103   
ref|XP_006465515.1|  PREDICTED: probable 2-oxoglutarate-dependent...    318   1e-102   
gb|AAL14695.1|  2-oxoglutarate-dependent dioxygenase                    317   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912205.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...    318   1e-102   
ref|XP_010249917.1|  PREDICTED: probable 2-oxoglutarate-dependent...    318   2e-102   
gb|AAL14688.1|  2-oxoglutarate-dependent dioxygenase                    316   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAL14677.1|  2-oxoglutarate-dependent dioxygenase                    315   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354215.1|  PREDICTED: probable 2-oxoglutarate-dependent...    317   5e-102   
ref|XP_009147659.1|  PREDICTED: probable 2-oxoglutarate-dependent...    316   1e-101   
ref|XP_002284985.1|  PREDICTED: probable 2-oxoglutarate-dependent...    315   2e-101   Vitis vinifera
gb|AAL14689.1|  2-oxoglutarate-dependent dioxygenase                    312   7e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010034855.1|  PREDICTED: probable 2-oxoglutarate-dependent...    314   8e-101   
emb|CDO98089.1|  unnamed protein product                                313   1e-100   
ref|XP_010665883.1|  PREDICTED: probable 2-oxoglutarate-dependent...    313   2e-100   
ref|XP_006427129.1|  hypothetical protein CICLE_v10027545mg             313   2e-100   
gb|KFK30902.1|  hypothetical protein AALP_AA6G041000                    311   8e-100   
emb|CDP19783.1|  unnamed protein product                                310   1e-99    
ref|XP_009339602.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    310   1e-99    
ref|XP_004151475.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         311   2e-99    
ref|XP_002517545.1|  Leucoanthocyanidin dioxygenase, putative           310   3e-99    Ricinus communis
ref|XP_006465422.1|  PREDICTED: probable 2-oxoglutarate-dependent...    309   4e-99    
ref|XP_008377590.1|  PREDICTED: probable 2-oxoglutarate-dependent...    308   6e-99    
emb|CDX97295.1|  BnaA02g20860D                                          308   6e-99    
ref|XP_009107019.1|  PREDICTED: probable 2-oxoglutarate-dependent...    309   6e-99    
ref|XP_009147661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    308   8e-99    
ref|XP_010061959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    308   9e-99    
ref|XP_006392870.1|  hypothetical protein EUTSA_v10011669mg             308   1e-98    
ref|XP_007214491.1|  hypothetical protein PRUPE_ppa020361mg             307   2e-98    
emb|CDY68239.1|  BnaA06g37440D                                          307   3e-98    
gb|KFK35768.1|  hypothetical protein AALP_AA4G033700                    306   4e-98    
ref|XP_008377591.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    306   5e-98    
gb|KFK35767.1|  hypothetical protein AALP_AA4G033600                    306   5e-98    
ref|XP_006406954.1|  hypothetical protein EUTSA_v10021145mg             306   6e-98    
ref|NP_175688.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    306   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011072311.1|  PREDICTED: probable 2-oxoglutarate-dependent...    306   7e-98    
gb|AAL14694.1|  2-oxoglutarate-dependent dioxygenase                    304   1e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDY26055.1|  BnaC06g05690D                                          305   2e-97    
ref|XP_002517690.1|  Gibberellin 20 oxidase, putative                   305   2e-97    Ricinus communis
emb|CDP10327.1|  unnamed protein product                                305   2e-97    
ref|XP_009379331.1|  PREDICTED: probable 2-oxoglutarate-dependent...    305   2e-97    
ref|XP_007024335.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    315   2e-97    
ref|XP_008794218.1|  PREDICTED: probable 2-oxoglutarate-dependent...    305   3e-97    
ref|XP_008226092.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    304   4e-97    
ref|XP_011019740.1|  PREDICTED: probable 2-oxoglutarate-dependent...    306   5e-97    
emb|CDX91263.1|  BnaC02g26740D                                          303   5e-97    
ref|XP_010479807.1|  PREDICTED: probable 2-oxoglutarate-dependent...    304   5e-97    
ref|XP_004171510.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    304   6e-97    
ref|XP_004136074.1|  PREDICTED: gibberellin 20 oxidase 1-like           304   6e-97    
ref|NP_175689.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    304   6e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KDP37167.1|  hypothetical protein JCGZ_06223                         303   2e-96    
ref|XP_007135718.1|  hypothetical protein PHAVU_010G152400g             303   2e-96    
emb|CAN66061.1|  hypothetical protein VITISV_007808                     303   2e-96    Vitis vinifera
ref|XP_003533058.1|  PREDICTED: probable 2-oxoglutarate-dependent...    302   4e-96    
emb|CDO98091.1|  unnamed protein product                                301   8e-96    
ref|XP_006306220.1|  hypothetical protein CARUB_v10011908mg             300   1e-95    
ref|XP_002284931.1|  PREDICTED: probable 2-oxoglutarate-dependent...    300   2e-95    Vitis vinifera
ref|XP_004165032.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         300   2e-95    
gb|KDO58208.1|  hypothetical protein CISIN_1g044747mg                   299   4e-95    
ref|XP_010545796.1|  PREDICTED: probable 2-oxoglutarate-dependent...    299   5e-95    
ref|XP_009393623.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    299   1e-94    
ref|XP_010033904.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    298   1e-94    
ref|XP_006304019.1|  hypothetical protein CARUB_v10009745mg             298   2e-94    
ref|XP_010500902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    297   3e-94    
ref|XP_006392868.1|  hypothetical protein EUTSA_v10011672mg             296   4e-94    
ref|XP_009799661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    296   4e-94    
ref|XP_010061960.1|  PREDICTED: probable inactive 2-oxoglutarate-...    296   4e-94    
ref|XP_010535123.1|  PREDICTED: probable 2-oxoglutarate-dependent...    296   6e-94    
ref|XP_002309592.1|  hypothetical protein POPTR_0006s26410g             296   6e-94    Populus trichocarpa [western balsam poplar]
ref|XP_009400514.1|  PREDICTED: probable inactive 2-oxoglutarate-...    296   9e-94    
gb|EYU21582.1|  hypothetical protein MIMGU_mgv1a010360mg                295   1e-93    
emb|CDP20247.1|  unnamed protein product                                295   2e-93    
ref|XP_004241717.1|  PREDICTED: probable 2-oxoglutarate-dependent...    295   2e-93    
ref|XP_006305421.1|  hypothetical protein CARUB_v10009821mg             294   3e-93    
ref|XP_010462133.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    294   3e-93    
ref|XP_003535849.1|  PREDICTED: probable 2-oxoglutarate-dependent...    294   3e-93    
gb|EYU31921.1|  hypothetical protein MIMGU_mgv1a010132mg                295   3e-93    
ref|XP_004302942.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    294   5e-93    
ref|XP_010500899.1|  PREDICTED: probable 2-oxoglutarate-dependent...    294   6e-93    
ref|XP_008461058.1|  PREDICTED: probable inactive 2-oxoglutarate-...    293   7e-93    
ref|XP_006304540.1|  hypothetical protein CARUB_v10011508mg             293   8e-93    
gb|KHN31409.1|  Gibberellin 20 oxidase 1                                293   9e-93    
ref|XP_009371496.1|  PREDICTED: probable 2-oxoglutarate-dependent...    293   9e-93    
ref|XP_009147660.1|  PREDICTED: probable 2-oxoglutarate-dependent...    293   1e-92    
ref|XP_003553391.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    293   2e-92    
gb|ACU24369.1|  unknown                                                 292   2e-92    Glycine max [soybeans]
ref|XP_009616144.1|  PREDICTED: probable 2-oxoglutarate-dependent...    292   2e-92    
ref|XP_002298125.1|  hypothetical protein POPTR_0001s17610g             290   3e-92    Populus trichocarpa [western balsam poplar]
ref|XP_009400516.1|  PREDICTED: probable inactive 2-oxoglutarate-...    291   4e-92    
ref|XP_009347560.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    291   4e-92    
ref|XP_006854891.1|  hypothetical protein AMTR_s00052p00016200          291   5e-92    
ref|XP_010463426.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   6e-92    
ref|XP_010460572.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   6e-92    
ref|XP_010499297.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   6e-92    
emb|CDP19495.1|  unnamed protein product                                291   7e-92    
emb|CDY39112.1|  BnaA01g29440D                                          291   7e-92    
ref|XP_009115437.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   7e-92    
ref|XP_009400518.1|  PREDICTED: probable inactive 2-oxoglutarate-...    291   8e-92    
ref|XP_002324836.1|  hypothetical protein POPTR_0018s01190g             290   9e-92    Populus trichocarpa [western balsam poplar]
emb|CDY20136.1|  BnaA01g28660D                                          291   9e-92    
ref|XP_009375961.1|  PREDICTED: probable inactive 2-oxoglutarate-...    291   9e-92    
ref|XP_010478155.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   9e-92    
ref|XP_004228709.1|  PREDICTED: probable inactive 2-oxoglutarate-...    290   1e-91    
ref|XP_006367752.1|  PREDICTED: probable 2-oxoglutarate-dependent...    286   1e-91    
ref|XP_010481152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    293   2e-91    
ref|XP_007145554.1|  hypothetical protein PHAVU_007G248400g             290   2e-91    
emb|CDY71515.1|  BnaCnng73240D                                          290   2e-91    
ref|XP_011026516.1|  PREDICTED: probable 2-oxoglutarate-dependent...    290   2e-91    
ref|XP_010915540.1|  PREDICTED: probable 2-oxoglutarate-dependent...    290   2e-91    
gb|EYU21577.1|  hypothetical protein MIMGU_mgv1a0102781mg               286   3e-91    
ref|XP_004228723.2|  PREDICTED: probable 2-oxoglutarate-dependent...    289   4e-91    
ref|XP_008219866.1|  PREDICTED: probable 2-oxoglutarate-dependent...    289   5e-91    
ref|XP_002517547.1|  Gibberellin 20 oxidase, putative                   288   6e-91    
ref|XP_007224725.1|  hypothetical protein PRUPE_ppa024900mg             288   6e-91    
ref|XP_006406953.1|  hypothetical protein EUTSA_v10021144mg             288   7e-91    
emb|CDY26054.1|  BnaC06g05700D                                          288   1e-90    
ref|XP_010913592.1|  PREDICTED: probable inactive 2-oxoglutarate-...    288   1e-90    
ref|XP_008366303.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    288   1e-90    
ref|XP_009382147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    290   1e-90    
gb|KDP24591.1|  hypothetical protein JCGZ_25507                         287   2e-90    
ref|XP_009116922.1|  PREDICTED: probable 2-oxoglutarate-dependent...    288   2e-90    
ref|XP_007162137.1|  hypothetical protein PHAVU_001G127200g             287   3e-90    
ref|XP_008386022.1|  PREDICTED: probable inactive 2-oxoglutarate-...    286   3e-90    
ref|XP_003625060.1|  Gibberellin 20 oxidase                             286   3e-90    
ref|XP_010110314.1|  Gibberellin 3-beta-dioxygenase 4                   286   4e-90    
gb|KDP37380.1|  hypothetical protein JCGZ_06834                         286   5e-90    
ref|XP_008384915.1|  PREDICTED: probable inactive 2-oxoglutarate-...    286   6e-90    
ref|NP_174124.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    286   7e-90    
ref|XP_010041295.1|  PREDICTED: probable 2-oxoglutarate-dependent...    285   2e-89    
ref|XP_009146228.1|  PREDICTED: probable 2-oxoglutarate-dependent...    285   2e-89    
gb|KDP37164.1|  hypothetical protein JCGZ_06220                         284   2e-89    
ref|XP_009780364.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    284   3e-89    
ref|XP_006365807.1|  PREDICTED: probable 2-oxoglutarate-dependent...    284   4e-89    
ref|XP_004148019.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    285   4e-89    
ref|XP_009375959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    283   6e-89    
gb|EYU21578.1|  hypothetical protein MIMGU_mgv1a025607mg                281   9e-89    
ref|XP_010050515.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    283   1e-88    
ref|XP_007013772.1|  2-oxoglutarate-dependent dioxygenase               282   2e-88    
ref|XP_010545794.1|  PREDICTED: probable 2-oxoglutarate-dependent...    283   2e-88    
ref|XP_010479801.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    281   5e-88    
ref|XP_003553825.1|  PREDICTED: probable 2-oxoglutarate-dependent...    281   5e-88    
gb|KCW82770.1|  hypothetical protein EUGRSUZ_C04146                     281   7e-88    
ref|XP_003521152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    281   8e-88    
gb|KHN06108.1|  Gibberellin 3-beta-dioxygenase 3                        280   8e-88    
ref|XP_006853001.1|  hypothetical protein AMTR_s00174p00019750          280   1e-87    
ref|XP_009377501.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    281   1e-87    
ref|XP_008394038.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    280   2e-87    
ref|XP_007145555.1|  hypothetical protein PHAVU_007G248500g             279   3e-87    
ref|XP_010110319.1|  Protein SRG1                                       279   3e-87    
ref|XP_009364342.1|  PREDICTED: probable inactive 2-oxoglutarate-...    278   4e-87    
gb|KDP37370.1|  hypothetical protein JCGZ_06824                         278   7e-87    
ref|XP_010050517.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    278   8e-87    
gb|AFK44600.1|  unknown                                                 278   9e-87    
ref|XP_007145552.1|  hypothetical protein PHAVU_007G248200g             278   9e-87    
ref|XP_010032029.1|  PREDICTED: probable 2-oxoglutarate-dependent...    277   1e-86    
ref|XP_010060704.1|  PREDICTED: probable inactive 2-oxoglutarate-...    277   2e-86    
ref|XP_008344774.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    277   2e-86    
ref|XP_010112085.1|  Gibberellin 20 oxidase 1                           276   3e-86    
gb|AFK38656.1|  unknown                                                 276   4e-86    
ref|XP_010061958.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   4e-86    
emb|CDO98088.1|  unnamed protein product                                276   6e-86    
ref|XP_009395077.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   6e-86    
ref|XP_010049940.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   7e-86    
gb|KFK35765.1|  hypothetical protein AALP_AA4G033400                    281   8e-86    
ref|XP_009802367.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    274   2e-85    
gb|KDP32296.1|  hypothetical protein JCGZ_13221                         274   3e-85    
gb|KHG09549.1|  Flavonol synthase/flavanone 3-hydroxylase               274   3e-85    
ref|XP_008366657.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    274   3e-85    
ref|XP_010061956.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   3e-85    
ref|XP_009603180.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    274   3e-85    
emb|CDY53799.1|  BnaA06g01840D                                          273   4e-85    
gb|KCW79744.1|  hypothetical protein EUGRSUZ_C01088                     273   4e-85    
ref|XP_006392867.1|  hypothetical protein EUTSA_v10011672mg             272   5e-85    
ref|XP_009608401.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    273   5e-85    
ref|XP_003555065.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    273   6e-85    
emb|CDP21179.1|  unnamed protein product                                273   6e-85    
ref|XP_008461057.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   7e-85    
ref|XP_009146229.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   8e-85    
ref|XP_006476205.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   8e-85    
ref|XP_004293154.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    272   1e-84    
ref|XP_010110321.1|  Gibberellin 20 oxidase 1                           272   1e-84    
ref|XP_006450545.1|  hypothetical protein CICLE_v10010426mg             272   1e-84    
ref|XP_004253140.1|  PREDICTED: probable 2-oxoglutarate-dependent...    272   2e-84    
ref|XP_004253465.1|  PREDICTED: probable 2-oxoglutarate-dependent...    271   2e-84    
ref|XP_010061957.1|  PREDICTED: probable 2-oxoglutarate-dependent...    272   2e-84    
ref|XP_006354213.1|  PREDICTED: probable 2-oxoglutarate-dependent...    272   2e-84    
ref|XP_010050518.1|  PREDICTED: probable 2-oxoglutarate-dependent...    271   3e-84    
ref|XP_009372949.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    271   4e-84    
ref|XP_002515597.1|  Gibberellin 2-beta-dioxygenase, putative           271   5e-84    
ref|XP_008227259.1|  PREDICTED: probable inactive 2-oxoglutarate-...    270   7e-84    
ref|XP_010460573.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   7e-84    
emb|CDP10138.1|  unnamed protein product                                270   1e-83    
emb|CBI20990.3|  unnamed protein product                                267   2e-83    
ref|XP_006655618.1|  PREDICTED: probable 2-oxoglutarate-dependent...    269   2e-83    
ref|XP_004291498.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    269   3e-83    
ref|XP_007162138.1|  hypothetical protein PHAVU_001G127300g             268   3e-83    
ref|XP_004963576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    271   3e-83    
ref|NP_175690.1|  2-oxoglutarate-dependent dioxygenase-related pr...    268   3e-83    
ref|XP_004136073.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...    268   4e-83    
gb|KDP37166.1|  hypothetical protein JCGZ_06222                         265   9e-83    
ref|XP_010050512.1|  PREDICTED: probable 2-oxoglutarate-dependent...    271   9e-83    
gb|KCW67512.1|  hypothetical protein EUGRSUZ_F01241                     267   9e-83    
ref|XP_006305900.1|  hypothetical protein CARUB_v10011074mg             267   1e-82    
ref|XP_004292967.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    267   1e-82    
emb|CDY20137.1|  BnaA01g28650D                                          266   2e-82    
ref|XP_004291427.1|  PREDICTED: gibberellin 20 oxidase 1-B-like i...    266   2e-82    
emb|CDP21163.1|  unnamed protein product                                265   3e-82    
ref|XP_007145557.1|  hypothetical protein PHAVU_007G248700g             266   3e-82    
ref|XP_009344329.1|  PREDICTED: probable inactive 2-oxoglutarate-...    266   3e-82    
gb|KFK38900.1|  hypothetical protein AALP_AA3G175500                    266   4e-82    
gb|KFK38898.1|  hypothetical protein AALP_AA3G175300                    266   5e-82    
ref|XP_008382989.1|  PREDICTED: probable inactive 2-oxoglutarate-...    265   5e-82    
gb|KCW79743.1|  hypothetical protein EUGRSUZ_C01086                     265   6e-82    
ref|XP_011045370.1|  PREDICTED: probable 2-oxoglutarate-dependent...    265   1e-81    
ref|XP_009115427.1|  PREDICTED: probable 2-oxoglutarate-dependent...    265   1e-81    
emb|CDP08608.1|  unnamed protein product                                265   1e-81    
ref|XP_008227273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    265   1e-81    
ref|XP_007214111.1|  hypothetical protein PRUPE_ppa017120mg             264   1e-81    
gb|KCW82320.1|  hypothetical protein EUGRSUZ_C03724                     265   1e-81    
ref|XP_004306704.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    264   2e-81    
ref|XP_009354842.1|  PREDICTED: probable inactive 2-oxoglutarate-...    264   2e-81    
ref|XP_008390710.1|  PREDICTED: probable inactive 2-oxoglutarate-...    264   3e-81    
ref|XP_008227260.1|  PREDICTED: probable 2-oxoglutarate-dependent...    263   5e-81    
ref|XP_008372275.1|  PREDICTED: probable inactive 2-oxoglutarate-...    263   5e-81    
ref|XP_002298128.2|  hypothetical protein POPTR_0001s17630g             263   6e-81    
gb|KDP32297.1|  hypothetical protein JCGZ_13222                         263   6e-81    
ref|XP_003547720.1|  PREDICTED: probable inactive 2-oxoglutarate-...    262   1e-80    
gb|KHN27538.1|  Gibberellin 20 oxidase 1                                261   2e-80    
gb|KHN14925.1|  Gibberellin 20 oxidase 1                                261   2e-80    
ref|XP_003554144.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    261   3e-80    
ref|XP_002441559.1|  hypothetical protein SORBIDRAFT_09g029340          261   4e-80    
ref|XP_008447674.1|  PREDICTED: probable 2-oxoglutarate-dependent...    262   1e-79    
gb|KDO58205.1|  hypothetical protein CISIN_1g045288mg                   256   1e-79    
ref|XP_004291426.1|  PREDICTED: gibberellin 20 oxidase 1-B-like i...    259   2e-79    
emb|CDO98087.1|  unnamed protein product                                258   2e-79    
ref|XP_002515596.1|  Gibberellin 3-beta-dioxygenase, putative           258   5e-79    
ref|XP_004291428.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    257   1e-78    
ref|XP_007212875.1|  hypothetical protein PRUPE_ppa021625mg             255   4e-78    
ref|XP_002889297.1|  predicted protein                                  255   4e-78    
ref|XP_008227261.1|  PREDICTED: probable inactive 2-oxoglutarate-...    255   4e-78    
ref|XP_006389780.1|  hypothetical protein EUTSA_v10018872mg             255   5e-78    
emb|CDP14441.1|  unnamed protein product                                255   7e-78    
ref|XP_009621187.1|  PREDICTED: probable 2-oxoglutarate-dependent...    253   9e-78    
ref|XP_009785373.1|  PREDICTED: probable 2-oxoglutarate-dependent...    253   9e-78    
ref|XP_004301787.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    255   9e-78    
ref|XP_009621185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    254   1e-77    
ref|XP_006301978.1|  hypothetical protein CARUB_v10022458mg             254   1e-77    
ref|XP_008650052.1|  PREDICTED: probable 2-oxoglutarate-dependent...    255   2e-77    
emb|CBI36205.3|  unnamed protein product                                252   2e-77    
emb|CDP19784.1|  unnamed protein product                                254   2e-77    
gb|KFK42423.1|  hypothetical protein AALP_AA2G254300                    254   2e-77    
ref|XP_007217670.1|  hypothetical protein PRUPE_ppa026316mg             251   3e-77    
ref|XP_004288730.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    253   3e-77    
ref|NP_001140777.1|  hypothetical protein                               253   3e-77    
gb|ABC60341.1|  putative oxidoreductase                                 251   3e-77    
ref|XP_004252327.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    253   4e-77    
gb|KHG18604.1|  hypothetical protein F383_26382                         253   4e-77    
ref|XP_008809069.1|  PREDICTED: probable 2-oxoglutarate-dependent...    252   7e-77    
ref|XP_010110316.1|  Gibberellin 20 oxidase 1                           254   1e-76    
gb|EYU21581.1|  hypothetical protein MIMGU_mgv1a010326mg                251   1e-76    
emb|CDY46979.1|  BnaC09g14250D                                          250   3e-76    
gb|KHG27363.1|  hypothetical protein F383_12181                         251   3e-76    
ref|NP_178148.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    250   6e-76    
ref|XP_010481153.1|  PREDICTED: probable 2-oxoglutarate-dependent...    249   8e-76    
ref|XP_006346585.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    249   8e-76    
emb|CDP21180.1|  unnamed protein product                                249   2e-75    
emb|CDY38659.1|  BnaC02g23200D                                          249   2e-75    
gb|KHG05299.1|  Gibberellin 2-beta-dioxygenase 8 -like protein          249   2e-75    
gb|AFK42467.1|  unknown                                                 248   3e-75    
ref|XP_010429979.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   4e-75    
gb|KHG23522.1|  hypothetical protein F383_29495                         247   9e-75    
gb|KHF99371.1|  hypothetical protein F383_19520                         247   1e-74    
emb|CDY37587.1|  BnaA02g19830D                                          247   1e-74    
ref|XP_010532145.1|  PREDICTED: probable 2-oxoglutarate-dependent...    246   2e-74    
gb|KDP24586.1|  hypothetical protein JCGZ_25502                         247   2e-74    
ref|XP_010472950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    245   4e-74    
gb|EAY99141.1|  hypothetical protein OsI_21100                          244   6e-74    
ref|XP_004291497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    244   8e-74    
gb|AHK10572.1|  oxidoreductase AOP1                                     241   9e-74    
gb|KHF99372.1|  hypothetical protein F383_19520                         244   1e-73    
ref|XP_010472949.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   1e-73    
ref|XP_009128434.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   1e-73    
ref|XP_003522635.1|  PREDICTED: probable inactive 2-oxoglutarate-...    243   2e-73    
gb|KFK35766.1|  hypothetical protein AALP_AA4G033500                    241   2e-73    
gb|KHG29411.1|  2'-deoxymugineic-acid 2'-dioxygenase                    243   5e-73    
gb|KHG14763.1|  hypothetical protein F383_19492                         242   5e-73    
ref|XP_007161252.1|  hypothetical protein PHAVU_001G054800g             242   7e-73    
ref|XP_010500901.1|  PREDICTED: probable 2-oxoglutarate-dependent...    241   8e-73    
gb|KHG08387.1|  hypothetical protein F383_35627                         241   1e-72    
gb|KHG16680.1|  hypothetical protein F383_22967                         241   2e-72    
emb|CDP21546.1|  unnamed protein product                                241   2e-72    
gb|KHG06206.1|  Gibberellin 2-beta-dioxygenase 8 -like protein          241   3e-72    
ref|XP_011072272.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   4e-72    
ref|XP_009372397.1|  PREDICTED: probable inactive 2-oxoglutarate-...    239   5e-72    
gb|EYU24677.1|  hypothetical protein MIMGU_mgv1a010266mg                239   6e-72    
emb|CDP11139.1|  unnamed protein product                                239   7e-72    
ref|XP_009340682.1|  PREDICTED: probable inactive 2-oxoglutarate-...    239   1e-71    
ref|XP_003523702.1|  PREDICTED: probable inactive 2-oxoglutarate-...    238   2e-71    
ref|XP_004501289.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    238   2e-71    
ref|XP_006416895.1|  hypothetical protein EUTSA_v10008198mg             238   2e-71    
ref|XP_006348005.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    238   3e-71    
ref|XP_009785369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   4e-71    
ref|XP_010026428.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    236   4e-71    
ref|XP_008351637.1|  PREDICTED: probable inactive 2-oxoglutarate-...    237   4e-71    
ref|XP_010532147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    237   5e-71    
dbj|BAJ96647.1|  predicted protein                                      237   6e-71    
dbj|BAJ93571.1|  predicted protein                                      237   6e-71    
ref|XP_004513386.1|  PREDICTED: probable flavonol synthase 5-like       236   8e-71    
ref|XP_002890109.1|  predicted protein                                  236   9e-71    
gb|KCW69003.1|  hypothetical protein EUGRSUZ_F02563                     235   9e-71    
ref|XP_007211257.1|  hypothetical protein PRUPE_ppa021247mg             236   1e-70    
ref|XP_003588694.1|  2-oxoglutarate-dependent dioxygenase               235   1e-70    
ref|XP_004229769.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    236   1e-70    
ref|XP_007162140.1|  hypothetical protein PHAVU_001G127500g             235   1e-70    
ref|XP_006348004.1|  PREDICTED: probable 2-oxoglutarate-dependent...    235   2e-70    
ref|XP_009340685.1|  PREDICTED: probable inactive 2-oxoglutarate-...    235   2e-70    
emb|CDP11140.1|  unnamed protein product                                235   4e-70    
ref|XP_008238357.1|  PREDICTED: probable inactive 2-oxoglutarate-...    234   5e-70    
ref|XP_004287966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    233   5e-70    
ref|XP_004295487.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    233   1e-69    
ref|XP_006348413.1|  PREDICTED: probable 2-oxoglutarate-dependent...    232   2e-69    
gb|KHG05367.1|  Flavonol synthase/flavanone 3-hydroxylase -like p...    233   2e-69    
ref|XP_004229768.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    233   3e-69    
gb|KHG20467.1|  hypothetical protein F383_25524                         233   3e-69    
ref|XP_009340689.1|  PREDICTED: probable inactive 2-oxoglutarate-...    232   3e-69    
ref|XP_008780295.1|  PREDICTED: probable 2-oxoglutarate-dependent...    230   4e-69    
gb|KHG23333.1|  hypothetical protein F383_30224                         232   6e-69    
ref|XP_009372418.1|  PREDICTED: probable inactive 2-oxoglutarate-...    231   1e-68    
gb|KEH35936.1|  gibberellin 2-beta-dioxygenase                          231   1e-68    



>ref|XP_009771248.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Nicotiana sylvestris]
Length=313

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/314 (79%), Positives = 283/314 (90%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ IKLP IDFS+E+LKPG   W++V+NQVHKALV YGCFEA+FDKIPIHLR+S+ +
Sbjct  1     MGSET-IKLPNIDFSNEDLKPGSLVWNQVKNQVHKALVNYGCFEASFDKIPIHLRKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +LKELFDLPLQTK+RN S KPFHGYVGQYP VPLYESMGIDDAN+    + FT I+WP+G
Sbjct  60    SLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANISDKAERFTRILWPEG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NPNFC ++QSYSE+LS LD  VR+MILESLGVEKYMDEHMNSTNYLLRVMKYKGP+ +DT
Sbjct  120   NPNFCKTIQSYSEQLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSNDT  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN+VNGLEVL KDGQWINV P+P++FIVMIGDSLYAW NGR+H
Sbjct  180   KLGLNAHTDKNIVTILYQNQVNGLEVLTKDGQWINVEPTPDAFIVMIGDSLYAWANGRVH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM+GNEARYS GLFSIPKAGY IKAPEEL D++HPLLF PFDHVEFL FYY+EE
Sbjct  240   SPYHRVMMTGNEARYSVGLFSIPKAGYKIKAPEELADKEHPLLFKPFDHVEFLAFYYTEE  299

Query  236   GQKCQSALATYCGV  195
             GQ+C SAL TYCGV
Sbjct  300   GQRCGSALKTYCGV  313



>ref|XP_004241720.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=313

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/314 (77%), Positives = 280/314 (89%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP IDFS E+LKP    W++V++QVHKALVEYGCFEA+FDKIPIHLR+S+ +
Sbjct  1     MGSEN-MKLPKIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPLQTK++N S KPFHGYVGQYP VPLYESMGIDDAN+ H  + FT I+WPQG
Sbjct  60    SLQELFDLPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKAEKFTQILWPQG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC ++QSYSE+LS LD  +RRMI+ESLGVEKYMDEHMNST+YLLRVMKYKGP+  +T
Sbjct  120   NPTFCKTIQSYSEQLSELDQTIRRMIVESLGVEKYMDEHMNSTSYLLRVMKYKGPQSSET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQNEV+GLEVL KDG+WINV+P+P++F VMIGDSLYAW NGRLH
Sbjct  180   KVGLNAHTDKNIVTILYQNEVSGLEVLTKDGKWINVDPTPDTFTVMIGDSLYAWANGRLH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM GNEARYS GLFSIPKAGY IKAPEELVDE+H LLF PFDHVEFL FYY+EE
Sbjct  240   SPYHRVMMRGNEARYSVGLFSIPKAGYTIKAPEELVDEEHSLLFKPFDHVEFLDFYYTEE  299

Query  236   GQKCQSALATYCGV  195
             GQ+C SAL TYCGV
Sbjct  300   GQRCASALKTYCGV  313



>ref|XP_009588351.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=313

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/314 (78%), Positives = 277/314 (88%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ IKLP IDFS+ +LKPG   W++V++QVHKALV YGCFEA+FDKIPIHLR+S+ +
Sbjct  1     MGSET-IKLPNIDFSNVDLKPGTLVWNQVKSQVHKALVNYGCFEASFDKIPIHLRKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +LKELFDLPLQTK+RN S KPFHGYVGQYP VPLYESMGIDDAN+    + FT I+WP+G
Sbjct  60    SLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANIPDKAESFTRILWPEG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC ++QSYSE+LS LD  VRRMILESLGVE YM EHMNSTNYLLRVMKYKGP+  +T
Sbjct  120   NPTFCKTIQSYSEQLSELDQTVRRMILESLGVENYMGEHMNSTNYLLRVMKYKGPQSSET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN+VNGLEVL +DGQWINV P+PN+FIVMIGDSLYAW NGR+H
Sbjct  180   KVGLNAHTDKNIVTILYQNQVNGLEVLTEDGQWINVEPTPNAFIVMIGDSLYAWANGRVH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMM GNEARYS GLFSIPKAGY I APEELVDE+HPLLF PFDHVEFL FYY+EE
Sbjct  240   SPFHRVMMRGNEARYSVGLFSIPKAGYKIMAPEELVDEEHPLLFKPFDHVEFLAFYYTEE  299

Query  236   GQKCQSALATYCGV  195
             GQ+C SAL TYCGV
Sbjct  300   GQRCGSALKTYCGV  313



>ref|XP_006356178.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=313

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/314 (78%), Positives = 278/314 (89%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLPIIDFS E+LKP    W++V++QVHKALVEYGCFEA+FDKIPIHLR+S+ +
Sbjct  1     MGSEN-TKLPIIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPLQTK++N S KPFHGYVGQYP VPLYESMGIDDAN+ H T+ FT I+WPQG
Sbjct  60    SLQELFDLPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKTEKFTQILWPQG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC ++QSYSE LS LD  VR+MILESLGVEKYMDEHMNSTNYLLRVMKYKGP+  +T
Sbjct  120   NPTFCETIQSYSEHLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSSET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQNEV+GLEVL KDG WINV+P+P++F VMIGDSLYAW NG+LH
Sbjct  180   KLGLNAHTDKNIVTILYQNEVSGLEVLTKDGHWINVDPTPDTFTVMIGDSLYAWANGQLH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMM GNEARYS GLFSIPKAGY IKAP+ELVDE+H LLF PFDHVEFL FYY+EE
Sbjct  240   SPNHRVMMRGNEARYSVGLFSIPKAGYTIKAPKELVDEEHSLLFKPFDHVEFLDFYYTEE  299

Query  236   GQKCQSALATYCGV  195
             GQ+C SAL TYCGV
Sbjct  300   GQRCASALKTYCGV  313



>ref|XP_007216862.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
 gb|EMJ18061.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
Length=321

 Score =   517 bits (1332),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 276/314 (88%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP+IDFS+++L PG   W+ VR QVH AL EYGCFEA F+K+P H+R+S+  
Sbjct  1     MGSETPLKLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFNKVPPHIRKSIFP  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPLQTK++N S KPFHGYVGQYPMVPLYESMG+DDAN+    Q  TN +WPQG
Sbjct  61    SIEELFDLPLQTKLQNVSKKPFHGYVGQYPMVPLYESMGVDDANVYEQVQSLTNTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+FC ++QS+SE++S LD ++RRMILESLG+EKY++EH+ STNYLLRVMKYKGP+ ++T
Sbjct  121   NPSFCKTIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGPQTNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN+V+GLEV NKDG+WINV PSP+SFI MIGDSLYAWTNGRLH
Sbjct  181   KLGLNAHTDKNIVTILYQNQVDGLEVQNKDGKWINVKPSPDSFIAMIGDSLYAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMMSGNE RYS GLFSIPK GYIIKAPEE+VDE+HPLLF PFDHV+FLGFYYSE 
Sbjct  241   SPYHRVMMSGNEVRYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGFYYSEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+  SAL TYCGV
Sbjct  301   GQRAHSALKTYCGV  314



>emb|CDP08458.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   517 bits (1331),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 239/314 (76%), Positives = 272/314 (87%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+   LP IDFS+  LKPG P WD V++QV KAL EYGCFEA FDKIP+ L++S+ D
Sbjct  1     MGSET-TSLPTIDFSNPGLKPGAPEWDLVKDQVRKALEEYGCFEALFDKIPLELQKSLFD  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPLQTKVRN+S KPFHGYVGQYPMVPLYESMGIDDA +    + FT+++WP+G
Sbjct  60    ALEELFDLPLQTKVRNSSKKPFHGYVGQYPMVPLYESMGIDDATISEKVESFTDLLWPEG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NFC +V SYS++LS LD +VRRMILESLG EKYMDEHM+STNYLLRVMKYKGP+  + 
Sbjct  120   NSNFCKTVHSYSDQLSDLDKIVRRMILESLGAEKYMDEHMDSTNYLLRVMKYKGPQTTEP  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTIL QN+V GLE+L KDG WI+V PSP SFIVMIGDSL AWTNGRLH
Sbjct  180   KLGLNAHTDKNIVTILSQNQVQGLELLTKDGHWIDVKPSPGSFIVMIGDSLLAWTNGRLH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYH+VMM+GNEARYSAGLFSIPKAGYIIKAPEELVDE+HPLLF PFDHVEFL FYY+E 
Sbjct  240   SPYHQVMMTGNEARYSAGLFSIPKAGYIIKAPEELVDEEHPLLFKPFDHVEFLSFYYTEA  299

Query  236   GQKCQSALATYCGV  195
             GQ+ QSAL TYCGV
Sbjct  300   GQRAQSALKTYCGV  313



>ref|XP_008228619.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   513 bits (1320),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 229/314 (73%), Positives = 275/314 (88%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP+IDFS+++L PG   W+ VR QVH AL EYGCFEA F+K+P H+R+S+  
Sbjct  1     MGSETPPKLPVIDFSNQSLTPGTTEWNAVRAQVHNALEEYGCFEALFNKVPSHIRKSIFP  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPLQTK++N S KP+HGYVGQYPMVPLYESMG+D AN+    Q  TN +WP+G
Sbjct  61    SIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGVDGANVYEQVQSLTNTLWPRG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+FC ++QS+SE++S LD ++RRMILESLG+EKY++EH+ STNYLLRVMKYKGP+ ++T
Sbjct  121   NPSFCKAIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGPQTNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN+V+GLEV NKDG+WINV PSP+SFI MIGDSLYAWTNGRLH
Sbjct  181   KLGLNAHTDKNIVTILYQNQVDGLEVQNKDGKWINVKPSPDSFIAMIGDSLYAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMMSGNEARYS GLFSIPK GYIIKAPEE+VDE+HPLLF PFDHV+FLGFYYSE 
Sbjct  241   SPYHRVMMSGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGFYYSEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+  SAL TYCGV
Sbjct  301   GQRAHSALKTYCGV  314



>ref|XP_002284968.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36202.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   506 bits (1302),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 273/314 (87%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP+IDFSD  LKPG   W+ V+ QV KAL EYGCFEA F+K+P+ LR+++  
Sbjct  1     MGSETPLKLPVIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPLQTK+RN+S KP+HGYVGQYP VPLYESMGIDDA +    +HFT ++WP+G
Sbjct  61    ALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPEG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NPNFC ++QS+SE+LS LD  +RRM+LESLG+EKY+DEHM+STNYLLRVMKYKGP+  +T
Sbjct  121   NPNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGPQTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN+V+GL V  KDGQWIN+  SP+SFI+MIGDS  AWTNGRLH
Sbjct  181   KLGLNAHTDKNIVTILYQNQVDGLGVQTKDGQWINIKCSPDSFIIMIGDSFLAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM+GNE+RYS GLFSIPKAGY+IKAPEELVDE+HPLLF PFDH+EFL FYY+E 
Sbjct  241   SPYHRVMMTGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQFYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+ +SAL TYCGV
Sbjct  301   GQRAESALKTYCGV  314



>ref|XP_003528366.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=314

 Score =   504 bits (1298),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 275/314 (88%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP+IDF++  L+   P W+ +++QVHKALV+YGCFEA F+K+P+ LR+++  
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPLQTK+ N S KP+HGYVGQYPMVPL+ESMGIDDAN+  N +  TNIMWP G
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPHG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+F  ++QS+SE+LS LD ++R+MILESLGVEKY++EHMNSTNYLLRVMKYKGP+  DT
Sbjct  121   NPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +H+DKNIVTILYQNEV GLEV+ KDG+WI+  PSP+SF+VMIGDSL+AW+NGRLH
Sbjct  181   KVGLTTHSDKNIVTILYQNEVEGLEVMTKDGKWISYRPSPDSFVVMIGDSLHAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMMSGNEARYSAGLFSIPK G IIKAPEELVDE+HPLLF PFDHVEFL +YY+E+
Sbjct  241   SPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKYYYTEK  300

Query  236   GQKCQSALATYCGV  195
             GQ+ Q AL TYCGV
Sbjct  301   GQRDQFALRTYCGV  314



>gb|KHN01361.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=314

 Score =   502 bits (1292),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 274/314 (87%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP+IDF++  L+   P W+ +++QVHKALV+YGCFEA F+K+P+ LR+++  
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPLQTK+ N S KP+HGYVGQYPMVPL+ESMGIDDAN+  N +  TNIMWP G
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPHG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+F  ++QS+SE+LS LD ++R+MILESLGVEKY++EHMNSTNYLL VMKYKGP+  DT
Sbjct  121   NPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLEVMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +H+DKNIVTILYQNEV GLEV+ KDG+WI+  PSP+SF+VMIGDSL+AW+NGRLH
Sbjct  181   KVGLTTHSDKNIVTILYQNEVEGLEVMTKDGKWISYRPSPDSFVVMIGDSLHAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMMSGNEARYSAGLFSIPK G IIKAPEELVDE+HPLLF PFDHVEFL +YY+E+
Sbjct  241   SPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKYYYTEK  300

Query  236   GQKCQSALATYCGV  195
             GQ+ Q AL TYCGV
Sbjct  301   GQRDQFALRTYCGV  314



>emb|CAN80138.1| hypothetical protein VITISV_028512 [Vitis vinifera]
Length=314

 Score =   502 bits (1292),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 271/314 (86%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP IDFSD  LKPG   W+ V+ QV KAL EYGCFEA F+K+P+ LR+++  
Sbjct  1     MGSETPLKLPXIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPLQTK+RN+S KP+HGYVGQYP VPLYESMGIDDA +    +HFT ++WP+G
Sbjct  61    ALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPEG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NPNFC ++QS+SE+LS LD  +RRM+LESLG+EKY+DEHM+STNYLLRVMKYKGP+  +T
Sbjct  121   NPNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGPQTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN+V+GL V  KDG WIN+  SP+SFI+MIGDS  AWTNGRLH
Sbjct  181   KLGLNAHTDKNIVTILYQNQVDGLGVQTKDGXWINIKCSPDSFIIMIGDSFLAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM+GNE+RYS GLFSIPKAGY+IKAPEELVDE+HPLLF PFDH+EFL FYY+E 
Sbjct  241   SPYHRVMMTGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQFYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+ +SAL TYCGV
Sbjct  301   GQRAESALKTYCGV  314



>gb|KHG05406.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=314

 Score =   499 bits (1284),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 268/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++ +KLP+IDFS  +LK G   WD V+ QV +AL EYGCFEA FDKIP+HLRE++  
Sbjct  1     MGSQTPLKLPVIDFSKPDLKAGSNEWDLVKGQVQQALQEYGCFEALFDKIPLHLREAIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPLQ K+RN SNKP+HGYVGQYP VPLYESMG+DDAN+    +  T  +WPQG
Sbjct  61    SLQELFDLPLQAKIRNVSNKPYHGYVGQYPQVPLYESMGVDDANITEKVEALTTTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F N++QS+SE+LS LD +VRRMILES  +EKYMDEHM STNYLLRVMKYKGP+  +T
Sbjct  121   NSSFSNTIQSFSEQLSELDQIVRRMILESFDLEKYMDEHMGSTNYLLRVMKYKGPKTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLNSHTDKNIVTILYQNEV+GLEVL+K G+WINV PS +SF VMIG+SLYAW NGRLH
Sbjct  181   KLGLNSHTDKNIVTILYQNEVDGLEVLSKQGEWINVKPSKHSFTVMIGESLYAWLNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             +PYHRVMM+G++ARYSAGLFS+PKAGYIIKAP+ELVDE HPLLF PFDHV+FL FYY+E 
Sbjct  241   APYHRVMMTGDKARYSAGLFSVPKAGYIIKAPDELVDEAHPLLFKPFDHVDFLRFYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQK +SAL  +CGV
Sbjct  301   GQKAESALKVFCGV  314



>ref|XP_004302952.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   496 bits (1277),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 268/316 (85%), Gaps = 0/316 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ IKLP IDFS  NLKPG   WD VR QV  AL EYGCFEA F+K+P+ +++++ +
Sbjct  1     MGSETPIKLPTIDFSMPNLKPGTTEWDSVRAQVRFALEEYGCFEALFNKVPLDVQKAIFE  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A +ELFDLPLQTK+RN S KPFHGY+GQYPMVPLYES+GID+AN+    Q FT+ +WPQ 
Sbjct  61    ATEELFDLPLQTKLRNVSQKPFHGYIGQYPMVPLYESVGIDEANVYGQVQSFTHTLWPQQ  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NPNF  +V S+SEKLS LD ++RRM+LESLG+EKY++EH+ STNYLLR+MKYKGP+ ++T
Sbjct  121   NPNFSKTVHSFSEKLSELDQIIRRMVLESLGLEKYLEEHIGSTNYLLRLMKYKGPQTNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+G+NSHTDKNIVTILYQN+V+GLE+  KDG+WINV P P SFI MIGDSLYAWTNGRLH
Sbjct  181   KLGINSHTDKNIVTILYQNQVHGLEIQTKDGKWINVKPLPESFIAMIGDSLYAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMM+GNE RYS GLFSIPKAGYIIKAPEE+VDE+HPLLF PFDHVEFLGFYYSE 
Sbjct  241   SPPHRVMMTGNEDRYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYYSEA  300

Query  236   GQKCQSALATYCGV*N  189
             GQ+  SAL  YCGV N
Sbjct  301   GQRAPSALKAYCGVQN  316



>ref|XP_009339603.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=322

 Score =   496 bits (1276),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 265/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+ + +PIIDFS  +L  G   WD VR QV  AL EYGCFEA FDK+P  +R+S I+
Sbjct  1     MASETPLGIPIIDFSKPDLNQGTKEWDLVRAQVRNALEEYGCFEALFDKVPSDIRKSTIE  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPLQTK++N S KP+HGYVGQYPMVPLYESMG DDAN+    +  TN +WPQG
Sbjct  61    SIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC ++QS+SE++S LD ++RRMILESLG+EKY +EH+ STNYLLRVMKYKGPE  +T
Sbjct  121   NPRFCTTIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGPETKET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPS-PNSFIVMIGDSLYAWTNGRL  420
             K+G+N+HTDKNIVTILYQN+V+GLEV  K G+WI V PS P+SFI MIGDSLYAWTNGRL
Sbjct  181   KLGINAHTDKNIVTILYQNQVDGLEVQTKAGKWIKVKPSLPHSFIAMIGDSLYAWTNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSPYHRVMMSGNEARYS GLFSIPK GYIIKAPEE+VDE+HPLLF PFDHVEFLGFYY+E
Sbjct  241   HSPYHRVMMSGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYYTE  300

Query  239   EGQKCQSALATYCGV  195
              GQ+ QSAL TYCGV
Sbjct  301   AGQRAQSALKTYCGV  315



>gb|KDP37168.1| hypothetical protein JCGZ_06224 [Jatropha curcas]
Length=314

 Score =   494 bits (1272),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 269/314 (86%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ ++LP+IDFS+ NLKPG   WD VR+QV +AL EYGCFEA ++++P  L++ ++ 
Sbjct  1     MGSETPLRLPVIDFSEGNLKPGTEEWDSVRSQVFEALKEYGCFEAFYNRVPSDLKKGVVG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A++ELF+LPL+TK++N S KPFHGYVGQYP  PL+ESMGIDDA++  N    TN +WPQG
Sbjct  61    AIEELFELPLETKLKNVSKKPFHGYVGQYPQAPLFESMGIDDADVPENVDSLTNTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP F  +V SYSE +S LD  VRRMILESLGVEKY+DEHMNSTNYLLRVMKYKGP+  +T
Sbjct  121   NPAFSKTVVSYSELVSELDQTVRRMILESLGVEKYLDEHMNSTNYLLRVMKYKGPQTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL+ HTDKNIVTILYQN+V+GLEV  K+G+WINV  SP+SF+VMIGDSLYAW NGRL+
Sbjct  181   KLGLHPHTDKNIVTILYQNQVDGLEVKTKEGEWINVKLSPHSFVVMIGDSLYAWANGRLY  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMMSGNEARYSAGLFSIPKAGY++KAPEELVDEQHPLLF PFDHV+FLGFYY+E 
Sbjct  241   SPYHRVMMSGNEARYSAGLFSIPKAGYMVKAPEELVDEQHPLLFKPFDHVKFLGFYYTES  300

Query  236   GQKCQSALATYCGV  195
             GQK +SAL  YCGV
Sbjct  301   GQKSESALKAYCGV  314



>ref|XP_008377588.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=322

 Score =   493 bits (1270),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 266/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+ + LPIIDFS  +L  G   WD VR QVH AL EYGCFEA F+K+P  +R+S I+
Sbjct  1     MASETPLGLPIIDFSKPDLNQGTKEWDLVRAQVHNALEEYGCFEALFNKVPSDIRKSTIE  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPLQTK++N S KP+HGYVGQYPMVPLYESMG DDAN+    +  TN +WPQG
Sbjct  61    SMEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC S+QS+SE++S LD ++RRMILESLG+EKY +EH+ STNYLLRVMKYKGPE  ++
Sbjct  121   NPRFCTSIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGPETKES  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRL  420
             K+G+N+HTDKNIVTILYQN+V+GLEV  K  +WI V P SP+SFI MIGDSL+AWTNGRL
Sbjct  181   KLGINAHTDKNIVTILYQNQVDGLEVQTKACKWIKVKPSSPHSFIAMIGDSLHAWTNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSPYHRVMMSGNEARYS GLFSIPKAGYIIKAPEE+VDE+HPLLF PFDHVEFLGFYY+E
Sbjct  241   HSPYHRVMMSGNEARYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYYTE  300

Query  239   EGQKCQSALATYCGV  195
              GQ+ QSAL TYCGV
Sbjct  301   AGQRAQSALKTYCGV  315



>ref|XP_002298129.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
 gb|EEE82934.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
Length=314

 Score =   493 bits (1269),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 267/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLPIIDFS+    PG   WD V+ QV KAL EYGCFEA FDKIP   R+++  
Sbjct  1     MGSETPLKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A++ELFDLPLQTK+RN S KP+HGYVGQYP VPL+ESMGIDDAN+    +  T I+WPQG
Sbjct  61    AVEELFDLPLQTKMRNASKKPYHGYVGQYPQVPLFESMGIDDANIAEEVESMTTILWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F N+V S+SE++S LD +VRRMI+ESLG+EKY+DEHMNSTNYLLRVMKYKGP+  +T
Sbjct  121   NQSFSNTVLSFSEQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKGPQTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +HTDKN+VTILYQN+V+GLE+  KDG WI++ P+P+SFIVMIGDSL+AW NGRLH
Sbjct  181   KLGLTAHTDKNMVTILYQNQVDGLELQTKDGCWIDLKPTPDSFIVMIGDSLHAWANGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM GNEARYS GLFS+PKAGYI+KAPEEL+DE+HPLLF PFDHV+FLGFYY+E 
Sbjct  241   SPYHRVMMRGNEARYSVGLFSVPKAGYIVKAPEELIDEEHPLLFKPFDHVKFLGFYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+ QSAL TYCGV
Sbjct  301   GQRAQSALKTYCGV  314



>ref|XP_010033902.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53768.1| hypothetical protein EUGRSUZ_J03021 [Eucalyptus grandis]
Length=314

 Score =   493 bits (1268),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 264/314 (84%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS + + LP+IDFS   LKPG   W  VR++V +AL   GCFEA F K+P+ L+ESM+ 
Sbjct  1     MGSMAELMLPVIDFSSLRLKPGTAEWTAVRDEVKQALETCGCFEARFKKVPVDLQESMLG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPLQTK+RN S KP+HGYVGQYPMVPLYESMGIDDA++       T I+WP+G
Sbjct  61    SVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESMGIDDADVYEKVDGLTTILWPEG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             +PNF  ++QS+SEKLS LD M+RRMILESLGVEKY+DEHMNSTNYLLRVM+Y GP+  DT
Sbjct  121   HPNFSKNIQSFSEKLSELDKMIRRMILESLGVEKYLDEHMNSTNYLLRVMRYAGPQTTDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLNSHTDKNIVTIL QNEV+GLEV  KDG+W +  PSPNSFIVMIGDSLYAW NGRLH
Sbjct  181   KLGLNSHTDKNIVTILCQNEVDGLEVQTKDGEWFSAQPSPNSFIVMIGDSLYAWVNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMMSGN+ARYS GLFSIPK GY+IKAP+ELVDE+ PLLF PFDHVEFLGFYY+E 
Sbjct  241   SPHHRVMMSGNKARYSVGLFSIPKGGYMIKAPDELVDEERPLLFKPFDHVEFLGFYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+ +SAL TYCGV
Sbjct  301   GQRAESALKTYCGV  314



>ref|XP_010110312.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25832.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=315

 Score =   492 bits (1267),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 226/316 (72%), Positives = 267/316 (84%), Gaps = 3/316 (1%)
 Frame = -1

Query  1136  MGSESG--IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             MG+E+   +KLP+IDFS + LKPG   WD VR+QV +AL E+GCFEA F KI +  R ++
Sbjct  1     MGTETSPSVKLPVIDFSIQPLKPGT-EWDLVRSQVRQALEEFGCFEALFGKISLDTRRAI  59

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
              D L+ELFDLPLQTK+RN S KPFHGYVGQYP +PL+ESM IDDAN+  N +   NI+WP
Sbjct  60    FDTLQELFDLPLQTKLRNVSKKPFHGYVGQYPQMPLFESMAIDDANIHENVESLANILWP  119

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             QGNPNFC  +QSYSE+LS LD ++RRMILESLGVEKY++EH+ S NYLLRVMKYKGP+  
Sbjct  120   QGNPNFCKIIQSYSEQLSELDQIIRRMILESLGVEKYLEEHLGSANYLLRVMKYKGPQTK  179

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +TK+GL++HTDKNIVTILYQN+V GLEV  KDG+WI+V PSPNSFIVMIGDSLYAW NGR
Sbjct  180   ETKMGLSAHTDKNIVTILYQNQVEGLEVQTKDGEWISVKPSPNSFIVMIGDSLYAWANGR  239

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             LHSP HRV+M+G+EARYSAGLFSIPKAGYI+KAPEELVDE+HPLLF PFDHVEFL F+Y 
Sbjct  240   LHSPCHRVIMTGSEARYSAGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLEFFYR  299

Query  242   EEGQKCQSALATYCGV  195
             E GQ+ +SAL TYCGV
Sbjct  300   EAGQRAESALKTYCGV  315



>ref|XP_004152262.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
 ref|XP_004156846.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=314

 Score =   489 bits (1260),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 267/315 (85%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SES +KLP+IDFS  NL+ G P W+  + QV +AL E+GCFEA+FDK+P+ +R+ + +
Sbjct  1     MDSESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPVEVRKGLFE  58

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELF+LPL+TK+RN S KPFHGYVGQYPM PL+ESMG+DD+ +    Q FTNI+WPQG
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD-D  600
             NP F   +++YS++L+ LD+MVRRM+LESLGVEKY++EH+ STNYLLRVMKYKG E + +
Sbjct  119   NPTFSKVMETYSQQLAELDEMVRRMVLESLGVEKYLEEHLESTNYLLRVMKYKGTESNYE  178

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             TKIGL+SHTDKNIVTILYQN V GL+V  KDG+WIN  PSP+SF+ MIGDS +AWTNGRL
Sbjct  179   TKIGLHSHTDKNIVTILYQNHVQGLQVKTKDGKWINFQPSPDSFVAMIGDSFHAWTNGRL  238

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSPYHRVMMSG E RYSAGLFSIPKAGYI+KAPEELVDEQHPLLFNPFDHV+FL FYY+E
Sbjct  239   HSPYHRVMMSGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFYYTE  298

Query  239   EGQKCQSALATYCGV  195
              GQK QSAL TYCG 
Sbjct  299   AGQKAQSALKTYCGA  313



>ref|XP_008454372.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Cucumis melo]
Length=314

 Score =   488 bits (1256),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 266/315 (84%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M  ES +KLP+IDFS  NL+ G P W+  + QV +AL E+GCFEA+FDK+PI +R+ + +
Sbjct  1     MDGESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPIEVRKGLFE  58

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELF+LPL+TK+RN S KPFHGYVGQYPM PL+ESMG+DD+ +    Q FTNI+WPQG
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-ECDD  600
             NP F   +++YS++LS LD+MVRRM+LESLGVEKYM+EH+ STNYLLRVMKYKG  + ++
Sbjct  119   NPTFSKVIETYSQQLSELDEMVRRMVLESLGVEKYMEEHLESTNYLLRVMKYKGTDQSNE  178

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             TKIGL+SHTDKNIVTILYQN V GL+V  KDG+WIN  PSP+SF+ MIGDS +AWTNGRL
Sbjct  179   TKIGLHSHTDKNIVTILYQNHVEGLQVQTKDGKWINFQPSPHSFVAMIGDSFHAWTNGRL  238

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSPYHRVMMSG E RYSAGLFSIPKAGYI+KAPEELVDEQHPLLFNPFDHV+FL FYY+E
Sbjct  239   HSPYHRVMMSGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFYYTE  298

Query  239   EGQKCQSALATYCGV  195
              GQK QSAL T+CG 
Sbjct  299   AGQKAQSALKTFCGA  313



>ref|XP_006465423.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=315

 Score =   487 bits (1254),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 266/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ IKLPIIDFS  NLKPG P WD V++ V KAL +YGCFEA F+K+P  + +++  
Sbjct  1     MGSETPIKLPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPL+TK+RN S KPFHGYVGQYP VPLYESMGIDDAN+    +  TNI+WP+G
Sbjct  61    ALEELFDLPLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC ++QS+SE++S LD  +RRMILESLG+EKYMDEHMNST+YLLRVMKYKGPE  + 
Sbjct  121   NKSFCKTIQSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEK  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRL  420
             K+GLN+HTDKNIVTILYQN+V GLE+  K+G+WINV P SP+SFI MIGDSLYAWTNG+L
Sbjct  181   KLGLNAHTDKNIVTILYQNQVEGLELQTKNGEWINVKPSSPHSFIAMIGDSLYAWTNGQL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             +SPYHRVMM+G E RYS GLFSIPKAGY I+APEELVDE+HPLLF  FDH EFL FYY+E
Sbjct  241   YSPYHRVMMTGIETRYSTGLFSIPKAGYKIEAPEELVDEEHPLLFKSFDHFEFLEFYYTE  300

Query  239   EGQKCQSALATYCGV  195
              GQ+ +SAL TYCGV
Sbjct  301   AGQRAESALKTYCGV  315



>ref|XP_007135717.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
 gb|ESW07711.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
Length=314

 Score =   484 bits (1247),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 266/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP+I+F+D  L+   P W+ V++QVH+ALVE+GCFEA FD++P+ LR++++ 
Sbjct  1     MGSEDTPKLPVINFTDLKLEAKDPNWEAVKSQVHRALVEFGCFEAVFDRVPLELRKAILG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPLQTK+ N S K FHGYVGQYPMVPL+ESMGIDDA +    +  TN MWP G
Sbjct  61    SLQELFDLPLQTKLLNVSKKLFHGYVGQYPMVPLFESMGIDDAVVYEEVESLTNTMWPNG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NPNF  ++QS+SE+L+ LD ++R+M+LESLGVEKY++EHMNSTNYLLRVMKY+GP+  DT
Sbjct  121   NPNFSKTIQSFSEELAELDQIIRKMVLESLGVEKYLEEHMNSTNYLLRVMKYQGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL++HTDKNIVTILYQNEV GLEVL KDG WI+  PSP+SF+VMIGDS  AW NGRLH
Sbjct  181   KLGLSAHTDKNIVTILYQNEVEGLEVLTKDGTWISYKPSPHSFVVMIGDSFNAWANGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMMSGNE RYSAGLFSIPK G IIKAPEELVDE+HPLLF PFDH+EFL +YY+E+
Sbjct  241   SPFHRVMMSGNETRYSAGLFSIPKGGSIIKAPEELVDEEHPLLFKPFDHMEFLKYYYTEK  300

Query  236   GQKCQSALATYCGV  195
             GQ+ Q AL TYCGV
Sbjct  301   GQRDQFALLTYCGV  314



>ref|XP_002517541.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44705.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   480 bits (1235),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 262/314 (83%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP IDFS ENLKPG   W+ V+ QV  AL EYGCFEA F ++   L++ +  
Sbjct  1     MGSETPLKLPAIDFSTENLKPGTVEWELVKTQVRNALEEYGCFEAFFSRVHNDLKKGVFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A++ELF+LPLQTK++N S KPFHGYVGQYP  PLYESMGI+D + +   + FT+++WPQG
Sbjct  61    AIEELFELPLQTKLKNVSRKPFHGYVGQYPQAPLYESMGIEDPDTVEKVESFTSVLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  F  +VQS+SE++S LD +VRRMI+ESLG+EKYMDEHMNST+YLLRVMKYKGPE  + 
Sbjct  121   NLTFSKTVQSFSEQVSKLDKVVRRMIVESLGLEKYMDEHMNSTDYLLRVMKYKGPETSEA  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL+ HTDKNIVTIL+QN+V+GLEV  K+G+WI V  SP+SF+VMIGDSL AW NGRLH
Sbjct  181   KLGLHPHTDKNIVTILFQNQVDGLEVKTKNGEWITVKLSPDSFVVMIGDSLLAWANGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM+GNEARYS GLFSIPKAGYI+KAPEELVDE+HPLLF PFDHVEFLGFYY+E 
Sbjct  241   SPYHRVMMTGNEARYSCGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLGFYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+ QSAL  YCGV
Sbjct  301   GQRAQSALKAYCGV  314



>ref|XP_006427127.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
 gb|ESR40367.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
Length=307

 Score =   479 bits (1233),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 259/307 (84%), Gaps = 1/307 (0%)
 Frame = -1

Query  1112  LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDL  933
             LPIIDFS  NLKPG P WD V++ V KAL EYGCFEA F+K+P  + +++  AL+ELFDL
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEEYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  932   PLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNSV  753
             PL+TK+RN S KPFHGYVGQYP VPLYESMGIDDAN+    +  TNI+WP+GN +FC ++
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKSFCKTI  120

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSHT  573
             QS+SE++S LD  +RRMILESLG+EKYMDEHMNST+YLLRVMKYKGPE  + K+GLNSHT
Sbjct  121   QSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEKKLGLNSHT  180

Query  572   DKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRLHSPYHRVM  396
             DKNIVTILYQN+V GLE+  K+G+WIN+ P SP+SFI MIGDSLYAWTNG+L+SPYHRVM
Sbjct  181   DKNIVTILYQNQVEGLELQTKNGEWINIKPSSPHSFIAMIGDSLYAWTNGQLYSPYHRVM  240

Query  395   MSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSA  216
             M+G E RYS G FSIPKAGY I+APEELVDE+HPLLF PFDH EFL FYY+E GQ+ +SA
Sbjct  241   MTGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQRAESA  300

Query  215   LATYCGV  195
             L TYCGV
Sbjct  301   LKTYCGV  307



>gb|KEH28749.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=315

 Score =   479 bits (1233),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 270/315 (86%), Gaps = 1/315 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MG+E+  KLPIIDF++ NL+   P W+ V++QV+KALVEYGCFEA FDK+P+ LR+++  
Sbjct  1     MGTEATPKLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPL+TK+ N S KP+HGYVGQYPM+PL+ESMGIDDAN+L      TN +WP G
Sbjct  61    SLQELFDLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NF  ++ S+SE+L+ LD ++R+MILESLGVEKY++EHMNSTNYLLRVMKYKGP+  DT
Sbjct  121   NQNFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRL  420
             K+GL++H+DKN+VTILYQN+V GLEV+ KDGQWI+  PS + SF+ MIGDS++AW+NGRL
Sbjct  181   KLGLSTHSDKNVVTILYQNQVEGLEVMTKDGQWISYKPSSSGSFVAMIGDSIHAWSNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSP+HRVMMSGNEARYS GLFSIPK GYIIKAPEELVDE+HPLLF P+DHVEFL +YY+E
Sbjct  241   HSPFHRVMMSGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEFLKYYYTE  300

Query  239   EGQKCQSALATYCGV  195
             +GQ+ Q A+ TYCGV
Sbjct  301   KGQRDQFAMRTYCGV  315



>ref|XP_011045369.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=314

 Score =   478 bits (1229),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 262/314 (83%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLPIIDFS+    PG   WD V+ QV KAL EYGCFEA FDKIP   R+++  
Sbjct  1     MGSETALKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A++ELFDLPLQTK+RN S KP+HGYVGQYP VPL+ESMGIDDAN+    +  T I+WPQG
Sbjct  61    AVEELFDLPLQTKMRNASRKPYHGYVGQYPQVPLFESMGIDDANIAEEVERTTAILWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F N+V S+S+++S LD +VRRMI+ESLG+EKY+DEHMNSTNYLLRVMKYK P+  +T
Sbjct  121   NQSFSNTVLSFSKQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKVPQTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL+SHTDKN+VTIL QN+V+GLE+  KDG W ++ P+P+SFIVMIGDSLYAW NGRLH
Sbjct  181   KLGLSSHTDKNMVTILCQNQVDGLELQTKDGCWTDLKPNPDSFIVMIGDSLYAWANGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVMM GNE RYS GLF++PKAGYI+KAPEEL+DE+HPLLF PFDH EFLG+YY+E 
Sbjct  241   SPYHRVMMRGNEVRYSLGLFAVPKAGYIVKAPEELIDEEHPLLFKPFDHFEFLGYYYTEA  300

Query  236   GQKCQSALATYCGV  195
             GQ  QSAL TYCGV
Sbjct  301   GQTDQSALKTYCGV  314



>gb|KDO58204.1| hypothetical protein CISIN_1g038676mg, partial [Citrus sinensis]
Length=307

 Score =   477 bits (1228),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 259/307 (84%), Gaps = 1/307 (0%)
 Frame = -1

Query  1112  LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDL  933
             LPIIDFS  NLKPG P WD V++ V KAL +YGCFEA F+K+P  + +++  AL+ELFDL
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  932   PLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNSV  753
             PL+TK+RN S KPFHGYVGQYP VPLYESMGIDDAN+    +  TNI+WP+GN +FC ++
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKSFCKTI  120

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSHT  573
             QS+SE++S LD  +RRMILESLG+EKYMDEHMNST+YLLRVMKYKGPE  + K+GLN+HT
Sbjct  121   QSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEKKLGLNAHT  180

Query  572   DKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRLHSPYHRVM  396
             DKNIVTILYQN+V GLE+  K+G+WINV P SP+SFI MIGDSLYAWTNG+L+SPYHRVM
Sbjct  181   DKNIVTILYQNQVEGLELQTKNGEWINVKPSSPHSFIAMIGDSLYAWTNGQLYSPYHRVM  240

Query  395   MSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSA  216
             M+G E RYS G FSIPKAGY I+APEELVDE+HPLLF PFDH EFL FYY+E GQ+ +SA
Sbjct  241   MTGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQRAESA  300

Query  215   LATYCGV  195
             L TYCGV
Sbjct  301   LKTYCGV  307



>gb|AFK40822.1| unknown [Medicago truncatula]
Length=315

 Score =   476 bits (1224),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 269/315 (85%), Gaps = 1/315 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MG+E+  KLPIIDF++ NL+   P W+ V++QV+KALVEYGCFEA FDK+P+ LR+++  
Sbjct  1     MGTEATPKLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELF LPL+TK+ N S KP+HGYVGQYPM+PL+ESMGIDDAN+L      TN +WP G
Sbjct  61    SLQELFYLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NF  ++ S+SE+L+ LD ++R+MILESLGVEKY++EHMNSTNYLLRVMKYKGP+  DT
Sbjct  121   NQNFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRL  420
             K+GL++H+DKN+VTILYQN+V GLEV+ KDGQWI+  PS + SF+ MIGDS++AW+NGRL
Sbjct  181   KLGLSTHSDKNVVTILYQNQVEGLEVMTKDGQWISYKPSSSGSFVAMIGDSIHAWSNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSP+HRVMMSGNEARYS GLFSIPK GYIIKAPEELVDE+HPLLF P+DHVEFL +YY+E
Sbjct  241   HSPFHRVMMSGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEFLKYYYTE  300

Query  239   EGQKCQSALATYCGV  195
             +GQ+ Q A+ TYCGV
Sbjct  301   KGQRDQFAMRTYCGV  315



>gb|AFK47428.1| unknown [Lotus japonicus]
Length=311

 Score =   474 bits (1219),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP+IDF+D N       W+ V+++VH+ALVEYGCFEA FDK+P+ LR+ +  
Sbjct  1     MGSETTRKLPVIDFTDLN---SLANWEAVKSKVHEALVEYGCFEAIFDKVPLDLRKEIFA  57

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELF+LPLQTK+ N S KP+HGYVGQYPMVPL+ESMGIDDAN+    +   NI+WP G
Sbjct  58    SLEELFNLPLQTKLLNVSKKPYHGYVGQYPMVPLFESMGIDDANVSEKVEAMANILWPDG  117

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+F  ++ S+SE+LS LD ++R+M+LESLGVEKY+DEH++STNYLLRVMKYKGPE  DT
Sbjct  118   NPSFSKTINSFSEQLSELDHIIRKMVLESLGVEKYLDEHLHSTNYLLRVMKYKGPETSDT  177

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +H+DKNIVTILYQN+V GLEVL KDG+WI+  PS   F+VMIGDSL+AW+NGRLH
Sbjct  178   KLGLTTHSDKNIVTILYQNQVEGLEVLTKDGKWISYKPSSEGFVVMIGDSLHAWSNGRLH  237

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMM+GNEARYS GLFSIPK  YIIK PEELVDE+HPLLF PFDHVEFL +YY+E+
Sbjct  238   SPFHRVMMTGNEARYSTGLFSIPKGEYIIKTPEELVDEEHPLLFKPFDHVEFLKYYYTEK  297

Query  236   GQKCQSALATYCGV  195
             GQ+ Q AL TYCGV
Sbjct  298   GQRDQFALRTYCGV  311



>ref|XP_004241718.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   470 bits (1210),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 264/309 (85%), Gaps = 1/309 (0%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             I LP IDFS + LKP    W++V++QVHKALVEYGCFEA+FDK PI L++S+ ++ +ELF
Sbjct  6     INLPKIDFSHKELKPHTLVWNQVKSQVHKALVEYGCFEASFDKFPISLQKSIFESSQELF  65

Query  938   DLPLQTKVRNTSNKPFHGYVGQY-PMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFC  762
             DLP QTK+++   KPF+GYVG Y P +PLYESMGIDDAN+ H  + FT I+WPQGN  FC
Sbjct  66    DLPSQTKLKSIRTKPFNGYVGFYHPSIPLYESMGIDDANIPHKAEKFTQILWPQGNTTFC  125

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLN  582
              ++QSYSE+LS LD M+RRMILESLGVE YMDEHMNSTNYLLR+MKYK P+  + ++GL+
Sbjct  126   KTIQSYSEQLSELDQMIRRMILESLGVENYMDEHMNSTNYLLRLMKYKTPQSSENEMGLS  185

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             SHTDK+ +TILYQN+VNGL+VL KDGQWINV+P+P++FIV+IGDSL+AWTNGR+H+P+HR
Sbjct  186   SHTDKSNITILYQNQVNGLQVLTKDGQWINVDPTPDTFIVLIGDSLHAWTNGRMHAPFHR  245

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             VMM GNEARYS GLF+IPK GY+IKAP+ELVDE+HPLL+ PF H+EF+ F Y+EEG +C+
Sbjct  246   VMMKGNEARYSIGLFTIPKTGYMIKAPKELVDEEHPLLYKPFTHLEFITFSYTEEGMQCE  305

Query  221   SALATYCGV  195
             SAL TYCGV
Sbjct  306   SALKTYCGV  314



>ref|XP_004506878.1| PREDICTED: S-norcoclaurine synthase 1-like [Cicer arietinum]
Length=314

 Score =   470 bits (1210),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 266/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S++ +KLP IDF+  NL+   P W+ V++QV++AL+EYGCFEA FD+IPI LR+++  
Sbjct  1     MSSKTTLKLPQIDFTSLNLEAKSPNWELVKSQVYEALLEYGCFEAIFDEIPIELRKAIFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPL+TK  N S KP+HGYVGQYPM+PLYESMGIDDAN+    +  TN  WP G
Sbjct  61    SLEELFDLPLETKQLNVSKKPYHGYVGQYPMIPLYESMGIDDANIFDKVESMTNNFWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F  ++ S+S++L+ LD ++R+MILESLGVEKY++EH+NS+NYLLRVMKYKGPE  DT
Sbjct  121   NQSFSKTIHSFSDELTKLDQIIRKMILESLGVEKYLEEHLNSSNYLLRVMKYKGPETSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL+SHTD+NIVTILYQNEV GLEV+ KDG+WI+  PS NSF+VMIGDSL+AW+NGRLH
Sbjct  181   KLGLSSHTDRNIVTILYQNEVEGLEVMTKDGKWISYKPSLNSFVVMIGDSLHAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+H+VMMSGNEARYS GLFSIPK GY+IKAP+ELVDE+HPLLF P+DHVEFL +YYSE+
Sbjct  241   SPFHQVMMSGNEARYSTGLFSIPKGGYLIKAPKELVDEEHPLLFKPYDHVEFLKYYYSEK  300

Query  236   GQKCQSALATYCGV  195
             GQ+ Q  + T+CGV
Sbjct  301   GQRDQFPMRTFCGV  314



>ref|NP_175691.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAG52269.1|AC019018_6 putative oxidoreductase; 38288-39393 [Arabidopsis thaliana]
 gb|AEE32855.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=317

 Score =   469 bits (1207),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 260/317 (82%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGI---KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +   +LP+IDFS++NLKPG P WD  R  V KAL +YG FEA+FD+IP  LR+S
Sbjct  1     MGSETPLLPLRLPVIDFSNKNLKPGEPEWDLTRADVQKALQDYGYFEASFDRIPFELRKS  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             +  AL+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGIDD+++      FT  +W
Sbjct  61    VFGALEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDIAEKVDAFTEKLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F  ++QS+S+KLS LD  +RRMI+ES G++KY+DEH++STNYLLRVMKYKGP+ 
Sbjct  121   PQGNISFSTTIQSFSKKLSELDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKGPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V P+ +SF VMIGDSLYA  NG
Sbjct  181   EETKVGLNAHTDKNIVTILYQNHVEGLEVQTKDKNWIKVKPTQDSFTVMIGDSLYALLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSPYHRVMM+G E RYS GLFSIPKAG+I+ +P+ELVDE+HP LF PFDHVEFL FYY
Sbjct  241   RLHSPYHRVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLQFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             +E GQ+ QSAL TYCG+
Sbjct  301   TEAGQRSQSALKTYCGI  317



>ref|XP_009147658.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=317

 Score =   469 bits (1207),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 260/317 (82%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGI---KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS++NLKPG P WD  +  V KAL +YGCFEA+FDK+PI LR+S
Sbjct  1     MGSETPLLPLHLPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKS  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             +  AL+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGIDD++++   + FT  +W
Sbjct  61    IFKALEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F  ++ S+S+KLS LD  +RRMI+ES G+ KY+DEH+ STNYL RVMKY GP+ 
Sbjct  121   PQGNTSFSATIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLFRVMKYTGPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WINV PS +SFIVMIGDSL+A  NG
Sbjct  181   EETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDKNWINVKPSEDSFIVMIGDSLHALLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSPYHRVMM+G E RYS GLFSIPKAG+I+ +P+ELVDE+HP LF PFDHVEFL FYY
Sbjct  241   RLHSPYHRVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             +E GQ+ QSAL TYCG+
Sbjct  301   TEAGQRSQSALKTYCGM  317



>ref|XP_007024009.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY26631.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=316

 Score =   468 bits (1204),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 260/316 (82%), Gaps = 0/316 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP+IDF+  +LKPG   WD V+ QV +AL EYGCFEA F++IP+ +RE++  
Sbjct  1     MGSETPLKLPVIDFTKPDLKPGTTEWDLVKGQVQQALQEYGCFEALFNRIPLDVRETIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPL+TK+ N S KP+HGYVGQYP  PLYES+GIDDAN++   +  T  +WP+G
Sbjct  61    ALEELFDLPLETKICNVSKKPYHGYVGQYPQAPLYESLGIDDANIIEKVEAQTRALWPEG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F N +QS+S++L+ LD  +RRMILES  ++KYMDEH++ST YLLR+MKYKGP+  +T
Sbjct  121   NKSFSNIIQSFSKQLAELDQTIRRMILESYDLDKYMDEHLDSTKYLLRLMKYKGPKTTET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL SHTDKNIVTILYQNEV GLEV  KDG+W +V PS  SFIVMIG+SL+AW NGRLH
Sbjct  181   KLGLQSHTDKNIVTILYQNEVEGLEVQTKDGKWFDVKPSKGSFIVMIGESLHAWLNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             +PYHRVMMSG+ ARYS GLFSIPK GY+IKAP+ELVDE HPLLF PFDHV+FLGFYY+E 
Sbjct  241   APYHRVMMSGDMARYSIGLFSIPKGGYMIKAPDELVDEAHPLLFKPFDHVQFLGFYYTEA  300

Query  236   GQKCQSALATYCGV*N  189
             GQK +SAL  YCGV N
Sbjct  301   GQKAESALKAYCGVQN  316



>emb|CDY26044.1| BnaC06g05800D [Brassica napus]
Length=317

 Score =   466 bits (1199),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 260/317 (82%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGI---KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS++NLKPG P WD  +  V KAL +YGCFEA+FDK+PI LR+S
Sbjct  1     MGSETPLLPLHLPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKS  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             +  AL+ELFDLPL+TK+RN S KPFHGYVGQYPMVPLYESMGIDD++++   + FT  +W
Sbjct  61    IFKALEELFDLPLKTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F  ++ S+S+KLS LD  +RRMI+ES G+ KY+DEH+ STNYLLRVMKY GP+ 
Sbjct  121   PQGNNSFSATIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLLRVMKYTGPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  181   EETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDKNWIKVKPSEDSFIVMIGDSLHALLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSPYHRVMM+G E RYS GLFSIPKAG+I+ +P+ELVDE+HP LF PFDHVEFL FYY
Sbjct  241   RLHSPYHRVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             +E GQ+ QSAL TYCG+
Sbjct  301   TEAGQRSQSALKTYCGM  317



>ref|XP_006305391.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
 gb|EOA38289.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
Length=317

 Score =   466 bits (1198),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 257/317 (81%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGI---KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +   +LP+IDFS++NLKPG P WD  R  V KAL +YGCFEA FD IP+ LR+S
Sbjct  1     MGSETPLLPLRLPVIDFSNKNLKPGEPEWDLTRADVKKALQDYGCFEAAFDGIPVELRKS  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             +  AL+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+DA++      FT  +W
Sbjct  61    VFGALEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDADVAEKVDDFTGKLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F  ++ S+SEKLS LD  +RRMI+ES  ++KY+DEH++STNYL+RVMKYK P+ 
Sbjct  121   PQGNNSFSTTIHSFSEKLSELDITIRRMIMESFRLDKYIDEHLHSTNYLMRVMKYKEPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             +DTK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSLY   NG
Sbjct  181   EDTKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSQDSFIVMIGDSLYGMLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSPYHRVMM+G E RYS GLFSIPKAG+II +P+ELVDE+HP LF PFDHVEFL FYY
Sbjct  241   RLHSPYHRVMMTGTETRYSLGLFSIPKAGHIISSPDELVDEEHPRLFKPFDHVEFLQFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             +E GQ+ QSAL TYCG+
Sbjct  301   TEAGQRSQSALKTYCGI  317



>ref|XP_011072273.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=315

 Score =   464 bits (1193),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 254/315 (81%), Gaps = 1/315 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSES +KLP+IDFS+       PTW+  + QV  AL EYGCFEA FD+IP  LR+S ID
Sbjct  1     MGSESCMKLPVIDFSNLKQDSRTPTWESTKTQVRAALEEYGCFEAVFDQIPPTLRQSTID  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ-  780
              +K+LFDLPLQTK+RN SNKP+HGYVGQYP+VPLYES+GI+DA        F+N+MWP+ 
Sbjct  61    GIKQLFDLPLQTKLRNRSNKPYHGYVGQYPIVPLYESLGIEDALSPAKVDSFSNLMWPED  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GNP F  S+   SE+ S LD +VRRM++ESLG+EKYM+EHM ST+YL+RV KY GP+  +
Sbjct  121   GNPTFSKSIACLSEQFSELDKVVRRMVVESLGLEKYMNEHMESTDYLVRVQKYDGPQSAE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             +KIGL SHTDKNIVTIL+QNEV GLEVL KDGQWI  +PS NSFIVMIG+S YAWTNGRL
Sbjct  181   SKIGLTSHTDKNIVTILHQNEVKGLEVLTKDGQWIAADPSHNSFIVMIGESFYAWTNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H PYHRVMM G+EARYS GLFS+PKAGYIIKAPEELVD++HPLLF PFDHVEFL FYY+E
Sbjct  241   HPPYHRVMMRGDEARYSIGLFSVPKAGYIIKAPEELVDDEHPLLFKPFDHVEFLDFYYTE  300

Query  239   EGQKCQSALATYCGV  195
              GQ+  +AL  YCG 
Sbjct  301   AGQRSPAALKAYCGA  315



>ref|XP_010542274.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   460 bits (1184),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ ++LP+IDFS +NLK G   W+  R+ V KAL E+GCFEA+FDKIP+HLR  +  
Sbjct  1     MGSET-LQLPVIDFSGKNLKKGSKEWECTRSDVRKALEEFGCFEASFDKIPLHLRREIFG  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              L+ELFDLPLQTK+RN S KPFHGYVGQYP VPLYESMGIDDA+L      FT  +WP G
Sbjct  60    CLEELFDLPLQTKLRNVSKKPFHGYVGQYPQVPLYESMGIDDADLPDQVLSFTQKLWPHG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F N++QS++E+LS LD  +RRM LES G+EKY+DEH+ STNYLLR MKYKGP+ ++T
Sbjct  120   NHHFSNTIQSFAEQLSELDITIRRMTLESFGLEKYIDEHLESTNYLLRAMKYKGPDTEET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GLN+HTDKNIVTILYQN V GLEV  KD +WI V PS +SFI MIGDSLYA  NGR+H
Sbjct  180   KLGLNAHTDKNIVTILYQNHVEGLEVQTKDNKWIKVKPSKDSFIAMIGDSLYALLNGRVH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVD-EQHPLLFNPFDHVEFLGFYYSE  240
             SPYHRVMM+G EARYSAGLFSIPKAG+II APEELVD +++P LF PFDHVEFL FYY+E
Sbjct  240   SPYHRVMMTGKEARYSAGLFSIPKAGHIIYAPEELVDGDEYPRLFKPFDHVEFLQFYYTE  299

Query  239   EGQKCQSALATYCGV  195
              GQ+ QSAL TYCG+
Sbjct  300   AGQRAQSALKTYCGM  314



>ref|XP_006367751.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   460 bits (1184),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++ IKLP I+FS E+LKP    W++V++QV+KALVEYGCFEA FDKIPI+L++S+ +
Sbjct  1     MGSKN-IKLPKINFSHEDLKPDTLVWNQVKSQVYKALVEYGCFEAFFDKIPINLQKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQY-PMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
               +E+FDLPLQTK++N S +PF+GYVGQY P +PL+ESMGI D+N+L   + +T ++WPQ
Sbjct  60    VSQEIFDLPLQTKLKNISTEPFYGYVGQYHPSIPLFESMGIIDSNILQKVEKYTQLLWPQ  119

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GNP+FC ++QSYSE+LS LD  +RRMI+ESLGVEKYMDEHMNSTNY LR++KYK P+ ++
Sbjct  120   GNPSFCKTIQSYSEQLSKLDQTIRRMIVESLGVEKYMDEHMNSTNYRLRLIKYKEPQSNE  179

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             TKIGL++HTDKNIVTILYQN+VNGLE+L KDGQWINV+P+P++F +MIGDSL+AWTNGR+
Sbjct  180   TKIGLHAHTDKNIVTILYQNQVNGLEILTKDGQWINVDPTPDNFTIMIGDSLHAWTNGRM  239

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H+P+HRVM+ GNEARYS GLFSIPKAG IIK P+ELVDE HPLLF PFD+ EFL F Y++
Sbjct  240   HAPFHRVMVRGNEARYSIGLFSIPKAGCIIKTPKELVDEDHPLLFTPFDYHEFLSFGYTQ  299

Query  239   EGQKCQSALATYCGV  195
             E  KC   L  Y GV
Sbjct  300   EDMKCDFTLKAYSGV  314



>gb|KEH28750.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=314

 Score =   460 bits (1183),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 206/314 (66%), Positives = 259/314 (82%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP+IDF++ N +   P W+ V++QV+KALVEYGCFEA FDK+P+ LR+++  
Sbjct  1     MGSEHTQKLPLIDFNNLNFEAKNPNWELVKSQVYKALVEYGCFEAIFDKVPLDLRKAIFT  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPL+TK+ N SNKP+ GY+GQYP+VPLYESM I+DAN+L   +  TNI+WP G
Sbjct  61    SIEELFDLPLETKLLNVSNKPYDGYIGQYPVVPLYESMAIEDANILEKVKSMTNILWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NF  ++ S+SE+L  LD ++R+MILESLGVEKY++EHMNSTNY LR MKYKGP+  DT
Sbjct  121   NKNFSETIHSFSEELIELDQIIRKMILESLGVEKYLEEHMNSTNYRLRAMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL  HTDKN VTILYQN+V GLE++ KDGQWI+  PS  SF+V++GDS++AW+NGRLH
Sbjct  181   KVGLTPHTDKNFVTILYQNQVEGLEMMTKDGQWISYKPSSGSFVVVLGDSIHAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRVMMSGNEARYSAGLFS PK GYIIKAPEELVDE+HPLLF PFD  EFL +Y+S E
Sbjct  241   SPFHRVMMSGNEARYSAGLFSTPKGGYIIKAPEELVDEEHPLLFKPFDQAEFLKYYHSRE  300

Query  236   GQKCQSALATYCGV  195
             G + + A+ TYCGV
Sbjct  301   GARDRFAIRTYCGV  314



>ref|XP_006392865.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
 gb|ESQ30151.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
Length=317

 Score =   459 bits (1182),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 213/317 (67%), Positives = 257/317 (81%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGI---KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+I+FS++NLKPG P WD  R  V KAL +YGCFEA+FD+IP  LR+S
Sbjct  1     MGSETPLLPLNLPVINFSNKNLKPGEPEWDLTRAHVKKALQDYGCFEASFDRIPSELRKS  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             +  A++ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGIDD+++      FT  +W
Sbjct  61    IFGAMEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVAAKVDAFTEKLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +   ++QS+S+KLS LD  +RRMI+ES G+ KYMDEH+ STNYLLRVMKYKGP+ 
Sbjct  121   PQGNNSLSTTIQSFSKKLSELDVTIRRMIMESFGLVKYMDEHLQSTNYLLRVMKYKGPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++T++GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  181   EETELGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSQDSFIVMIGDSLHALLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RL+SP HRVMM+G E RYS GLFSIPKAGYI+ AP+ELVDE+HP +F PFDHVEFL FYY
Sbjct  241   RLYSPNHRVMMTGTETRYSLGLFSIPKAGYIVNAPDELVDEEHPRMFKPFDHVEFLQFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             +E GQ+ QSAL TYCG+
Sbjct  301   TEAGQRSQSALKTYCGM  317



>ref|XP_006367749.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=315

 Score =   459 bits (1181),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 205/316 (65%), Positives = 262/316 (83%), Gaps = 3/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+ IKLP IDFS E+LK     W++V++QVHKALVEYGCFEA+FDKIPIHLR+S+ +
Sbjct  1     MNSEN-IKLPKIDFSQEDLKTDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQ--YPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
             +L+++FDLPLQTK+ N S KPFHGY+    +P  PL+ESM +DDAN+    + F  I+WP
Sbjct  60    SLQQIFDLPLQTKLENISTKPFHGYISSKTFPSFPLFESMCVDDANIPGKAEKFAQILWP  119

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             QGNP+FC +VQSYSE+LS LD  VRRM+LESLG+EKYMDEHMNSTN++LR++KY  P+  
Sbjct  120   QGNPSFCKTVQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLRLLKYNTPQSS  179

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +++IG+++HTD++I TILYQNE+NGL+V+ KDGQWINV P+ ++F VMIGDSL+AWTNGR
Sbjct  180   ESEIGISAHTDRSIATILYQNEINGLQVMTKDGQWINVEPTQDTFTVMIGDSLHAWTNGR  239

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             +H+PYHRVMM GN+ARYSA LFS+PK GY IKAP ELVDE+HPLL+  FD  EFL F Y+
Sbjct  240   MHAPYHRVMMRGNKARYSAALFSLPKGGYTIKAPRELVDEEHPLLYKSFDLHEFLAFSYT  299

Query  242   EEGQKCQSALATYCGV  195
             EEG +C+ AL TYCG+
Sbjct  300   EEGMRCEFALKTYCGL  315



>emb|CDP08459.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   459 bits (1180),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 257/314 (82%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+ IKLP IDFS   LKPG P WD V+ QV KAL E+GCFEA +DKI + L++S   
Sbjct  1     MDSET-IKLPAIDFSQPGLKPGNPEWDSVKGQVRKALEEFGCFEAMYDKISLELQKSFFK  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELF+LPLQTK RN S K +HGY+GQYP+ PLYESMG+DDAN+L   + FT+++WP+G
Sbjct  60    ALEELFNLPLQTKQRNASKKIYHGYIGQYPIFPLYESMGLDDANILEKVESFTDLLWPEG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NFC +V SYSE++S LD +VRRMILESLG+EKYMDEHM  TNYLLR MKY+GP+  +T
Sbjct  120   NSNFCKTVHSYSEQISELDKIVRRMILESLGLEKYMDEHMELTNYLLRAMKYEGPQTTET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +HTDKNI++IL Q+++ GL+VL KDG WI+V PSP SF VMIGD+L+AWTNGRLH
Sbjct  180   KVGLPAHTDKNILSILCQDQIRGLQVLTKDGHWIDVEPSPGSFTVMIGDALFAWTNGRLH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
              P+HRVMM+GN ARYSAG+FS+PKAGYIIKAPEELVDE+HPLLF PFD+VEFL F  +E 
Sbjct  240   CPFHRVMMTGNIARYSAGIFSMPKAGYIIKAPEELVDEEHPLLFKPFDNVEFLSFLRTEA  299

Query  236   GQKCQSALATYCGV  195
             G+  Q AL TY G+
Sbjct  300   GKGAQFALKTYSGI  313



>ref|XP_004241719.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   459 bits (1180),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 204/309 (66%), Positives = 263/309 (85%), Gaps = 1/309 (0%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             IKLP IDFS E+LKPG   W++V++QVHKALVEYGCFEA+F KIPIHL++S+ ++L+E+F
Sbjct  6     IKLPKIDFSHEDLKPGTLVWNQVKSQVHKALVEYGCFEASFYKIPIHLKKSIFESLQEIF  65

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLPLQTK+ N S KPFHGYVGQ+P +PL+ESMGIDDAN+      F  I+WPQGNP+FC 
Sbjct  66    DLPLQTKLENISTKPFHGYVGQFPSLPLFESMGIDDANIPRKADEFAQILWPQGNPSFCK  125

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD-DTKIGLN  582
             ++QSYSE+LS LD  VRRM+LESLG+EKYMDEHMNSTN++L++MKY  P+ + +T+IG++
Sbjct  126   TIQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLQLMKYNTPQSNTETEIGVS  185

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             +HTDK+I TILYQN++NGL+V+NK+GQWINV P+ ++F VMIGDSL+AWTNGR+H+PYHR
Sbjct  186   AHTDKSIATILYQNQINGLQVMNKNGQWINVEPTQDTFTVMIGDSLHAWTNGRMHAPYHR  245

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             VMM GN+ARYS GLFS+PK  Y IKAP+E+VDE++PLL+ PFD    L F  +EEG +C+
Sbjct  246   VMMRGNKARYSVGLFSVPKGDYTIKAPKEMVDEENPLLYKPFDLHGLLAFTNTEEGMRCE  305

Query  221   SALATYCGV  195
             SAL TYCG+
Sbjct  306   SALKTYCGL  314



>ref|XP_010033901.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53767.1| hypothetical protein EUGRSUZ_J03020 [Eucalyptus grandis]
Length=314

 Score =   458 bits (1179),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 206/314 (66%), Positives = 253/314 (81%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS + +KLP+IDFS   L+PG   W  VR++V +AL  YGCFEA F+K+P+ L++SM+ 
Sbjct  1     MGSMAELKLPVIDFSSPRLEPGTAEWTAVRDEVKQALETYGCFEAWFEKVPVELQKSMLG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPLQTK+RN S KP+HGYVGQYPMVPLYES+GIDDA++       T  +WP+G
Sbjct  61    SVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESIGIDDADIYEKVDGLTTTLWPEG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NF  ++ S++EKLS LD M RRMILES GVEKY+DEHMNSTNYL R+MKY GP+  D 
Sbjct  121   NMNFSKTIHSFTEKLSELDKMSRRMILESFGVEKYLDEHMNSTNYLFRLMKYAGPQTTDP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL  HTD+N VTIL QNEV+GL+V  K G+WI+  PS NSF+VMIG+SL AW NGRLH
Sbjct  181   KLGLVPHTDQNTVTILCQNEVDGLQVQTKHGEWISTRPSTNSFVVMIGESLNAWLNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             +PYH+VMMSGN ARYSAGLF++PK GYI+KAP ELVDE+HPLLF PFDHVEFL FYY+E 
Sbjct  241   TPYHQVMMSGNRARYSAGLFTVPKGGYIVKAPNELVDEEHPLLFKPFDHVEFLDFYYTET  300

Query  236   GQKCQSALATYCGV  195
             GQ+ +SAL  YCGV
Sbjct  301   GQRAKSALKAYCGV  314



>ref|XP_006356185.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 262/315 (83%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++ IKLP I+FS E+LKP    W++V++QV+KALVEYGCFEA FDKIPI+L++S+ +
Sbjct  1     MGSKN-IKLPKINFSHEDLKPDTLEWNQVKSQVYKALVEYGCFEAFFDKIPINLQKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQY-PMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
               +E FDLPLQTK++N S KPF GYVGQY P +PL ESMGI D+N+ H  + +T ++WPQ
Sbjct  60    VSQEFFDLPLQTKLKNISTKPFSGYVGQYHPSIPLAESMGIIDSNIPHKVEKYTQLLWPQ  119

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GNP+FC ++QSY E+LS LD  +RRMI+ESLG+EKYMDEHMNS NY LR+MKYK P+ D+
Sbjct  120   GNPSFCKTIQSYLEQLSKLDQTIRRMIVESLGIEKYMDEHMNSINYSLRLMKYKEPQSDE  179

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             TKIGL++HTDKNIVTILYQN+V GLE+L KDGQWINV+P+P++F VMIGDSL+AWTNGR+
Sbjct  180   TKIGLHAHTDKNIVTILYQNQVKGLEILTKDGQWINVDPTPDTFTVMIGDSLHAWTNGRM  239

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H+ +HRVMM GN+ARYS GLFS PK GYIIKAP+ELVDE HPLLF PFD  EFL F Y+E
Sbjct  240   HATFHRVMMRGNKARYSIGLFSKPKDGYIIKAPKELVDEDHPLLFKPFDFHEFLAFGYTE  299

Query  239   EGQKCQSALATYCGV  195
             +  KC  +L  YCGV
Sbjct  300   QDMKCDFSLKAYCGV  314



>ref|XP_010462134.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=317

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 254/317 (80%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGIK---LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS+E LKPG P WD     V KAL +YGCFEA+FD+IPI LR+ 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             + + L+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+D ++      FT  +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F   + ++S+KLS LD  +RRMI+ES G++KY+DEH+ STNYLLRVMKYKGP+ 
Sbjct  121   PQGNNSFSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLQSTNYLLRVMKYKGPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  181   EETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSP HRVMM+G E RYS GLFSIPKAG+II +PEELVD++HP LF PFDHVEFL FYY
Sbjct  241   RLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEFLQFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             ++ GQ+ QSAL TYCG+
Sbjct  301   TQAGQRSQSALKTYCGI  317



>ref|XP_010500907.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=317

 Score =   452 bits (1163),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 254/317 (80%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGIK---LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS+E LKPG P WD     V KAL +YGCFEA+FD+IPI LR+ 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             + + L+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+D ++      FT  +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F   + ++S+KLS LD  +RRMI+ES G++KY+DEH++STNYLLRVMKYK P+ 
Sbjct  121   PQGNNSFSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  181   EETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSP HRVMM+G E RYS GLFSIPKAG+II +PEELVDE+HP LF PFDHVEFL FYY
Sbjct  241   RLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             ++ GQ+ QSAL TYCG+
Sbjct  301   TQAGQRSQSALKTYCGI  317



>ref|XP_007216816.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
 gb|EMJ18015.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
Length=321

 Score =   452 bits (1162),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 257/314 (82%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ ++LP+IDFS+++L PG   W+ VR QVH AL EYGCFEA F K+P H+R+S+  
Sbjct  1     MGSETPLRLPVIDFSNQSLTPGTREWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIFQ  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             ++++L DLPLQTK++N S KP+ GY GQ PM+PLYESMGID AN+    Q   N +WPQG
Sbjct  61    SIEDLLDLPLQTKLKNVSRKPYRGYAGQLPMMPLYESMGIDGANVYEQVQSLANTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+FC ++QS++EK+S LD ++RRMILESLG+++Y++EH+NST+YLLRVMKYK P+ ++T
Sbjct  121   NPSFCKTIQSFTEKVSELDQIIRRMILESLGLKEYLEEHLNSTDYLLRVMKYKAPQTNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL  HTDKNIVTILYQN+V+GLEV  KDG+WINV PS +SFI +IG+SL+AWTNGRLH
Sbjct  181   KLGLPPHTDKNIVTILYQNQVDGLEVQTKDGKWINVKPSSDSFIALIGESLHAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMM+GNE RYS GLFS PK GYIIKAP E+VDE+HPLLF P++H +F+ F  SE 
Sbjct  241   SPIHRVMMNGNEIRYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFIAFCNSEA  300

Query  236   GQKCQSALATYCGV  195
             GQ+   +L T+CGV
Sbjct  301   GQRGPFSLKTFCGV  314



>ref|XP_008228620.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 255/314 (81%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ ++LP+IDFS+++L PG   W+ VR QVH AL EYGCFEA F K+P H+R+S+  
Sbjct  1     MGSETPLRLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIFQ  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++EL DLPLQTK++  S KPF GY GQ PM+PLYESM ID AN+    Q   N +WPQG
Sbjct  61    SIEELLDLPLQTKLKIVSKKPFRGYAGQSPMMPLYESMPIDGANVYEQVQSLANTLWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+FC ++QS++EK+S LD ++RRMILESLG+EKY++EH+NSTNYLLRVMKYK P+ ++T
Sbjct  121   NPSFCKTIQSFTEKVSELDQIIRRMILESLGLEKYLEEHLNSTNYLLRVMKYKVPQTNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+G+  HTDKNIVTILYQN+V+GLEV  KDG+WINV PS +SFIV+IG+SL+AWTNGRL+
Sbjct  181   KLGIPPHTDKNIVTILYQNQVDGLEVQTKDGKWINVKPSSDSFIVLIGESLHAWTNGRLY  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMM+GNEARYS GLFS PK GYIIKAP E+VDE+HPLLF P++H +F  F  SE 
Sbjct  241   SPIHRVMMNGNEARYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFTAFCNSEA  300

Query  236   GQKCQSALATYCGV  195
             G++    L T+CGV
Sbjct  301   GRRDLFPLKTFCGV  314



>ref|XP_010500906.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=318

 Score =   448 bits (1153),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 256/318 (81%), Gaps = 4/318 (1%)
 Frame = -1

Query  1136  MGSESGIK---LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS+E LKPG P WD     V KAL +YGCFEA+FD+IPI LR+ 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             + + L+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+D ++      FT  +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  785   PQGNPNFCNS-VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPE  609
             PQGN +F ++ + ++S+KLS LD  +RRMI+ES G++KY+DEH++STNYLLRVMKYK P+
Sbjct  121   PQGNNSFSSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPD  180

Query  608   CDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTN  429
              ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  N
Sbjct  181   TEETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLN  240

Query  428   GRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY  249
             GRLHSP HRVMM+G E RYS GLFSIPKAG+II +PEELVDE+HP LF PFDHVEFL FY
Sbjct  241   GRLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQFY  300

Query  248   YSEEGQKCQSALATYCGV  195
             Y++ GQ+ QSAL TYCG+
Sbjct  301   YTQAGQRSQSALKTYCGI  318



>ref|XP_010479810.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=317

 Score =   444 bits (1142),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 208/317 (66%), Positives = 251/317 (79%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGIK---LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSES +    LP+IDFS+E LKPG P WD  R  V KAL +YGCFEA+F +IP  LR+ 
Sbjct  1     MGSESPLLPLCLPVIDFSNEYLKPGEPEWDLTRADVQKALQDYGCFEASFKRIPTELRKL  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             + + L+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+D ++      FT  +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F   + ++++KLS LD  +RRMI+ES G++KY++EH++STNYLLRVMKYKGP+ 
Sbjct  121   PQGNNSFSTRIHTFAKKLSDLDITIRRMIMESFGLDKYIEEHLHSTNYLLRVMKYKGPDT  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
              +TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  181   KETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSP HRVMM+G E RYS GLFSIPKA +II +PEELV E+HP LF PFDHVEFL FYY
Sbjct  241   RLHSPNHRVMMTGTETRYSLGLFSIPKAEHIISSPEELVGEEHPRLFKPFDHVEFLQFYY  300

Query  245   SEEGQKCQSALATYCGV  195
             ++ GQ+ QSAL TYCG+
Sbjct  301   TQAGQRSQSALKTYCGM  317



>ref|XP_006365982.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   439 bits (1128),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 252/313 (81%), Gaps = 5/313 (2%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             IKLP IDF  E+LK G   W++V++QVHKALVEYGCFEA+FDKI IHL++S+ +  +ELF
Sbjct  2     IKLPEIDFFHEDLKSGTLVWNQVKSQVHKALVEYGCFEASFDKISIHLKKSIFEVSQELF  61

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLPLQTK++N S +P HGY+G  P +PLYES+ I+DAN+ +  + FT  +WPQG  +FC 
Sbjct  62    DLPLQTKLKNISTRPLHGYIGPCPQIPLYESLCIEDANIHNKAEKFTQTLWPQGKSSFCK  121

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             ++QSYSEKLS LD +V RMILESLG+EKYMDEHMNSTNYLLR+MKYK P+  +T++G+N 
Sbjct  122   TIQSYSEKLSELDQIVNRMILESLGMEKYMDEHMNSTNYLLRLMKYKAPQSSETEMGMNV  181

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             HTD + +TILYQN+VNGL++L KDGQWIN +P+P++FIVMIGD L+AWTNGRLH+PYHRV
Sbjct  182   HTDTSNLTILYQNQVNGLQILTKDGQWINADPTPDTFIVMIGDPLHAWTNGRLHAPYHRV  241

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY-----SEEG  234
             +M G EARYS G FS PKAG+IIK P+ELVDE HPLLF PF H E+L F Y     ++EG
Sbjct  242   IMRGKEARYSIGFFSRPKAGHIIKTPKELVDEDHPLLFKPFVHAEYLDFCYRAFNNTKEG  301

Query  233   QKCQSALATYCGV  195
               C+S L TY GV
Sbjct  302   MGCESILKTYYGV  314



>ref|XP_004506877.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Cicer arietinum]
Length=314

 Score =   437 bits (1125),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 256/314 (82%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+  KLPIIDF++ NL+   P W+ V++QV+KAL EYGCFEA  DK+P+ LR+++  
Sbjct  1     MSSETIPKLPIIDFNNLNLEAKSPNWESVKSQVYKALEEYGCFEAILDKVPLDLRKTIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLPLQTK  N S K  HGY+ QYPM+PLYES+GIDDAN+  N +  TNI+WP G
Sbjct  61    SLEELFDLPLQTKQLNVSKKLHHGYLSQYPMLPLYESIGIDDANIFENVESLTNILWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F  +V ++SE+L  LD ++R+MILESLGVEKY++EHMNST+YLLR MKYKGP+  DT
Sbjct  121   NQSFSKTVHTFSEELLELDQIIRKMILESLGVEKYLEEHMNSTSYLLRFMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +HTDKN VTILYQN+V GLEV+NKDG+WI+  PS +SF+V++G+SL+AW+NGRLH
Sbjct  181   KVGLKAHTDKNTVTILYQNQVEGLEVMNKDGKWISYKPSLDSFVVLVGESLHAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMMSGNEARYS  L SIPK   IIKAP+ELVD++HPLLF P+ + EFL +++SE+
Sbjct  241   SPLHRVMMSGNEARYSIALGSIPKEECIIKAPDELVDDEHPLLFKPYVYDEFLKYFFSEK  300

Query  236   GQKCQSALATYCGV  195
             GQ+ Q A+ TYCGV
Sbjct  301   GQRDQFAMRTYCGV  314



>ref|XP_010462135.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=299

 Score =   429 bits (1102),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 243/317 (77%), Gaps = 21/317 (7%)
 Frame = -1

Query  1136  MGSESGIK---LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS+E LKPG P WD     V KAL +YGCFEA+FD+IPI LR+ 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             + + L+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+D ++      FT  +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F                  RRMI+ES G++KY+DEH+ STNYLLRVMKYKGP+ 
Sbjct  121   PQGNNSF------------------RRMIMESFGLDKYIDEHLQSTNYLLRVMKYKGPDT  162

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  163   EETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLNG  222

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSP HRVMM+G E RYS GLFSIPKAG+II +PEELVD++HP LF PFDHVEFL FYY
Sbjct  223   RLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEFLQFYY  282

Query  245   SEEGQKCQSALATYCGV  195
             ++ GQ+ QSAL TYCG+
Sbjct  283   TQAGQRSQSALKTYCGI  299



>ref|XP_010500908.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X3 [Camelina sativa]
Length=299

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 243/317 (77%), Gaps = 21/317 (7%)
 Frame = -1

Query  1136  MGSESGIK---LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+ +    LP+IDFS+E LKPG P WD     V KAL +YGCFEA+FD+IPI LR+ 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             + + L+ELFDLPLQTK+RN S KPFHGYVGQYPMVPLYESMGI+D ++      FT  +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN +F                  RRMI+ES G++KY+DEH++STNYLLRVMKYK P+ 
Sbjct  121   PQGNNSF------------------RRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDT  162

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GLN+HTDKNIVTILYQN V GLEV  KD  WI V PS +SFIVMIGDSL+A  NG
Sbjct  163   EETKLGLNAHTDKNIVTILYQNHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLNG  222

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLHSP HRVMM+G E RYS GLFSIPKAG+II +PEELVDE+HP LF PFDHVEFL FYY
Sbjct  223   RLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQFYY  282

Query  245   SEEGQKCQSALATYCGV  195
             ++ GQ+ QSAL TYCG+
Sbjct  283   TQAGQRSQSALKTYCGI  299



>emb|CDP14980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   424 bits (1089),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 253/321 (79%), Gaps = 10/321 (3%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDAL  951
             S  G KLP IDFS++ LKPG P W+ ++ QV +AL EYGCFEA++D+IPI LR+S+ DA+
Sbjct  2     SSEGPKLPFIDFSNQELKPGFPLWNSLKIQVREALEEYGCFEASYDRIPIQLRKSIFDAV  61

Query  950   KELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNP  771
              ELFDLPLQ KV+N++ KP+HGY+GQ P+ PLYE MGID+AN+L + + F+  MWP+GN 
Sbjct  62    TELFDLPLQVKVKNSNGKPYHGYIGQSPLFPLYEGMGIDEANVLEHAESFSKDMWPEGNS  121

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKI  591
              F  ++Q+Y+E+LS LD MVR+M+LE LGVE+Y+DEH+ ST+YLLRV+KYKGP+ ++TK+
Sbjct  122   EFSKTIQNYAEQLSELDQMVRKMVLEGLGVEQYIDEHLESTHYLLRVIKYKGPQTNETKL  181

Query  590   GLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLY---------A  438
             GL SH D N+VTIL+QN+V GLE+  KDGQWI+  PSPNSF+VMIG+S +         A
Sbjct  182   GLPSHRDANLVTILHQNQVQGLELQKKDGQWIDFKPSPNSFVVMIGESFHASLFNKFCSA  241

Query  437   WTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFL  258
             WTNGRLH P HRV+M+GNEARYS GLFS PK GY++KAP+ELVDE HPLLF PF+  ++L
Sbjct  242   WTNGRLHPPNHRVLMTGNEARYSVGLFSFPKDGYMVKAPKELVDETHPLLFKPFNCPDYL  301

Query  257   GFYYSEEGQKCQSALATYCGV  195
              + Y + G+K  S+L TYCG 
Sbjct  302   AYIY-KRGKKVDSSLKTYCGA  321



>ref|XP_006598543.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like, 
partial [Glycine max]
Length=270

 Score =   419 bits (1077),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 233/270 (86%), Gaps = 2/270 (1%)
 Frame = -1

Query  998  FDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLL  819
            F+K+P+ LR+++  AL+ELFDLPLQTK+ N S KP+ GYVGQYPMVPL+ESMGIDDAN+ 
Sbjct  1    FEKVPLELRKAIFAALQELFDLPLQTKILNVSKKPYRGYVGQYPMVPLFESMGIDDANVY  60

Query  818  HNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYL  639
             N +  TNIMWP GNP+F  ++QS+SE+LS LD ++R+MILESLGVEKY++EHMNSTNYL
Sbjct  61   ENVESMTNIMWPHGNPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYL  120

Query  638  LRVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVM  459
            L VMKYKGP+  DTK+GL +H+DKNIVTILYQNEV GLEV+ KDG+WI+  PSP+SF+VM
Sbjct  121  LGVMKYKGPQTSDTKVGLTTHSDKNIVTILYQNEVEGLEVMTKDGKWISYRPSPDSFVVM  180

Query  458  IGDSLYAWT--NGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLF  285
            IGDSL+  +  + RLHSP+HRVMMSGNEARYSAGLFSIPK G IIKAPEELVDE+HPLLF
Sbjct  181  IGDSLHVNSIHHLRLHSPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLF  240

Query  284  NPFDHVEFLGFYYSEEGQKCQSALATYCGV  195
             PFDHVEFL +YY+E+GQ+ Q AL TYCGV
Sbjct  241  KPFDHVEFLKYYYTEKGQRDQFALRTYCGV  270



>gb|KHN45675.1| Gibberellin 20 oxidase 1, partial [Glycine soja]
Length=263

 Score =   417 bits (1073),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 192/268 (72%), Positives = 230/268 (86%), Gaps = 5/268 (2%)
 Frame = -1

Query  998  FDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLL  819
            F+K+P+ LR+++  AL+ELFDLPLQTK+ N S KP+HGYVGQYPMVPL+ESMGIDDAN+ 
Sbjct  1    FEKVPLELRKAIFAALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVY  60

Query  818  HNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYL  639
             N +  TNIMWP GNP+F  ++QS+SE+LS LD ++R+MILESLGVEKY++EHMNSTNYL
Sbjct  61   ENVESMTNIMWPHGNPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYL  120

Query  638  LRVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVM  459
            L VMKYKGP+  DTK+GL +H+DKNIVTILYQNEV GLEV+ KDG+WI+  PSP+SF+VM
Sbjct  121  LGVMKYKGPQTSDTKVGLTTHSDKNIVTILYQNEVEGLEVMTKDGKWISYRPSPDSFVVM  180

Query  458  IGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNP  279
            I     A +N RLHSP+HRVMMSGNEARYSAGLFSIPK G IIKAPEELVDE+HPLLF P
Sbjct  181  I-----ACSNRRLHSPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKP  235

Query  278  FDHVEFLGFYYSEEGQKCQSALATYCGV  195
            FDHVEFL +YY+E+GQ+ Q AL TYCGV
Sbjct  236  FDHVEFLKYYYTEKGQRDQFALRTYCGV  263



>ref|XP_007024010.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26632.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   412 bits (1059),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 244/318 (77%), Gaps = 3/318 (1%)
 Frame = -1

Query  1142  RKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
              ++  E+ + LPIIDFS+++LK G P WD V+ QV KAL E+GCFEA  D++P  LRE++
Sbjct  3     EEISCETPLGLPIIDFSNKDLKQGTPEWDSVKIQVRKALQEFGCFEALVDEVPPELREAV  62

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYP-MVPLYESMGIDDANLLHNTQHFTNIMW  786
               ALKELFDLPL+TK+ N S KP+HGY+G +P   PLYES GI+D N+  N +  +NI+W
Sbjct  63    FGALKELFDLPLETKMLNVSEKPYHGYLGVHPERSPLYESFGIEDPNI-ENVEGLSNILW  121

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             P+GN  F   +   +E++ GL+ MVRRMILESL +EKYM+EHM+S  YLLR+MKYKGPE 
Sbjct  122   PEGNLAFSKPIHYLAEQVLGLERMVRRMILESLSLEKYMEEHMDSNYYLLRLMKYKGPET  181

Query  605   DDTKIGLNSHTDKNIVTILYQN-EVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTN  429
              + K+GL  HTDKNI+TILYQN +V+ L+V  KDG+WI+V PSP SFIVMIGD L AW N
Sbjct  182   TEAKLGLYGHTDKNIMTILYQNNDVHALQVRAKDGEWIHVKPSPRSFIVMIGDPLKAWLN  241

Query  428   GRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY  249
             G +HSP+HRVMM GNE R+S GLFSIPKAGY IKAPEELVDEQHPLLF PF + EFLGF 
Sbjct  242   GHMHSPFHRVMMKGNETRFSTGLFSIPKAGYTIKAPEELVDEQHPLLFKPFTYDEFLGFL  301

Query  248   YSEEGQKCQSALATYCGV  195
             Y+E GQ  + AL  YCGV
Sbjct  302   YTEAGQTAECALTDYCGV  319



>ref|XP_003554143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=310

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 244/315 (77%), Gaps = 6/315 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLPIIDFS E L+     W+ V++QVHKALVEYGCFEA FDK+P+ LR+++  
Sbjct  1     MGSETELKLPIIDFSIEYLESNSDQWESVKSQVHKALVEYGCFEAVFDKVPLDLRKAIFL  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              ++ELFDLPLQTK R  S+KP+HGYVG    + LYESMGIDD ++    +    I+WPQG
Sbjct  61    EVEELFDLPLQTKQRVVSSKPYHGYVGP---LQLYESMGIDDVDVHDKVESLIKILWPQG  117

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
              P F  ++QS++E+++ LD ++R+MILESLG+EKYMDEHMNSTNYL R+MKY+GP+ ++ 
Sbjct  118   KPGFSKNLQSFTEQVTRLDQIIRKMILESLGIEKYMDEHMNSTNYLARLMKYQGPQTNEA  177

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPS-PNSFIVMIGDSLYAWTNGRL  420
             K+G+  HTDKNI+T L QN+++GLEV  K G+WI   PS PNSF+V+ GD+LYAWTNGR+
Sbjct  178   KVGIREHTDKNILTTLCQNQIDGLEVQTKSGEWIKCKPSTPNSFVVVTGDTLYAWTNGRV  237

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H+P HRVMMSGNE R+S GLF++PK G+IIKAP+ELV E+HPLLF PF   EF+ F  S 
Sbjct  238   HTPAHRVMMSGNETRFSIGLFTVPKPGFIIKAPDELVTEEHPLLFKPFVQSEFMKFLRSS  297

Query  239   EGQKCQSALATYCGV  195
             E  K  +AL  YCGV
Sbjct  298   ESTK--NALKVYCGV  310



>gb|KHN14924.1| Gibberellin 20 oxidase 3 [Glycine soja]
Length=310

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 244/315 (77%), Gaps = 6/315 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLPIIDFS E L+     W+ V++QVHKALVEYGCFEA FDK+P+ LR+++  
Sbjct  1     MGSETELKLPIIDFSIEYLESNSDQWESVKSQVHKALVEYGCFEAVFDKVPLDLRKAIFL  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              ++ELFDLPLQTK R  S+KP+HGYVG    + LYESMGIDD ++    +    I+WPQG
Sbjct  61    EVEELFDLPLQTKQRVVSSKPYHGYVGP---LQLYESMGIDDVDVHDKVESLIKILWPQG  117

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
              P F  ++QS++E+++ LD ++R+MILESLG+EKYMDEHMNSTNYL R++KY+GP+ ++ 
Sbjct  118   KPGFSKNLQSFTEQVTRLDQIIRKMILESLGIEKYMDEHMNSTNYLARLIKYQGPQTNEA  177

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPS-PNSFIVMIGDSLYAWTNGRL  420
             K+G+  HTDKNI+T L QN+++GLEV  K G+WI   PS P+SF+V+ GD+LYAWTNGR+
Sbjct  178   KVGIGEHTDKNILTTLCQNQIDGLEVQTKSGEWIKCKPSTPSSFVVVTGDTLYAWTNGRV  237

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H+P HRVMMSGNE R+S GLF++PK G+IIKAP+ELV E+HPLLF PF   EF+ F  S 
Sbjct  238   HTPAHRVMMSGNETRFSIGLFTVPKPGFIIKAPDELVTEEHPLLFKPFVQSEFMKFLRSS  297

Query  239   EGQKCQSALATYCGV  195
             E  K  +AL  YCGV
Sbjct  298   ESTK--NALKVYCGV  310



>ref|XP_008784635.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Phoenix dactylifera]
Length=314

 Score =   398 bits (1023),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 240/315 (76%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S++ +KLP +D SDE L+PG  +W  VR QV +AL  +GCFEA F K+P  LR ++  
Sbjct  1     MASKALVKLPRLDLSDEGLQPGSESWGLVRAQVRQALETFGCFEAVFPKVPEELRRAIFP  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-Q  780
             AL ELF LP + K+RN S+KP HGYVGQYP +PL+ESMGI+DA +    Q FT +MWP  
Sbjct  61    ALDELFSLPTEAKLRNISDKPSHGYVGQYPHLPLFESMGIEDAEIPEEAQKFTALMWPPH  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +F  ++ S+S+ +  LD MVRRM+LESLGVEKY+D HM  T Y+LRVMKYKGP+  +
Sbjct  121   GNQSFSETICSFSKHVGELDQMVRRMVLESLGVEKYLDSHMQLTRYVLRVMKYKGPDTAE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +GL +H+D NIVTILYQN+ +GLE+  KDG+WI V+ SP+SF+VM GDS  AW+NGR+
Sbjct  181   ATMGLGAHSDSNIVTILYQNQ-DGLEIQTKDGRWIPVSTSPDSFVVMTGDSFTAWSNGRV  239

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H+P HRVMM+G+E RYSAGLF++PKAG++++AP+ELVDE+HPLL+ PFDH++FL F+ + 
Sbjct  240   HAPEHRVMMTGSEVRYSAGLFAMPKAGHLVRAPDELVDEEHPLLYKPFDHMDFLRFHRTR  299

Query  239   EGQKCQSALATYCGV  195
               Q  ++AL  +CG 
Sbjct  300   LNQTVKAALNEFCGA  314



>ref|XP_002515914.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF46334.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=314

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 231/314 (74%), Gaps = 0/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP IDFS   LKPG P W+ V++QV KA  EYGCFEA F  I   LR++M  
Sbjct  1     MGSETTFKLPAIDFSSTELKPGNPLWETVKSQVRKAAEEYGCFEALFQDISQELRKAMDG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+E+F LPL+ K  N S++PFHGY+G    + LYES+G DD +  H  + FTNIMWPQG
Sbjct  61    ALEEIFALPLEIKKLNVSDRPFHGYIGSSSPLSLYESIGFDDPDNFHKVESFTNIMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NF  +V S+S+ L+ LD M+R+MI+ES G+EKY+DEHMNS   + RV KY  PE  D 
Sbjct  121   NINFSTTVHSFSKTLTELDQMIRKMIVESFGMEKYLDEHMNSAYNIFRVTKYAAPETTDK  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K GL +HTDKN  +ILYQN+++GLE+  KDG+WINV  SP SFIV+IG+SL AWTNGRLH
Sbjct  181   KTGLRAHTDKNTTSILYQNQIDGLEIQTKDGEWINVEFSPYSFIVIIGESLNAWTNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMMSG++ RYSA LF++PK GY+IKA EELVD++HPL F PF+++E+L   Y+E 
Sbjct  241   SPCHRVMMSGSKTRYSAVLFTVPKEGYVIKAVEELVDDEHPLQFKPFEYLEYLKLRYAEV  300

Query  236   GQKCQSALATYCGV  195
             G+  +S L  Y G 
Sbjct  301   GKNFESPLKAYFGA  314



>ref|XP_007024016.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26638.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   393 bits (1009),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 238/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  1148  KERKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRE  969
             K  +M SE+ ++LP+ID S ++LKPG   W+ V+ QV +AL EYGCFEA FDK+ + L +
Sbjct  3     KSAEMSSETPVRLPVIDSSKQDLKPGSADWELVKVQVRQALQEYGCFEALFDKV-LELGK  61

Query  968   SMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNT-QHFTNI  792
              +I AL+ELFDLPLQTK R  S K F GY G  P  PL+ESM ID+AN+  N  Q  TNI
Sbjct  62    PLIGALEELFDLPLQTKTRYVSEKVFRGYYG--PKAPLHESMVIDEANVAENVEQRLTNI  119

Query  791   MWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP  612
             +WPQGN +F  ++ S+S   SGL+  +RRMILES G+EKYMD+HM STNY+LRVMKY+GP
Sbjct  120   LWPQGNSSFSETLLSFSSLASGLEKTIRRMILESFGLEKYMDKHMESTNYILRVMKYEGP  179

Query  611   ECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWT  432
                +  IG  +H+D+N+VT+L+QNEVNGLE+  KDG+WINV PSP SFIVMIG+SL  W 
Sbjct  180   HTSEPTIGARAHSDQNMVTLLHQNEVNGLEIQTKDGEWINVKPSPASFIVMIGESLSVWL  239

Query  431   NGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGF  252
             NGRL SPYHRVM++GN+ARYS+GLF+  K GY +K PEELVDE++PLLF PFD+ EFL F
Sbjct  240   NGRLPSPYHRVMITGNKARYSSGLFATTKGGYKVKVPEELVDEENPLLFKPFDYEEFLEF  299

Query  251   YYSEEGQKC-QSALATYCGV  195
             Y +E  +    S L  YC V
Sbjct  300   YSTEAARGALGSGLKAYCSV  319



>ref|XP_009771249.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2 
isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   390 bits (1003),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 209/233 (90%), Gaps = 1/233 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ IKLP IDFS+E+LKPG   W++V+NQVHKALV YGCFEA+FDKIPIHLR+S+ +
Sbjct  1     MGSET-IKLPNIDFSNEDLKPGSLVWNQVKNQVHKALVNYGCFEASFDKIPIHLRKSIFE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +LKELFDLPLQTK+RN S KPFHGYVGQYP VPLYESMGIDDAN+    + FT I+WP+G
Sbjct  60    SLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANISDKAERFTRILWPEG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NPNFC ++QSYSE+LS LD  VR+MILESLGVEKYMDEHMNSTNYLLRVMKYKGP+ +DT
Sbjct  120   NPNFCKTIQSYSEQLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSNDT  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYA  438
             K+GLN+HTDKNIVTILYQN+VNGLEVL KDGQWINV P+P++FIVMIGDSLY 
Sbjct  180   KLGLNAHTDKNIVTILYQNQVNGLEVLTKDGQWINVEPTPDAFIVMIGDSLYC  232



>ref|XP_007162139.1| hypothetical protein PHAVU_001G127400g [Phaseolus vulgaris]
 gb|ESW34133.1| hypothetical protein PHAVU_001G127400g [Phaseolus vulgaris]
Length=313

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 236/317 (74%), Gaps = 6/317 (2%)
 Frame = -1

Query  1142  RKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             +KMGSE+ +KLPIIDFS   L+     W+ V++QVHKALVEYGCFEA FD++P+H+R+++
Sbjct  2     KKMGSETEVKLPIIDFSVVELESNVAEWESVKSQVHKALVEYGCFEAVFDEVPLHIRKAI  61

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
                + ELF+LPL+TK    S+KPF GYVG    + LYES+GIDDA++    +   NI+WP
Sbjct  62    FFEVDELFNLPLETKKLAVSSKPFRGYVGP---IQLYESIGIDDADVYEKVESLINILWP  118

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             QG  +F  ++Q ++EK+S LD M+R+M LESLGVEKY+DEHMNST YL R++KY  P+ +
Sbjct  119   QGKSSFSKNLQFFTEKVSRLDRMIRKMCLESLGVEKYLDEHMNSTYYLARLIKYTAPQTN  178

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNG  426
             + K+ +  HTDKNI TIL QN+++GLE+  K+G+WI   P S NSF+V+ GD+ YAWTNG
Sbjct  179   EPKVAIAEHTDKNIFTILCQNQIDGLEIQTKNGEWIKYKPSSSNSFVVVTGDTFYAWTNG  238

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R+H+P H+VMM+GNE R + GLF++PK G+IIKAP ELV E+HPLLF PF   EF+ F  
Sbjct  239   RVHTPIHQVMMTGNETRLTVGLFTVPKPGFIIKAPNELVTEEHPLLFKPFVQSEFMKFLR  298

Query  245   SEEGQKCQSALATYCGV  195
             S   Q  ++AL  YCGV
Sbjct  299   S--SQNTKNALKVYCGV  313



>emb|CDY22099.1| BnaA09g01280D [Brassica napus]
Length=321

 Score =   373 bits (958),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 236/317 (74%), Gaps = 10/317 (3%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIP-IHLRESMIDA  954
             SES ++LP+IDFSD+NL PG   WDKV+  V KAL +YGCF+A  DK+  I L +S+ +A
Sbjct  10    SES-LQLPVIDFSDQNLTPGTSKWDKVKADVRKALEDYGCFQAYVDKVSNIELDKSVYEA  68

Query  953   LKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QG  777
             +++LFDLP+QTK RN S+KPFHGY+       LY+S+GI+DAN+      F  ++WP  G
Sbjct  69    MEKLFDLPVQTKQRNVSSKPFHGYLSH----NLYQSLGIEDANVAEKVNDFIQLLWPDHG  124

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD-  600
             N +    +  +S +L  LD MVR+MI+ES GVEKY+DEH+NSTNYL R+MKY  P  DD 
Sbjct  125   NKSISEMMHKFSTQLVELDVMVRKMIMESFGVEKYLDEHLNSTNYLFRMMKYTAPPDDDV  184

Query  599   --TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
               TK+GL SHTDKNI+TIL+Q EV+GLE++ KDG+WI V PS NSFI+M+GDSL A  NG
Sbjct  185   EETKLGLRSHTDKNIITILHQYEVDGLEIMTKDGKWIKVKPSQNSFIIMVGDSLCALLNG  244

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RL+SPYHRVMM   + RYS  +FS+PK+G +I +PEE+VDE+HP +F PF++++FL F++
Sbjct  245   RLYSPYHRVMMVAKKTRYSTAMFSVPKSGVVIDSPEEVVDEEHPRMFKPFEYMDFLNFFH  304

Query  245   SEEGQKCQSALATYCGV  195
             SE G++ +S L  +C +
Sbjct  305   SEAGRRVESTLHAFCAL  321



>gb|EYU21580.1| hypothetical protein MIMGU_mgv1a010552mg [Erythranthe guttata]
Length=309

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 240/316 (76%), Gaps = 10/316 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSES +KLP+IDFS  NLK    TW+ V+ QV +AL EYGCFEA F     + + S+++
Sbjct  1     MGSESRMKLPVIDFS--NLKQETATWESVKTQVSEALAEYGCFEAIFS----NPKYSLVN  54

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ-  780
              L++LFDLPLQTK+ N SN  +HGY+GQ+ +VPLYES+GI DA +  N + F  +MW   
Sbjct  55    VLQQLFDLPLQTKLLNKSNTTYHGYIGQHAVVPLYESLGISDALVPGNIEAFVELMWSHN  114

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GNP FC SV+S SE+L  L+ +VR M+LE+ G++KY+DEH++STNY++R  KY GP+ ++
Sbjct  115   GNPTFCESVRSISEELLELNKIVRTMVLENNGIKKYLDEHIDSTNYVVRFQKYDGPKTNE  174

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQ-WINVNPSPNSFIVMIGDSLYAWTNGR  423
             T++GL  H D N +TIL+Q++V GLE+  KDG  WI    SPNSFIVM G+SL AWTNGR
Sbjct  175   TELGLVPHIDMNTLTILFQDDVTGLEMQKKDGDDWIET--SPNSFIVMAGESLRAWTNGR  232

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             +H+P+HRVMM+G++ARYS GLF++PK+GYI+ AP+E+VDE+HPLL+ P+D+VEFL +YY 
Sbjct  233   VHAPFHRVMMTGDKARYSIGLFAVPKSGYIVTAPKEMVDEEHPLLYKPYDYVEFLNYYYG  292

Query  242   EEGQKCQSALATYCGV  195
             E  +   +AL  YCGV
Sbjct  293   EASKTSPNALKDYCGV  308



>emb|CDY21938.1| BnaC09g00440D [Brassica napus]
Length=321

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 236/317 (74%), Gaps = 10/317 (3%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIP-IHLRESMIDA  954
             SES ++LP+IDFSD+NL PG   WDKV+  V KAL +YGCF+A  DK+  I L +S+ +A
Sbjct  10    SES-LQLPVIDFSDQNLTPGTSKWDKVKADVRKALEDYGCFQAYVDKVSNIELDKSVYEA  68

Query  953   LKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QG  777
             +++LFDLP+QTK RN S+KPFHGY+       LY+S+GI+DAN+      F  ++WP  G
Sbjct  69    MEKLFDLPVQTKQRNVSSKPFHGYLSH----NLYQSLGIEDANVAEKVNDFIQLLWPDHG  124

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP---EC  606
             N +    +  +SE+L  LD MVRRMI+ES GVEKY+DEH+NSTNYL R+MKY  P   + 
Sbjct  125   NKSISEMMHKFSEQLVELDVMVRRMIMESFGVEKYLDEHLNSTNYLFRMMKYTAPPDEDV  184

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++ K+GL SHTDKNI+TIL+Q EV+GLE++ KDGQWI V PS +SFI+M+GDSL A  NG
Sbjct  185   EEAKLGLRSHTDKNIITILHQYEVDGLEIMTKDGQWIKVKPSQHSFIIMVGDSLCALLNG  244

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RL+SPYHRV+M   + RYS  +FS+PK+G II +PEE+VDE+HP +F PF++++FL F++
Sbjct  245   RLYSPYHRVLMVAKKTRYSTAMFSVPKSGVIIDSPEEVVDEEHPRMFKPFEYMDFLNFFH  304

Query  245   SEEGQKCQSALATYCGV  195
             SE G + +S L  +C +
Sbjct  305   SEAGSRVESTLHAFCAL  321



>ref|XP_009122188.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=321

 Score =   368 bits (945),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 235/317 (74%), Gaps = 10/317 (3%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIP-IHLRESMIDA  954
             SES ++LP+IDFSD+NL PG   WDKV+  V KAL +YG F+A  DK+  I L +S+ +A
Sbjct  10    SES-LQLPVIDFSDQNLTPGTSKWDKVKADVRKALEDYGWFQAYVDKMSNIELDKSVYEA  68

Query  953   LKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QG  777
             +++LFDLP+QTK RN S+KPFHGY+       LY+S+GI+DAN+      F  ++WP  G
Sbjct  69    MEKLFDLPVQTKQRNVSSKPFHGYLSH----NLYQSLGIEDANVAEKVNDFIQLLWPDHG  124

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD-  600
             N +    +  +S +L  LD MVR+MI+ES GVEKY+DEH+NSTNYL R+MKY  P  DD 
Sbjct  125   NKSISEMMHKFSTQLVELDVMVRKMIMESFGVEKYLDEHLNSTNYLFRMMKYTAPPDDDV  184

Query  599   --TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
               TK+GL SHTDKNI+TIL+Q EV+GLE++ KDG+WI V PS NSFI+M+GDSL A  NG
Sbjct  185   EETKLGLRSHTDKNIITILHQYEVDGLEIMTKDGKWIKVKPSQNSFIIMVGDSLCALLNG  244

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RL+SPYHRVMM   + RYS  +FS+PK+G +I +PEE+VDE+HP +F PF++++FL F++
Sbjct  245   RLYSPYHRVMMVAKKTRYSTAMFSVPKSGVVIDSPEEVVDEEHPRMFKPFEYMDFLNFFH  304

Query  245   SEEGQKCQSALATYCGV  195
             SE G++ +S L  +C +
Sbjct  305   SEAGRRVESTLHAFCAL  321



>ref|XP_006289716.1| hypothetical protein CARUB_v10003282mg [Capsella rubella]
 gb|EOA22614.1| hypothetical protein CARUB_v10003282mg [Capsella rubella]
Length=325

 Score =   367 bits (942),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/314 (54%), Positives = 233/314 (74%), Gaps = 9/314 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+ LKPG   WD+V+  V KAL +YGCFEA+FDK+ + L++S+ +A++EL
Sbjct  16    SFQLPLIDFSDKTLKPGSSKWDEVKIDVRKALEDYGCFEASFDKVSLELKKSVFEAVEEL  75

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F LP+QT+ RN S+KP+HGY+       LY+S GIDDAN+      FT  +WP  GN + 
Sbjct  76    FKLPVQTRQRNVSSKPYHGYLSH----NLYQSFGIDDANVFDKVNDFTRQLWPDHGNKSI  131

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-ECDD---T  597
               ++  +SEKLS L+ MVRRMI+ES G+++Y+DEH+NSTNY+LR+M+Y  P + DD   +
Sbjct  132   SETIHQFSEKLSELEVMVRRMIMESFGIQRYIDEHLNSTNYILRLMEYTTPLDADDEEES  191

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL +HTDKN++TIL+Q++V GLEV  KD +WI V PS +SFIVM+GDSL A  NGR+ 
Sbjct  192   KLGLRAHTDKNMITILHQHQVEGLEVKTKDEKWIKVKPSQDSFIVMVGDSLCALLNGRVF  251

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRVM++G + RYS GLFS+PK G  I +P+ELVDE+HP LF P+D+ +FL F+ +E 
Sbjct  252   SPYHRVMLTGKKTRYSTGLFSVPKTGVTIDSPDELVDEEHPRLFKPYDYNDFLHFFSTEA  311

Query  236   GQKCQSALATYCGV  195
             G+  QSAL  +  +
Sbjct  312   GRSAQSALHAFAAL  325



>gb|AAL14687.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis halleri]
Length=294

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 224/298 (75%), Gaps = 8/298 (3%)
 Frame = -1

Query  1112  LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDL  933
             LP+IDFSD+ LKPG   WD+V+  V KAL +YGCFEA+FDK+ + L++S+ +A++ELF+L
Sbjct  1     LPVIDFSDQTLKPGSSKWDEVKADVRKALEDYGCFEASFDKVSVELKKSVFEAMEELFEL  60

Query  932   PLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNS  756
             P+QTK RN S+KPFHGY+       LY+S+GIDDAN+L     FT  +WP QGN     +
Sbjct  61    PIQTKQRNVSSKPFHGYLCHN----LYQSLGIDDANVLEKVDDFTQQLWPDQGNKTISET  116

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD---TKIGL  585
             +  +SE+L  LD MVRRMI+ES G+EKY+DEH+NS+NYL+R MKY  P  DD   TK+GL
Sbjct  117   IHRFSEQLVELDVMVRRMIMESFGIEKYIDEHVNSSNYLMRFMKYTSPPDDDDEETKLGL  176

Query  584   NSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYH  405
              SHTDKNI+TIL+Q +V GLEV  KD +WI V PS +S ++M+GDSL A  NGRL SPYH
Sbjct  177   RSHTDKNIITILHQYQVGGLEVKTKDDKWIKVQPSQDSVLIMLGDSLCALLNGRLPSPYH  236

Query  404   RVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQ  231
             RV+M   + RYS GLFSIPK G II +PEELVDE+HP +F PF++ +F+ F+++E G+
Sbjct  237   RVIMMSKKTRYSTGLFSIPKTGVIIDSPEELVDEEHPRIFKPFEYKDFIHFFHTEAGR  294



>ref|XP_011045372.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=317

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 232/317 (73%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M  E+  +LPIIDF   +LKPG   WD V++QV KA+ E+GCF+A FDKIP+++ +S + 
Sbjct  1     MSQETLFQLPIIDFCKSDLKPGTSEWDLVKSQVWKAISEHGCFKALFDKIPLNVAKSFLG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              +KELFDLPLQTK ++ S  PFH Y G++P    +ES GI+D ++  N  +FTN++WP G
Sbjct  61    EVKELFDLPLQTKRQHVSEIPFHSYFGKFPPPLQFESFGIEDPSIFENCNNFTNVLWPHG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+F  ++  +S K+S  + ++RRMILESL +  Y+DEHM+ST  +LRVMKY+ P+  + 
Sbjct  121   NPDFRKNIDYFSTKVSEFEKLIRRMILESLSLGNYLDEHMSSTTCVLRVMKYQVPQITEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRL  420
                  +HTDKN++TILYQN V+GLEV  K+G+WI V  S + SF++MIG+S  AWTNGRL
Sbjct  181   TYTSKAHTDKNLITILYQNLVDGLEVQTKNGEWIGVELSQDHSFVIMIGESFRAWTNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY--Y  246
             H PYHRV M+G+EARYSAGLFS+ KAGY +K PE+L+DE HPLL+ PFD+ EFL F+  +
Sbjct  241   HPPYHRVRMTGSEARYSAGLFSLFKAGYKMKTPEDLIDEDHPLLYKPFDYFEFLKFFSAW  300

Query  245   SEEGQKCQSALATYCGV  195
             + + Q  Q AL  YCGV
Sbjct  301   APKAQPNQCALKAYCGV  317



>sp|Q945B6.1|AOP1L_ARATH RecName: Full=Probable 2-oxoglutarate-dependent dioxygenase AOP1.2 
[Arabidopsis thaliana]
 gb|AAL14644.1|AF417856_1 AOP1.2 [Arabidopsis thaliana]
Length=321

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 229/314 (73%), Gaps = 10/314 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V+  V KAL +YGCFEA FDK+ + L  S+ +A+++L
Sbjct  11    SFQLPVIDFSDQNLKPGSSKWDEVKADVLKALEDYGCFEAFFDKLSVELNRSVFEAMEDL  70

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+KPFHGY+       LYES+GIDDAN+L     FT  +WP  GN + 
Sbjct  71    FELPIPTKQRNVSSKPFHGYLCH----NLYESLGIDDANVLEKVNDFTQQLWPDHGNKSI  126

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----ECDD  600
               ++  +SE+L  LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P     + ++
Sbjct  127   SETIHLFSEQLVELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDEE  186

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             TK+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRL
Sbjct  187   TKLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRL  246

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E
Sbjct  247   HSPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTE  306

Query  239   EGQKCQSALATYCG  198
              G+  QSAL  +  
Sbjct  307   AGRIAQSALHAFAA  320



>gb|AAL14645.1|AF417857_1 AOP1 [Arabidopsis lyrata]
 gb|AAL14690.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis lyrata]
Length=318

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 228/312 (73%), Gaps = 8/312 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              +KLP+IDFS++ LKPG   WD+V+  V KAL +YGCFEA+FDK+ + L+ S+ +A++EL
Sbjct  10    SLKLPVIDFSNQTLKPGSSKWDEVKADVRKALEDYGCFEASFDKVSVELKTSVFEAMEEL  69

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+QTK RN S+KPFHGY+       LY+S GIDDAN+L     FT  +WP  GN + 
Sbjct  70    FELPIQTKQRNVSSKPFHGYICH----NLYQSXGIDDANVLVKVNDFTQQLWPDHGNKSI  125

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP---ECDDTK  594
               ++  +S++L  LD MVRRMI+ES G+EKY+DEH+ STNYL R+MKY  P   + ++T+
Sbjct  126   SETIHRFSDQLLELDVMVRRMIMESFGIEKYIDEHLKSTNYLFRMMKYTTPLDADVEETQ  185

Query  593   IGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHS  414
             +GL +HTDKNI+TIL+Q ++NGLEV  K+  WI V PS +SF+VM+GDSL A  NGRL S
Sbjct  186   VGLRAHTDKNIITILHQYQINGLEVKTKNENWIKVKPSQDSFVVMVGDSLCALLNGRLPS  245

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
              YHRVMM GN+ RYS  LFS PK   II +PEELVDE+HP +F PFD+ +F+ F+++E G
Sbjct  246   SYHRVMMMGNKTRYSTALFSAPKLETIIDSPEELVDEEHPRMFKPFDYNDFVHFFHTEAG  305

Query  233   QKCQSALATYCG  198
             +K QS L  +  
Sbjct  306   RKAQSTLHAFAA  317



>ref|NP_192216.1| oxidoreductase AOP1 [Arabidopsis thaliana]
 sp|Q9ZTA3.1|AOP1C_ARATH RecName: Full=Probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Arabidopsis thaliana]
 gb|AAL14643.1|AF417855_1 AOP1.1 [Arabidopsis thaliana]
 gb|AAC79098.1| putative oxidoreductase [Arabidopsis thaliana]
 emb|CAB77792.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE82267.1| oxidoreductase AOP1 [Arabidopsis thaliana]
Length=322

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 229/315 (73%), Gaps = 11/315 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++L
Sbjct  11    SFQLPVIDFSDQNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDL  70

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN + 
Sbjct  71    FELPIPTKQRNVSSKPFHGYLCHN----LYESLGINDANVLEKVNDFTQQLWPDHGNKSI  126

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECD  603
               ++  +SE+L  LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P      + +
Sbjct  127   SETIHLFSEQLVELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDE  186

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +TK+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGR
Sbjct  187   ETKLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGR  246

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             LHSPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +
Sbjct  247   LHSPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQT  306

Query  242   EEGQKCQSALATYCG  198
             E G+  QSAL  +  
Sbjct  307   EAGRIAQSALHAFAA  321



>ref|XP_002284974.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36203.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 229/314 (73%), Gaps = 3/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  +LP+++FS   LKPG  +W      V  AL EYGCF A +DK+   L  +   
Sbjct  1     MGSEAP-RLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTFC  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              L+ELFDLP +TKV+NTS+KP+ GY+GQ+P++PL+ESMGI+DA  L   + FTNIMWP G
Sbjct  60    QLEELFDLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPAG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC +V SYS+ +S L+ MV++M+ ES   EKY D H+ ST YLLR++KY+GP+ ++T
Sbjct  120   NDHFCETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGPQKNET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              IG + HTDK+ +T+L+QNEV GLE+  KDG+WI+  PSP+S++VM GD+L AW+NGR+H
Sbjct  180   CIGTSCHTDKSFITVLHQNEVCGLEIRTKDGEWISFKPSPSSYVVMAGDALLAWSNGRIH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRV+M+GN+ARYS GLF+  +   II+ PEEL DE+HPL F PF+H   L FY++ +
Sbjct  240   SPEHRVIMNGNKARYSIGLFAYHRG--IIEIPEELADEEHPLQFKPFNHYGLLHFYFTNK  297

Query  236   GQKCQSALATYCGV  195
               + +S    YCGV
Sbjct  298   AGQAESTAKAYCGV  311



>emb|CAN80139.1| hypothetical protein VITISV_028513 [Vitis vinifera]
Length=311

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 229/314 (73%), Gaps = 3/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  +LP+++FS   LKPG  +W      V  AL EYGCF A +DK+   L  +   
Sbjct  1     MGSEAP-RLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTFC  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              L+ELFDLP +TKV+NTS+KP+ GY+GQ+P++PL+ESMGI+DA  L   + FTNIMWP G
Sbjct  60    QLEELFDLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPAG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC +V SYS+ +S L+ MV++M+ ES   EKY D H+ ST YLLR++KY+GP+ ++T
Sbjct  120   NDHFCETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGPQKNET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              IG + HTDK+ +T+L+QNEV GLE+  KDG+WI+  PSP+S++VM GD+L AW+NGR+H
Sbjct  180   CIGTSCHTDKSFITVLHQNEVCGLEIRTKDGEWISFKPSPSSYVVMAGDALLAWSNGRIH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRV+M+GN+ARYS GLF+  +   II+ PEEL DE+HPL F PF+H   L FY++ +
Sbjct  240   SPEHRVIMNGNKARYSIGLFAYHRG--IIEIPEELADEEHPLQFKPFNHYGLLHFYFTNK  297

Query  236   GQKCQSALATYCGV  195
               + +S    YCGV
Sbjct  298   AGQTESTAKAYCGV  311



>gb|KFK30903.1| hypothetical protein AALP_AA6G041100 [Arabis alpina]
Length=319

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 229/316 (72%), Gaps = 12/316 (4%)
 Frame = -1

Query  1124  SGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKE  945
             S  +LP+IDFSD+ LKPG   WD+ ++ V KAL +YGCFEA+FD++ + L++S+ +A++E
Sbjct  10    SCFQLPVIDFSDQTLKPGSSKWDQAKSDVRKALEDYGCFEASFDQVSMDLKKSVFEAMQE  69

Query  944   LFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPN  768
             LF+LP+QTK RN S KPF+GY+       LY+S+GIDDAN+L     F   +WP  GN +
Sbjct  70    LFELPIQTKQRNVSPKPFYGYLNN----NLYQSLGIDDANVLEKVNDFAQQIWPDHGNKS  125

Query  767   FCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKG-PECDD---  600
                ++  +SE+LS LD MVRRMI+ES G+EKY+DEH+NSTNYL R+ KY   P+ DD   
Sbjct  126   ISETIHKFSEQLSELDVMVRRMIMESFGIEKYIDEHLNSTNYLFRMAKYTSPPDADDGVE  185

Query  599   -TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
              TK+GL SHTDKN +TIL+Q +V GLEV  KD +WI V PS +SFIVM+GD L A  NGR
Sbjct  186   ETKLGLRSHTDKNTITILHQYQVGGLEVKTKDEKWIKVKPSQDSFIVMVGDCLCALLNGR  245

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             L SPYHRVMM   + RYS  LFS+PKA  II +PEELVDE+HP +F PF++ +F+ F+++
Sbjct  246   LSSPYHRVMM--KKTRYSTALFSVPKAEVIIDSPEELVDEEHPRIFKPFEYNDFINFFHT  303

Query  242   EEGQKCQSALATYCGV  195
             E G++ QS L  +C  
Sbjct  304   EAGRRAQSTLQAFCAT  319



>gb|EYU21579.1| hypothetical protein MIMGU_mgv1a010719mg [Erythranthe guttata]
Length=304

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 236/310 (76%), Gaps = 10/310 (3%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             +KLP+IDFS  NLK    TW+ V+ QV +AL EYGCFEA F     + + S+++ L++LF
Sbjct  1     MKLPVIDFS--NLKQETETWESVKTQVSEALAEYGCFEAIFS----NRKYSLVNVLQQLF  54

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ-GNPNFC  762
             DLPLQTK+ N S+  +HGY+GQ  +VPLYES+ I+DA +  N + F  +MW   GNP FC
Sbjct  55    DLPLQTKLLNKSDTTYHGYIGQDAVVPLYESLAINDALVPGNIEAFAELMWSDNGNPTFC  114

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLN  582
              S++S SE+L  L+ +VR M+LE++G++KY+DEH++STNY++RV KY GP+ ++T++GL 
Sbjct  115   ESIRSISEELLELNKIVRTMVLENIGIKKYLDEHIDSTNYVVRVQKYDGPKTNETELGLI  174

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQ-WINVNPSPNSFIVMIGDSLYAWTNGRLHSPYH  405
              H D N +TIL+Q++V GLE+  KDG  WI    SPNSFIVM G+SL AWTNGR+H+P+H
Sbjct  175   PHIDMNTLTILFQDDVTGLEMQTKDGDNWIET--SPNSFIVMAGESLRAWTNGRVHAPFH  232

Query  404   RVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKC  225
             RVMM+G++ARYS GLF+ PK+GYI+KAP+E+VDE+HPLL+ P+D+V+FL FYY E  +  
Sbjct  233   RVMMTGDKARYSIGLFASPKSGYIVKAPKEMVDEEHPLLYKPYDYVQFLNFYYVEATKTS  292

Query  224   QSALATYCGV  195
              +AL  +CGV
Sbjct  293   PNALKDHCGV  302



>gb|AAL14683.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=320

 Score =   360 bits (924),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 229/313 (73%), Gaps = 9/313 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++L
Sbjct  11    SFQLPVIDFSDQNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDL  70

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN + 
Sbjct  71    FELPIPTKQRNVSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSI  126

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----T  597
               ++  +SE+L  LD MVRRMI+ES G+EKY+DEH+NST YL R+MKY  P  DD    T
Sbjct  127   SETIHLFSEQLVELDLMVRRMIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEET  186

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLH
Sbjct  187   KLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLH  246

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E 
Sbjct  247   SPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTEA  306

Query  236   GQKCQSALATYCG  198
             G+  QSAL  +  
Sbjct  307   GRIAQSALHAFAA  319



>emb|CAN77851.1| hypothetical protein VITISV_030994 [Vitis vinifera]
Length=317

 Score =   360 bits (923),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 221/314 (70%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS S  K+P++DFS ENL PG  +W      V  AL E+GCF A +DK+P  L+  +  
Sbjct  1     MGSHSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELF+LP +TK++N  NKP+HGYVGQ+  +PL+ES+GID+A  L   Q F N+MWP G
Sbjct  61    ALEELFNLPTETKMQNAHNKPYHGYVGQHSXLPLHESIGIDNATTLEGXQSFANLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC   + +S+    LD +V +MI ES GV KY D H+   +YLLRV+K+K P+  + 
Sbjct  121   NDHFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAPKVKEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G   HTDK+ +T+LYQN+V GLEV  KDG+WI++  SP+SF V+ GD+L AW+NGRLH
Sbjct  181   NLGFARHTDKSFITVLYQNQVKGLEVETKDGEWISLELSPSSFAVIAGDALVAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYH+VMMSGNE RYS GLF       +I+ PEEL D++HPL F  FDH+  L F+++EE
Sbjct  241   SPYHKVMMSGNEERYSLGLFQFSSG--MIQIPEELGDDEHPLQFKSFDHLGLLRFFHTEE  298

Query  236   GQKCQSALATYCGV  195
             GQK +S + +YCG+
Sbjct  299   GQKSKSLIKSYCGI  312



>ref|XP_006396533.1| hypothetical protein EUTSA_v10028799mg [Eutrema salsugineum]
 gb|ESQ37986.1| hypothetical protein EUTSA_v10028799mg [Eutrema salsugineum]
Length=324

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 236/317 (74%), Gaps = 12/317 (4%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD  LKPG   W KV++ V KAL +YGCFEA+FD++ + L++S+ +A+++L
Sbjct  12    SFQLPVIDFSDRTLKPGTSKWVKVKDDVRKALEDYGCFEASFDRVSMELKKSVFEAMEDL  71

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP++TK RN S+KPFHGY+       LY+S+GIDDAN+L     FT+ +WP  G+ + 
Sbjct  72    FELPVETKKRNVSSKPFHGYLSHN----LYQSLGIDDANVLEKVNDFTHQLWPDHGSKSI  127

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-------EC  606
               ++  ++EKL  LD MVRRMI+ES G+EKY+DEH+N+T+YLLR+MKY  P       + 
Sbjct  128   SETMHGFTEKLVELDVMVRRMIMESFGIEKYIDEHLNTTSYLLRMMKYTAPPDDDDDDDV  187

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             ++TK+GL SHTDKNI+TIL+Q +V+GLE++ KD +WI V PS +S IVM+GDSL A  NG
Sbjct  188   EETKLGLRSHTDKNIITILHQYQVDGLEIMTKDEKWIKVKPSQDSCIVMVGDSLCALLNG  247

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R+ SPYHRV++   + RYS  LFSIPK+G II +P+EL+DE+HP +F PF++ +F+ F++
Sbjct  248   RISSPYHRVLVMEKKTRYSTALFSIPKSGVIIDSPKELLDEEHPRVFRPFEYNDFVHFFH  307

Query  245   SEEGQKCQSALATYCGV  195
             +E G++ QS L  +C +
Sbjct  308   TEAGRRTQSPLHAFCAL  324



>gb|AAL14686.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=309

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 227/309 (73%), Gaps = 11/309 (4%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++L
Sbjct  5     SFQLPVIDFSDQNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDL  64

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN + 
Sbjct  65    FELPIPTKQRNVSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSI  120

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECD  603
               ++  +SE+L  LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P      + +
Sbjct  121   SETIHLFSEQLVELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDE  180

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +TK+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGR
Sbjct  181   ETKLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             LHSPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +
Sbjct  241   LHSPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQT  300

Query  242   EEGQKCQSA  216
             E G+  QSA
Sbjct  301   EAGRIAQSA  309



>ref|XP_002298124.1| hypothetical protein POPTR_0001s17580g [Populus trichocarpa]
 gb|EEE82929.1| hypothetical protein POPTR_0001s17580g [Populus trichocarpa]
Length=317

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 228/317 (72%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M  E+  +LP IDF   +LKPG   WD V++QV KA+ E+GCF+A FDKIP+H+ +S + 
Sbjct  1     MSQETPFQLPSIDFCKSDLKPGTSEWDLVKSQVWKAISEHGCFKALFDKIPLHVEKSCLG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              +KELFDLPLQTK ++ S  PF+ Y  + P    YES GI+D ++  N  +FTN++WP G
Sbjct  61    EVKELFDLPLQTKRQHVSEIPFNSYFWKSPPPLQYESFGIEDPSIFENCNNFTNVLWPHG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP+F  ++  +S K+S  + ++RRMILES+G++ Y+DEHM+ST  +LRVMKY+ P+  + 
Sbjct  121   NPDFRKNINYFSTKVSEFEKLIRRMILESMGLDNYLDEHMSSTTCVLRVMKYQVPQITEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRL  420
                   HTDKN++TILYQN+V+GLEV  K G+WI V  S + SF+++IG+S  AWTNGRL
Sbjct  181   TYTSKPHTDKNLITILYQNQVDGLEVQTKHGEWIGVELSHDHSFVILIGESFRAWTNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY--Y  246
             H PYHRV MSG+EARYSAGLFS  KAGY  K PE+L+DE HPLL+ PFD+ EFL F+  +
Sbjct  241   HPPYHRVRMSGSEARYSAGLFSFFKAGYKTKTPEDLIDEDHPLLYKPFDYFEFLKFFSAW  300

Query  245   SEEGQKCQSALATYCGV  195
             + + Q  Q AL  YCGV
Sbjct  301   APKAQPNQCALKAYCGV  317



>ref|XP_002280670.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36208.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   357 bits (917),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 221/314 (70%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS S  K+P++DFS ENL PG  +W      V  AL E+GCF A +DK+P  L+  +  
Sbjct  1     MGSHSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELF+LP +TK++N  NKP+HGYVGQ+  +PL+ES+GID+A  L   Q F N+MWP G
Sbjct  61    ALEELFNLPTETKMQNAHNKPYHGYVGQHSRLPLHESIGIDNATTLEGMQSFANLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC   + +S+    LD +V +MI ES GV KY D H+   +YLLRV+K+K P+  + 
Sbjct  121   NDHFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAPKVKEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G   HTDK+ +T+LYQN+V GLEV  KDG+WI++  SP+SF V+ GD+L AW+NGRLH
Sbjct  181   NLGFARHTDKSFITVLYQNQVKGLEVETKDGEWISLELSPSSFAVIAGDALVAWSNGRLH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYH+VMMSGNE RYS GLF       +I+ PEEL D++HPL F  F+H+  L F+++EE
Sbjct  241   SPYHKVMMSGNEERYSLGLFQFSSG--MIQIPEELGDDEHPLQFKSFNHLGLLRFFHTEE  298

Query  236   GQKCQSALATYCGV  195
             GQK +S + +YCG+
Sbjct  299   GQKSKSLIKSYCGI  312



>gb|KFK30901.1| hypothetical protein AALP_AA6G040900 [Arabis alpina]
Length=321

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 230/318 (72%), Gaps = 14/318 (4%)
 Frame = -1

Query  1124  SGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKE  945
             S  ++P+IDFSD+ LKPG   WD+V++ V KAL +YGCFEA+FDK+ + L++S+ +A++E
Sbjct  10    SSFQVPVIDFSDQTLKPGSSKWDQVKSDVRKALEDYGCFEASFDKVSMELKKSIFEAMQE  69

Query  944   LFDLPLQTKVRNTSNKPF-HGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNP  771
             LF+LP++TK RN S KPF +GY+       LY+S+GIDDAN+L     F   +WP  GN 
Sbjct  70    LFELPIETKQRNVSPKPFYYGYLNH----NLYQSLGIDDANVLEKVNEFAQQIWPDHGNK  125

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP------E  609
             +   ++  +SE+LS LD MVRRMI+ES G+EKY+DEH+NSTNYLLR+MKY  P      +
Sbjct  126   SISETIHKFSEQLSELDVMVRRMIMESFGIEKYIDEHLNSTNYLLRIMKYTSPLDADNND  185

Query  608   CDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTN  429
              ++ K+GL SHTDKNI+TIL+Q +V GLEV  KD +WI V PS +SFIVMIGDSL A  N
Sbjct  186   VEEAKLGLRSHTDKNIITILHQYQVGGLEVKTKDEKWIKVKPSHDSFIVMIGDSLCALLN  245

Query  428   GRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY  249
             GRL SPYHRVMM+  + RYS  LFS+P     I +PEELVDE+HP +F PF++ +F+ F+
Sbjct  246   GRLSSPYHRVMMT--KTRYSTALFSVPNPEVTIDSPEELVDEEHPRIFKPFEYNDFVKFF  303

Query  248   YSEEGQKCQSALATYCGV  195
              +E G+  QS L  +C +
Sbjct  304   RTEAGRGAQSTLQDFCAL  321



>gb|AAL14698.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=301

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/305 (56%), Positives = 223/305 (73%), Gaps = 12/305 (4%)
 Frame = -1

Query  1103  IDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQ  924
             IDFSD+ LKPG   WD+V+  V KAL  YGCFEA+FDK+ + L  S+ +A+++LF+LP+ 
Sbjct  1     IDFSDQTLKPGSSKWDEVKADVRKALENYGCFEASFDKLSVELNRSVFEAMEDLFELPIP  60

Query  923   TKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQS  747
             TK RN S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN +   ++  
Sbjct  61    TKQRNVSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHR  116

Query  746   YSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-------ECDDTKIG  588
             +SEKL  LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P       + ++TK+G
Sbjct  117   FSEKLVELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDDEETKLG  176

Query  587   LNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPY  408
             L SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPY
Sbjct  177   LRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPY  236

Query  407   HRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQK  228
             HRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E G+ 
Sbjct  237   HRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTEAGRI  296

Query  227   CQSAL  213
              QSAL
Sbjct  297   AQSAL  301



>gb|AAL14701.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=300

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 224/303 (74%), Gaps = 10/303 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V+  V KAL +YGCFEA FDK+ + L  S+ +A+++L
Sbjct  1     SFQLPVIDFSDQNLKPGSSKWDEVKADVLKALEDYGCFEAFFDKLSVELNRSVFEAMEDL  60

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+KPFHGY+       LYES+GIDDAN+L     FT  +WP  GN + 
Sbjct  61    FELPIPTKQRNVSSKPFHGYLCH----NLYESLGIDDANVLEKVNDFTQQLWPDHGNKSI  116

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----ECDD  600
               ++  +SE+L  LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P     + ++
Sbjct  117   SETIHLFSEQLVELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDEE  176

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             TK+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRL
Sbjct  177   TKLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRL  236

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             HSPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E
Sbjct  237   HSPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTE  296

Query  239   EGQ  231
              G+
Sbjct  297   AGR  299



>ref|XP_002515925.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF46345.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=316

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 220/294 (75%), Gaps = 1/294 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+ + LP+IDFS+ +L+PG  TWD V++QV KA  EYGCF+A F+KIP  ++++   
Sbjct  1     MDSENFLSLPMIDFSNSDLRPGTATWDLVKSQVRKAAEEYGCFQALFNKIPEEIQKATNG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYP-MVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
             AL+ELF LPL+TK  N S KPFHGY+G     V LYES+GI + ++    ++F N++WP+
Sbjct  61    ALEELFQLPLETKKCNVSEKPFHGYLGSSSSAVSLYESLGIVEPDIYEKVENFINVLWPE  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN      + S+SE +  LD ++RRMI+ESLGVEKY++EHM ST Y LRV KY+ P+  +
Sbjct  121   GNVKVSKILHSFSEPVLELDQIIRRMIVESLGVEKYLEEHMKSTYYFLRVAKYQTPQTTE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              K GL +HTDKN +TI YQN+V+GLE+  ++G WI V  SPNS +++ G+SL AWTNGRL
Sbjct  181   KKTGLRAHTDKNTLTIFYQNQVDGLEIQTRNGDWIPVKFSPNSLVILFGESLKAWTNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFL  258
             +SP+HRVMM+G+E RYSA  FS+PK GYIIKA EELVDE HPL +NPFD+ E+L
Sbjct  241   YSPFHRVMMAGSEPRYSAVFFSVPKEGYIIKALEELVDEDHPLQYNPFDYSEYL  294



>ref|XP_009134375.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
 emb|CDX90907.1| BnaA03g25870D [Brassica napus]
Length=319

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 222/312 (71%), Gaps = 7/312 (2%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              I+LP+IDFSD+ L PG   WDKV+  V KAL +YGCFEA FDK+ + L +S+ +A++EL
Sbjct  12    SIQLPVIDFSDQCLTPGTSKWDKVKTDVRKALEDYGCFEAFFDKVSVELDKSVFEAMEEL  71

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             FDLP QTK RN S+KP+HGY+ Q     +YES GIDDANL      FT  +WP  GN   
Sbjct  72    FDLPTQTKERNVSSKPYHGYLSQ----DIYESFGIDDANLAEKVNEFTQQLWPDHGNKRI  127

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC-DDTKIG  588
               ++   SEKL+ LD MVRRMI+ES G+EKY+DEH++STNYL R+MKY  P   ++ K+G
Sbjct  128   SETMHGISEKLAELDVMVRRMIMESFGIEKYIDEHLDSTNYLFRMMKYTPPRPHEEKKLG  187

Query  587   LNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPS-PNSFIVMIGDSLYAWTNGRLHSP  411
             L SHTDKNI+TIL+Q +V+GLE+ NKD +W  V PS  NSFIVM+GDS+ A+ NGRL S 
Sbjct  188   LPSHTDKNIMTILHQYQVDGLEIQNKDKKWFKVKPSHQNSFIVMVGDSMCAFLNGRLAST  247

Query  410   YHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQ  231
             YHRV+++  + RYS  LFS PK G I+ +PEEL+DE+HP +F PF+  ++  FY +E G 
Sbjct  248   YHRVLVTAKKTRYSTALFSTPKTGVILDSPEELIDEEHPRVFKPFEFNDYRDFYNTEAGF  307

Query  230   KCQSALATYCGV  195
               QS L  +C +
Sbjct  308   AAQSTLHAFCAL  319



>gb|AAL14699.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=300

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 224/302 (74%), Gaps = 9/302 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++L
Sbjct  3     SFQLPVIDFSDQNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDL  62

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN + 
Sbjct  63    FELPIPTKQRNVSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSI  118

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----T  597
               ++  +SE+L  LD MVRRMI+ES G+EKY+DEH+NST YL R+MKY  P  DD    T
Sbjct  119   SETIHLFSEQLVELDLMVRRMIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEET  178

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLH
Sbjct  179   KLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLH  238

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E 
Sbjct  239   SPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTEA  298

Query  236   GQ  231
             G+
Sbjct  299   GR  300



>emb|CBI36206.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 226/322 (70%), Gaps = 3/322 (1%)
 Frame = -1

Query  1157  KELKERKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIH  978
             +ELK + MGSE+  KLPIIDFS+ENLKPG  +W  V + V  AL EYGCF A ++++P+ 
Sbjct  142   QELKTKIMGSETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLE  201

Query  977   LRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFT  798
             L   + +AL ELFDLP + KV+NTS+KP HGY+GQ P  PL+ESMGID A  L   Q F 
Sbjct  202   LHNKIFNALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFA  261

Query  797   NIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYK  618
              +MWP GN +FC  V SY+  L+ L+ +V RM+L+S G+EKY D H+ ST YLLR +K +
Sbjct  262   KLMWPAGNEHFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNR  321

Query  617   GPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLY  441
              P+ ++  I   +H+DK+ +TIL QN V+GLEV  KDG+ I    PSP+ FIV+ GD+  
Sbjct  322   VPKMNENDIAFPTHSDKSFMTILQQNHVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFM  381

Query  440   AWTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             AW+NGR+H P HRV+M  NE RYS  LF+      +IK PEELVD++HPL F PFDHV F
Sbjct  382   AWSNGRIHPPKHRVIMRANEERYSLALFAFKNG--MIKVPEELVDDKHPLQFKPFDHVGF  439

Query  260   LGFYYSEEGQKCQSALATYCGV  195
             + F+++EEG+K  SA+  YCG+
Sbjct  440   IRFFHTEEGRKSNSAIKAYCGI  461


 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = -1

Query  815  NTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLL  636
            N +H    +W   +  +  +V  YS+ LS L+ +V RM+LES G+E   D H+ S  +L+
Sbjct  32   NVRHALEEVW-LFHGTYLVTVHCYSKLLSELEQIVMRMVLESYGIEN--DFHIGSATFLI  88

Query  635  RVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWIN  492
            R +KY+ P+ ++T I +  HTDK+ ++IL+QN+VNGLE+  KDG+WI+
Sbjct  89   RFLKYRVPKMNETSISVPPHTDKSFISILHQNQVNGLEIETKDGKWIS  136



>ref|XP_002284983.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Vitis vinifera]
Length=313

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 221/315 (70%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLPIIDFS+ENLKPG  +W  V + V  AL EYGCF A ++++P+ L   + +
Sbjct  1     MGSETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELHNKIFN  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL ELFDLP + KV+NTS+KP HGY+GQ P  PL+ESMGID A  L   Q F  +MWP G
Sbjct  61    ALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC  V SY+  L+ L+ +V RM+L+S G+EKY D H+ ST YLLR +K + P+ ++ 
Sbjct  121   NEHFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVPKMNEN  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRL  420
              I   +H+DK+ +TIL QN V+GLEV  KDG+ I    PSP+ FIV+ GD+  AW+NGR+
Sbjct  181   DIAFPTHSDKSFMTILQQNHVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFMAWSNGRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H P HRV+M  NE RYS  LF+      +IK PEELVD++HPL F PFDHV F+ F+++E
Sbjct  241   HPPKHRVIMRANEERYSLALFAFKNG--MIKVPEELVDDKHPLQFKPFDHVGFIRFFHTE  298

Query  239   EGQKCQSALATYCGV  195
             EG+K  SA+  YCG+
Sbjct  299   EGRKSNSAIKAYCGI  313



>gb|KDP40825.1| hypothetical protein JCGZ_24824 [Jatropha curcas]
Length=314

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 222/316 (70%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+    P+IDFS   LKPG P W+ V++QV KA  EYGCFEA F  IP  LR++M  
Sbjct  1     MGSETIQSFPVIDFSSTELKPGTPLWETVKSQVRKAAEEYGCFEAVFKNIPQELRKAMNG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVP--LYESMGIDDANLLHNTQHFTNIMWP  783
             AL+E+F LP + K  N S  PFHGY+G  P  P  +YES+G    +     Q+FTN+ WP
Sbjct  61    ALEEIFALPSEIKKLNVSELPFHGYIG--PSFPGSIYESLGFYYPDNYDKVQNFTNVFWP  118

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             +GN NF  ++  +S+ L+ LD  VRRMI+ES G+E  +DEH+NST   LRV KY+ P+  
Sbjct  119   EGNINFSKTLYGFSKALAELDQTVRRMIVESFGIENLLDEHLNSTYNFLRVTKYEAPKTS  178

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             + K GL +HTDKN  +ILYQN+++GLEV  K+G+WINV  SP+SFI +IGDSL AWTNGR
Sbjct  179   EKKTGLRAHTDKNTTSILYQNQIDGLEVQLKNGEWINVKFSPDSFIFIIGDSLNAWTNGR  238

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             L+SP+HRV+MSG++ R+SA LF+IP  GY IKA EELVDE+HPL F PF++ ++L   + 
Sbjct  239   LYSPFHRVIMSGDKTRHSAVLFTIPNEGYTIKAVEELVDEEHPLQFKPFEYKDYLKLRFG  298

Query  242   EEGQKCQSALATYCGV  195
             E G+  ++ L  Y GV
Sbjct  299   EVGKVYEAPLKEYFGV  314



>ref|XP_009799663.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana sylvestris]
Length=315

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 219/307 (71%), Gaps = 0/307 (0%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             KLPIIDF+ ENL+PG  +W KV  +V  AL EYGCF A +DKI + +   +  AL+ELF+
Sbjct  9     KLPIIDFTKENLEPGTNSWFKVCKEVVCALEEYGCFVALYDKISLKIHNEVFQALEELFN  68

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP QTK++N S KP +GYVGQ P +PLYESMGID+AN +   Q+F+N MWP GN  F  +
Sbjct  69    LPTQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTIEGIQNFSNFMWPNGNNCFSEA  128

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             + +YS+  + +++MV RM+ ES GVEKY + H+ S NYL RVMKYK  +  + K+G  +H
Sbjct  129   LLAYSKAAAEVEEMVVRMVFESYGVEKYYESHIKSVNYLARVMKYKEAQVQEPKLGFVAH  188

Query  575   TDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVM  396
             TDK+ ++ ++QN+VNGLE+  KDGQW  V  SP+S +VM GD++ AW+N R+ SP+HRVM
Sbjct  189   TDKSFMSTIHQNQVNGLEIKGKDGQWFGVELSPSSIVVMAGDAIMAWSNNRIKSPHHRVM  248

Query  395   MSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSA  216
             M G   RYS   FS  +   +++ PEELVDE+HPL F  F+H+++L F+  EE ++ +SA
Sbjct  249   MEGKGERYSIAQFSFMEDTVMVETPEELVDEEHPLKFKSFNHLDYLHFFSKEENRRLESA  308

Query  215   LATYCGV  195
             L TYCGV
Sbjct  309   LKTYCGV  315



>ref|XP_008377592.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=312

 Score =   350 bits (897),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 222/314 (71%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP+ID SDENLKPG   W     ++  AL EYGCFEA + KIP+ L  S+  
Sbjct  1     MGSETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKIPLELHNSIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A+++LF LPL+TK + TS++P+H Y GQY  +PLYES+G+D+   +   Q FT+IMWPQG
Sbjct  61    AMEDLFGLPLETKKQKTSDRPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTSIMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC +  S+S+ ++ L  MV RM+ +  GV++  D HM ST YLLR  KY+  E ++T
Sbjct  121   NAHFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLFDSHMESTTYLLRCFKYRTQEENET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL+ HTDK  ++IL QN+VNGL++  KDGQWI+VNPSP+SF+++ GD+  AW+N R+ 
Sbjct  181   NVGLHPHTDKTFISILNQNQVNGLQIGTKDGQWIDVNPSPSSFLILAGDAFMAWSNDRVP  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  H+V M  N+ RYS GLF+  K+G II+ PEEL+DE+HPLL+ PFDH  FL F  + E
Sbjct  241   SCDHQVTMKENKTRYSLGLFAF-KSG-IIQVPEELIDEKHPLLYKPFDHFSFLDFDRTPE  298

Query  236   GQKCQSALATYCGV  195
              +K + ++  YCGV
Sbjct  299   ARKLKCSIKAYCGV  312



>gb|KHN47795.1| hypothetical protein glysoja_029213 [Glycine soja]
Length=236

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/314 (55%), Positives = 210/314 (67%), Gaps = 78/314 (25%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+ +KLP+IDF++  L+   P W+ V++QVHKALV+YGCFEA FDK+P+ LR+++  
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAVKSQVHKALVDYGCFEAIFDKVPLELRKAIFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLPLQTK+ N S KP+HGYVGQYPMVPL+E+                       
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFET-----------------------  97

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
                    +QS+SE+LS LD ++R+MILESLGVE+Y++EHMNSTNYLLRVMKYKGP+  DT
Sbjct  98    -------IQSFSEQLSELDQIIRKMILESLGVEEYLEEHMNSTNYLLRVMKYKGPQTSDT  150

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL                                                AW+NGRLH
Sbjct  151   KLGL------------------------------------------------AWSNGRLH  162

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRV+MSGNEARYSAGLFSIPK G IIKAPEELVDE+HPLLF PFDHVEFL  YY+E+
Sbjct  163   SPFHRVIMSGNEARYSAGLFSIPKGGSIIKAPEELVDEEHPLLFKPFDHVEFLKSYYTEQ  222

Query  236   GQKCQSALATYCGV  195
             GQ+ QSAL TYCGV
Sbjct  223   GQRDQSALRTYCGV  236



>sp|Q944Z5.1|AOP1V_ARATH RecName: Full=Probable 2-oxoglutarate-dependent dioxygenase AOP1, 
partial [Arabidopsis thaliana]
 gb|AAL14682.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=301

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 223/302 (74%), Gaps = 9/302 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
               +LP+IDFSD+NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++L
Sbjct  4     SFQLPVIDFSDQNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDL  63

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F+LP+ TK RN S+K FHGY+       LYES+GI+DAN+L     FT  +WP  GN + 
Sbjct  64    FELPIPTKQRNVSSKLFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSI  119

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----T  597
               ++  +SE+L  LD MVRRMI+ES G+EKY+DEH+NST YL R+MKY  P  DD    T
Sbjct  120   SETIHLFSEQLVELDLMVRRMIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+GL SHTDKNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLH
Sbjct  180   KLGLRSHTDKNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SPYHRV+M+G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E 
Sbjct  240   SPYHRVIMTGKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTEA  299

Query  236   GQ  231
             G+
Sbjct  300   GR  301



>ref|XP_010467243.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=331

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 225/315 (71%), Gaps = 10/315 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              + LP+IDFSD+ LKPG   WD+V+  V KAL +YGCF+A+FDK+   L++++ +A++EL
Sbjct  21    SVHLPVIDFSDKTLKPGSSKWDEVKIDVRKALEDYGCFQASFDKVSAELKKTVFEAVEEL  80

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F LP+QT+ RN S KPFHGY+       LY+S GIDDAN+L     FT  +WP  GN N 
Sbjct  81    FKLPIQTRQRNVSTKPFHGYLSH----NLYQSFGIDDANVLDKVNGFTQQLWPDHGNKNI  136

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP---ECDD--  600
               ++  +SEKLS LD MVRRMI+ES G+EKY+D H+NST   LR+M+Y  P   + DD  
Sbjct  137   SETLHQFSEKLSELDVMVRRMIMESFGIEKYIDGHLNSTYNTLRMMEYTTPPLLDADDEE  196

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             +K+GL +HTDKN++TIL+Q++V+GLEV  KD +WI V PS + F+VM+GDSL A  NGR+
Sbjct  197   SKVGLRAHTDKNMITILHQHQVDGLEVKTKDEKWIKVKPSQDHFLVMVGDSLCALLNGRV  256

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
               PYHRVMM G + RYS  LFS+PK+  II++PEELVDE+HP +F  +++ EFL F  +E
Sbjct  257   FCPYHRVMMMGKKTRYSTALFSVPKSEVIIESPEELVDEEHPRIFKTYEYKEFLHFLTTE  316

Query  239   EGQKCQSALATYCGV  195
              G+  QSAL  +  +
Sbjct  317   AGRSAQSALHAFAAL  331



>gb|KDP40827.1| hypothetical protein JCGZ_24826 [Jatropha curcas]
Length=318

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 225/311 (72%), Gaps = 3/311 (1%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              + LP+IDFS+ +LKP  PTW  +++QV KA  EYGCF+  F+KIP  L++SM  A +EL
Sbjct  7     SLSLPVIDFSNSDLKPSNPTWGLLKSQVRKAAEEYGCFQVLFNKIPEQLQKSMNQASEEL  66

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYP-MVPLYESMGIDDANLLHNTQH-FTNIMWPQGNPN  768
             F LPL+TK  N S KPFHGY+G     + LYES+ I + ++ +  +  FTN+++PQGN  
Sbjct  67    FQLPLETKQLNVSEKPFHGYLGSSSSAMSLYESLAIVEPDIYNKVETTFTNVLYPQGNTE  126

Query  767   FCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIG  588
                 + S+SE +  LD +VRRMI+ES GVEKY+DEHMNST Y LRV KYK PE  +   G
Sbjct  127   LSKILHSFSETVLELDKIVRRMIVESFGVEKYLDEHMNSTYYFLRVAKYKAPETTEKITG  186

Query  587   LNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPY  408
             L +HTDKN ++I YQN+V+GLE+ +++G WI +  SP+SF+V+IG+SL AWTNGRL SPY
Sbjct  187   LRAHTDKNTISIFYQNQVDGLEIQSRNGDWIPIMFSPDSFLVLIGESLNAWTNGRLCSPY  246

Query  407   HRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQ-  231
             HRVM+SGN+ RYSA  FS+PK GYIIKA EELVDE HPLL+ PFD+ ++L   ++++ + 
Sbjct  247   HRVMLSGNKPRYSASFFSVPKDGYIIKALEELVDEDHPLLYKPFDYSDYLKRRFADDVKI  306

Query  230   KCQSALATYCG  198
             K    L +Y G
Sbjct  307   KSVPPLKSYFG  317



>gb|KDO58207.1| hypothetical protein CISIN_1g037660mg [Citrus sinensis]
Length=312

 Score =   347 bits (891),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 225/314 (72%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++  K+ ++D  +ENLKPG  TW    N++ +A+ + GCFEA ++KIP+ L   +  
Sbjct  1     MGSQTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIFK  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A  ELFDLP++TK++NTS+KP+H Y GQY  +PLYES+ IDD   L  TQ FT+ MWP G
Sbjct  61    AADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPNG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC SV S+++ +  +D +V RMI+ES G+EKY D H+ ++NYLLR  KY+ PE ++ 
Sbjct  121   NPPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKPEINEH  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL  HTDKN+V+I++QN +NGL++  KDG+WI++ PSP+SF++M  D L AW+NGR+ 
Sbjct  181   NVGLYPHTDKNMVSIIHQNHINGLQIKAKDGEWIDLEPSPSSFVIMAADGLLAWSNGRIR  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  H+V+++ +E RYS GLFS  +   I+  PEE VDE HPL + PFD  EFL F+ S+E
Sbjct  241   SCEHQVIINAHETRYSMGLFSFNRG--IVHIPEEFVDELHPLRYRPFDIYEFLRFHDSDE  298

Query  236   GQKCQSALATYCGV  195
             G+K   ++ ++CG+
Sbjct  299   GKKTDGSITSFCGI  312



>ref|XP_006427130.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
 gb|ESR40370.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
Length=323

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 225/314 (72%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++  K+ ++D  +ENLKPG  TW    N++ +A+ + GCFEA ++KIP+ L   +  
Sbjct  12    MGSQTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIFK  71

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A  ELFDLP++TK++NTS+KP+H Y GQY  +PLYES+ IDD   L  TQ FT+ MWP G
Sbjct  72    AADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPNG  131

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP FC SV S+++ +  +D +V RMI+ES G+EKY D H+ ++NYLLR  KY+ PE ++ 
Sbjct  132   NPPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKPEINEH  191

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL  HTDKN+V+I++QN +NGL++  KDG+WI++ PSP+SF++M  D L AW+NGR+ 
Sbjct  192   NVGLYPHTDKNMVSIIHQNHINGLQIKAKDGEWIDLEPSPSSFVIMAADGLLAWSNGRIR  251

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  H+V+++ +E RYS GLFS  +   I+  PEE VDE HPL + PFD  EFL F+ S+E
Sbjct  252   SCEHQVIINAHETRYSMGLFSFNRG--IVHIPEEFVDELHPLRYRPFDIYEFLRFHDSDE  309

Query  236   GQKCQSALATYCGV  195
             G+K   ++ ++CG+
Sbjct  310   GKKTDGSITSFCGI  323



>emb|CDY17965.1| BnaC03g30370D [Brassica napus]
Length=319

 Score =   347 bits (890),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/312 (54%), Positives = 219/312 (70%), Gaps = 7/312 (2%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              I+LP+IDFSD+ L PG   WDKV+  V KAL +YGCFEA FDK+ + L +S+ +A++EL
Sbjct  12    SIQLPVIDFSDQCLTPGTSKWDKVKTDVRKALEDYGCFEAFFDKVSVELDKSVFEAMEEL  71

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             FDLP QTK RN S+KP+HGY+ Q     +YES GIDDANL      FT  +WP  GN   
Sbjct  72    FDLPTQTKERNVSSKPYHGYLSQ----NIYESFGIDDANLAEKVNEFTQQLWPDHGNKRI  127

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC-DDTKIG  588
               ++   S KL+ LD MVRRMI+ES G+EKY+DEH++STNYL R+MKY  P   ++ K+G
Sbjct  128   SETMHGISGKLAELDVMVRRMIMESFGIEKYIDEHLDSTNYLFRMMKYTPPPPHEEKKLG  187

Query  587   LNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRLHSP  411
             L SHTDKNI+TIL+Q +V GLE+ NKD +W  V PS   SFIVM+GDS+ A+ NGRL S 
Sbjct  188   LPSHTDKNIMTILHQYQVEGLEIQNKDKKWFKVKPSHQYSFIVMVGDSMCAFLNGRLAST  247

Query  410   YHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQ  231
             YHRV+++  + RYS  LFS PK G I+ +PEEL+DE+HP +F PF+  ++  FY +E G 
Sbjct  248   YHRVLVTAKKTRYSTALFSTPKTGVILDSPEELIDEEHPRVFKPFEFNDYRDFYNTEAGF  307

Query  230   KCQSALATYCGV  195
               QS L  +C +
Sbjct  308   AAQSTLHAFCAL  319



>ref|XP_002517544.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF44708.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=319

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 218/305 (71%), Gaps = 5/305 (2%)
 Frame = -1

Query  1109  PIIDFS--DENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             P++DFS  D  L  G P W+ V+ Q+ KA+ EYGCF+A + +IP+ L++ ++   KELFD
Sbjct  7     PVVDFSGLDMELPGGTPEWETVKFQIRKAMEEYGCFKALYRRIPLELQQEILHEAKELFD  66

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LPL TK++N S  P  GY+G+ P+ PLYES+GIDD N L   +  TN  WPQG P+F  S
Sbjct  67    LPLATKMQNVSKIPNGGYIGKSPLAPLYESIGIDDPNSLEKVESLTNAFWPQGKPSFSKS  126

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             + S+S+++S L   +RRMI+ESLGVEKYMDEHMNST Y LRV+KY  PE  +  +GL  H
Sbjct  127   MHSFSKQISELAKTIRRMIVESLGVEKYMDEHMNSTIYKLRVIKYDVPEDKEPMLGLAPH  186

Query  575   TDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVM  396
              D  ++TIL+QN V+GLE+  K G W+++N  PN+F+V+ G+S +AWTNGR+  PYHRV 
Sbjct  187   MDPGLITILFQNPVDGLEIQTKAGDWVSLNLCPNNFLVLAGESFHAWTNGRMRPPYHRVT  246

Query  395   MSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG---QKC  225
             M G+EARYS  LF+I K GYIIKAP+ELVDE+HPLL+ PFD +E L  + +  G   + C
Sbjct  247   MRGDEARYSVALFTIFKPGYIIKAPQELVDEEHPLLYRPFDFLEVLKRHQAGAGKNSENC  306

Query  224   QSALA  210
             Q+A A
Sbjct  307   QNAFA  311



>ref|XP_002298131.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
 gb|EEE82936.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
Length=313

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 225/315 (71%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS S  +LP+IDFS EN+KPG  +W      V  AL EYGCF A +DK+P+ L   +  
Sbjct  1     MGSLSPPELPVIDFSKENMKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVP-LYESMGIDDANLLHNTQHFTNIMWPQ  780
              LK+LFDLP++TK +N S+ P++GYVG  P +P LYE MGID+A  L  T+ F + MWP 
Sbjct  61    TLKDLFDLPIETKRKNVSDLPYYGYVGNQPFIPSLYEGMGIDNAITLEGTEDFADTMWPG  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +FC +V SYS  +S L+ MV RM+ ES GV ++ D H  ST YL R+MKY+GPE ++
Sbjct  121   GNDHFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGPEKNE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +G ++HTDK+ +T+L+QN+V+GLEV +KDGQW+   PSP+SFIVM G++L  W+N R+
Sbjct  181   ANVGCDAHTDKSFITVLHQNQVSGLEVKSKDGQWMGFKPSPSSFIVMAGEALLGWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             ++P+HRV+MS +E RYS GLFS  K   IIK PE+L+DE++PL F PF++   L ++++E
Sbjct  241   NAPFHRVVMSESEPRYSVGLFSFIKG--IIKVPEKLIDEKNPLRFKPFENFGLLRYFFTE  298

Query  239   EGQKCQSALATYCGV  195
             EG+  +S +  YCGV
Sbjct  299   EGRGKESTIKAYCGV  313



>gb|EYU41035.1| hypothetical protein MIMGU_mgv1a013300mg [Erythranthe guttata]
Length=224

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 189/224 (84%), Gaps = 0/224 (0%)
 Frame = -1

Query  866  MVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESL  687
            MVPLYES+GIDD     N + FTN+MW +GNP F  +VQS+S++LS LD ++R M++ESL
Sbjct  1    MVPLYESLGIDDVLSPGNIETFTNLMWSEGNPAFSQTVQSFSDQLSELDKIMRTMVVESL  60

Query  686  GVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKD  507
            G+EKY+DEH++ST YL+RV KY GP+ D+TK+GL+SHTDKN +TILYQN V+GLEVL KD
Sbjct  61   GLEKYVDEHIDSTKYLVRVQKYDGPQTDETKLGLSSHTDKNTMTILYQNTVSGLEVLTKD  120

Query  506  GQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIK  327
            GQWI   PSP+SFIVMIG+S +AWTNGRL+ PYHRVMM+G EARYS GLFS+PK+GYIIK
Sbjct  121  GQWITAQPSPDSFIVMIGESFHAWTNGRLYPPYHRVMMTGEEARYSIGLFSVPKSGYIIK  180

Query  326  APEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSALATYCGV  195
            APEELVDE+HPLLF P+DHV+FL FYY++ GQ  +SAL  YCGV
Sbjct  181  APEELVDEEHPLLFKPYDHVQFLDFYYTQAGQTSKSALKEYCGV  224



>emb|CDO98090.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 223/314 (71%), Gaps = 3/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS +  KLP IDFS E+LKPG   W K+R +V  AL EYGCF A+++KIP  L++++  
Sbjct  1     MGSLTLHKLPTIDFSKEDLKPGTTAWIKIRKEVMSALEEYGCFVASYEKIP-QLQDAVFG  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLP Q K++N S+KP HGYVGQ P+VPLYESMGIDDAN     Q FT  MWP G
Sbjct  60    ALEELFDLPSQIKMQNKSSKPMHGYVGQIPVVPLYESMGIDDANTSEGMQAFTYAMWPNG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  F   + +Y++  + L+++V RMI ES GVEKY D H+ S  YL RVMKY+  + ++T
Sbjct  120   NEGFSEKLLAYTKLAAELEEIVVRMIFESYGVEKYYDNHLQSVGYLSRVMKYREAKENET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
             K+G  SHTDK+ ++ ++QN+VNGLE+  KDG++ +V+ S +S +VM GD++ AW+N R+ 
Sbjct  180   KLGFVSHTDKSFMSTIHQNQVNGLEIKAKDGEYFSVDLSRSSVVVMAGDAIMAWSNNRIK  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+H+V+M G   RYS   FS       ++ PEELVD++HPL F PFDH+E+L F+  EE
Sbjct  240   SPHHQVIMEGKGPRYSIAQFSFMDG--TVQTPEELVDDEHPLQFKPFDHLEYLSFFSKEE  297

Query  236   GQKCQSALATYCGV  195
              ++ + AL TYCGV
Sbjct  298   NRRLECALKTYCGV  311



>gb|KFK30904.1| hypothetical protein AALP_AA6G041200 [Arabis alpina]
Length=316

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 225/313 (72%), Gaps = 10/313 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              I+LP+I FSD+ LKPG   WD+V++ V KAL +YGCFEA+FDK+ + L++S+ +A++EL
Sbjct  10    SIQLPVIHFSDKTLKPGSSEWDQVKSDVRKALEDYGCFEASFDKLSMELKKSVFEAMEEL  69

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             FDLP+Q K RN S+K  HGY+     + L+E +G+DDAN+L     FT  +WP  GN   
Sbjct  70    FDLPMQAKQRNVSSKRLHGYLN----MSLHEGLGVDDANVLEKVDEFTQQLWPDHGNKTI  125

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD---TK  594
               ++  +S++LS +D  VRRMILES G+EKY+DEH+NSTNYL R+MKY   + DD    K
Sbjct  126   SETLHKFSKQLSEVDATVRRMILESFGIEKYIDEHLNSTNYLFRMMKYTPADNDDGEEPK  185

Query  593   IGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHS  414
              GL +HTD N +TIL+Q +V+GLEVL KDG+WI V PS + F+VM+GD+L A  NGRL  
Sbjct  186   QGLRTHTDTNFITILHQYQVDGLEVLTKDGKWIQVKPSQDYFLVMLGDTLSALLNGRLSP  245

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
             P HRVM+S  + RYS  LFS+PK  +II +PEELVDE+HP  F PF + +++ F++SE G
Sbjct  246   PSHRVMVS--KKRYSTALFSVPKPEFIIDSPEELVDEEHPRRFKPFVYNDYIHFFHSEVG  303

Query  233   QKCQSALATYCGV  195
             ++ QSAL  +C +
Sbjct  304   RRAQSALHDFCAI  316



>ref|XP_009616143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=315

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 216/307 (70%), Gaps = 0/307 (0%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             KLPIIDF+ ENL+PG  +W KV  +   AL EYGCF A  DKI + +   +  AL+++FD
Sbjct  9     KLPIIDFTKENLEPGTNSWSKVCKEAVCALEEYGCFVALSDKISLKIHNEVFGALEKVFD  68

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP+QTK++N S KP +GYVGQ P +PLYESMGID+AN L   Q+FTN MW  GN  F  +
Sbjct  69    LPIQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWSSGNNAFSQA  128

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             + +YS+  + L++MV RM+ ES GVEK  + H+ S NYL RVMKYK  + ++ K+G  +H
Sbjct  129   LLAYSKAAAELEEMVVRMVFESYGVEKNYESHIKSVNYLARVMKYKEAQLEEPKLGFVAH  188

Query  575   TDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVM  396
             TDK+ ++ ++QN+VNGLE+  KDGQW  V  SP+S +VM GD++ AW+N R+ SP+HRVM
Sbjct  189   TDKSFMSTIHQNQVNGLEIKGKDGQWFGVELSPSSIVVMAGDAIMAWSNNRIKSPHHRVM  248

Query  395   MSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSA  216
             M G   RYS   FS  +   +++ P+E VDE+HPL F PF+H+++L F+  EE ++ + A
Sbjct  249   MEGKGERYSIAQFSFMEDTVMVETPKEFVDEEHPLKFKPFNHLDYLHFFSKEENRRLECA  308

Query  215   LATYCGV  195
             L TYCGV
Sbjct  309   LKTYCGV  315



>ref|XP_009339601.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=312

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 221/314 (70%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP+ID SDENLKP    W     ++  AL EYGCFEA + K+P+ L  S+  
Sbjct  1     MGSETQPKLPVIDLSDENLKPDTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A+++LF LPL+TK++ TS++P+H Y+GQY  +PLYES+ +D+   +  +Q FTNIMWPQG
Sbjct  61    AMEDLFGLPLETKMQKTSDRPYHSYIGQYSFLPLYESLAVDNPTTVDGSQGFTNIMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC +V S S+ ++ L  MV RM+ +  GV++  + HM ST Y LR +KY+ PE ++T
Sbjct  121   NDHFCETVHSISKLVAELSQMVTRMVFDVYGVQRLYNSHMESTTYQLRCLKYRTPEENET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL  HTDK  ++I+ QN+VNGL++  KDGQWI+VNPSP+SF+++ GD+  AW+N R+ 
Sbjct  181   NMGLQPHTDKTFISIVNQNQVNGLQIRTKDGQWIDVNPSPSSFLILAGDAFMAWSNDRVP  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  H+++M  N+ RYS GLFS  K+G II+ PEEL+DE+HPLL+ PFDH  FL F  + E
Sbjct  241   SCEHQIIMKENKTRYSLGLFSF-KSG-IIQVPEELIDEKHPLLYKPFDHFSFLDFGRTPE  298

Query  236   GQKCQSALATYCGV  195
              +     +  YCGV
Sbjct  299   ARNLLRTIKAYCGV  312



>ref|XP_011045368.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 222/315 (70%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S S  +LP+IDFS ENLKPG  +W      V  AL EYGCF A +DK+P+ L   +  
Sbjct  1     MDSLSPPELPVIDFSKENLKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVP-LYESMGIDDANLLHNTQHFTNIMWPQ  780
              LK+LFDLPL+TK +N S+ P++GYVG  P VP LYE MGID+A  L  T+ F + MWP 
Sbjct  61    TLKDLFDLPLETKRKNVSDLPYYGYVGNQPFVPSLYEGMGIDNAIALEGTEDFADTMWPG  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +FC +V SYS  +S L+ MV RM+ ES GV ++ D H  ST YL R+MKY+GPE ++
Sbjct  121   GNDHFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGPEKNE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +G ++HTDK+ +T+L+QN+V+GLEV +KDGQW+   PSP+SFIVM GD+L  W+N R+
Sbjct  181   ANVGCDAHTDKSFITVLHQNQVSGLEVKSKDGQWMGFKPSPSSFIVMAGDALLGWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             ++P+HRV+MS +E RYS GLFS  K   IIK PE+L+DE++PL F PF++   L ++ +E
Sbjct  241   NAPFHRVVMSESEPRYSVGLFSFIKG--IIKVPEKLIDEKNPLRFKPFENFGLLRYFITE  298

Query  239   EGQKCQSALATYCGV  195
             EG+  +  +  YCGV
Sbjct  299   EGRGKEFTIKAYCGV  313



>emb|CDY17969.1| BnaC03g30410D [Brassica napus]
Length=322

 Score =   343 bits (879),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/315 (53%), Positives = 220/315 (70%), Gaps = 10/315 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              I+LP+IDFSD+NL PG   WDKV+  V KAL +YGCFEA F K+   L +S+ +A++EL
Sbjct  12    SIQLPVIDFSDQNLTPGTSKWDKVKADVRKALEDYGCFEAFFHKVSSELDKSVFEAIEEL  71

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F LP+QTK RN S KP+HGY+ +     LYES+GIDDANL    + FT  +WP  GN   
Sbjct  72    FGLPIQTKERNVSAKPYHGYLNRN----LYESLGIDDANLAEKVKDFTQQLWPDHGNKRI  127

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPE--CDD--T  597
               ++   SEKL+ LD MVRRMILES G++KY++EH++STNYL R+MKY  P    DD  T
Sbjct  128   SETMHGVSEKLAELDVMVRRMILESFGIKKYINEHLDSTNYLFRMMKYTPPPPVVDDVET  187

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRL  420
             K+GL SHTDKNI+TIL+Q +V GLE+  KD +W  V PS   SFIVM+GDS+ A+ NGRL
Sbjct  188   KVGLPSHTDKNIMTILHQYQVEGLEIQTKDEKWFKVKPSHQYSFIVMVGDSMCAFLNGRL  247

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              S YHRV+M+  + RYS  LFS PK G I+ +P+EL+DE+HP +F PF+  ++  FY +E
Sbjct  248   SSTYHRVLMTAKKTRYSTALFSTPKTGVIVDSPQELIDEEHPRVFKPFEFNDYRDFYNTE  307

Query  239   EGQKCQSALATYCGV  195
              G   QS L  +C +
Sbjct  308   AGFAAQSTLHAFCAL  322



>ref|XP_007215723.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
 gb|EMJ16922.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
Length=312

 Score =   342 bits (877),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 212/314 (68%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP+ID S+ENLKPG   W      V  AL EYGCFEA F K+P+ L  S+  
Sbjct  1     MGSETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              +++LFDLP++TK + TS +P+H Y GQY  +PLYES+G+D+   +   + FT IMWP G
Sbjct  61    VVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAKGFTKIMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC S QS+S+ ++ LD MV RM+ +  GVE+  D HM ST YLLR  KY+  + ++T
Sbjct  121   NDHFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLLRCFKYREQKENET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL  H DK   +IL+Q++V+GL+V +KDGQWI   PSP+SF+VM GD+  AW+N R+ 
Sbjct  181   NVGLRPHKDKTFTSILHQSQVHGLQVRSKDGQWIEAEPSPSSFLVMAGDAFMAWSNDRVR  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  H+V+M  N+ RYS GLFS      I++ PEEL D+QHPLL+ PFDH  FL F  + E
Sbjct  241   SCDHQVIMKENKTRYSVGLFSFNSG--ILQVPEELTDDQHPLLYKPFDHFSFLRFDQTPE  298

Query  236   GQKCQSALATYCGV  195
              +K +  +  YCGV
Sbjct  299   AKKSECPIKAYCGV  312



>emb|CDY21937.1| BnaC09g00430D [Brassica napus]
Length=331

 Score =   342 bits (878),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 225/311 (72%), Gaps = 9/311 (3%)
 Frame = -1

Query  1106  IIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIP-IHLRESMIDALKELFDLP  930
             +IDFSD+NL PG   WD+V++ V KAL +YGCF+A  DK+  I L + + +A++ELFDLP
Sbjct  17    VIDFSDQNLAPGTSKWDEVKDDVRKALEDYGCFQAYVDKVSNIELNKPVFEAMEELFDLP  76

Query  929   LQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSV  753
             +QTK RN S+KP HGY+       LY+S+GI++AN      +FT  +WP  GN +   ++
Sbjct  77    VQTKQRNVSSKPLHGYLSH----NLYQSLGIEEANDAEKVNYFTQQLWPDHGNKSISETM  132

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD---TKIGLN  582
               +SE+   LD M RRMI+ES G+EKY+DEH+NST Y+LR+MKY     DD   TK+GL 
Sbjct  133   HKFSERSVELDVMARRMIMESFGIEKYLDEHLNSTYYVLRLMKYTSAPDDDVEETKLGLL  192

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             SHTDK+I TIL+Q EV+GLE+  KD +WI V PS + FI+M+GD L A +NGRL+SP HR
Sbjct  193   SHTDKSITTILHQYEVDGLEIKTKDEKWIKVKPSQHCFIIMVGDFLCALSNGRLYSPRHR  252

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V+M+ N+ RYS+ +FS+PK G II +PEELVDE+HP +F PF++ EF+ F++SE G+K +
Sbjct  253   VLMTANKTRYSSAMFSVPKPGVIIDSPEELVDEEHPRMFIPFEYNEFINFFHSEAGRKAE  312

Query  221   SALATYCGV*N  189
             SAL  +C + N
Sbjct  313   SALHAFCALCN  323



>ref|XP_006356186.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=317

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 223/310 (72%), Gaps = 4/310 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             KLP+IDF+ ENL+PG  +W K   +   AL EYGCF A +DK+ +++ + +  AL+ELFD
Sbjct  9     KLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSLNIHDDVFQALEELFD  68

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP Q KV+N S+KP +GYVGQ P +PLYESMGID+AN L   Q+FTN MWP G+ +F  +
Sbjct  69    LPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPNGHNDFSQA  128

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             + +YS+  + L++MV +M+ ES GVEKY + H+ S NYL RVMKY+  + ++ K+G  +H
Sbjct  129   LLAYSKASAELEEMVVKMVFESYGVEKYYESHVKSVNYLARVMKYREAQVEEAKLGFVAH  188

Query  575   TDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             TDK+ ++ ++Q N+VNGLE+  KDGQW  V  SP+S +VM GD++ AW+N R+ SP+HRV
Sbjct  189   TDKSFMSTIHQTNQVNGLEIKGKDGQWFGVELSPSSIVVMAGDAIMAWSNNRIKSPHHRV  248

Query  398   MMSGNE--ARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKC  225
             MM G E  ARYS   FS  +   +++ P+ELVDE+HPLLFN F+H+++L F+  EE ++ 
Sbjct  249   MM-GEEKGARYSIAQFSFMEDSLMVETPKELVDEEHPLLFNSFNHLDYLKFFSKEENRRL  307

Query  224   QSALATYCGV  195
             + AL +YCG 
Sbjct  308   ECALKSYCGA  317



>ref|XP_004241716.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
lycopersicum]
Length=317

 Score =   342 bits (877),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 221/310 (71%), Gaps = 4/310 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             KLP+IDF+ ENL+PG  +W K   +   AL EYGCF A +DK+   + + +  AL+ELFD
Sbjct  9     KLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSSKIHDDVFQALEELFD  68

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP Q KV+N S+KP +GYVGQ P +PLYESMGID+AN L   Q+FTN MWP GN +F  +
Sbjct  69    LPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPNGNNDFSEA  128

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             + +YS+  + L++MV +M+ ES GVEKY + H+ S NYL RVMKY+  + ++ K+G  +H
Sbjct  129   LLAYSKAAAELEEMVVKMVFESYGVEKYYESHIKSVNYLARVMKYREAQVEEAKLGFVAH  188

Query  575   TDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             TDK+ ++ ++Q N+VNGLE+  KDGQW  V  SP+S +VM GD++ AW+N R+ SP+HRV
Sbjct  189   TDKSFMSTIHQTNQVNGLEIKGKDGQWFKVELSPSSIVVMAGDAIMAWSNNRIKSPHHRV  248

Query  398   MMSGNE--ARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKC  225
             MM G E  ARYS   FS  +   +++ P+ELVD+ HPLLFN F+H+++L F+  EE ++ 
Sbjct  249   MM-GEEKGARYSIAQFSFMEDSLMVETPKELVDDDHPLLFNSFNHLDYLKFFSKEENRRL  307

Query  224   QSALATYCGV  195
             + AL +YCGV
Sbjct  308   ECALKSYCGV  317



>emb|CDP17011.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 222/314 (71%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS +  KLP+IDF+ +NL PG  +W   R  V  AL EYGCF A +DK+ + L E++  
Sbjct  1     MGSLAQHKLPVIDFTKKNLDPGSSSWLSTRQAVVGALEEYGCFIALYDKVSLELHEAIFR  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A ++LFDLP +TK+ NT +KP  GYVGQ P  PLYES+GIDDA  +   Q FT +MWP G
Sbjct  61    ASEDLFDLPTETKLLNTCHKPAPGYVGQNPRFPLYESLGIDDATSIDGVQKFTTLMWPNG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC S  SYS+ ++ LD MV RM+ E+ GVEK  +  + ST+YLLR++KY+ P+ ++T
Sbjct  121   NDSFCESASSYSKLVAELDQMVMRMVSETYGVEKSYETLLGSTSYLLRLIKYREPQENET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G+  HTDK+ ++IL Q++V GLE+  KDG+W+ ++P P+SFI+M G++  AWTNGR+ 
Sbjct  181   NLGIVPHTDKSFMSILQQHQVKGLEIKTKDGRWMEIDPFPSSFIIMAGEAFMAWTNGRIE  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             +P+HRV+M GN  RYS GLF+      +I+ PEELVD +HPL F PFDH +F  F+ +EE
Sbjct  241   APHHRVIMPGNAERYSVGLFTF-IWDLLIQVPEELVDVEHPLQFKPFDHHKFHQFHTTEE  299

Query  236   GQKCQSALATYCGV  195
             G + + A+ +YCGV
Sbjct  300   GMRSKCAIKSYCGV  313



>gb|KDP40826.1| hypothetical protein JCGZ_24825 [Jatropha curcas]
Length=317

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 227/316 (72%), Gaps = 3/316 (1%)
 Frame = -1

Query  1136  MGSESG-IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             M S +G + LP+IDFS+ +LKPG PTWD ++ QV KA  EYGC EA F+KIP  L++SM 
Sbjct  1     MSSNNGSVSLPVIDFSNSDLKPGNPTWDSLKFQVRKAAEEYGCCEALFNKIPQDLQKSMN  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQH-FTNIMWP  783
             +A +ELF LPL+TK  N S KPFHGY G     PL+ES  + + ++ +  +  FTN+++P
Sbjct  61    EASEELFQLPLETKQLNVSEKPFHGYFGSSSSSPLHESFSVVEPDIYNKVETTFTNLLYP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             +G       + S+SEK+  LD M+RRMI+ES GV KY+D+HMNST Y+LR+ KYK PE  
Sbjct  121   RGTIELSKILHSFSEKVLELDQMIRRMIVESFGVGKYLDDHMNSTYYILRLTKYKAPETT  180

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +   GL +HTDKNI++ILYQN+V GLE+  ++G WI +  SP+SF+++IG+SL AWTNGR
Sbjct  181   EKVTGLKAHTDKNIISILYQNQVEGLEIQTRNGYWIPIKFSPHSFLILIGESLNAWTNGR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             L+SPYHRVM+SGN+ R S   FS+PK GYIIKA EELVD+ HPLL+ PFD+ ++L    +
Sbjct  241   LYSPYHRVMVSGNKPRCSTLFFSVPKDGYIIKALEELVDKDHPLLYKPFDYSDYLKRRIA  300

Query  242   EEGQ-KCQSALATYCG  198
             E+ + + +  L  Y G
Sbjct  301   EDRKIQTEPPLKDYFG  316



>ref|XP_009122199.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=321

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 221/309 (72%), Gaps = 9/309 (3%)
 Frame = -1

Query  1106  IIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIP-IHLRESMIDALKELFDLP  930
             +IDFSD+NL PG   WD+V+  V KAL +YGCF+A   K+  I L +S+ +A++ELFDLP
Sbjct  17    VIDFSDQNLTPGTSKWDEVKADVRKALEDYGCFQAFVGKVSNIELTKSVFEAMEELFDLP  76

Query  929   LQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSV  753
             +QTK RN S+KPFHGY+       LY+S+GI++AN      +FT  +WP  GN +   ++
Sbjct  77    VQTKQRNVSSKPFHGYLSH----NLYQSLGIEEANDAEKVNYFTQQLWPDHGNKSISETM  132

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD---TKIGLN  582
               ++E+L  LD M RRM +ES G+EKY+DEH+NST Y+LR+MKY  P  DD   TK+GL 
Sbjct  133   HKFAERLVELDLMARRMTMESFGIEKYLDEHLNSTYYVLRMMKYTAPPDDDVEETKLGLL  192

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             SHTDK+I TIL+Q EV+GLE+  KD +WI V PS + FI+M+GD L A  NGRL+SP HR
Sbjct  193   SHTDKSITTILHQYEVDGLEIKTKDNKWIKVKPSQHCFIIMVGDFLCALLNGRLYSPNHR  252

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V+M+  + RYS  +F +PK G +I APEELVD++HP +F PF++ EF+ F++SE G+K +
Sbjct  253   VLMTAKKTRYSTAMFFVPKQGVVIDAPEELVDQEHPRMFKPFEYNEFINFFHSEAGRKAE  312

Query  221   SALATYCGV  195
             SAL  +C +
Sbjct  313   SALHAFCAL  321



>ref|XP_004302943.1| PREDICTED: gibberellin 20 oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 221/316 (70%), Gaps = 5/316 (2%)
 Frame = -1

Query  1136  MGSES--GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             MGS +    K+PI+D S EN+KPG   W     ++  AL EYGCFEA ++K+P+ L  S 
Sbjct  1     MGSHTQPAAKVPIVDLSKENVKPGTDAWLLASKEIKYALEEYGCFEAIYNKVPLELHNST  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
                L++LF+LPL+TK+++TS++P+H Y GQY  +PLYES+G+D+   +   Q FT+IMWP
Sbjct  61    FSVLQDLFNLPLETKMQSTSDRPYHSYFGQYSFLPLYESLGVDNPTKIEGVQRFTSIMWP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             +GN  FC S  SYS+ ++ LD+MV +M+ E+ GVE+  + HM ST YLLR   Y+ P+ D
Sbjct  121   EGNDKFCESAHSYSKLVAELDEMVTKMVFENYGVERLYESHMASTTYLLRCFYYREPQLD  180

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +T +GL+ HTDK  ++IL+Q+E+NGL++ +K+GQWI+V PSP+SFIVM GD+  AW+N R
Sbjct  181   ETDMGLHPHTDKTFISILHQDEINGLQIKSKEGQWIDVEPSPSSFIVMAGDAFMAWSNDR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             + S  H+V+M   + RYS GLF+      +++ P ELVDE+HPLL+ PFDH+ FL F  +
Sbjct  241   VRSCEHQVIMKEKKTRYSIGLFAF---NGVLQVPAELVDEKHPLLYKPFDHIGFLLFNKT  297

Query  242   EEGQKCQSALATYCGV  195
              EG K +  +  YCGV
Sbjct  298   PEGMKSKCPIKDYCGV  313



>emb|CDY22098.1| BnaA09g01270D [Brassica napus]
Length=321

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 221/309 (72%), Gaps = 9/309 (3%)
 Frame = -1

Query  1106  IIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIP-IHLRESMIDALKELFDLP  930
             +IDFSD+NL PG   WD+V+  V KAL +YGCF+A   K+  I L +S+ +A++ELFDLP
Sbjct  17    VIDFSDQNLTPGTSKWDEVKADVRKALEDYGCFQAFVGKVSNIELTKSVFEAMEELFDLP  76

Query  929   LQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSV  753
             +QTK RN S+KPFHGY+       LY+S+GI++AN      +FT  +WP  GN +   ++
Sbjct  77    VQTKQRNVSSKPFHGYLSH----NLYQSLGIEEANDAEKVNYFTQQLWPDHGNKSISETM  132

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD---TKIGLN  582
               +SE+L  LD M RRMI+ES G+EKY+ EH+NST Y+LR+MKY  P  DD   TK+GL 
Sbjct  133   HKFSERLVELDVMARRMIMESFGIEKYLGEHLNSTYYVLRMMKYTSPPDDDVEETKLGLL  192

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             SHTDK+I TIL+Q EV+GLE+  KD +WI V PS + FI+M+GD L A  NGRL+SP HR
Sbjct  193   SHTDKSITTILHQYEVDGLEIKTKDNKWIKVKPSQHCFIIMVGDFLCALLNGRLYSPNHR  252

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V+M+  + RYS  +F +PK G +I APEELVD++HP +F PF++ EF+ F++SE G+K +
Sbjct  253   VLMTAKKTRYSTAMFFVPKQGVVIDAPEELVDQEHPRMFKPFEYNEFINFFHSEAGRKAE  312

Query  221   SALATYCGV  195
             SAL  +C +
Sbjct  313   SALHAFCAL  321



>ref|XP_002298127.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE82932.1| oxidoreductase family protein [Populus trichocarpa]
Length=313

 Score =   340 bits (871),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 220/315 (70%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGS-ESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             MGS E   KLPI+DF+ E+LKPG  +W K  + V  AL EYGCF   ++++P+ LR+ + 
Sbjct  1     MGSNELPSKLPILDFAKEDLKPGTSSWLKACSDVRLALEEYGCFVVEYNRLPLELRDKVF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
               LKELFDLP +TK++N   KP +GYVGQ   +PL+ESMGID+A  L  TQ+FT++MWP 
Sbjct  61    GVLKELFDLPTETKMQNKYEKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPN  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN  FC  V  Y+   + LD MV RM+ ES GVEKY D ++ ST YLLR++K + P+ D+
Sbjct  121   GNDRFCECVLKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +G  +HTDK+  TIL+QNE+NGLEV  KDG+ INV  SP+SF+V+ GD+L AW+N R+
Sbjct  181   HNLGFVTHTDKSFTTILHQNEINGLEVDTKDGKKINVELSPSSFVVIAGDALMAWSNDRV  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+M+G   RYS  LF+  K   I++ PEELVDE+HPL++ P DH+  L FY +E
Sbjct  241   ISPSHRVIMNGKIDRYSLALFAFNKG--ILQVPEELVDEEHPLMYKPLDHIGLLHFYRTE  298

Query  239   EGQKCQSALATYCGV  195
             EG K +  +  YCGV
Sbjct  299   EGYKSKCPIKAYCGV  313



>ref|XP_011045371.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 219/315 (70%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGS-ESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             MGS E   KLPI+DF+ E+LKPG  +W K  + V  AL EYGCF   ++++P+ LR+ + 
Sbjct  1     MGSNELPSKLPILDFAKEDLKPGTSSWLKACSDVTLALEEYGCFVVEYNRLPLELRDKVF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
               LKELFDLP +TK++N   KP +GYVGQ   +PL+ESMGID+A  L  TQ+FT++MWP 
Sbjct  61    GVLKELFDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPN  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN  FC  V  Y+   + LD MV RM+ ES GVEKY D ++ ST YLLR++K + P+ D+
Sbjct  121   GNDRFCEYVFKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +G  +HTDK+  TIL+QNE+NGLEV  KDG+ INV  SP+SF+V+ GD+L AW+N R+
Sbjct  181   HNLGFITHTDKSFTTILHQNEINGLEVDTKDGKKINVELSPSSFVVIAGDALMAWSNDRV  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+M+G   RYS  LF+  K   II+ PEELVDE+HPL++ P DH   L FY +E
Sbjct  241   ISPSHRVIMNGKRDRYSLALFAFNKG--IIQVPEELVDEEHPLMYKPLDHTGLLHFYRTE  298

Query  239   EGQKCQSALATYCGV  195
             EG K +  +  YCGV
Sbjct  299   EGYKSKCPIKAYCGV  313



>ref|XP_002517546.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44710.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=321

 Score =   340 bits (871),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 218/316 (69%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS    K+P+IDFS ENLKPG  +W      V +AL EYGCF A ++KIP+ L+ S  +
Sbjct  1     MGSRIPPKIPVIDFSQENLKPGTSSWVSTCKNVLRALEEYGCFIAVYEKIPLELQSSFYN  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVP-LYESMGIDDANLLHNTQHFTNIMWPQ  780
              L  LFDLP+ TK +N S  P++GYVG  P VP LYE MGI++A  +  T  FTNIMWP 
Sbjct  61    KLITLFDLPIDTKRKNVSAIPYYGYVGNQPFVPPLYEGMGINNAATMEGTLDFTNIMWPN  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             G+ +FC +V SYS+ ++ L+ MV RM+ E  GV+   D     TNYL R+MKY+ P   +
Sbjct  121   GDDDFCKTVFSYSKWVAELEQMVTRMVFEGYGVQYSYDTQQERTNYLFRMMKYRAPTEGE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGR  423
             + +G + HTDK  +T+L+QNEV+GLEV  KDGQW+   P SP+SFIVM  D+L AW+NGR
Sbjct  181   SDLGCDVHTDKGFITVLHQNEVSGLEVQTKDGQWVCFEPSSPSSFIVMAADALLAWSNGR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             +H+ +HRV+M G++ARYS GLFS  K   I + PEEL+DE+HPL F PFD+   L ++Y+
Sbjct  241   IHAAFHRVVMRGSKARYSVGLFSYLKG--ITEVPEELIDEEHPLQFKPFDNFGLLHYFYT  298

Query  242   EEGQKCQSALATYCGV  195
             EEG++ +S +  YCG+
Sbjct  299   EEGREKESTVKAYCGL  314



>ref|XP_006465516.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
 ref|XP_006495319.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
Length=315

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 224/317 (71%), Gaps = 5/317 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS S  KLP+++ S ENLKPG  +W     +V +AL E+GCF A +D++ + L  ++  
Sbjct  1     MGSLSVPKLPVVNLSKENLKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVP-LYESMGIDDANLLHNTQHFTNIMWPQ  780
             A +ELF+LP++ K +N S KP++GY+G  P+VP +YE MG+D AN +  TQ+FTN++WP+
Sbjct  61    AAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWPE  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN NFC +V SYS  +S L+ MV+RM+ ES GV++Y D  + S+ YLLR+MKY+ PE ++
Sbjct  121   GNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDQYYDSVLESSTYLLRIMKYRCPETNE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGR  423
               +G + HTDK+ +T+L+QNEVN LE+  KDG WI  N P+P+SFIV+ GD+  AW+NGR
Sbjct  181   NNLGCDVHTDKSFITVLHQNEVNVLEIRTKDGCWIGFNDPTPSSFIVLAGDAFLAWSNGR  240

Query  422   LHSPYHRVMMSG-NEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             +HSP HRV+++G  +ARYS GLF+      II+ PEELVD++HPL F  F+H   L +Y 
Sbjct  241   IHSPVHRVILNGIKQARYSLGLFTYNDG--IIQIPEELVDDEHPLKFKSFEHFGLLRYYL  298

Query  245   SEEGQKCQSALATYCGV  195
              EEGQK +     YC V
Sbjct  299   KEEGQKAECTAKAYCCV  315



>ref|XP_006427128.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
 gb|ESR40368.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
Length=338

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 230/332 (69%), Gaps = 7/332 (2%)
 Frame = -1

Query  1181  ITQFNQKAKELKERKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEA  1002
             IT     AK+L+ +  G E   KLP+++ S EN KPG  +W     +V +AL E+GCF A
Sbjct  11    ITPLLPIAKDLQAK--GLEVFPKLPVVNLSKENFKPGASSWLGTSRKVREALEEFGCFVA  68

Query  1001  TFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVP-LYESMGIDDAN  825
              +D++ + L  ++  A +ELF+LP++ K +N S KP++GY+G  P+VP +YE MG+D AN
Sbjct  69    LYDEVSLELHNAIFSAAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYAN  128

Query  824   LLHNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTN  645
              +  TQ+FTN++WP+GN NFC +V SYS  +S L+ MV+RM+ ES GV+KY D  + S+ 
Sbjct  129   TIEGTQNFTNLIWPEGNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESST  188

Query  644   YLLRVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINV-NPSPNSF  468
             YLLR+MKY+ PE ++  +G + HTDK+ +T+L+QNEVNGLE+  KDG WI   +P+P+SF
Sbjct  189   YLLRIMKYRCPETNEKNLGCDVHTDKSFITVLHQNEVNGLEIRTKDGCWIGFDDPTPSSF  248

Query  467   IVMIGDSLYAWTNGRLHSPYHRVMMSG-NEARYSAGLFSIPKAGYIIKAPEELVDEQHPL  291
             IV+ GD+  AW+N R+HSP HRV+++G  +ARYS GLF+      II+ PEELVD++HPL
Sbjct  249   IVLAGDAFLAWSNSRIHSPVHRVILNGIKQARYSLGLFTFNDG--IIQIPEELVDDEHPL  306

Query  290   LFNPFDHVEFLGFYYSEEGQKCQSALATYCGV  195
              F  F+H   L +Y +EEGQK +     YC V
Sbjct  307   KFKSFEHFGLLRYYLTEEGQKAECTAKAYCSV  338



>ref|XP_008228621.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=312

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 211/314 (67%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLP+ID S+ENLKPG   W      V  AL EYGCFEA F K+P+ L  S+  
Sbjct  1     MGSETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              +++LFDLP++TK + TS +P+H Y GQY  +PLYES+G+D+   +   Q FT IMWP G
Sbjct  61    VVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTKIMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC S QS+S+ ++ LD MV RM+ +  GVE+  D HM ST YL R  KY+  + ++T
Sbjct  121   NDHFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLFRCFKYREQKENET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL  H DK   +IL+Q++V+GL+V +KD QWI+  PSP+SF+VM GD+  AW+N R+ 
Sbjct  181   NVGLRPHKDKTFTSILHQSQVHGLQVRSKDCQWIDAEPSPSSFLVMAGDAFMAWSNDRVR  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  H+V+M  N+ RYS GLFS      I++ PEEL D+QHPLL+ PFDH  FL F  + E
Sbjct  241   SCDHQVIMKENKTRYSLGLFSFNSG--ILEVPEELTDDQHPLLYKPFDHFGFLRFDQTPE  298

Query  236   GQKCQSALATYCGV  195
              +K +  +  YCGV
Sbjct  299   AKKSECPIKAYCGV  312



>ref|XP_002517543.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF44707.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=322

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 229/322 (71%), Gaps = 8/322 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPT--WDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             M  ++ + +P+IDFS  +L P   T  W+ VR QV KAL E+GCF+A+ +KI + LR+++
Sbjct  1     MSPKTYLAVPVIDFSRLDLNPDNNTEEWESVRTQVVKALEEHGCFKASSNKISLELRQAI  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
             +  L+ELF LPL+ K+RNTS  P  GY+G+ P  PL+ES+GI D   L N +  TN++WP
Sbjct  61    LSDLEELFALPLENKMRNTSELPNCGYIGKSPFTPLHESLGIIDPITLENVESLTNVLWP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
              G P+F  ++QSYS+++  ++ ++RRMILE+LGV+KY+DEHMNST   LRVM+Y+ P   
Sbjct  121   GGKPSFSENIQSYSKQILEVEKIIRRMILENLGVDKYLDEHMNSTASSLRVMRYEAPNTT  180

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +T++GL +HTD+ I+ ILYQN+++GLEV  K+G+W N+   P+ F+V+ G+S  AW NGR
Sbjct  181   ETQLGLAAHTDQGIIAILYQNQIDGLEVETKNGEWANIKLEPDHFLVIFGESFNAWVNGR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             L++P+HRV M GNE RYS G FS  K GY+IKAPEELVDE+HPL + PFD +E L  + +
Sbjct  241   LYAPFHRVTMIGNEVRYSFGTFSAFKPGYLIKAPEELVDEEHPLQYRPFDFIEVLNRHQA  300

Query  242   E---EGQKCQSALA---TYCGV  195
             +      K ++A+A    Y GV
Sbjct  301   QVQKSSDKVETAIAPLKAYYGV  322



>gb|KHG07058.1| hypothetical protein F383_33647 [Gossypium arboreum]
Length=325

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 225/328 (69%), Gaps = 17/328 (5%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S +   +P+IDFS++NLKPG P WD V++QV +AL EYGCFEA FD I + LR+++  
Sbjct  1     MSSTTPAMVPVIDFSNQNLKPGSPEWDLVKSQVREALGEYGCFEALFDPI-LDLRKAVFG  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNT-QHFTNIMWPQ  780
             AL+E FDLPLQTK    S+KPF GY    P    ++S+ ++DA +  N  Q  TN +WPQ
Sbjct  60    ALQETFDLPLQTKKLCVSDKPFRGYFN--PSSGPFQSLAMEDAQIAENIEQCLTNTLWPQ  117

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +F  ++ S+++  S L   + +MILES G+EKYMDE +++ +Y LR+MKY+ P+ +D
Sbjct  118   GNISFSKTLASFTQLASELQKKILKMILESFGLEKYMDELIDAVSYELRIMKYEKPKTND  177

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             +   L +H D N +T+LYQNEVNGL++ +KDG+WIN+ PSPNSFIV+IG+SL  W NGRL
Sbjct  178   STHVLAAHCDSNTMTLLYQNEVNGLQIQSKDGEWINMKPSPNSFIVLIGESLSVWLNGRL  237

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+M GNE RYS GLF+ P+ GY++K P ELVD+ +P+LF P D+ EFL FYYSE
Sbjct  238   PSPSHRVIMKGNEDRYSLGLFTRPREGYVVKVPNELVDDNNPILFKPHDYEEFLKFYYSE  297

Query  239   --------EGQKCQSA-----LATYCGV  195
                      G   QS      L  YC V
Sbjct  298   ITQAAVKSGGSAVQSEGYITRLKAYCSV  325



>gb|KHG05318.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=314

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 223/317 (70%), Gaps = 6/317 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S +G K+P+IDFS++NLKP  P WD ++ QV +AL EYGCFEA+FD++ + LR+ +++
Sbjct  1     MSSRTGAKVPVIDFSNQNLKPSSPEWDLLKFQVREALEEYGCFEASFDQL-LELRQPVLE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNT-QHFTNIMWPQ  780
             ALK+LFDLP QTK    S+KP   Y G      LY+S+  DDA++  N  Q  T  +WPQ
Sbjct  60    ALKQLFDLPFQTKQLCVSDKPLRAYHGSQSR--LYDSISTDDAHIAENIEQCLTTTLWPQ  117

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +FC ++ S+++   GL+  + RMILES G+EKYMDE ++ TN  LR MKY  P   +
Sbjct  118   GNISFCKTLASFTQLALGLEKTILRMILESFGLEKYMDELVDLTNNHLRAMKYGRPNTSE  177

Query  599   TKIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
               +G+  H D  I+T+L Q NEV GLE+ NK+G+W+N+NPSPNSF+VM+G+S   W NGR
Sbjct  178   PTLGIPQHCDNTILTLLSQLNEVQGLEIQNKNGEWMNLNPSPNSFVVMLGESFSIWLNGR  237

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             L S YHRV+M GNEARYS GLF+ P+ GY++K P+ELVD+++P+LF PFD  EFL  Y  
Sbjct  238   LSSCYHRVLMEGNEARYSIGLFARPRGGYLVKVPKELVDDKNPMLFKPFDLEEFLKTYSP  297

Query  242   EEGQ-KCQSALATYCGV  195
             +  Q + +SAL  YC V
Sbjct  298   QIVQERGKSALIAYCSV  314



>ref|XP_007024003.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
 gb|EOY26625.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
Length=313

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 218/315 (69%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSES   +P +DFSDE+LKPG  TW     +V +AL EYGCF   ++K P+ L   +  
Sbjct  1     MGSESSPNVPFLDFSDEDLKPGTDTWLLACKKVRQALEEYGCFILEYNKFPLELHNQVFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              L+ELFDLP +TK++N   KP +GYVGQ P +PL+ESMGID+AN L  T+ FTN+MWPQG
Sbjct  61    VLEELFDLPTETKMKNRYEKPLNGYVGQIPKLPLHESMGIDNANTLEGTRFFTNLMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC  +  Y++  + LD MV RMI ES G++KY D ++++T YLLR++K + P  ++ 
Sbjct  121   NDRFCEYIYKYAKVAAELDQMVTRMIFESYGLDKYSDAYIDTTTYLLRLLKNRAPRENEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRL  420
              +G  +HTDK+  TIL+QN+VN LEV  +DG WI+V+  SP+SF+V+ GD+L AW+N R+
Sbjct  181   NLGFITHTDKSFTTILHQNQVNALEVETRDGTWIDVDFSSPSSFVVIAGDALMAWSNDRV  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+M GN  RYS GLF+       I+ PEELVDE+HPL +  F+H+  L FY ++
Sbjct  241   LSPSHRVVMRGNMDRYSLGLFAFNSG--TIQVPEELVDEEHPLKYKAFEHLGLLRFYRTD  298

Query  239   EGQKCQSALATYCGV  195
             +G K +  +  YCGV
Sbjct  299   KGYKSKCPIKAYCGV  313



>ref|XP_010110313.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25833.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 215/309 (70%), Gaps = 6/309 (2%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             K+P IDFS+ NL PG  +W  V N V +AL EYGCF A +DKI   LR SM   LKELFD
Sbjct  8     KIPTIDFSEGNLNPGTSSWFSVCNDVRRALEEYGCFVALYDKISQQLRTSMFSELKELFD  67

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVP-LYESMGIDDANLLHNTQHFTNIMWPQG-NPNFC  762
             LP + K++N S+KP+ GY+G +P +P L+ESMGI++A  L   + FTNI+WP+G N +FC
Sbjct  68    LPTEIKMKNVSDKPYFGYIGNHPSIPPLHESMGIENATTLEGGESFTNIIWPKGGNNHFC  127

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLN  582
              +V SYS  +S L+ MV+RM+ +S GVEKY D H+ ST +LL+++KY+ PE +++ IG  
Sbjct  128   ETVVSYSRLVSELEKMVKRMVFQSYGVEKYYDSHLGSTTFLLKLIKYRVPEMNESSIGCA  187

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
              HTDK+ +T+L+QNEVNGLE+  +DG WI   PSP+SF+V+ GD+  AWTNGR+HS  HR
Sbjct  188   PHTDKSFITVLHQNEVNGLEIETRDGDWIQFEPSPSSFLVLAGDAFLAWTNGRIHSAAHR  247

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V+M+G + RYS GLFS       I+ P+ELVDEQHP  F  FDH   L  Y++    K +
Sbjct  248   VVMTGTKPRYSIGLFSYHNG--TIEIPDELVDEQHPQQFKSFDHYGLLHHYHA--APKIE  303

Query  221   SALATYCGV  195
             S    YCGV
Sbjct  304   STAKDYCGV  312



>gb|AAL14685.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=285

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 213/289 (74%), Gaps = 9/289 (3%)
 Frame = -1

Query  1082  LKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTS  903
             LKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S
Sbjct  1     LKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVS  60

Query  902   NKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSG  726
             +KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L  
Sbjct  61    SKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVE  116

Query  725   LDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----TKIGLNSHTDKNIV  558
             LD MVRRMI+ES G+EKY+DEH+NST YL R+MKY  P  DD    TK+GL SHTDKNI+
Sbjct  117   LDLMVRRMIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEETKLGLRSHTDKNII  176

Query  557   TILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEA  378
             TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + 
Sbjct  177   TILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKT  236

Query  377   RYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQ  231
             RYS GLFSIPK G II +PEELVD++HP +F PF++ +FL F+ +E G+
Sbjct  237   RYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDFLHFFQTEAGR  285



>gb|KGN52785.1| hypothetical protein Csa_4G001530 [Cucumis sativus]
Length=238

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 193/236 (82%), Gaps = 4/236 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SES +KLP+IDFS  NL+ G P W+  + QV +AL E+GCFEA+FDK+P+ +R+ + +
Sbjct  1     MDSESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPVEVRKGLFE  58

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELF+LPL+TK+RN S KPFHGYVGQYPM PL+ESMG+DD+ +    Q FTNI+WPQG
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD-D  600
             NP F   +++YS++L+ LD+MVRRM+LESLGVEKY++EH+ STNYLLRVMKYKG E + +
Sbjct  119   NPTFSKVMETYSQQLAELDEMVRRMVLESLGVEKYLEEHLESTNYLLRVMKYKGTESNYE  178

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSL-YAW  435
             TKIGL+SHTDKNIVTILYQN V GL+V  KDG+WIN  PSP+SF+ MIGDS  + W
Sbjct  179   TKIGLHSHTDKNIVTILYQNHVQGLQVKTKDGKWINFQPSPDSFVAMIGDSFHFGW  234



>gb|KHG17593.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=314

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 222/317 (70%), Gaps = 6/317 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S +  K+P+IDFS++NLKP  P WD ++ QV +AL +Y CFEA+FD++ + LR+ +++
Sbjct  1     MSSRTRAKVPVIDFSNQNLKPSSPEWDLLKFQVREALEDYSCFEASFDQL-LELRQPVLE  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNT-QHFTNIMWPQ  780
             AL++LFDLP QTK    S+KPF  Y G+     LYESM  DDA+++ N  Q  T  +WPQ
Sbjct  60    ALEQLFDLPSQTKQLCVSDKPFRAYSGRPSR--LYESMSTDDAHIVENIEQCLTTTLWPQ  117

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +F  ++ S+++  SGL+  + RMILES G+EKYMDE ++STN  LR MKY      +
Sbjct  118   GNISFSKTLASFTQLASGLEKTILRMILESFGLEKYMDEIVDSTNNHLRAMKYGRTNTSE  177

Query  599   TKIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
               +G+ +H D   +T+L Q NEV GLE+ NK+G+WIN+NPSPNSF+VM+G+S   W NGR
Sbjct  178   PTLGVPAHCDHTTMTLLCQLNEVQGLEIQNKNGEWININPSPNSFVVMLGESFSVWLNGR  237

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             L S YHRVMM GNEARYS GLF+ P+ GY++K P+ELVD+++P+LF PFD  EFL  Y  
Sbjct  238   LPSAYHRVMMKGNEARYSIGLFARPRGGYLVKVPKELVDDKNPMLFKPFDLEEFLKIYSP  297

Query  242   EEGQ-KCQSALATYCGV  195
             +  Q   +S L  YC V
Sbjct  298   QAVQGATKSTLKAYCSV  314



>ref|XP_002517548.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44712.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=313

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 217/315 (69%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKI-PIHLRESMI  960
             MGS +  KLP++DF+ ENLKPG   W K   +V +AL EYGCF   ++ I    LR+ + 
Sbjct  1     MGSAAQPKLPVLDFTLENLKPGTSCWAKACGEVRQALEEYGCFIVEYNNILSPKLRDGVF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
             ++LKELFDLP +TK++N   KP +GYVGQ   +PL+ESMGID+A  L  TQ FT +MWP 
Sbjct  61    NSLKELFDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATCLEATQDFTTLMWPD  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN NFC  V  Y++  + +D MV RMI ES G EKY D ++ STNYLLR++K + P+ D+
Sbjct  121   GNDNFCECVYEYAKLTAEIDQMVTRMIFESYGAEKYHDSYVESTNYLLRLLKNRLPKGDE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +G  +HTDK+  TIL+QN +NGLEV  KDGQ IN+  SP+SF+V+ GD+L  W+N R+
Sbjct  181   PNLGFITHTDKSFTTILHQNHINGLEVDTKDGQKINIEFSPSSFVVIAGDALMVWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+++G E RYS GLF+      II+ PEEL+D+ HPL++ P DH+  L FY ++
Sbjct  241   ISPSHRVIINGKEDRYSMGLFAFNSG--IIRVPEELIDKDHPLMYKPLDHIGLLYFYRTD  298

Query  239   EGQKCQSALATYCGV  195
             EG K +  +  +CGV
Sbjct  299   EGYKSKCPVKAFCGV  313



>ref|XP_010047771.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW79750.1| hypothetical protein EUGRSUZ_C01096 [Eucalyptus grandis]
Length=313

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 212/315 (67%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MG+ S  KLP+IDF   ++KPG   WD V+ +V KAL EYGCFEA +DKI + L + +  
Sbjct  1     MGALSPPKLPLIDFCKNDMKPGSADWDSVQREVVKALEEYGCFEARYDKISVELHDEVFR  60

Query  956   ALKELFDLPLQTK-VRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
              +++LF+LP +TK +     KP+ GY+   P + LYE++GI         Q   N+MWPQ
Sbjct  61    QVEDLFNLPAKTKRLFVDPRKPYDGYITNLPNLSLYEAIGISGMLDSGGIQKLANLMWPQ  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GNP FC ++ SY+ +LS L+ ++ RM+ +SLGVEKY+D H  S N+ +R M+YK P   +
Sbjct  121   GNPKFCETLTSYAMRLSELESLITRMVFQSLGVEKYLDSHTKSLNHSIRAMRYKSPMTQE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              ++G +SH DKN +TIL QN VNGLEV  KDG+W  V PS ++ +VM+G+SL  W+NGRL
Sbjct  181   PQVGASSHCDKNFLTILQQNHVNGLEVQTKDGRWSPVAPSASTLVVMVGESLLGWSNGRL  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H P H+VMMSGNE RYS G FS  +   +I+ P ELVDEQHPLLF PFD V  L F  +E
Sbjct  241   HCPRHQVMMSGNETRYSIGSFSAIRG--VIECPCELVDEQHPLLFKPFDEVGLLRFSLTE  298

Query  239   EGQKCQSALATYCGV  195
             +G + +S L  YCGV
Sbjct  299   QGHEAESTLKAYCGV  313



>gb|AAL14696.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAL14697.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=278

 Score =   330 bits (847),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 208/282 (74%), Gaps = 10/282 (4%)
 Frame = -1

Query  1088  ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRN  909
             +NLKPG   WD+V+  V KAL +YGCFEA FDK+ + L  S+ +A+++LF+LP+ TK RN
Sbjct  1     QNLKPGSSKWDEVKADVLKALEDYGCFEAFFDKLSVELNRSVFEAMEDLFELPIPTKQRN  60

Query  908   TSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKL  732
              S+KPFHGY+       LYES+GIDDAN+L     FT  +WP  GN +   ++  +SE+L
Sbjct  61    VSSKPFHGYLCH----NLYESLGIDDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQL  116

Query  731   SGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----ECDDTKIGLNSHTDK  567
               LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P     + ++TK+GL SHTDK
Sbjct  117   VELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDEETKLGLRSHTDK  176

Query  566   NIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSG  387
             NI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G
Sbjct  177   NIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTG  236

Query  386   NEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
              + RYS GLFSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  237   KKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  278



>ref|XP_007024008.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
 gb|EOY26630.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
Length=312

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 208/314 (66%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MG +S  KLP+IDFS+ NL PG  TW    N V +AL E GCFEA FDK+P+ L +++  
Sbjct  1     MGLQSQFKLPVIDFSEGNLNPGTSTWVSACNDVRQALEEQGCFEARFDKVPLQLHDTVFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
                ELFDLP + K+RNTSNKP+  Y GQY  +PLYES+ +D+      TQ FTN+MWP G
Sbjct  61    TAAELFDLPTELKMRNTSNKPYFDYFGQYRSLPLYESLAMDNPTTHSGTQSFTNLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  F  S QS+SE ++ LD  V RM+ ES GV  Y D ++ STNYLLR  KY+ PE +++
Sbjct  121   NDRFRESAQSFSELVAELDRTVMRMLFESYGVGNYYDYYIKSTNYLLRFYKYRKPEMNES  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
               GL  HTD+ +++I++Q  ++GL+V  KDGQW+ V PSP SF VM GD+L AW+N R+ 
Sbjct  181   DTGLPPHTDRTLLSIIHQGRISGLQVKLKDGQWVGVQPSPTSFAVMAGDALMAWSNDRIP  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
               YH+V M   E RYS G+FS      II   EELVDE HPL +  FDH +FL F  S+E
Sbjct  241   PCYHQVTMKEKETRYSIGMFSFISG--IIHILEELVDETHPLKYKSFDHFQFLHFDRSDE  298

Query  236   GQKCQSALATYCGV  195
             G+K + ++  +CGV
Sbjct  299   GKKSKCSIKAFCGV  312



>gb|AAL14702.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=279

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 208/283 (73%), Gaps = 11/283 (4%)
 Frame = -1

Query  1088  ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRN  909
             +NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN
Sbjct  1     QNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRN  60

Query  908   TSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKL  732
              S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L
Sbjct  61    VSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQL  116

Query  731   SGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECDDTKIGLNSHTD  570
               LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P      + ++TK+GL SHTD
Sbjct  117   VELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDEETKLGLRSHTD  176

Query  569   KNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMS  390
             KNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+
Sbjct  177   KNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMT  236

Query  389   GNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             G + RYS GLFSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  237   GKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  279



>gb|AAL14700.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=276

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 206/280 (74%), Gaps = 10/280 (4%)
 Frame = -1

Query  1088  ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRN  909
             +NLKPG   WD+V+  V KAL +YGCFEA FDK+ + L  S+ +A+++LF+LP+ TK RN
Sbjct  1     QNLKPGSSKWDEVKADVLKALEDYGCFEAFFDKLSVELNRSVFEAMEDLFELPIPTKQRN  60

Query  908   TSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKL  732
              S+KPFHGY+       LYES+GIDDAN+L     FT  +WP  GN +   ++  +SE+L
Sbjct  61    VSSKPFHGYLCH----NLYESLGIDDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQL  116

Query  731   SGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----ECDDTKIGLNSHTDK  567
               LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P     + ++TK+GL SHTDK
Sbjct  117   VELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDEETKLGLRSHTDK  176

Query  566   NIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSG  387
             NI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G
Sbjct  177   NIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTG  236

Query  386   NEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHV  267
              + RYS GLFSIPK G II +PEELVD++HP +F PF++ 
Sbjct  237   KKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYT  276



>ref|XP_006339306.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=310

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 220/312 (71%), Gaps = 6/312 (2%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             +K+P IDF    LKPG   WD  ++QV +AL EYGCFEAT+DK+     E+M    KE+F
Sbjct  1     MKVPTIDFCKPELKPGTIQWDSTKSQVFQALQEYGCFEATYDKLRNETLEAMFGRSKEIF  60

Query  938   DLPLQTKVRNTSNK-PFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFC  762
             + PL+TK++N S K PF+GY+G+ P +PLYES+ IDD   L   + F NI WP+GNP   
Sbjct  61    EFPLETKMKNLSKKLPFNGYIGKLPTLPLYESVCIDDLLQLEIVETFANIFWPEGNP--Y  118

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD--TKIG  588
               V+SYS+ L  LD+MV+RM+LESLG++ Y+DE ++ T++LLR+ KY   + +D   K+G
Sbjct  119   KVVKSYSKPLVELDEMVKRMVLESLGLQNYIDEFLDLTSFLLRLTKYNATQDEDMGNKLG  178

Query  587   LNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPY  408
             +  HTD N +TI+ QN+VNGL++L K+G+WI+V+ S NSF+V+ GDS  AWTNGRLHSP 
Sbjct  179   IGDHTDGNFLTIISQNQVNGLQILKKNGEWIDVDISSNSFVVLSGDSFMAWTNGRLHSPL  238

Query  407   HRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQK  228
             HRV M+G   R+S  LF+ PK    IKAP+ELVDE+HPLLF P+D + +  F+ +E G++
Sbjct  239   HRVTMAGENDRFSIQLFADPKTDCTIKAPKELVDEEHPLLFKPYDMLGYFEFFGTEAGRE  298

Query  227   C-QSALATYCGV  195
                + L  YCGV
Sbjct  299   AGPNVLKAYCGV  310



>gb|AAL14684.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=276

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/280 (57%), Positives = 207/280 (74%), Gaps = 9/280 (3%)
 Frame = -1

Query  1085  NLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNT  906
             NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN 
Sbjct  1     NLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNV  60

Query  905   SNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLS  729
             S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L 
Sbjct  61    SSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLV  116

Query  728   GLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----TKIGLNSHTDKNI  561
              LD MVRRMI+ES G+EKY+DEH+NST YL R+MKY  P  DD    TK+GL SHTDKNI
Sbjct  117   ELDLMVRRMIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEETKLGLRSHTDKNI  176

Query  560   VTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNE  381
             +TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G +
Sbjct  177   ITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKK  236

Query  380   ARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
              RYS GLFSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  237   TRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  276



>gb|AAL14692.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=277

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/281 (56%), Positives = 206/281 (73%), Gaps = 11/281 (4%)
 Frame = -1

Query  1088  ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRN  909
             +NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN
Sbjct  1     QNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRN  60

Query  908   TSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKL  732
              S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L
Sbjct  61    VSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQL  116

Query  731   SGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECDDTKIGLNSHTD  570
               LD MVRRMI+ES G+E Y+DEH+NST YL R+MKY  P      + ++TK+GL SHTD
Sbjct  117   VELDLMVRRMIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDEETKLGLRSHTD  176

Query  569   KNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMS  390
             KNI+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+
Sbjct  177   KNIITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMT  236

Query  389   GNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHV  267
             G + RYS GLFSIPK G II +PEELVD++HP +F PF++ 
Sbjct  237   GKKTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYT  277



>ref|XP_008792974.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Phoenix dactylifera]
Length=331

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 220/320 (69%), Gaps = 7/320 (2%)
 Frame = -1

Query  1136  MGSESGI---KLPIIDFSDENLK-PGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRE  969
             MG+E+     +L  IDFSD N   PG  +W  VR +V +A+   GCFEA + +I   LR+
Sbjct  1     MGAETAASERRLSKIDFSDVNSSNPGTRSWAAVRARVMQAMESDGCFEAVYPRISSELRD  60

Query  968   SMI-DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNI  792
             S+   A+KELF LPL+TK++N  +KPFHGY+ Q P +  YES+ I DA   +  Q FT++
Sbjct  61    SLFGTAMKELFALPLETKLQNICDKPFHGYLSQIPYLS-YESLAIMDAPFSYGAQSFTSL  119

Query  791   MWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP  612
             MWP GN  FC +VQS+SE++  L++ VRRM+LESLGVEKY      ST +LLRV +Y  P
Sbjct  120   MWPSGNSTFCETVQSFSEQVMELEETVRRMVLESLGVEKYCVAQTESTRFLLRVSEYGAP  179

Query  611   ECDD-TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAW  435
             + ++  K+GL  H DKN + I+ QN+V+GLE+  KDG+WI   PSP SFIV+ GD+  AW
Sbjct  180   QGEEEKKLGLVPHRDKNTLAIVCQNQVDGLEIETKDGEWIPATPSPASFIVIAGDAFRAW  239

Query  434   TNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLG  255
             TNGR++SP HR+++ G+  RYSA +FSIPK   +I+AP ELVDE+HP LF PF + +++ 
Sbjct  240   TNGRVYSPLHRIVVGGDTTRYSAIIFSIPKDEVVIQAPPELVDEEHPSLFRPFLYNKYVH  299

Query  254   FYYSEEGQKCQSALATYCGV  195
             +  SEEG K +  L +YCGV
Sbjct  300   YCVSEEGMKVKCQLDSYCGV  319



>ref|XP_011072310.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 217/315 (69%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS +  KLP+I F++EN KPG  TW K   QV  AL EYGCF A +D+I   +   + +
Sbjct  1     MGSLTLHKLPVIAFTEENSKPGTETWSKTCRQVISALQEYGCFVAAYDQITQRIHTGVFE  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFD+P + KV+N S KP +GYVGQ P++PLYESMGID+AN L   Q F  +MWP G
Sbjct  61    ALEELFDIPTERKVQNKSAKPLYGYVGQIPLIPLYESMGIDNANTLEGIQSFAKVMWPNG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  F   +  Y++  + L+ +V +M+ E  GV +Y + H++S NYL RVM+Y+ P+  + 
Sbjct  121   NDGFSEKLLLYTKLAAELEKIVVQMVFEGYGVGQYYESHISSANYLCRVMQYRQPKMQEN  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRL  420
             ++G  SHTDK+ ++ ++QN+V+GLE+  KDG+W  V+  SP+S +VM GD++ AW+N R+
Sbjct  181   RMGFVSHTDKSFMSTIHQNQVDGLEIKAKDGEWFGVHDLSPSSLVVMAGDAIMAWSNNRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV M GNEARYS   FS  +   +++ P+EL+++ +P  + PFDH++FL FY  E
Sbjct  241   RSPPHRVTMQGNEARYSLAQFSFIEKS-MVQTPQELINDDNPQQYKPFDHLKFLEFYSKE  299

Query  239   EGQKCQSALATYCGV  195
             E ++ +SA+ TYCGV
Sbjct  300   ENRRLESAIRTYCGV  314



>gb|AAL14680.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=275

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 206/279 (74%), Gaps = 9/279 (3%)
 Frame = -1

Query  1088  ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRN  909
             +NLKPG   WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN
Sbjct  1     QNLKPGSSKWDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRN  60

Query  908   TSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKL  732
              S+KPFHGY+       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L
Sbjct  61    VSSKPFHGYLCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQL  116

Query  731   SGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----TKIGLNSHTDKN  564
               LD MVRRMI+ES G+EKY+DEH+NST YL R+MKY  P  DD    TK+GL SHTDKN
Sbjct  117   VELDLMVRRMIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEETKLGLRSHTDKN  176

Query  563   IVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGN  384
             I+TIL+Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G 
Sbjct  177   IITILHQYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGK  236

Query  383   EARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHV  267
             + RYS GLFSIPK G II +PEELVD++HP +F PF++ 
Sbjct  237   KTRYSTGLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYT  275



>ref|XP_011072270.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Sesamum indicum]
Length=313

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/314 (48%), Positives = 208/314 (66%), Gaps = 1/314 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS     LP I FS +NL+PG   W      V +AL +YGCF AT+ K  + + +++  
Sbjct  1     MGSLVNPTLPTIHFSGKNLEPGSTAWMSTSKDVVRALEDYGCFAATYSKFSLGMHKAIFR  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
               +ELFDLP   KV+NTS+ P HGYVGQ P++PLYE +GI++A      + FTN++WP G
Sbjct  61    CSEELFDLPTNVKVQNTSDTPSHGYVGQEPIIPLYEGLGIENATTREGVKKFTNLLWPSG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC +   YS  ++ LD +V RM+ ES G+E   +  + +T+YLLR++KY+ PE  + 
Sbjct  121   NDRFCETALEYSRLVAELDQVVMRMVSESYGIESSYESLLGATSYLLRIIKYRKPEKGEN  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G+  HTDK+ +TI++Q +VNGLE+  KDG WI V+PSP+SFIVM GD+   WTNGR+ 
Sbjct  181   GLGIVPHTDKSFMTIIHQCQVNGLEIKTKDGDWITVDPSPSSFIVMAGDACMGWTNGRIE  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
                HRV++ G+E RYS GLF+  +    I+ PEELVD+ HP  F PFDH +F+ FYY+EE
Sbjct  241   PSIHRVIIKGSEERYSLGLFTFIR-DLKIQVPEELVDDHHPAQFKPFDHYKFIHFYYTEE  299

Query  236   GQKCQSALATYCGV  195
             G+K    L  YCGV
Sbjct  300   GRKSNCPLRAYCGV  313



>ref|XP_006465514.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like, 
partial [Citrus sinensis]
Length=314

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 213/316 (67%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCF--EATFDKIPIHLRESM  963
             +G+E+ +KLP++DFS+++LKPG  +W K  N V +AL E+GCF  E   + I    R  +
Sbjct  1     IGAEAMLKLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEV  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
               ALK LFDLP +TK++N   +P  GYVGQ P +PL+ESMGID+A  L   Q FT IMWP
Sbjct  61    FGALKNLFDLPSETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             QGN +FC  V SY+   + LD  V RMI ES  +EKY D ++ S  YLLRV+K + P   
Sbjct  121   QGNDSFCKIVNSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPIGG  180

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +  +G  +HTDK+  TIL+QN++NGLE+  +DGQ INV  SP+SF+V+ GD+L AW+N R
Sbjct  181   EPNLGFVTHTDKSFTTILHQNQINGLEIDTRDGQKINVGLSPSSFVVVAGDALMAWSNDR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             +HSP HRV+M+G   RYS  LFS      I+K P+ELVD++HPL + PF+H   L ++ +
Sbjct  241   IHSPSHRVIMNGAVDRYSLALFSFSSG--IVKVPDELVDDEHPLKYKPFEHFGLLRYFRT  298

Query  242   EEGQKCQSALATYCGV  195
             +EG K +  +  YCG+
Sbjct  299   DEGYKSKCPIKAYCGI  314



>gb|KHG02339.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=318

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 221/321 (69%), Gaps = 10/321 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S++   +P+IDFS++NLK G P WD V++Q+ +AL EYGCFEA FD I + LR+++  
Sbjct  1     MSSKTQAMVPVIDFSNQNLKAGSPEWDFVKSQIREALEEYGCFEALFDPI-LELRKAVFG  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNT-QHFTNIMWPQ  780
             AL+E+FDLPL+TK    S+KPF GY        L++SM +DDA++  N  Q  T  +WPQ
Sbjct  60    ALQEVFDLPLETKKLCVSDKPFRGYSCSPS--GLFQSMAVDDAHIAENIEQCLTTSLWPQ  117

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +F  ++ S+ +  S L+  + +MILES G+EKYMDE  ++TNY LR+MKY+ P+ ++
Sbjct  118   GNISFSKTLASFIQLTSDLEKKILKMILESFGLEKYMDELTDTTNYQLRIMKYEKPKTNE  177

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +   +H D+N++T+LYQ+EVNGLE+ NK G+W+N+  S +SFIVMIG+ L  W NGRL
Sbjct  178   QTMMAPAHCDQNMMTLLYQDEVNGLEIQNKYGEWMNMKLSSSSFIVMIGECLSVWLNGRL  237

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SPYHRVMM GN+ RYS GLF+ P+ GY+IK P ELVD+ +P+LF P DH EFL  + SE
Sbjct  238   SSPYHRVMMKGNDDRYSLGLFTRPREGYVIKVPNELVDDNNPILFKPHDHEEFLKIFSSE  297

Query  239   EGQK------CQSALATYCGV  195
               +         S L  YC V
Sbjct  298   MAKADFKSGVVISRLKAYCSV  318



>ref|XP_010455020.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2 
[Camelina sativa]
Length=298

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 210/290 (72%), Gaps = 10/290 (3%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              + LP+IDFSD+ L PG   WD+V+  V KAL +YGCFEA+FDK+   L++S+ +A++EL
Sbjct  13    SVHLPVIDFSDKTLNPGSSKWDEVKIDVRKALEDYGCFEASFDKVSAELKKSVFEAVEEL  72

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             F LP+ TK RN S K FHGY+       LY+S GI+DAN+L     FT  + P  GN N 
Sbjct  73    FKLPIHTKQRNVSTKLFHGYLYH----NLYQSFGIEDANVLDRVNDFTQQLRPDHGNKNI  128

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP---ECDD--  600
               ++  +SEKLS LD MVRR+I+ES G+EKY+D H+NST YLLR+M+Y  P   + DD  
Sbjct  129   SETLHQFSEKLSKLDVMVRRIIMESFGIEKYIDGHLNSTYYLLRMMEYTTPPLLDADDEE  188

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             +K+GL +HTDKN +TIL+Q++V+GLEV  KD +WI V PS + F+VM+GDSL A  NGR+
Sbjct  189   SKVGLLAHTDKNTITILHQHQVDGLEVKTKDEKWIKVKPSQDHFLVMVGDSLCALLNGRV  248

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDH  270
              SPYHRVMM G + RYS GLFS+PK+  II +PEELVDE+HP +F P+++
Sbjct  249   FSPYHRVMMMGKKTRYSTGLFSVPKSEIIIDSPEELVDEEHPRIFKPYEY  298



>emb|CDP10326.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 215/306 (70%), Gaps = 1/306 (0%)
 Frame = -1

Query  1112  LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDL  933
             LP+IDF+ +NL P    W   R  V +AL +YGCF A +D++ + L E++  A +ELFDL
Sbjct  9     LPVIDFTKKNLDPSSSFWPSTRQAVVRALEDYGCFIALYDEVTLELNEAIFRASEELFDL  68

Query  932   PLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNSV  753
             P + KV NTSN P HGYVGQ P++PLYE +GI++A  L   + FTN++WP GN +F  + 
Sbjct  69    PTEIKVLNTSNTPSHGYVGQEPIIPLYEGLGIENATTLDGVEKFTNLLWPNGNHSFSETA  128

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSHT  573
              SYS+ ++ LD MV RM+ E+ G+EK  +  + S +YLLR++KY+ P  ++  +G+  HT
Sbjct  129   FSYSKIVAELDQMVMRMVSEAYGIEKNYESLLGSMSYLLRLIKYRRPHENEKNLGIVPHT  188

Query  572   DKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMM  393
             DK+ ++IL Q++V GLE+  KDG+W+ ++PSP SFIVM GD   AWTNGR+  P+HRV+M
Sbjct  189   DKSFMSILQQDQVKGLEIKTKDGEWMVIDPSPFSFIVMAGDVCMAWTNGRIEPPHHRVVM  248

Query  392   SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSAL  213
             + N  RYS GLF+  +   I++ PEELVD++HPL F PFDH +++ +YY++EG++ +  +
Sbjct  249   TENAERYSLGLFTFIR-DLIVQVPEELVDDEHPLQFKPFDHYKYIDYYYTDEGKRSKCPI  307

Query  212   ATYCGV  195
               YCGV
Sbjct  308   RDYCGV  313



>ref|XP_008228622.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=312

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 204/314 (65%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP++DFS E LKPG  +W      V +AL E+GCF   +DKI    R + + 
Sbjct  1     MGSEGQPKLPVLDFSKEALKPGTNSWLLACKDVRQALEEFGCFVVLYDKISPEFRNAFLV  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLP QTK+ N   KP +GYVGQ P +PL+ES+GID+A  L  TQ FT +MWP G
Sbjct  61    ALQELFDLPTQTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATKLVETQKFTKLMWPGG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC S  S+++    LD MV RMI ES GVEKY + ++ S +YLLR++K + P+ ++ 
Sbjct  121   NDKFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQENEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G  +HTDK+  TILYQN VN LEV  +  +WI V   P+SFIVM GD+L AW+N R+ 
Sbjct  181   SLGFVAHTDKSFTTILYQNHVNALEVETRSHEWIRVEFPPSSFIVMAGDALMAWSNDRIL  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRV+MSGNE RYS   FS       I  PEEL DE+HPL +  FDH   L F+ S++
Sbjct  241   SPNHRVIMSGNETRYSLAQFSFSDGA--IHVPEELADEEHPLRYKSFDHPGLLRFFRSDD  298

Query  236   GQKCQSALATYCGV  195
                  SA+  YCGV
Sbjct  299   RFNSNSAIKAYCGV  312



>gb|KEH28751.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=265

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP+IDF++ N +   P W+ V++QV+KALVEYGCFEA FDK+P+ LR+++  
Sbjct  1     MGSEHTQKLPLIDFNNLNFEAKNPNWELVKSQVYKALVEYGCFEAIFDKVPLDLRKAIFT  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELFDLPL+TK+ N SNKP+ GY+GQYP+VPLYESM I+DAN+L   +  TNI+WP G
Sbjct  61    SIEELFDLPLETKLLNVSNKPYDGYIGQYPVVPLYESMAIEDANILEKVKSMTNILWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N NF  ++ S+SE+L  LD ++R+MILESLGVEKY++EHMNSTNY LR MKYKGP+  DT
Sbjct  121   NKNFSETIHSFSEELIELDQIIRKMILESLGVEKYLEEHMNSTNYRLRAMKYKGPQTSDT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYA  438
             K+GL  HTDKN VTILYQN+V GLE++ KDGQWI+  PS  SF+V++GDS++ 
Sbjct  181   KVGLTPHTDKNFVTILYQNQVEGLEMMTKDGQWISYKPSSGSFVVVLGDSIHV  233



>ref|XP_006427131.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
 gb|ESR40371.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
Length=314

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++  K+P+ID S ++LK G  TW      V  A  E+GCFEA + KI    R  ++ 
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVLA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             + +ELFD+P++ KV+NTS KP+  Y GQY ++PLYES+ ID  +  + TQ FTN+MWP G
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC S  S SE +  LD MV RM+ ES GVE Y D ++ S NYLLR  KY+ PE ++T
Sbjct  121   NDCFCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAPEPNET  180

Query  596   KIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             K+GL  HTDK + +I++Q N +NGL+V  KDG+WI+V PSP+SFIVM GD+L AW N R+
Sbjct  181   KMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIVMAGDALMAWGNDRI  240

Query  419   HSPYHRVMM-SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
                 H+V+M + +E RYS GLFS      ++  P+EL DE  PL + PFDH  FL F  S
Sbjct  241   RPCRHQVIMDNASETRYSLGLFSFSSG--VVDIPKELGDETQPLKYKPFDHFGFLHFNQS  298

Query  242   EEGQKCQSALATYCGV  195
             EEG+K  S++  YCG+
Sbjct  299   EEGKKSASSIKAYCGI  314



>gb|AAL14681.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=274

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 202/275 (73%), Gaps = 12/275 (4%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V+  V KAL  YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVKADVRKALENYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SEKL  LD MVRR
Sbjct  64    LCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHRFSEKLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGP-------ECDDTKIGLNSHTDKNIVTILY  546
             MI+ES G+E Y+DEH+NST YL R+MKY  P       + ++TK+GL SHTDKNI+TIL+
Sbjct  120   MIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDDEETKLGLRSHTDKNIITILH  179

Query  545   QNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSA  366
             Q +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS 
Sbjct  180   QYQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYST  239

Query  365   GLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             GLFSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  240   GLFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  274



>gb|EYU21585.1| hypothetical protein MIMGU_mgv1a010381mg [Erythranthe guttata]
Length=314

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 212/308 (69%), Gaps = 3/308 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             KL +I+FSD+NLKPG  +W K  N+V  AL +YGCF A++DK+      ++  AL+ELFD
Sbjct  9     KLDVIEFSDKNLKPGTESWSKTCNEVVSALEKYGCFVASYDKLTQETHTTVFKALEELFD  68

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP QTKV+N S KP +GYVGQ P +PLYESMGID+A+ L   Q+F  +MWP G  +F   
Sbjct  69    LPTQTKVQNKSTKPLYGYVGQIPFIPLYESMGIDNADTLQGIQNFAKVMWPNGYNDFSEK  128

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             + SY++  + L+ +V RM+ E  GV K+ +  + S NYL RVMKY+ P+ ++  +G  SH
Sbjct  129   LVSYTKLAAELEKIVVRMVFERYGVGKHYESLIGSANYLCRVMKYREPKSNENNMGFVSH  188

Query  575   TDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             TDK+ ++ ++QN+V+GLE+  KDG W  V+  S +S IVM GD++ AW+N R+ SP+HRV
Sbjct  189   TDKSFMSTIHQNQVDGLEIKTKDGDWFGVHQLSSSSVIVMAGDAIMAWSNNRIKSPHHRV  248

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQS  219
              M   +ARYS   FS  +    ++ P+ELVDE HP+ + PF+H+EFL FY  EE ++ +S
Sbjct  249   TMEAKKARYSIAQFSFLEK--TVEIPQELVDEDHPMQYKPFEHLEFLDFYSKEENRRLES  306

Query  218   ALATYCGV  195
             A+ TYCGV
Sbjct  307   AIRTYCGV  314



>gb|AFC36356.1| 2-oxoglutarate-dependent dioxygenase [Salvia miltiorrhiza]
Length=316

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 218/315 (69%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KL +I+F+D+N  P   +W +   +V  AL EYGCF A +DK+   + +    
Sbjct  1     MGSETVHKLGVIEFTDKNTNPETESWSETCKKVVDALEEYGCFVAVYDKLTHEIHKQAFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L++LFDLP QTKV+N S+KP +GYVGQ P +PLYESMGIDDA+ +   Q+F+N+MW  G
Sbjct  61    SLQQLFDLPTQTKVQNKSSKPLYGYVGQIPFLPLYESMGIDDAHTIQGIQNFSNVMWHNG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             NP F  ++  Y++  + ++ +  RM+ ES GV K+ D ++ S NYL RVMKY+ P+  + 
Sbjct  121   NPAFDENLVVYTKLAAEVERIAVRMVCESYGVGKHYDSYVESANYLCRVMKYREPKIGEN  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGRL  420
             K+   +HTDK+ ++ ++QN+V+GL++  KDG+W  V+  SP+S IVM GD++ AW+N R+
Sbjct  181   KMAFVTHTDKSFMSTIHQNQVDGLQIKAKDGEWFTVHHLSPSSIIVMAGDAIMAWSNKRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP+HRV M GNEARYS   FS  +   ++  P+E VDE HPL + PFDH++FL F+  E
Sbjct  241   KSPHHRVTMEGNEARYSIAQFSFMEKD-MVATPDEFVDEDHPLQYKPFDHLKFLDFFSQE  299

Query  239   EGQKCQSALATYCGV  195
             E ++ +SA+ TYCGV
Sbjct  300   ENRRLESAITTYCGV  314



>gb|AAL14678.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=272

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 202/273 (74%), Gaps = 10/273 (4%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V+  V KAL +YGCFEA FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVKADVLKALEDYGCFEAFFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GIDDAN+L     FT  +WP  GN +   ++  +SE+L  LD MVRR
Sbjct  64    LCH----NLYESLGIDDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----ECDDTKIGLNSHTDKNIVTILYQN  540
             MI+ES G+E Y+DEH+NST YL R+MKY  P     + ++TK+GL SHTDKNI+TIL+Q 
Sbjct  120   MIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDEETKLGLRSHTDKNIITILHQY  179

Query  539   EVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGL  360
             +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS GL
Sbjct  180   QVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTGL  239

Query  359   FSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             FSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  240   FSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  272



>ref|XP_006392866.1| hypothetical protein EUTSA_v10011658mg [Eutrema salsugineum]
 gb|ESQ30152.1| hypothetical protein EUTSA_v10011658mg [Eutrema salsugineum]
Length=321

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 215/313 (69%), Gaps = 4/313 (1%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              ++LP+IDF+  NLKPG   WD VR  V KAL EYGCFEA FDK+P+ LR+++ DA +E 
Sbjct  9     ALQLPVIDFTSPNLKPGTAEWDSVRGHVRKALEEYGCFEALFDKVPVQLRKAVFDASEEA  68

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFC  762
             F LPL+TK R  S + + GY+GQ P +PL+E +G+D A        FT+ +WPQGN +F 
Sbjct  69    FKLPLETKQRVVSRRKYRGYIGQIPTLPLFEVLGVDFAENEDKVNEFTHKLWPQGNTSFS  128

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKGPECDDTKIGL  585
              +V S++EK+S LD M RRMI+ES G+ E Y+ +H+NST  L+R+MKY G E  + ++G+
Sbjct  129   EAVMSFTEKVSELDFMTRRMIMESFGINEDYIGKHLNSTKCLMRMMKYTGVEETEEELGM  188

Query  584   NSHTDKNIVTILYQNEV-NGLEVLNKDGQ-WINVNPSPN-SFIVMIGDSLYAWTNGRLHS  414
              +HTD+N++TIL QNEV +GLEV   DG+ WI  NPS + SFIV+ G +L+   NGR+ +
Sbjct  189   EAHTDRNVLTILCQNEVKDGLEVKTSDGKHWIKANPSQDSSFIVLGGATLHVLMNGRVLT  248

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
               HRVM  G   R+SAGLFS+PK   +I APEE+VD +HP L+ PFD   +  +     G
Sbjct  249   GVHRVMRMGTNTRFSAGLFSVPKTEDLIYAPEEMVDAEHPRLYKPFDFEAYFQYTTEGSG  308

Query  233   QKCQSALATYCGV  195
             ++  +AL TYCG+
Sbjct  309   RRDLAALKTYCGL  321



>gb|KDP37163.1| hypothetical protein JCGZ_06219 [Jatropha curcas]
Length=312

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 213/314 (68%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS    KLP++DF+ ENLKPG   W K  ++V +AL EYGCF   ++K+   LR S+  
Sbjct  1     MGSVLAPKLPVLDFTQENLKPGSSFWVKTCSEVRQALEEYGCFIVKYNKLSPELRNSVFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             ALK+LFDLP +TK++N   KP +GYVGQ P +PL+ES+GID+A  L     FT +MWP G
Sbjct  61    ALKDLFDLPTETKMQNKYVKPLNGYVGQIPKIPLHESLGIDNATSLEALLSFTKLMWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  F   +  Y++  + LD MV RM+ ES GVEK  D ++ ST YLLR++K + P+ D+ 
Sbjct  121   NLRFSEPIFEYAKLAAELDYMVTRMVFESYGVEKLHDSYIGSTTYLLRLLKNRVPKGDEP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G  +HTDK+  TIL+QN+V+GLEV  +DG+ I V  SP+SF+V+ GD+L AW+N R+ 
Sbjct  181   NLGFITHTDKSFTTILHQNQVDGLEVDTRDGEKIMVEFSPSSFVVIAGDALMAWSNDRIM  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP HRVMM+G   RYS GLF+       I+ P+ELVDE+HPL++ P DH+  L FY ++E
Sbjct  241   SPSHRVMMNGKVDRYSTGLFAFNSGK--IQVPQELVDEEHPLMYKPLDHIGLLYFYRTDE  298

Query  236   GQKCQSALATYCGV  195
             G K +  +  YCG+
Sbjct  299   GYKSKCPVKAYCGI  312



>ref|XP_006427132.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|ESR40372.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|KDO58209.1| hypothetical protein CISIN_1g043442mg [Citrus sinensis]
Length=309

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 208/310 (67%), Gaps = 4/310 (1%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCF--EATFDKIPIHLRESMIDALKE  945
             +KLP++DFS+++LKPG  +W K  N V +AL E+GCF  E   + I    R  +  ALK 
Sbjct  2     LKLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEVFGALKN  61

Query  944   LFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNF  765
             LFDLP +TK++N   +P  GYVGQ P +PL+ESMGID+A  L   Q FT IMWPQGN +F
Sbjct  62    LFDLPTETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWPQGNDSF  121

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGL  585
             C  V SY+   + LD  V RMI ES  +EKY D ++ S  YLLRV+K + P   +  +G 
Sbjct  122   CKIVHSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPIGGEPNLGF  181

Query  584   NSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYH  405
              +HTDK+  TIL+QN++NGLE+  +DGQ INV  SP+SF+V+ GD+L AW+N R+HSP H
Sbjct  182   VTHTDKSFTTILHQNQINGLEIDTRDGQKINVELSPSSFVVVAGDALMAWSNDRIHSPSH  241

Query  404   RVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKC  225
             RV+M+G   RYS  LFS      I+K P+ELVD++HPL + PF+H   L ++ ++EG K 
Sbjct  242   RVIMNGAVDRYSLALFSFSSG--IVKVPDELVDDEHPLKYKPFEHFGLLRYFRTDEGYKS  299

Query  224   QSALATYCGV  195
             +  +  YCG+
Sbjct  300   KCPIKAYCGI  309



>ref|XP_010110322.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25842.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=372

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 206/305 (68%), Gaps = 2/305 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             KLP++DFS E LKPG  +W+  R  V +A  EYGCF  T++ I   LR +M  AL+ELFD
Sbjct  9     KLPVLDFSKETLKPGTKSWELARKDVQRAFEEYGCFLVTYEAISCELRNAMFGALEELFD  68

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP +TK++N   KP +GYVGQ P+VPL+ES+GID+A      Q FTN++WP GN  F  S
Sbjct  69    LPTETKMKNKYEKPLNGYVGQNPVVPLHESLGIDNATAKEGIQSFTNLLWPVGNDRFSES  128

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
               S+++  + +D +V RMI ES  +EKY + ++ S  YLLR++K+  P+ +D ++G  +H
Sbjct  129   AHSFAKLAAEIDQIVTRMIFESYSLEKYYEAYIGSITYLLRLLKHNAPQGNDPQLGFVAH  188

Query  575   TDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVM  396
             TDK+  TIL+QN VN LEV  K+G WI V  SP+SF+V  GD+L AW+N R+ SP HRV+
Sbjct  189   TDKSFTTILHQNHVNALEVETKNGDWIKVELSPSSFVVFAGDALMAWSNDRIVSPKHRVV  248

Query  395   MSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSA  216
             +SGNE RYS   FS      +++ PEELVDEQHPL + PF+H+ FLGF+     ++ +  
Sbjct  249   VSGNEDRYSLAQFSFGDG--MVEVPEELVDEQHPLKYKPFNHLGFLGFFAENAYKRLECP  306

Query  215   LATYC  201
             +  YC
Sbjct  307   IKAYC  311



>gb|AAL14691.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=273

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 202/274 (74%), Gaps = 11/274 (4%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L  LD MVRR
Sbjct  64    LCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECDDTKIGLNSHTDKNIVTILYQ  543
             MI+ES G+E Y+DEH+NST YL R+MKY  P      + ++TK+GL SHTDKNI+TIL+Q
Sbjct  120   MIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDEETKLGLRSHTDKNIITILHQ  179

Query  542   NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAG  363
              +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS G
Sbjct  180   YQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTG  239

Query  362   LFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             LFSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  240   LFSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  273



>gb|KHG02338.1| Flavonol synthase/flavanone 3-hydroxylase -like protein [Gossypium 
arboreum]
Length=333

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 222/329 (67%), Gaps = 10/329 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S +   +P+IDFS++N K G P WD V++QV +AL  YGCF A FD I + LR+++  
Sbjct  1     MSSTTQAMVPVIDFSNQNPKAGSPEWDLVKSQVREALEGYGCFAALFDPI-LELRKAVFG  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNT-QHFTNIMWPQ  780
             AL+E+FDLPLQTK    S+KPF GY      V  ++SM +DDA++  N  Q  T  +W Q
Sbjct  60    ALQEVFDLPLQTKKLCVSDKPFRGYSCSPSGV--FQSMAVDDAHIAENIEQCLTTSLWTQ  117

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +F  ++ S+ +  S L+  + +MILES G+EKYMDE  +  +Y LR+MKY+ P+ ++
Sbjct  118   GNISFSKTLASFIQLTSELEKTILKMILESFGLEKYMDELTDIASYQLRIMKYEKPKANE  177

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               IG+ +H D N++T+LYQNEVNGLE+ NKDG+W+N+  SPNSFIV+IG+ L  W NGRL
Sbjct  178   QTIGVPAHCDSNMMTLLYQNEVNGLEIQNKDGEWMNLKLSPNSFIVIIGECLCVWLNGRL  237

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SPYHRV+M GN+ RYS GLF+  + GY++K P ELVD+++P+LF P DH EFL ++ SE
Sbjct  238   SSPYHRVLMKGNDDRYSLGLFATVRGGYMVKVPTELVDDKNPMLFKPHDHEEFLKYFSSE  297

Query  239   EGQ------KCQSALATYCGV*NSTCKLW  171
               +         S L TY  +  +  K+W
Sbjct  298   VAKGVVKSGAAISRLKTYSKLLIAMFKIW  326



>ref|XP_004233542.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=321

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 216/322 (67%), Gaps = 9/322 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSD-ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             M S   +K+P IDFS+ ++LKP  P W+  + QV +AL EYGCFEA +DK+P  +RE   
Sbjct  1     MASTKLVKVPTIDFSNHQDLKPNTPLWESKKIQVFEALQEYGCFEAIYDKVPKDIREETF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
                KE+F+ PL+TK++N S KP HGY+G  P +PLYES+ I D     + Q F NI WPQ
Sbjct  61    SISKEIFEFPLETKLKNISEKPTHGYMGMIPQLPLYESLCIPDLLNPKSLQSFANIFWPQ  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC--  606
             GN +FCN V+SYS  L  LD+M++RMI E+LG++ ++DE +N+   L R  +YKG     
Sbjct  121   GNQHFCNLVKSYSNPLLELDEMLKRMISENLGLKNHIDELLNANYILFRFTQYKGSSIAS  180

Query  605   ---DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAW  435
                ++   GL  HTD N ++I+ QNEVNGL++ NK+G+WI+VN SPNS++V+ GDS  AW
Sbjct  181   GDENNKAAGLGGHTDGNFLSIISQNEVNGLQI-NKNGEWIDVNISPNSYVVLSGDSFTAW  239

Query  434   TNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLG  255
             TNGRLHSP HRV M     RYS  LFS+ K G+ I+AP+E+VDE+HPLLF PF+ +  LG
Sbjct  240   TNGRLHSPVHRVEMPRGSDRYSIQLFSLSKPGHFIEAPKEMVDEEHPLLFKPFEILGLLG  299

Query  254   FYYSEEGQKCQSA--LATYCGV  195
             +  +E G     +     YCGV
Sbjct  300   YGATEAGYTTPPSDLFKAYCGV  321



>gb|KDP37165.1| hypothetical protein JCGZ_06221 [Jatropha curcas]
Length=322

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/294 (51%), Positives = 211/294 (72%), Gaps = 3/294 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             +  ++ I +P ID S  NLKP  P WD  R+Q+ KA+ E+GCF   F+KIP +L  S+++
Sbjct  2     VSGQNPINVPEIDLS--NLKPMTPEWDSARSQIWKAVEEFGCFRVVFNKIPQNLPNSILN  59

Query  956   ALKELFDLPLQTK-VRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
              LKELFDLPL+TK + N     + GYVG+    PLYES+G DD  +L   +   N + P 
Sbjct  60    ELKELFDLPLETKKLTNHITDLYGGYVGKSLFGPLYESIGFDDPFMLEKVEKLINAILPP  119

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             G P FC  V   ++ +S ++ M+ RM++ESLGVEKY+DEH NS  + LRV KY+ P+  +
Sbjct  120   GKPEFCKHVHDLAKLMSEMETMIVRMVMESLGVEKYLDEHCNSVFHALRVQKYEIPQKGE  179

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              ++ LN H D++++TILYQ++++ LEV  +DG+W++V PS ++F+V+IG++L+AWTNGR 
Sbjct  180   VEVALNIHKDQDVMTILYQSQIDALEVETRDGKWVDVKPSSDNFMVVIGETLHAWTNGRA  239

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFL  258
             HSPYHRV+M GN  RYS GLF+  KAG++IKAPEELVDEQ+PLL+ PFDH EFL
Sbjct  240   HSPYHRVIMRGNRPRYSTGLFTAFKAGFVIKAPEELVDEQNPLLYKPFDHFEFL  293



>ref|XP_007217562.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
 gb|EMJ18761.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
Length=313

 Score =   319 bits (817),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 205/315 (65%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP++DFS E LKPG   W  V   V +AL E+GCF A +DKI    R + + 
Sbjct  1     MGSEGQPKLPVLDFSKEALKPGTNPWLSVCKDVRQALEEFGCFVALYDKISPEFRNAFLG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             AL+ELFDLP +TK+ N   KP +GYVGQ P +PL+ES+GID+A  L  TQ FT +MWP G
Sbjct  61    ALQELFDLPTRTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNLEETQKFTKLMWPGG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC S  S+++    LD MV RMI ES GVEKY + ++ S +YLLR++K + P+ ++ 
Sbjct  121   NDKFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQENEP  180

Query  596   KIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              +G  +HTDK+  TILYQ N VN LEV  +  +WI V   P+SFIVM GD+L AW+N R+
Sbjct  181   SLGFVAHTDKSFTTILYQNNHVNALEVETRSHEWIRVEFPPSSFIVMAGDALMAWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+MSGNE RYS   FS       I  PEEL DE+HPL +  FDH   L F+ ++
Sbjct  241   LSPNHRVIMSGNETRYSLAQFSFSDGE--IHVPEELADEEHPLRYKSFDHPGLLRFFRND  298

Query  239   EGQKCQSALATYCGV  195
             +     SA+  YCGV
Sbjct  299   DRFNSNSAIKAYCGV  313



>ref|XP_004233539.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=321

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 216/322 (67%), Gaps = 9/322 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSD-ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             M S   +K+P IDFS+ + LKP  P W+  + QV +A  EYGCFEA +DK+P  +RE   
Sbjct  1     MASIKSVKVPTIDFSNYQELKPNTPLWESTKIQVFEAFQEYGCFEAIYDKVPNEIREETF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
             D  KE+F+ PL TKV+N S KP HGY+G  P +PLYES+ I D     + Q+F NI WPQ
Sbjct  61    DMSKEIFEFPLDTKVKNISEKPMHGYMGMIPQLPLYESLCIPDLLNPQSLQNFANIFWPQ  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC--  606
             GN +FCN V+SYS  L  LD++++RMI E+L ++ ++DE +N+  +L R   YKG     
Sbjct  121   GNQHFCNLVKSYSNPLVELDEILKRMISENLRLKIHIDELLNANYFLFRFTHYKGSSITG  180

Query  605   --DDTKI-GLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAW  435
               ++ K+ GL  HTD N +T + QN+VNGL++ NK+G+WI+VN SPNS++V+ GDS  AW
Sbjct  181   GDENNKVAGLGGHTDGNFLTFISQNQVNGLQI-NKNGEWIDVNISPNSYVVLAGDSFKAW  239

Query  434   TNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLG  255
             TNGRLHSP HRV MSG   R S  LFS+ K G+ I+AP+ELVDE+HPLLF PF+ +    
Sbjct  240   TNGRLHSPLHRVTMSGENDRLSIQLFSLSKPGHFIEAPKELVDEEHPLLFKPFEIIGLFE  299

Query  254   FYYSEEGQKCQSA--LATYCGV  195
             +  +E G     +  L +YCGV
Sbjct  300   YGTTEAGYTAPPSDLLKSYCGV  321



>ref|XP_004233541.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=321

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 213/322 (66%), Gaps = 9/322 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSD-ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             M S   +K+P IDFS+ + LKP  P W+  + QV +AL EYGCFEA +DK+   +RE   
Sbjct  1     MASIKSVKVPTIDFSNYQELKPNTPLWESTKIQVFEALQEYGCFEAIYDKVSKEIREETF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
             D  KE+F+ PL+TKV+N S KP HGY+G  P +PLYES+ I D     + + F+NI WPQ
Sbjct  61    DMSKEIFEFPLETKVKNISEKPMHGYMGMIPQLPLYESLCIPDLLNPQSLEKFSNIFWPQ  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC--  606
             GN +FCN ++SYS  L  LD M++RMI E+LG++ ++DE +N+  +L R   YKG     
Sbjct  121   GNQHFCNLIKSYSNPLVELDGMLKRMISENLGLKNHIDELLNANYFLFRFTHYKGSSIAS  180

Query  605   ---DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAW  435
                ++   GL  HTD N +T + QN+VNGL++ NK+G+WI+V  SPNS++V+ GDS  AW
Sbjct  181   GDENNKAAGLGGHTDGNFLTFISQNQVNGLQI-NKNGEWIDVIISPNSYVVLAGDSFKAW  239

Query  434   TNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLG  255
             TNGRLHSP HRV MSG   R S  LFS+ K G+ I+AP+ELVDE+HPLLF PF+ +E   
Sbjct  240   TNGRLHSPLHRVTMSGQNDRLSIQLFSLSKPGHFIQAPKELVDEEHPLLFKPFEILELFK  299

Query  254   FYYSEEGQKCQSA--LATYCGV  195
             +  +E G     +     YCGV
Sbjct  300   YGTTEAGYTAPPSDLFKIYCGV  321



>ref|XP_006465515.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=314

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 209/316 (66%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++  K+P+ID S ++LK G  TW      +  A  E+GCFEA + K    LR  ++ 
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDIRHAFEEFGCFEAIYQKFSQELRSEVLA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             + +ELFD+P++ KV+NTS KP+  Y GQY ++PLYES+ ID  +  + TQ FTN+MWP G
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC S  S SE +  LD MV RM+ ES GVE Y D ++ S NYLLR  KY+ PE ++T
Sbjct  121   NDCFCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAPEPNET  180

Query  596   KIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             K+GL  HTDK + +I++Q N +NGL+V  KDG+WI+V PSP+SFIVM GD+L AW N R+
Sbjct  181   KMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIVMAGDALKAWGNDRI  240

Query  419   HSPYHRVMM-SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
                 H+V+M + +E RYS GLFS      ++  P+EL  E  PL + PFDH  FL F  S
Sbjct  241   RPCRHQVIMDNASETRYSLGLFSFSSG--VVDIPKELGVETQPLKYKPFDHFGFLHFNQS  298

Query  242   EEGQKCQSALATYCGV  195
             EEG+K  S++  YCG+
Sbjct  299   EEGKKSASSIKAYCGI  314



>gb|AAL14695.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=272

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 201/273 (74%), Gaps = 10/273 (4%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V   V KAL +YGCFEA FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVTADVLKALEDYGCFEAFFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L  LD MVRR
Sbjct  64    LCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----ECDDTKIGLNSHTDKNIVTILYQN  540
             MI+ES G+E Y+DEH+NST YL R+MKY  P     + ++TK+GL SHTDKNI+TIL+Q 
Sbjct  120   MIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDEETKLGLRSHTDKNIITILHQY  179

Query  539   EVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGL  360
             +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS GL
Sbjct  180   QVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTGL  239

Query  359   FSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             FSIPK G II +PEELVD++HP +F PF++ +F
Sbjct  240   FSIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  272



>ref|XP_010912205.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutarate-dependent dioxygenase 
AOP2-like [Elaeis guineensis]
Length=326

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 208/299 (70%), Gaps = 5/299 (2%)
 Frame = -1

Query  1079  KPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI-DALKELFDLPLQTKVRNTS  903
             KPG  +WD VR +V +A+  YGCFEA + ++   LR+S+   ALKELF LPL+TK +N S
Sbjct  17    KPGTRSWDAVRARVMQAMESYGCFEAVYPRVSSELRDSLFGTALKELFALPLETKQQNIS  76

Query  902   NKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGL  723
             +KPFHGYVGQ P +  YES+ I DA   +    FT++MWP GNP FC +VQS+SE++  L
Sbjct  77    DKPFHGYVGQIPYLS-YESLAIMDAPFPYGAHSFTSLMWPNGNPTFCETVQSFSEQVMEL  135

Query  722   DDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD-TKIGLNSHTDKNIVTILY  546
             ++ +RRM+LESLGVEKY      ST +L RV +Y  P+ ++  K+GL  H DKN + I+ 
Sbjct  136   EETIRRMVLESLGVEKYCAAQTESTRFLFRVSEYGAPQGEEEKKLGLVPHMDKNTLGIVC  195

Query  545   --QNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARY  372
               QN+V+GLE+  +DG+WI V PSP SFIV+ GD+  AWTNGR++SP HR+++ G+  RY
Sbjct  196   HGQNQVDGLEMETEDGEWIPVTPSPASFIVIAGDAFRAWTNGRVYSPLHRIVVGGDRTRY  255

Query  371   SAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSALATYCGV  195
             SA +FSIPK   +I+AP ELVDE+HP LF P  H E++ F +SEE  K +  L  Y GV
Sbjct  256   SAIMFSIPKDNVVIQAPPELVDEEHPSLFRPLLHNEYVHFCFSEEAMKAKYQLDAYRGV  314



>ref|XP_010249917.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nelumbo nucifera]
Length=320

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 215/320 (67%), Gaps = 6/320 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDE--NLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             MG E   ++P +DFS +  +L+ G   W  + N+V +A  +YGCF+  +D IP+   E M
Sbjct  1     MGFEGVREIPFLDFSKQSLDLEEGSEEWKALCNKVREACEDYGCFQVAYDGIPVQQHEEM  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
               A+KELF+LP +TK +N+S KP+ GY G+   VPLYES+G++DA+ L + Q FT +MWP
Sbjct  61    FVAIKELFELPAETKKKNSSTKPYFGYAGKSDDVPLYESLGVEDASRLESAQAFTELMWP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC-  606
              GNP FC  + S S K+  L  ++R+MI +SLG+E Y D H  S+N LLR+ KY+ P   
Sbjct  121   DGNPGFCEKLNSMSSKMQELGLLIRKMIFQSLGLEMYYDSHAESSNGLLRLNKYEAPPAG  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
              ++ +GL +H DK+++TIL QN V GLEVL  DG W++V PS  SFIV IG+ L AW+NG
Sbjct  181   SESAMGLLAHKDKSLITILSQNHVKGLEVLTNDGSWVSVAPSEGSFIVFIGEMLEAWSNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RL +P HRV+MSG+  RYS  LF IPK G +I+ P+ELVD++HPLLF PF +++FL ++ 
Sbjct  241   RLLAPKHRVVMSGDIERYSFALFCIPKEGVVIEVPKELVDKEHPLLFRPFKYMDFLRYFQ  300

Query  245   S---EEGQKCQSALATYCGV  195
             S       + ++ L  Y G+
Sbjct  301   SVVNSNALENENVLGVYAGI  320



>gb|AAL14688.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=271

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 202/272 (74%), Gaps = 9/272 (3%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L  LD MVRR
Sbjct  64    LCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD----TKIGLNSHTDKNIVTILYQNE  537
             MI+ES G+EKY+DEH+NST YL R+MKY  P  DD    TK+GL SHTDKNI+TIL+Q +
Sbjct  120   MIMESFGIEKYIDEHLNSTYYLTRLMKYTSPPDDDDDEETKLGLRSHTDKNIITILHQYQ  179

Query  536   VNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLF  357
             V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS GLF
Sbjct  180   VDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTGLF  239

Query  356   SIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             SIPK G II +PEELVD++HP +F PF++ +F
Sbjct  240   SIPKTGVIIDSPEELVDKEHPRIFKPFEYTDF  271



>gb|AAL14677.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAL14679.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAL14693.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=271

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 200/272 (74%), Gaps = 11/272 (4%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L  LD MVRR
Sbjct  64    LCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECDDTKIGLNSHTDKNIVTILYQ  543
             MI+ES G+E Y+DEH+NST YL R+MKY  P      + ++TK+GL SHTDKNI+TIL+Q
Sbjct  120   MIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDEETKLGLRSHTDKNIITILHQ  179

Query  542   NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAG  363
              +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS G
Sbjct  180   YQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTG  239

Query  362   LFSIPKAGYIIKAPEELVDEQHPLLFNPFDHV  267
             LFSIPK G II +PEELVD++HP +F PF++ 
Sbjct  240   LFSIPKTGVIIDSPEELVDKEHPRIFKPFEYT  271



>ref|XP_006354215.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=320

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 211/320 (66%), Gaps = 9/320 (3%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDAL  951
             + + +K+P IDFS+  LKP  P W+  + QV +AL EYGCFEAT+DKIP  +RE +    
Sbjct  2     ASTKVKIPTIDFSNLELKPNTPLWESTKVQVFEALKEYGCFEATYDKIPNEIREGIFGIT  61

Query  950   KELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNP  771
             KE+F  PL+TKV+N S+   HGYVG  P +P YES+ I D     N + F NI WP GNP
Sbjct  62    KEIFQFPLETKVKNYSDITLHGYVGMIPHLPFYESLCIPDLLNPQNVETFANIFWPHGNP  121

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-------  612
             +FCN V++YS  L  LD+M+++MILE+LG+E ++DE ++      R   YKG        
Sbjct  122   DFCNLVKAYSNPLMELDEMLKKMILENLGLENHIDELLDINYMRFRFTHYKGSSIISGDH  181

Query  611   ECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWT  432
             E +  + GLN HTD N +T + QN+VNGL++ NK+G+WI+VN SPNS++V+ GDS  AWT
Sbjct  182   ENNIKQDGLNGHTDGNFLTFISQNQVNGLQI-NKNGEWIDVNISPNSYVVLSGDSFKAWT  240

Query  431   NGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGF  252
             NGRLHSP H+V + G   R+S  LFS  K G+ IKAP+ELVDE+HPLLF PF+ V    +
Sbjct  241   NGRLHSPIHKVKIFGESDRFSIQLFSFSKPGHFIKAPKELVDEEHPLLFKPFEMVGLSEY  300

Query  251   YYSEEGQKCQS-ALATYCGV  195
               S+ G    S A   YCG+
Sbjct  301   VTSQAGYAAPSDAFKAYCGL  320



>ref|XP_009147659.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=321

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 215/313 (69%), Gaps = 4/313 (1%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              ++LP+IDF+  NLKPG   WD VR  V +AL EYGCFEA FDK+P+ LR+++ D  +E 
Sbjct  9     ALQLPVIDFTSPNLKPGTVEWDSVRGDVRRALEEYGCFEALFDKVPVKLRKAVFDVSEEA  68

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFC  762
             F LPL+TK R  S + + GYVGQ P +PL+E MG+D A        FT+ +WPQGN +F 
Sbjct  69    FQLPLETKKRVVSKRKYRGYVGQIPSLPLFEVMGVDFAENEDKVNEFTHKLWPQGNGSFS  128

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKGPECDDTKIGL  585
              +V S++EK+S LD M RRMI+ES GV E Y+++H+NST  L+R+MKY+G E  + ++G+
Sbjct  129   EAVMSFAEKVSELDFMTRRMIMESFGVNENYIEKHLNSTKCLVRMMKYQGVEETEEELGM  188

Query  584   NSHTDKNIVTILYQNEV-NGLEV-LNKDGQWINVNPSPN-SFIVMIGDSLYAWTNGRLHS  414
              +HTD+N++TIL QN+V +GLEV  + D QWI  NPS + SFIV+ G +L+   NGR+ +
Sbjct  189   EAHTDRNMLTILCQNDVKDGLEVRTSDDKQWIKANPSQDSSFIVLGGATLHVLLNGRVLT  248

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
               HRVM  G   R+SAGLFS+PK   +I APEELVD +HP L+ PFD   +  F     G
Sbjct  249   GVHRVMRMGTNTRFSAGLFSVPKTEDLIYAPEELVDAEHPRLYKPFDFEAYFQFTTEGPG  308

Query  233   QKCQSALATYCGV  195
             ++  +AL  YCG+
Sbjct  309   RRDVAALRGYCGL  321



>ref|XP_002284985.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36207.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 213/318 (67%), Gaps = 6/318 (2%)
 Frame = -1

Query  1142  RKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             R MG E+  K+P++DFS ENLKPG  +W    N V  AL EYGCF A +D++P+ +  ++
Sbjct  3     RIMGLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTI  62

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANL-LHNTQHFTNIMW  786
               A++ELFDLP++TK +N S KP+ GY  + P  PL++ +GID+    L   + F  IMW
Sbjct  63    FGAMRELFDLPIETKKQNISEKPYQGYTSESPAAPLHQGLGIDNVTTNLEEIRRFAKIMW  122

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             P GN NFC SV  YS+ ++ LD MV RM+LES G+E     H+ S ++L+R++K + P+ 
Sbjct  123   PAGNENFCQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIESASFLVRLLKSRVPKM  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTN  429
             ++T     SH DK+ ++IL+QN+VNGLE+  KDG+WI+   PS   F+VM G+ L AW+N
Sbjct  181   NETNKAFPSHCDKSFISILHQNKVNGLEIQTKDGKWISHEPPSLQVFLVMAGEVLTAWSN  240

Query  428   GRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY  249
             GR+H   HRV++ GNEARY+ GLFS      +IK PEELVD+ HPL F PFDH   L F 
Sbjct  241   GRIHPARHRVVVKGNEARYTLGLFSTING--MIKVPEELVDDHHPLQFKPFDHTGLLHFL  298

Query  248   YSEEGQKCQSALATYCGV  195
              ++EG+  ++AL  YCG+
Sbjct  299   GTKEGRNPETALKAYCGL  316



>gb|AAL14689.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=267

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 198/270 (73%), Gaps = 14/270 (5%)
 Frame = -1

Query  1040  VHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMV  861
             V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY+      
Sbjct  2     VRKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGYLCH----  57

Query  860   PLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLG  684
              LYES+GI+DAN+L     FT  +WP  GN +   ++  +SEKL  LD MVRRMI+ES G
Sbjct  58    NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHRFSEKLVELDLMVRRMIMESFG  117

Query  683   VEKYMDEHMNSTNYLLRVMKYKGP---------ECDDTKIGLNSHTDKNIVTILYQNEVN  531
             +E Y+DEH+NST YL R+MKY  P         + ++TK+GL SHTDKNI+TIL+Q +V+
Sbjct  118   IENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDDDDEETKLGLRSHTDKNIITILHQYQVD  177

Query  530   GLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLFSI  351
             GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS GLFSI
Sbjct  178   GLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTGLFSI  237

Query  350   PKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             PK G II +PEELVD++HP +F PF++ +F
Sbjct  238   PKTGVIIDSPEELVDKEHPRIFKPFEYTDF  267



>ref|XP_010034855.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53769.1| hypothetical protein EUGRSUZ_J03022 [Eucalyptus grandis]
Length=315

 Score =   314 bits (804),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 206/317 (65%), Gaps = 5/317 (2%)
 Frame = -1

Query  1136  MGSESGI--KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             MGS+S +  +L +I+FS ENL PG   W     +V  AL EYGCF AT           +
Sbjct  1     MGSQSKLLPELSVIEFSRENLDPGTDLWISTSKRVVFALEEYGCFIATCSDFTSQAHNEI  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
               AL ELFDLP + K RNTS KP+ GYVGQ+P +PLYES+GIDDA  L   Q FTN++WP
Sbjct  61    FHALDELFDLPTEIKSRNTSEKPYFGYVGQHPSIPLYESLGIDDATTLKGVQSFTNLLWP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
              GN  F +   ++S+K+S L+ MV+RM+ E  GV+KY D H+ S+ YLLR MKY+ PE +
Sbjct  121   AGNERFRDGALAFSKKVSELEQMVKRMVFERYGVKKYYDSHVMSSTYLLRFMKYRAPEMN  180

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
             +T  G + HTDK+ VTIL+QN+++GLEV  KDG WI   PSP+SF+VM GD+  AW+NGR
Sbjct  181   ETNRGCDVHTDKSFVTILHQNQIDGLEVKTKDGDWIAFEPSPSSFLVMAGDAFLAWSNGR  240

Query  422   LHSPYHRVMMSGNEA-RYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             +HSP H+V+M   ++ RYS GLF+      II+ P+EL D ++PL F  FDH   L ++ 
Sbjct  241   IHSPLHQVVMKEKKSPRYSLGLFTFHSG--IIEIPQELADPENPLKFKAFDHYGLLRYFC  298

Query  245   SEEGQKCQSALATYCGV  195
              +   +       YCGV
Sbjct  299   QDGVPQDVCTAQAYCGV  315



>emb|CDO98089.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS +   L ++DF+++ LKPG   W    N +  AL  +GCF A +DKI   L +++  
Sbjct  1     MGSVTPTNLLVVDFTNKELKPGSSCWSLACNDIRHALENHGCFIALYDKISQELDKAIFH  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A  +LFDLP Q KV+NT+ KP+HGYVGQ P VPL+E +GID A  L   Q FTN+MWPQG
Sbjct  61    AADDLFDLPTQLKVQNTNEKPYHGYVGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F  S  S+++ ++ LD+MV +M+ ES GVEKY D H+ S+ YLLR +KY+ PE ++T
Sbjct  121   NKSFSESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHVESSTYLLRFLKYRAPEVNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +   SHTDK+ +TILYQN ++GLE+  +DG+WI V+  P SF+VM GD+  AW+N  + 
Sbjct  181   TMAFPSHTDKSFLTILYQNHISGLEIRTRDGEWITVDFPPRSFVVMAGDACQAWSNDGVL  240

Query  416   SPYHRVMM--SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             SP H+V M  +G E R++  LFS      +++ PEELVD++ PL F PF HV+ L FY +
Sbjct  241   SPNHKVTMDANGKETRHTIALFSF--LSKMVQVPEELVDDEKPLQFKPFVHVDLLNFYAT  298

Query  242   EEGQKCQSALATYCGV  195
             ++G++ Q+ L  +CGV
Sbjct  299   DQGRRSQNILKDFCGV  314



>ref|XP_010665883.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Beta vulgaris subsp. vulgaris]
Length=319

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 210/315 (67%), Gaps = 4/315 (1%)
 Frame = -1

Query  1124  SGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKE  945
             + ++LP I+   EN  PG  +W    N + +AL EYGCF A +DK  + L    ID ++ 
Sbjct  7     AKLQLPTINLGGENTNPGTSSWTSTCNNIKQALEEYGCFIAVYDKFSLDLHNKAIDVIQP  66

Query  944   LFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNF  765
             +F+LP + K RN+SN P+HGY      +PL ES+GI+DA + +  + FTN++WP GN  F
Sbjct  67    MFELPTEVKARNSSNLPYHGYYKPGNPMPLLESLGIEDALMRNAVRSFTNLLWPSGNHQF  126

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGL  585
             C ++  Y++K++ L+ +V RM+ ES GVEKY + H+NST+YLLR+ KY+ P+ ++  +G 
Sbjct  127   CETIDQYAKKVAELEQLVLRMVFESYGVEKYHNSHLNSTSYLLRIAKYRVPQKNEHNLGA  186

Query  584   NSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYH  405
               HTDKN +TIL++N+VNGLEV  KDG+W++++ SP SFIVM G+   AW+N R+H+P H
Sbjct  187   VGHTDKNFITILHENDVNGLEVQTKDGEWLSIDSSPQSFIVMAGEPFLAWSNNRIHAPLH  246

Query  404   RVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKC  225
             RV+M G++ RYS  LFS  K    I+ P+ELVD++HPL F PFD++  L FY  +  +  
Sbjct  247   RVIMKGDKPRYSFALFSTTKD--TIETPKELVDDEHPLQFKPFDYMGLLQFYTEDVSRMA  304

Query  224   QSALATYCGV*NSTC  180
                +  YCG+  S C
Sbjct  305   VCTIKDYCGI--SVC  317



>ref|XP_006427129.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
 gb|ESR40369.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
Length=339

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 205/317 (65%), Gaps = 4/317 (1%)
 Frame = -1

Query  1139  KMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             KMGSE+  KLPI+D S ENLKPG  +W    N++  AL EYGCF A +DK+    R  + 
Sbjct  25    KMGSEAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALYDKLLPEFRNKVF  84

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
             D+L+ELFDLP +TK++N + KP HGY+G+    PL+E MGI+ A      + FT++MWPQ
Sbjct  85    DSLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRGECEKFTSLMWPQ  144

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN  FC    +Y+  ++ L  +V +M+ ES GVEK  +    ST YLLR +KY+  + D 
Sbjct  145   GNYQFCEVAHTYANIVAELQQLVMKMLFESYGVEKLYESQKESTTYLLRFLKYRKSQTDT  204

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             T +    HTDK++V+IL+ N V GLE+  KDG+WI+  PSP+SF+++ GD   AW+N R+
Sbjct  205   TNLAFKGHTDKSLVSILHSNHVKGLELRTKDGEWIHFEPSPSSFVIIAGDVCMAWSNDRI  264

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              S YHRV++ G E RY+ GLFS      +I+ PEELVD++HPL + PFDH   L FY S 
Sbjct  265   KSCYHRVIVDGPEVRYALGLFSFLSG--VIQTPEELVDDEHPLQYKPFDHAGLLQFYLSN  322

Query  239   EGQKC--QSALATYCGV  195
               Q    ++ +  YCG+
Sbjct  323   SDQNKGERNMMKAYCGI  339



>gb|KFK30902.1| hypothetical protein AALP_AA6G041000 [Arabis alpina]
Length=322

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/315 (49%), Positives = 216/315 (69%), Gaps = 14/315 (4%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
              +LPII FSD+ LKPG   WD+V++ V KAL +YG FEA+F K+ + L+ S+ +A++EL+
Sbjct  15    FQLPIIHFSDQTLKPGSSKWDQVKSDVRKALEDYGSFEASFYKVSMDLKNSVFEAMQELY  74

Query  938   DLPLQTKVR-NTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNF  765
             DLP+  + + N S K  HGY+       L+E +G++DAN+L     FT  +WP  GN N 
Sbjct  75    DLPVHDEEQGNVSFKHLHGYLK----TSLHEGLGVNDANVLEKVYEFTQQLWPDHGNKNI  130

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD-----D  600
               ++  + + LS +D MVRRMI+ES G+EKY+DEH+NST+YL R+MKY  P+ D     +
Sbjct  131   SETLHKFLKHLSEVDVMVRRMIMESFGIEKYIDEHLNSTDYLFRMMKY-TPDADNDDEEE  189

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              K GL SHTD N +TIL+Q +V+G E+  KD +WI V PSP+ F+VM+GDSL A  NGRL
Sbjct  190   PKQGLRSHTDTNYITILHQYQVDGFEMKTKDEKWIKVKPSPDHFLVMVGDSLSALLNGRL  249

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP+HRVM+   + RYS  LFS+PK   II +PEELVDE+HP +F PF H ++L F++SE
Sbjct  250   SSPHHRVMV--KKTRYSTALFSVPKPEVIIVSPEELVDEEHPRIFKPFVHDDYLHFFHSE  307

Query  239   EGQKCQSALATYCGV  195
              G++   AL  +C +
Sbjct  308   VGRRAPLALQAFCAI  322



>emb|CDP19783.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S S I+LP+I+ ++E L+ G  +W + RN V +A  EYGCF A  DK P  + +S+  
Sbjct  1     MDSASNIRLPVINLTEEILRSGKDSWTEARNTVTRAFEEYGCFIAVHDKYPSEVSDSIFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              L++LF+LPL+ KV+NTS  P  GY G  P +PLYES  I+DA  L   Q FTN MWP  
Sbjct  61    ELQDLFNLPLEIKVQNTSQTPLFGYYGPNPYLPLYESTSIEDAINLEAVQKFTNQMWPSK  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC  +  Y+ + + LD MV +++ ES GVEKY + H+ S  Y++R  KY+ PE ++T
Sbjct  121   NNHFCELLHCYANQAAELDKMVSKLVFESYGVEKYHESHVGSVTYIVRFTKYRVPEQNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G+  HTDKN +TIL Q++ +GLEV  K+G WI V+  P+S ++M GD+   W+NGR+H
Sbjct  181   NVGVLPHTDKNFITILQQSDADGLEVQLKNGSWIPVDFPPSSVVIMAGDAFSVWSNGRVH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRV M G + RYS   F+  K   ++K P ELVD++HPLL+ PFD+  FL F  ++E
Sbjct  241   SPFHRVTMKG-KGRYSIAQFAYCKK--LVKTPTELVDDEHPLLYKPFDNFGFLRFTSTDE  297

Query  236   GQKCQSALATYCGV  195
             G+K Q+ L  YCGV
Sbjct  298   GRKAQNPLKAYCGV  311



>ref|XP_009339602.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Pyrus x 
bretschneideri]
Length=313

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 207/315 (66%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP++DFS E LKPG  +W    N V +AL E+GCF   +DKI    R +++ 
Sbjct  1     MGSEVEQKLPVLDFSKEALKPGTNSWLLACNDVQQALEEFGCFVVLYDKISDEFRNALLR  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLP +TK+ N   KP +GYVGQ P +PL+ES+GID+A     TQ FT +MWP G
Sbjct  61    SLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNFEETQKFTKLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC +  ++++    LD MV RMI +S GVEKY D ++ S +YLLR+++ + P+ ++ 
Sbjct  121   NDKFCEAAYAFAKVAEELDQMVARMIFQSYGVEKYYDSYVGSISYLLRILQNRSPKENEH  180

Query  596   KIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              +G  +HTDK+  T+LYQ N+V+ LEV  ++ +WI V   P+SFIVM GD+L AW+N R+
Sbjct  181   NLGFVAHTDKSFTTVLYQNNQVHALEVETRNHEWIKVEFPPSSFIVMAGDALMAWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+MSGNE RYS   F+       I  PEEL +E+ PL +  FDH   L F+ S+
Sbjct  241   LSPNHRVIMSGNETRYSLAQFAFSDGE--IHVPEELGNEERPLRYKSFDHPGLLRFFRSQ  298

Query  239   EGQKCQSALATYCGV  195
             +G    SA+  YCGV
Sbjct  299   DGYISNSAIKAYCGV  313



>ref|XP_004151475.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=335

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 215/316 (68%), Gaps = 8/316 (3%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             +LP++ F  +NLK G   W     +V +AL EYGCF A +D +   +  +M D+LKELFD
Sbjct  9     QLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMFDSLKELFD  68

Query  935   -LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFC  762
              +PL+ K++N S KP+HGY GQ P++P++ESMGI+   L  N   FTN+MWP +GN +F 
Sbjct  69    EVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWPSRGNHSFR  128

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLN  582
              +V +Y+  +S LD  V+ M+ ES GV   +  HM ST YL+R++KY+ P+  +  +G  
Sbjct  129   ENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKEKEMNLGAF  188

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP----SPNSFIVMIGDSLYAWTNGRLHS  414
              HTDK+ +TIL+QNEVNGL++  +D +WI  +P    S +SFIVM GD+ +AW+NGR++S
Sbjct  189   PHTDKSFLTILHQNEVNGLQIKTRDNKWIQYHPFSSSSTSSFIVMAGDAFFAWSNGRIYS  248

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
             P HRV+MSGN+ RYS GLFS      I++ P+ELVD++HP LF PFDH ++L FY +E G
Sbjct  249   PPHRVIMSGNKERYSVGLFSFNNG--IVQIPKELVDDKHPQLFKPFDHQDYLRFYSTERG  306

Query  233   QKCQSALATYCGV*NS  186
             Q    A+  YCGV NS
Sbjct  307   QNSPCAIKAYCGVGNS  322



>ref|XP_002517545.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF44709.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=323

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 213/315 (68%), Gaps = 5/315 (2%)
 Frame = -1

Query  1136  MGSESGIK-LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             MGS++ +  LP ID S   L+ G   WD  ++++ KA+  YGCF   F KIP  L ++++
Sbjct  1     MGSDNSLNNLPEIDLS--GLERGTLEWDYAKSKLWKAVEHYGCFRVVFRKIPKELPDAIL  58

Query  959   DALKELFDLPLQTKVRN--TSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
               L+ELFDLPL+TK+ N   S   + GYVG  P  PLYES+G DD   +   +   + + 
Sbjct  59    SELRELFDLPLETKLLNNDISELAYGGYVGISPFGPLYESIGFDDPFKMEKIEKLISTLL  118

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             P G P+FC +V ++S+++S L+ ++  MI+ESLG+EKY+DEH+NS  Y  RV KY  P+ 
Sbjct  119   PPGKPDFCKNVHNFSKQMSELEIIIITMIVESLGIEKYLDEHLNSVFYSFRVQKYGVPKT  178

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
               T+IGLNSH D++++TILYQ +V+ LEV  KDGQW++   SP++F+V+IG+SL+AWTNG
Sbjct  179   GQTEIGLNSHKDQDVMTILYQTQVDALEVETKDGQWVDAKLSPDNFVVVIGESLHAWTNG  238

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R +SP HRV M  N  RYS GLF+  K GY++KAPEELVDE+HPLL+ PFDH E+L    
Sbjct  239   RAYSPNHRVTMKANTVRYSTGLFTAFKQGYLVKAPEELVDEEHPLLYKPFDHYEYLKLIQ  298

Query  245   SEEGQKCQSALATYC  201
              +  +   + L +Y 
Sbjct  299   RDAMENYGTTLKSYV  313



>ref|XP_006465422.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
 gb|KDO58206.1| hypothetical protein CISIN_1g046776mg [Citrus sinensis]
Length=314

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 203/316 (64%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE+  KLPI+D S ENLKPG  +W    N++  AL EYGCF A +DK     R  + D
Sbjct  1     MGSEAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALYDKHLPEFRNKVFD  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLP +TK++N + KP HGY+G+    PL+E MGI+ A      + FT++MWPQG
Sbjct  61    SLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRGECEKFTSLMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC    +Y+  ++ L  +V +M+ ES G+EK  +    ST YLLR +KY+  + D T
Sbjct  121   NYQFCEVAHTYANIVAELQQLVMKMLFESYGIEKLYESQKESTTYLLRFLKYRKSQTDTT  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +    HTDK++V+IL+ N V GLE+  KDG+WI+  PSP+SF+++ GD   AW+N R+ 
Sbjct  181   NLAFKGHTDKSLVSILHSNHVKGLELRTKDGEWIHFEPSPSSFVIIAGDVCMAWSNDRIK  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S YHRV++ G E RY+ GLFS      +I+ PEELVD++HPL + PFDH   L FY S  
Sbjct  241   SCYHRVIVDGPEVRYALGLFSFLSG--VIQTPEELVDDEHPLQYKPFDHAGLLQFYLSNS  298

Query  236   GQKC--QSALATYCGV  195
              Q    ++ +  YCG+
Sbjct  299   DQNKGERNMMKAYCGI  314



>ref|XP_008377590.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=291

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 200/292 (68%), Gaps = 2/292 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M SE+  KLP+ID SDENLKPG   W     ++  AL EYGCFEA + K+P+ L  SM  
Sbjct  1     MASETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSMFT  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A+++LF LPL+TK + TS++  H Y+GQY  +PLYES+ + +   +   Q FT+ MWPQG
Sbjct  61    AMEDLFGLPLETKKQKTSDRHLHSYLGQYSFIPLYESLAMANPTTVEGAQGFTSTMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC +  S+S+ ++ L  MV RM+ +  GV++  D HM  T Y LR  KY+  + ++T
Sbjct  121   NDHFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLYDSHMELTTYQLRWYKYRTQQANET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G+  HTDK+ ++IL Q++VNGL++  KD QWI+V PSP+SF+++ GD+  AW+N R+ 
Sbjct  181   NVGMLPHTDKSFISILNQDQVNGLQIGTKDSQWIDVKPSPSSFLILAGDAFMAWSNDRVP  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEF  261
             S  H+V M  N+ RYS GLFS  K+G II+ PEEL+DE+HPLL+ PFDH  F
Sbjct  241   SCEHQVTMRENKTRYSLGLFSF-KSG-IIQVPEELIDEKHPLLYKPFDHFSF  290



>emb|CDX97295.1| BnaA02g20860D [Brassica napus]
Length=294

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 207/317 (65%), Gaps = 29/317 (9%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS+S  +LP+I  SD+ LKPG   W +VRN V KAL +YG FE ++D++   L++S+++
Sbjct  1     MGSDSTPQLPVIYLSDQTLKPGSEKWVEVRNDVRKALEDYGAFEVSYDRVSEELKQSVLE  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP--  783
             A+KELF+LP++ K RN S KP+ GY        L ES+GI DA +L     FT ++ P  
Sbjct  61    AMKELFELPVEAKRRNVSPKPYTGYSTHN---GLSESLGIQDAEVLEKVNEFTQLLRPDF  117

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             +GN +   ++Q +SEKL+ LD MVRRM++ES G+EKY DEH+ STNY LR+MKY  P   
Sbjct  118   EGNKSISETIQKFSEKLAELDVMVRRMVMESFGIEKYFDEHLKSTNYRLRLMKYIAPP--  175

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
                                  ++ GLEVLNKD +WI + PS NSF+VM GDS+YA  NGR
Sbjct  176   ---------------------DIEGLEVLNKDEKWIRLKPSRNSFVVMAGDSVYALMNGR  214

Query  422   LHSPYHRVMMS-GNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             L  P+HRV ++   + RYS  LFS P AGYII+ P+ELVDE+HP +F PF +V+ + FY+
Sbjct  215   LFRPFHRVRVTEKKKTRYSIALFSTPNAGYIIEPPKELVDEKHPRVFKPFTYVDLMSFYH  274

Query  245   SEEGQKCQSALATYCGV  195
             +E G++ +S L  YC V
Sbjct  275   TEGGRRARSTLHAYCAV  291



>ref|XP_009107019.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=322

 Score =   309 bits (792),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 214/314 (68%), Gaps = 5/314 (2%)
 Frame = -1

Query  1121  GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
              ++LP+IDF+  NLKPG   WD VR  V +AL EYGCFEA  DK+P+ LRE++ +  +E 
Sbjct  9     ALQLPVIDFTSPNLKPGTVEWDSVRGDVRRALEEYGCFEALDDKVPVQLREAVFNVSEEA  68

Query  941   FDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFC  762
             F LPL+TK R  S + + GYVGQ P +PL+E MG+D A        FT+ +WPQGN +F 
Sbjct  69    FQLPLETKQRVVSKRKYRGYVGQIPTLPLFEVMGVDFAENEDKVNEFTHKLWPQGNASFS  128

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKG-PECDDTKIG  588
              +V  ++EK+S LD M RRMI+ES G+ E Y+D+H+ ST  L+R+MKY+G  E  + ++G
Sbjct  129   EAVMLFTEKVSKLDLMTRRMIMESFGISENYIDKHLKSTKCLMRMMKYQGVEEETEEELG  188

Query  587   LNSHTDKNIVTILYQNEV-NGLEVLNKDGQ-WINVNPSPN-SFIVMIGDSLYAWTNGRLH  417
             +  HTD+N++TIL QN+V +GLEV   D + WI  NPS + SFIV+ G +L+   NGR+ 
Sbjct  189   MEVHTDRNMLTILCQNDVKDGLEVRASDNKGWIKANPSQDSSFIVLGGATLHVLLNGRVF  248

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             +  HRVM +G + R+SAGLFS+PK  ++I AP+E+VD +HP LF PFD   +  F     
Sbjct  249   TGVHRVMRTGTKTRFSAGLFSVPKKDHLIYAPDEIVDAEHPRLFKPFDFEAYFQFTTEGP  308

Query  236   GQKCQSALATYCGV  195
             G++  +AL TYCG+
Sbjct  309   GRRDLAALRTYCGL  322



>ref|XP_009147661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3 isoform 
X1 [Brassica rapa]
Length=310

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/309 (48%), Positives = 206/309 (67%), Gaps = 4/309 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LKPG   W      + +AL EYGCF     DK P+ L + +  +L ELF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK+RN  +KP +GYVGQ P +PL+ES+GID+A  L  T+ FT +MWPQGN +F  
Sbjct  64    DLPTQTKMRNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFSE  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              V  Y+E  + LD MV RM+ ES  VEK+   ++ ST YLLRV+K   P  D + +G  +
Sbjct  124   CVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKSNLGFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+QN+VNGLE+  ++G+ IN+N  SP+ F+++ GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQNQVNGLEMETREGERININLSSPSLFMIVAGDALMAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG+  RYS G+FS       ++ PEEL+D QHPL++ PFDH+  L FY ++ G K  
Sbjct  244   VLVSGDTDRYSLGMFSFNNG--TLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKSV  301

Query  221   SALATYCGV  195
               +  YCG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_010061959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW69006.1| hypothetical protein EUGRSUZ_F02566 [Eucalyptus grandis]
Length=313

 Score =   308 bits (790),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 210/316 (66%), Gaps = 5/316 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++ + +P ID + EN KP   +W    N V  AL E+G F A +DK+  HLRE ++ 
Sbjct  1     MGSQT-MPIPTIDLTLENSKPQSSSWVTTCNDVRLALEEHGWFVAKYDKLSPHLREVILS  59

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              + ELF LP +TK++NTS+KP  GYVG+   +PL+E +GID A  L   Q FT +MWP G
Sbjct  60    DVVELFKLPYETKIQNTSDKPAFGYVGKIAAIPLHEGLGIDRATDLGECQKFTKLMWPSG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC + Q Y++ ++ L+  V RM+ ES GVEK+ + H+ +T YLLR + Y+ PE D+ 
Sbjct  120   NDRFCENAQLYAKTVAELEQTVVRMLFESYGVEKHCESHLGATTYLLRFLNYRRPENDEA  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +   +HTDK+ ++IL+QN V GLE+ NKDG+WI   PSP+SF+V+ GD+  AW+N R+ 
Sbjct  180   NLAFVTHTDKSFISILHQNHVRGLELRNKDGEWIGFEPSPSSFLVLAGDACMAWSNNRVR  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
               YHRV+M GNEARY+ GLFS    G +I+ PEEL+D++HP+ + PFDHV  L FY + +
Sbjct  240   PGYHRVVMKGNEARYALGLFSF--RGGLIETPEELIDDEHPMQYKPFDHVGLLRFYDTVD  297

Query  236   GQKCQSALAT--YCGV  195
              ++      T  YCGV
Sbjct  298   VRERAKHTMTKAYCGV  313



>ref|XP_006392870.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
 gb|ESQ30156.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
Length=316

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/309 (48%), Positives = 207/309 (67%), Gaps = 4/309 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E LKPG   W+     + +AL EYGCF     DK P+ L + +  +L ELF
Sbjct  4     KIPTLDFSREVLKPGTKYWESTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK++N  +KP +GYVGQ P +PL+ES+GIDDA  L  T+ FT +MWPQGN  F +
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDDATSLVATRSFTGLMWPQGNERFSD  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             SV  Y+E ++ LD MV RM+ ES  VEK  + ++ ST YLLRV+K + P   ++ +G  +
Sbjct  124   SVHKYAEFVAKLDQMVTRMVFESYNVEKDYNPYIESTTYLLRVLKTRAPNSKNSNLGFIT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+QN+VNGL +  ++G+ IN+N  SP+ F+V+ GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQNQVNGLVMETREGERININLSSPSLFMVVAGDALMAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG   RYS G+FS       ++ PEEL+D QHPL + PFDH+  L FY ++ G K +
Sbjct  244   VLVSGETDRYSLGMFSFNNG--TLQVPEELIDHQHPLKYKPFDHIGLLRFYRTDTGYKSE  301

Query  221   SALATYCGV  195
               +  YCG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_007214491.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
 gb|EMJ15690.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
Length=315

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 202/317 (64%), Gaps = 5/317 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDEN--LKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             MGS+   KLP++DFS E   LKPG  +W      V +AL E+GCF  ++DK+P   +   
Sbjct  1     MGSDGQPKLPVLDFSKEAEALKPGTNSWVSACKDVRQALEEFGCFFVSYDKLPPEFQNGF  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
             +  LKELFDLP QTK+ N S  P  GY GQ P +PL+E +GI++A  L  TQ FT +MWP
Sbjct  61    LGTLKELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMWP  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
              GN NFC S  S+++    LD MV RMI ES G+EKY D ++ S +YLLR++K + P+ +
Sbjct  121   GGNDNFCESAHSFAKVAEELDQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQEN  180

Query  602   DTKIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             +  +G  +HTDK+  T+LYQ N+ +GLEV  K  +WI     P+SF+VM GD+L AW+N 
Sbjct  181   EPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKSHEWIRAEFPPSSFLVMAGDALMAWSND  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R+ SP HRV+M+GNEARYS   F+       I  PEEL DEQHPL +  FDH   L F+ 
Sbjct  241   RILSPNHRVIMNGNEARYSLAQFAFSDGE--IHVPEELADEQHPLRYKSFDHPGLLVFFR  298

Query  245   SEEGQKCQSALATYCGV  195
             + E     SA+  YCGV
Sbjct  299   TNESYVSNSAIKAYCGV  315



>emb|CDY68239.1| BnaA06g37440D [Brassica napus]
Length=310

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 206/308 (67%), Gaps = 4/308 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LKPG   W      + +AL EYGCF     DK P+ L + +  +L ELF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK++N  +KP +GYVGQ P +PL+ES+GID+A  L  T+ FT +MWPQGN +F  
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFSE  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              V  Y+E  + LD MV RM+ ES  VEK+   ++ ST YLLRV+K   P  D + +G  +
Sbjct  124   CVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKSNLGFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+QN+VNGLE+  ++G+ IN+N  SP+ F+++ GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQNQVNGLEMETREGERININLSSPSLFMIVAGDALMAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG+  RYS G+FS       ++ PEEL+D QHPL++ PFDH+  L FY ++ G K +
Sbjct  244   VLVSGDTDRYSLGMFSFNNG--TLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKSE  301

Query  221   SALATYCG  198
               +  YCG
Sbjct  302   CPIKAYCG  309



>gb|KFK35768.1| hypothetical protein AALP_AA4G033700 [Arabis alpina]
Length=310

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 208/309 (67%), Gaps = 4/309 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LK G   W+     + +AL EYGCF     DK P+ L + +  +L ELF
Sbjct  4     KIPTLDFSREDLKQGTKYWESTSKNIIQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             +LP QTK++NT +KP +GYVGQ P +PL+ES+GID+A  L  T  FT +MWPQGN +F  
Sbjct  64    NLPTQTKMKNTYDKPLNGYVGQIPALPLHESLGIDNATSLEATSSFTGLMWPQGNKHFSE  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              +  Y+E  + LD MV RM+ ES  V+KY D+++ ST YLLRV+K + P  ++ K+   +
Sbjct  124   CMHKYAEFTAELDQMVTRMVFESYNVKKYYDQYIKSTTYLLRVLKNRAPNNENKKLAFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+QN+VNGLE+   +G+ IN+N  SP+ F+++ GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQNQVNGLEMETTEGERININLSSPSLFMIVAGDALMAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V+MSG+  RYS G+FS       ++ PEEL+D QHPL + PFDH+  L FY ++ G K +
Sbjct  244   VLMSGDTDRYSLGMFSFNNG--TLQVPEELIDHQHPLKYKPFDHIGLLRFYRTDTGYKSE  301

Query  221   SALATYCGV  195
               +  YCG+
Sbjct  302   CPIKAYCGL  310



>ref|XP_008377591.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Malus domestica]
Length=313

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 202/315 (64%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE   KLP++DFS E LKPG  +W      V +AL E+GCF   +DKI    R + + 
Sbjct  1     MGSEVEQKLPVLDFSKEALKPGTNSWLLACKDVQRALEEFGCFVVLYDKISDEFRNAFVG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +L+ELFDLP +TK+ N   KP +GYVGQ P +PL+ES+GID A     T+ FT +MWP G
Sbjct  61    SLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDCATNFEETKKFTKLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC    ++++    LD MV RMI ES GVEKY D ++ S +YLLR+++ + P+ ++ 
Sbjct  121   NDKFCERAYAFAKVAEELDQMVARMIFESYGVEKYYDSYVGSISYLLRILQNRSPKENEH  180

Query  596   KIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
              +G  +HTDK+  T+LYQ N+VN LEV  ++ +WI V   P+SFIVM GD+L AW+N R+
Sbjct  181   NLGFVAHTDKSFTTVLYQNNQVNALEVETRNHEWIKVEFPPSSFIVMAGDALMAWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              SP HRV+MSGNE RYS   F+       I  PEEL DE+ PL +  FDH   L F+ S+
Sbjct  241   LSPNHRVIMSGNETRYSLAQFAFSDGE--IHVPEELGDEERPLRYKSFDHPGLLRFFRSQ  298

Query  239   EGQKCQSALATYCGV  195
             +     SA+  YCGV
Sbjct  299   DRYISNSAIKAYCGV  313



>gb|KFK35767.1| hypothetical protein AALP_AA4G033600 [Arabis alpina]
Length=313

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 204/308 (66%), Gaps = 3/308 (1%)
 Frame = -1

Query  1115  KLPIIDF-SDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             K+PI+D  S ++LKP   TW  +  +  +AL EYGCF A +D +   L +S   A KELF
Sbjct  8     KVPILDLTSQQDLKPNTSTWRSISKEACEALEEYGCFVAVYDGVTKQLDDSAFAAAKELF  67

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP +TK +N + KP+HGYVGQ P++PL+E +GID      + Q FT++MWPQGN +FC 
Sbjct  68    DLPTETKRKNVNEKPYHGYVGQMPIIPLHEGLGIDYITNKEDAQRFTHLMWPQGNHHFCE  127

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             +VQ++S  ++ LD +V RMI E+ GVEK  + H+ S  YLL+ +KY  P    +      
Sbjct  128   TVQAFSTAVAELDKLVVRMIFENYGVEKNYESHVESKTYLLKFLKYLAPPESTSMQAFPQ  187

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             HTDK  ++IL+QN+VNGLEV +KDG+WI++   P S++VM GD    W+N R+ S  HRV
Sbjct  188   HTDKTFLSILHQNDVNGLEVKSKDGEWISLQLPPKSYVVMAGDISMGWSNDRIRSCEHRV  247

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQS  219
              M G++ RY+ GLFS      ++  PE+LVD++HPL++ PFD++  + FY ++EG++  S
Sbjct  248   TMEGDKTRYTLGLFSFVTG--MVSVPEDLVDDEHPLMYKPFDNIALINFYATKEGREANS  305

Query  218   ALATYCGV  195
              L  YCG+
Sbjct  306   TLKAYCGI  313



>ref|XP_006406954.1| hypothetical protein EUTSA_v10021145mg [Eutrema salsugineum]
 gb|ESQ48407.1| hypothetical protein EUTSA_v10021145mg [Eutrema salsugineum]
Length=322

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 209/312 (67%), Gaps = 4/312 (1%)
 Frame = -1

Query  1118  IKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             + LP+IDFS  +LKP    WD VR +V KAL EYGCFEA FD   + LR+++ +A +E F
Sbjct  11    LTLPVIDFSSRDLKPETLEWDSVRARVRKALEEYGCFEALFDGASVELRKALFEASEEAF  70

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLPL+TK    S+K + GYVGQ P +PLYE MG D A+        T+ +WPQGN  F  
Sbjct  71    DLPLETKQSTKSDKLYKGYVGQVPTIPLYEGMGFDGADNPEVVDDMTHKLWPQGNVTFSK  130

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKG-PECDDTKIGLN  582
             +VQS++EKL  LD  VR MI+ES G+EKY+DEH+NS     R  KY+G  E  + K+GL+
Sbjct  131   NVQSFAEKLIELDVKVRTMIMESFGLEKYIDEHLNSAKNHFRFFKYRGLDENTEEKLGLD  190

Query  581   SHTDKNIVTILYQNE-VNGLEVLNKDG-QWINVNPSPN-SFIVMIGDSLYAWTNGRLHSP  411
              H D++ +TIL QN+ V+GLE+  KDG +WI   PS + SF+V+ G SL+   NG +  P
Sbjct  191   PHIDRHFLTILCQNDVVDGLEIKAKDGEEWIKAKPSQDSSFLVIAGASLHVLLNGGVFPP  250

Query  410   YHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQ  231
              HRV+++G + R++AGLF +PK G II APEE+VD++HP L+ PFD   +  F Y++  +
Sbjct  251   LHRVIITGKKDRHAAGLFLLPKEGLIINAPEEMVDDEHPRLYKPFDFEAYFKFTYTDTKK  310

Query  230   KCQSALATYCGV  195
             +  SAL TYC +
Sbjct  311   RDLSALKTYCSL  322



>ref|NP_175688.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52288.1|AC019018_25 putative oxidoreductase; 32373-31266 [Arabidopsis thaliana]
 gb|AEE32852.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=310

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 209/308 (68%), Gaps = 4/308 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LKPG   W+  R  + +AL EYGCF     DK P+ L + +  +L +LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRENIRQALEEYGCFIIDLKDKTPLDLLDRVFGSLVDLF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK++N  +KP +GYVGQ P +PL+ES+GID+A  L  T+ FT +MWPQGN +F  
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNEHFSE  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              +  Y+E  + LD MV RM+ +S  VEKY D ++ ST YLLRV+K + P  ++  +G  +
Sbjct  124   CLYKYAEFAAELDQMVTRMVFQSYNVEKYYDPYIESTTYLLRVLKNRAPNNENPTLGFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+Q++VNGLE+  ++G+ IN+N  SP+ F+V+ GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQDQVNGLEMETREGERININLSSPSLFMVVAGDALMAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG   RYS G+F+       ++ PEEL+D QHPL++ PFDH+  L FY ++ G K +
Sbjct  244   VLVSGETDRYSLGMFAFNNG--TLQVPEELIDHQHPLMYKPFDHLGLLRFYRTDTGYKSE  301

Query  221   SALATYCG  198
               +  YCG
Sbjct  302   CPIKAYCG  309



>ref|XP_011072311.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   306 bits (784),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 208/316 (66%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS +  +L +ID S+E LK G  +W      + +AL  +GCF A +DKI   L  S+  
Sbjct  1     MGSLNLPELVVIDLSNEGLKAGSSSWSSACKDIRQALENHGCFIALYDKISPQLHRSIFQ  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A  +LFDLP + KV+N + KP+HGYVGQ P+VPL+E +GID A  L   Q FT +MWP G
Sbjct  61    AADQLFDLPTEVKVQNINEKPYHGYVGQMPIVPLHEGLGIDYATTLEGAQSFTKLMWPDG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC +  S+++ ++ ++ +  R++ ES GV+KY D H+ +T YLLR +KY+ PE  ++
Sbjct  121   NDSFCETAMSFAKTVADIEKIAVRLLFESYGVQKYTDSHVEATTYLLRFLKYRAPEEGES  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
                  SHTDK+  T+L+QN ++GLEV  ++G+WINV   P+SF+VM GD+  AW+N R+ 
Sbjct  181   NNAFPSHTDKSFFTVLHQNHISGLEVRARNGEWINVVFPPSSFVVMAGDACQAWSNNRVL  240

Query  416   SPYHRVMM--SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             SP H+V +  +G E RY+   FS      +++ PEELVD++HPL F PF HV+ L FY +
Sbjct  241   SPNHKVSLDKNGKETRYTMAQFSF--LSKMVEVPEELVDDEHPLQFKPFAHVDLLNFYAT  298

Query  242   EEGQKCQSALATYCGV  195
             + G++ Q+ L  +CGV
Sbjct  299   DHGRRSQNILKDFCGV  314



>gb|AAL14694.1| 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=261

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 193/262 (74%), Gaps = 11/262 (4%)
 Frame = -1

Query  1061  WDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGY  882
             WD+V   V KAL +YGCFEA+FDK+ + L  S+ +A+++LF+LP+ TK RN S+KPFHGY
Sbjct  4     WDEVTADVLKALEDYGCFEASFDKLSVELNRSVFEAMEDLFELPIPTKQRNVSSKPFHGY  63

Query  881   VGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFCNSVQSYSEKLSGLDDMVRR  705
             +       LYES+GI+DAN+L     FT  +WP  GN +   ++  +SE+L  LD MVRR
Sbjct  64    LCH----NLYESLGINDANVLEKVNDFTQQLWPDHGNKSISETIHLFSEQLVELDLMVRR  119

Query  704   MILESLGVEKYMDEHMNSTNYLLRVMKYKGP------ECDDTKIGLNSHTDKNIVTILYQ  543
             MI+ES G+E Y+DEH+NST YL R+MKY  P      + ++TK+GL SHTDKNI+TIL+Q
Sbjct  120   MIMESFGIENYIDEHLNSTYYLTRLMKYTSPPDDDDDDDEETKLGLRSHTDKNIITILHQ  179

Query  542   NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAG  363
              +V+GLEV  KD +WI V PS +S +VM+GDSL A  NGRLHSPYHRV+M+G + RYS G
Sbjct  180   YQVDGLEVKTKDDKWIKVKPSQDSVLVMVGDSLCALLNGRLHSPYHRVIMTGKKTRYSTG  239

Query  362   LFSIPKAGYIIKAPEELVDEQH  297
             LFSIPK G II +PEELVD++H
Sbjct  240   LFSIPKTGVIIDSPEELVDKEH  261



>emb|CDY26055.1| BnaC06g05690D [Brassica napus]
Length=310

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 205/309 (66%), Gaps = 4/309 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LKPG   W      + +AL EYGCF     DK P+ L + +  +L +LF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVQLF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK++N  +KP +GYVGQ P +PL+ES+GID+A  L  T+ FT +MWPQGN +F  
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFSE  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              V  Y+E  + LD MV RM+ ES  VEK+   ++ ST YLLRV+K   P  D   +G  +
Sbjct  124   CVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKPNLGFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+QN+VNGLE+  ++G+ IN+N  SP+ F+++ GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQNQVNGLEMETREGEKININLSSPSLFMIVAGDALMAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG   RYS G+FS       ++ PEEL+D QHPL++ PFDH+  L FY ++ G K +
Sbjct  244   VLVSGETDRYSLGMFSFNNG--TLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKSE  301

Query  221   SALATYCGV  195
               +  YCG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_002517690.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44854.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=307

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 204/314 (65%), Gaps = 7/314 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M  E+  KLP +DFS E LKPG   W K   +V  AL EYGCF   + K+ + LR+ +  
Sbjct  1     MVVEAAPKLPALDFSQETLKPGSSCWLKACGEVRTALEEYGCFVVEYKKLSLELRDEVFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              LKELFDLP   K++N   +P   Y+GQ   +PL+ESMGI+DA+     Q+FTN+MWP G
Sbjct  61    ELKELFDLPTAVKMQNKCQRPLISYIGQNSRIPLHESMGIEDADTPEAAQNFTNLMWPNG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  F   + +Y + +  LD +V RMI ES G+ KY D ++ ST Y++R++K + P+ D+T
Sbjct  121   NDRFSECIHAYGKLVVELDKIVTRMIFESYGLGKYHDSYVESTCYVIRLLKTRAPKEDET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +GL +HTD +  TIL+QN+VNGLE+  KDG+ INV+ SP SF+VM GD+L AW+N R+ 
Sbjct  181   VLGLGAHTDTSFTTILHQNQVNGLEIDTKDGKKINVDFSPTSFVVMAGDALMAWSNDRIK  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP H+V+M+G   RYS GLF+       ++ PEELV+E HPL + PF+H+EFL FY    
Sbjct  241   SPRHQVIMNGKVDRYSMGLFTFNNGN--LQVPEELVNEDHPLTYKPFNHIEFLHFY----  294

Query  236   GQKCQSALATYCGV  195
              Q     +  YCG+
Sbjct  295   -QNNHRPIRFYCGI  307



>emb|CDP10327.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS +  KL ++DF++E LKPG  +W    N + +AL  +GCF A ++K+   L +++  
Sbjct  1     MGSPAPRKLLVVDFTNEELKPGSSSWASACNDIQRALENHGCFIALYNKVSPELDKAIFQ  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A  +LFDLP + KV+N + KP+HGY+GQ P VPL+E +GID A  L   Q FTN+MW +G
Sbjct  61    AADDLFDLPTELKVQNINEKPYHGYIGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWSKG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F  S  S+++ ++ LD+MV +M+ ES GVEKY D H++ST YLLR +KY+ PE ++T
Sbjct  121   NKSFSESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHIDSTRYLLRFLKYRAPEMNET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +   SHTDK+ +TILYQN ++GLE+  +D +WI V+    SF+VM GD+  AW+N R+ 
Sbjct  181   TMAFPSHTDKSFLTILYQNHISGLEIRTRDDEWIKVDFPQKSFVVMAGDACQAWSNDRVL  240

Query  416   SPYHRVMM--SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             S  H+V M  +G E RY+  LFS      +++ PEELV+++ PL F PF H++ L FY +
Sbjct  241   SSNHKVTMDANGKETRYTIALFSF--LSKMVQVPEELVNDEKPLQFKPFVHIDLLNFYAT  298

Query  242   EEGQKCQSALATYCGV  195
             ++G+K Q+ L  +CGV
Sbjct  299   DQGRKSQNILKDFCGV  314



>ref|XP_009379331.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=313

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 205/315 (65%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSD-ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             MGSE   KLP++D ++ ENLKPG   W     QV +AL + GCFEAT+  +P+ L  +M 
Sbjct  1     MGSEGQAKLPVVDLTNAENLKPGTEAWRSTCKQVQQALEDCGCFEATYHGVPLDLHNAMF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
                  LFDLP++TK + TS+KP+H Y+GQ   +PLYES+G+D A      + FTN+MWP 
Sbjct  61    SMSNGLFDLPVETKCQKTSDKPYHSYIGQISSLPLYESLGVDYATTPEGVEKFTNMMWPA  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             G+  F   V ++S  ++ L  +V +M+  + GV++  + HM ST YLLR  +Y+  + ++
Sbjct  121   GSDEFREKVYNFSNLVAELTKLVTKMVFHNYGVQRLYESHMASTIYLLRWSQYREQKENE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
             T +GL  HTDK  +++L+Q EVNGLEV  KDGQW    PSP SF+VM GD+  AW+NGR+
Sbjct  181   TNVGLPPHTDKAFISVLHQKEVNGLEVQTKDGQWFVAEPSPTSFVVMAGDAFMAWSNGRV  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              S +H+V+M  N+ R S GLFS       ++ PEEL+D++HPL + PFDH  +L F  + 
Sbjct  241   PSCFHQVIMKQNKTRLSIGLFSWLNG--TVQVPEELIDDEHPLSYKPFDHFSYLHFSVTP  298

Query  239   EGQKCQSALATYCGV  195
             E ++ + A+ TYCGV
Sbjct  299   EAKQSKCAIKTYCGV  313



>ref|XP_007024335.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY26957.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
Length=642

 Score =   315 bits (808),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 215/330 (65%), Gaps = 4/330 (1%)
 Frame = -1

Query  1181  ITQFNQKAKELKERKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEA  1002
             ++ ++Q+        M ++S IKLP+ID  D+  +PG  +W     +V +A  EYGCF A
Sbjct  316   LSNYSQQKSSKNYMIMATQSAIKLPVIDLFDDESEPGTDSWISKCEEVQRAFEEYGCFLA  375

Query  1001  TFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANL  822
             T+DK+ + L++ + D+++ELF LP + KV NTS+KP+ GY  ++P +PL ESMGID+  +
Sbjct  376   TYDKVSLQLQDEVFDSVRELFHLPTEKKVLNTSDKPYFGYF-KHPSIPLSESMGIDNPTI  434

Query  821   LHNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNY  642
             L  TQ FTN+MWP GN  FC S+ +Y++ +S LD MV+ M+ ES GV KY D H+ STNY
Sbjct  435   LEGTQSFTNLMWPNGNQIFCESIYAYAKLVSELDRMVKTMVFESYGVRKYYDSHIQSTNY  494

Query  641   LLRVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIV  462
             LLR++KY+ P  D+       HTDK+ +TIL+ N + GL++  KDG WI V PS + F+V
Sbjct  495   LLRLIKYRVPREDENDFDGCPHTDKSFMTILHDNHIAGLQIKAKDGNWIGVEPSGSMFVV  554

Query  461   MIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFN  282
             M GD+  AW+NGR+ SP HRV+M   + RY   LFS   +G  I+ PEELVDE HPLLF 
Sbjct  555   MAGDAFLAWSNGRIQSPTHRVIMKAKKERYCLALFSF--SGETIRTPEELVDEAHPLLFK  612

Query  281   PFDHVEFLGFYYSEE-GQKCQSALATYCGV  195
             PFD+++ L  +  ++  Q  +S     CG 
Sbjct  613   PFDNMDLLRLFSLDDVHQHARSFSQPKCGA  642


 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 209/303 (69%), Gaps = 3/303 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M  +S ++LP+ID  DEN  PG  +W      V  AL EYGCF   +DK+ + L++ + +
Sbjct  1     MAPQSAVRLPVIDLFDENSVPGTASWVSKCKDVRLALEEYGCFLTPYDKVSLQLQDQVFN  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             +++ELF LP + KV+NTS+KP+ GY  ++P++PL ESMGID   +L  TQ FT++MWP G
Sbjct  61    SVQELFALPTEKKVQNTSDKPYFGYF-KHPLIPLSESMGIDGPTVLEGTQSFTDLMWPNG  119

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC SV +Y++ +S LD  V+ M+ ES GV KY D H++ST+YLLR++KY+ P+ ++T
Sbjct  120   NKRFCESVHTYAKLVSQLDRRVKYMVFESYGVGKYFDSHIDSTSYLLRLIKYRLPKEEET  179

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
                   HTDK+ +TIL+ N+V GLE+  KDG+WI V PS + FIVM GD+  AW+NGR+H
Sbjct  180   NNCGFPHTDKSFLTILHDNQVAGLEIKTKDGRWIGVEPSGSMFIVMAGDAFLAWSNGRVH  239

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             S  HRV+ +G + RYS G FS   +G  I+ PEEL+DE HPLLF PF++++ L  Y  ++
Sbjct  240   SALHRVVTNGKKERYSLGFFSF--SGETIRTPEELIDEAHPLLFKPFENIDLLRLYSLDD  297

Query  236   GQK  228
              +K
Sbjct  298   VRK  300



>ref|XP_008794218.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Phoenix dactylifera]
Length=323

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 212/313 (68%), Gaps = 3/313 (1%)
 Frame = -1

Query  1127  ESGIKLPIIDFSDENLK-PGCPTWDKVRNQVHKALVEYGCFEATFDKI-PIHLRESMIDA  954
             E+ +++P +D +   L+  G   WD  R +V +AL  YGCF+A +D + P  LR      
Sbjct  5     EAQLRIPRVDLTGLRLEHVGTARWDAAREEVARALESYGCFDAVYDGVGPELLRTLFGKG  64

Query  953   LKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGN  774
              KELF LPL+TK +N++  P+HGY+GQ P +  YES+ ++DA ++   + FT +MWP GN
Sbjct  65    AKELFGLPLETKRKNSAGTPYHGYIGQLPGLD-YESLALEDAEVMRGAERFTRLMWPDGN  123

Query  773   PNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTK  594
             P F +++ S+++KL  LD +V++MILESLG +KY D H+++T YLLR+ +Y+ P+  +T 
Sbjct  124   PEFRDTLCSFAKKLVELDRLVQKMILESLGADKYFDSHIDTTKYLLRLAEYRAPQTSETI  183

Query  593   IGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHS  414
             + +  HTD + VTI+ Q++V+GLE+L K+  WI V PSP+SF +M GD+  AW+NGRL  
Sbjct  184   VCMPEHTDHSFVTIICQDQVSGLEILTKNRDWITVRPSPDSFTIMTGDAFEAWSNGRLVP  243

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
             P HRV+++G   RYS+ L S  K G++++AP ELVD++HP+LF P+ H ++L F  +E G
Sbjct  244   PRHRVVLNGGNTRYSSILCSFRKDGHLVQAPNELVDKEHPMLFKPYLHGDYLNFCITEAG  303

Query  233   QKCQSALATYCGV  195
                Q  L  +CG+
Sbjct  304   YNAQHRLRAFCGL  316



>ref|XP_008226092.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=315

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 202/317 (64%), Gaps = 5/317 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDEN--LKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             MGS+   KLP++DFS E   LKPG  +W      V +AL E+GCF  ++DK+P   +   
Sbjct  1     MGSDGQPKLPVLDFSKEAEALKPGTNSWLSACKDVRQALEEFGCFFVSYDKLPPEFQNGF  60

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP  783
             + AL+ELFDLP QTK+ N S  P  GY GQ P +PL+E +GI++A  L  TQ FT +MW 
Sbjct  61    LGALQELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMWA  120

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
              GN NFC S  S+++    L+ MV RMI ES G+EKY D ++ S +YLLR++K + P+ +
Sbjct  121   GGNDNFCESTHSFAKVAEELNQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQEN  180

Query  602   DTKIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             +  +G  +HTDK+  T+LYQ N+ +GLEV  K  +WI     P+SF+VM GD+L AW+N 
Sbjct  181   EPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKSHEWIRAEFPPSSFLVMAGDALMAWSND  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R+ SP HRV+MSGNEARYS   F+       I  PEEL DEQHPL +  FDH   L F+ 
Sbjct  241   RILSPNHRVIMSGNEARYSLAQFAFSDGE--IHVPEELADEQHPLRYKSFDHPGLLVFFR  298

Query  245   SEEGQKCQSALATYCGV  195
             + E     SA+  YCGV
Sbjct  299   TNESYISNSAIKAYCGV  315



>ref|XP_011019740.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=364

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 216/332 (65%), Gaps = 8/332 (2%)
 Frame = -1

Query  1178  TQFNQKAKELKERKMGSESGIKLPIIDFSDE---NLKPGCPTWDKVRNQVHKALVEYGCF  1008
             T  N   + ++ER M + S +++P +DFS+E    L+     W ++ NQV +A   +G F
Sbjct  37    TTANNSIERVRERDM-TVSKVEIPFLDFSEEALTGLEVKSEKWKELCNQVREACEAHGVF  95

Query  1007  EATFDKIPIHLRESMIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDA  828
                +DKIP  LRE M  A+K LFDLP +TK R+ + KP+  Y+G+ P+VP +ES G+DDA
Sbjct  96    FLVYDKIPSSLREEMFGAMKALFDLPEETKNRHVNPKPYRSYLGKCPVVPFHESFGVDDA  155

Query  827   NLLHNTQHFTNIMWPQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNST  648
               L  +Q FTN+MWP+GNP+FC ++ S S K+  L+ +V +MI ES G+EK  D  +  T
Sbjct  156   PTLDASQAFTNLMWPEGNPSFCETIHSMSSKMQELNFLVMKMIYESFGIEKLYDSFLEET  215

Query  647   NYLLRVMKYKGPECD-DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNS  471
               +L+VMKYK P  D ++ IGL +HTDKN +TIL QNEV GLEV  K+G W  V    N+
Sbjct  216   TSILKVMKYKVPPSDTESAIGLVAHTDKNAITILCQNEVQGLEVQAKNGDWAQVMVPENA  275

Query  470   FIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPL  291
             F  ++GD++ AW+NGRLH+  HRV++SG+  RYS GLFS PK   +I+ P ELVD++HPL
Sbjct  276   FTAIVGDTVKAWSNGRLHAARHRVVISGDRDRYSCGLFSTPKEEAVIEVPNELVDKEHPL  335

Query  290   LFNPFDHVEFLGFYYSEEGQKCQSALATYCGV  195
              + PF+  ++L ++ S   +    AL  Y G+
Sbjct  336   QYRPFNFSDYLSYFVS---KLSDDALEIYAGI  364



>emb|CDX91263.1| BnaC02g26740D [Brassica napus]
Length=294

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 205/317 (65%), Gaps = 29/317 (9%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS+S  +LP+I  SD+ LKPG   W +VR+ V KAL +YG FE  +D++   L++S+++
Sbjct  1     MGSDSTPQLPVIYLSDQTLKPGSEKWVEVRSDVRKALEDYGAFEVPYDRVSEELKQSVLE  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP--  783
             A+KELF+LP++ K RN S KP+ GY        L ES+GI D  +L     FT ++ P  
Sbjct  61    AMKELFELPVEAKRRNVSPKPYTGYSTHN---GLSESLGIQDPEVLEKVNEFTQLLRPDC  117

Query  782   QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD  603
             +GN +   ++Q +SEKL+ LD MVRRM++ES G+EKY DEH+ STNY LR+MKY  P   
Sbjct  118   EGNKSISETIQKFSEKLAELDVMVRRMVMESFGIEKYFDEHLKSTNYRLRLMKYIAP---  174

Query  602   DTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
                                  ++ GLEVLNKD +WI + PS NSF+VM GDS+YA  NGR
Sbjct  175   --------------------PDIEGLEVLNKDEKWIRLKPSRNSFVVMAGDSVYALMNGR  214

Query  422   LHSPYHRVMMS-GNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             L  P+HRV ++   + RYS  LFS P AGYII+ P+ELVDE+HP +F PF +V+ + FY+
Sbjct  215   LFRPFHRVRVTEKKKTRYSIALFSTPIAGYIIEPPKELVDEKHPRVFKPFTYVDLMSFYH  274

Query  245   SEEGQKCQSALATYCGV  195
             +E G++ +S L  YC V
Sbjct  275   TEAGRRARSTLHAYCAV  291



>ref|XP_010479807.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=324

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 210/317 (66%), Gaps = 5/317 (2%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDAL  951
             ++  +KLP+IDF+  +LK G   WD V   V  AL EYGCFEA FDK+   LR+++ +A 
Sbjct  5     TKPALKLPVIDFTSRDLKSGTVEWDLVSGDVRTALAEYGCFEALFDKVTAELRKAVFEAS  64

Query  950   KELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNP  771
             ++LF LPL+TK R  S   + GYVGQ P  PLYE +GID A    N + FT  +WPQGN 
Sbjct  65    EDLFRLPLETKQRTVSEVKYKGYVGQNPTNPLYEGVGIDVAENEENVKAFTQKLWPQGNK  124

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKGPECDDTK  594
             NF ++V S+++ +S LD  +RRM+++S G+ E Y+DEH+ ST  L+R+MKY+G +  + +
Sbjct  125   NFSDTVLSFTKNVSELDFKIRRMVMDSFGINENYIDEHLKSTKCLMRMMKYRGVDETEEE  184

Query  593   IGLNSHTDKNIVTILYQNEV--NGLEVLNKDGQ-WINVNPSPN-SFIVMIGDSLYAWTNG  426
             +G+ +HTD+N++TI+ QN+V   GLEV  KDG  WI  NPS + SF+V+ G  L+   NG
Sbjct  185   LGMEAHTDRNVLTIVCQNDVADGGLEVRTKDGSHWIKANPSQDSSFLVIGGSILHVLLNG  244

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R+ S  HRV+  G E RYSAGLFS+P    +I AP+E+VD ++P LFNPFD   +  F  
Sbjct  245   RVQSAVHRVVRMGTETRYSAGLFSMPNTEDLICAPDEMVDAEYPRLFNPFDFEAYYKFTC  304

Query  245   SEEGQKCQSALATYCGV  195
                G++  S L TYC +
Sbjct  305   EGSGRRDLSGLKTYCSL  321



>ref|XP_004171510.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-like 
[Cucumis sativus]
Length=317

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 213/319 (67%), Gaps = 7/319 (2%)
 Frame = -1

Query  1136  MGSESG--IKLPIIDFSDENLKP-GCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+   I+LP+I+FSDE +K  G   W +   +V +A+ EYGCF A ++ +   LRE 
Sbjct  1     MGSETTEEIRLPVINFSDEKVKAEGGVEWRRTSKKVREAMEEYGCFIAKYEGVSKELREE  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             ++ A+KELF+LP++ K  N   KPF+GYVG+   +PL+ES+GIDDA   +  Q F+++MW
Sbjct  61    VLKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMW  120

Query  785   P-QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPE  609
             P +GN +F  ++ S+++    LD MV +MI ES GVEKY + H +S  YLLRV+K K P+
Sbjct  121   PPEGNHHFSATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAPQ  180

Query  608   CDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINV-NPSPNSFIVMIGDSLYAWT  432
               D  + L  HTDK+  T++YQ+ +NGLE+  K GQWI V N SP+SF+V+ GD++ AW+
Sbjct  181   SPDPTLCLVDHTDKSFTTMVYQDHINGLELKTKXGQWIQVDNSSPSSFLVIAGDAIKAWS  240

Query  431   NGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGF  252
             N R+ SP H+V + GNE RYS  +F       I++ P+ELVD+ HPL + PFDH+  L F
Sbjct  241   NDRIESPTHKVTIRGNEDRYSLAMFGFSNG--IVEVPKELVDQNHPLRYKPFDHIGLLHF  298

Query  251   YYSEEGQKCQSALATYCGV  195
             + S+EG   +S L  YC +
Sbjct  299   FRSKEGFNSKSPLKDYCAI  317



>ref|XP_004136074.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus]
Length=317

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 213/319 (67%), Gaps = 7/319 (2%)
 Frame = -1

Query  1136  MGSESG--IKLPIIDFSDENLKP-GCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGSE+   I+LP+I+FSDE +K  G   W +    V +A+ EYGCF A ++ +   LRE 
Sbjct  1     MGSETTEEIRLPVINFSDEKVKAEGGVEWRRTSKNVREAMEEYGCFIAKYEGVSKELREE  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             ++ A+KELF+LP++ K  N   KPF+GYVG+   +PL+ES+GIDDA   +  Q F+++MW
Sbjct  61    VLKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMW  120

Query  785   P-QGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPE  609
             P +GN +F  ++ S+++    LD MV +MI ES GVEKY + H +S  YLLRV+K K P+
Sbjct  121   PPEGNHHFSATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAPQ  180

Query  608   CDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINV-NPSPNSFIVMIGDSLYAWT  432
               D  + L  HTDK+  T++YQ+ +NGLE+  K+GQWI V N SP+SF+V+ GD++ AW+
Sbjct  181   SPDPTLCLVDHTDKSFTTMVYQDHINGLELKTKNGQWIQVDNSSPSSFLVIAGDAIKAWS  240

Query  431   NGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGF  252
             N R+ SP H+V + GNE RYS  +F       I++ P+ELVD+ HPL + PFDH+  L F
Sbjct  241   NDRIESPTHKVTIRGNEDRYSLAMFGFSNG--IVEVPKELVDQNHPLRYKPFDHIGLLHF  298

Query  251   YYSEEGQKCQSALATYCGV  195
             + S+EG   +S L  YC +
Sbjct  299   FRSKEGFNSKSPLKDYCAI  317



>ref|NP_175689.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52291.1|AC019018_28 putative oxidoreductase; 33116-34434 [Arabidopsis thaliana]
 gb|AAY78650.1| oxidoreductase [Arabidopsis thaliana]
 gb|AEE32853.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=314

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 203/308 (66%), Gaps = 3/308 (1%)
 Frame = -1

Query  1115  KLPIIDF-SDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             K+PI+D  S + LKP   TW  V  +  +AL EYGCF A +D +   L +S+  A +ELF
Sbjct  9     KVPILDLTSQQELKPNTSTWRSVSREACEALEEYGCFLAVYDGVTQQLDDSIFAAAEELF  68

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP +TK +N + KP+HGYVGQ P++PL+E +G+D        Q FT++MWPQGN  FCN
Sbjct  69    DLPTETKKKNVNEKPYHGYVGQMPVIPLHEGLGVDYVTNKEIAQRFTHLMWPQGNDRFCN  128

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             +V ++S  ++ LD +V RMI E+ GVEK+ + H+ S  YLL+ +KY  P    +      
Sbjct  129   TVHTFSNAVAELDRLVVRMIFENYGVEKHYESHVGSKTYLLKFLKYLAPPESISMPAFPQ  188

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             HTDK  ++IL+QN+VNGLEV +KDG+WI++   P S++VM GD    W+N R+ S  HRV
Sbjct  189   HTDKTFLSILHQNDVNGLEVKSKDGEWISLQLPPKSYVVMAGDISMGWSNDRIRSCEHRV  248

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQS  219
              M G++ RY+ GLFS      ++  PEELVD++HPL++ PFD++  + FY ++EG++  S
Sbjct  249   TMEGDKTRYTLGLFSFLTD--LVSIPEELVDDKHPLMYKPFDNIALINFYTTKEGREANS  306

Query  218   ALATYCGV  195
              L  YCG+
Sbjct  307   TLKAYCGI  314



>gb|KDP37167.1| hypothetical protein JCGZ_06223 [Jatropha curcas]
Length=321

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 208/295 (71%), Gaps = 4/295 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFS--DENLKPGCPT-WDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             M  ++   LP IDFS  D N     P  W+ +R QV KA+ EYGCF+A   KI   L ++
Sbjct  1     MSPKACADLPTIDFSKLDLNNPSNNPEEWEFIRYQVKKAVEEYGCFKANSSKISSELTKA  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             ++  ++ELF LPL+TK+RN ++    GY+G+    PL+ES+G  D   L   +  T+ +W
Sbjct  61    VLRDIEELFALPLETKMRNVADMHNGGYIGKATFTPLFESLGFLDPIDLEKIERITDALW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             P+G P+F  ++QSYS ++ G++ ++R MILESLG+EKY++EH+NST   LR+MKY  PE 
Sbjct  121   PEGKPSFSKNMQSYSVQVLGMEKIMRTMILESLGLEKYLEEHINSTTTSLRIMKYDAPEP  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNK-DGQWINVNPSPNSFIVMIGDSLYAWTN  429
              + +I L  H D++++TILYQNEV GLEV +K +G WINVN SPN+F+V+IG++  AWTN
Sbjct  181   GEPQIALAPHIDQDMITILYQNEVGGLEVQSKVNGDWINVNLSPNNFLVLIGETFQAWTN  240

Query  428   GRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVE  264
             GR ++P HRV MSGN+ RYS G F+  K GYI+KAPEE+VDEQ+PLL+ PFD +E
Sbjct  241   GRTYAPIHRVTMSGNKDRYSVGTFTATKFGYIVKAPEEVVDEQNPLLYRPFDFME  295



>ref|XP_007135718.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
 gb|ESW07712.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
Length=320

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 211/313 (67%), Gaps = 3/313 (1%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDAL  951
             SE+  ++P++DF+D+ LKPG   W      +  AL ++GCF A +D++P+ L  S+   +
Sbjct  4     SEAVCEVPVVDFTDKELKPGTRKWGSACEVIRNALEDHGCFYALYDEVPMELYNSVFTLM  63

Query  950   KELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNP  771
             +E FDLPL+TK++  S+KP+HGY GQ+  VPLYES+GI+    +   Q+FT +MWP G  
Sbjct  64    EEQFDLPLETKMQKISDKPYHGYYGQHAHVPLYESLGINHPLTMEGIQNFTKLMWPAGYD  123

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGVE-KYMDEHMNSTNYLLRVMKYKGPECDDTK  594
             +FC S+  Y++ L  LD M +RM+ +  GVE ++ D  + STNY+LR  KY+ P+ D+  
Sbjct  124   HFCESMSMYAKLLVELDHMTKRMVFDGYGVEQRHCDSLLESTNYMLRSFKYRLPQKDEND  183

Query  593   IGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHS  414
             +GL++HTD +  TIL+QN VNGL+V  K+G WI+++PSP  F+++ GD+   W+N R+H 
Sbjct  184   LGLHAHTDTSFFTILHQNNVNGLQVKFKNGDWIDIDPSPFMFLILAGDAFKVWSNDRIHC  243

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
               HRV++SG + RYS GLFS+   G +++  EELVDE+HP  + PFDH E+L F  +++ 
Sbjct  244   CEHRVIISGKKERYSMGLFSL--GGKMVETQEELVDEEHPRCYKPFDHYEYLSFCATKKA  301

Query  233   QKCQSALATYCGV  195
              +  S +  +CG+
Sbjct  302   LQSHSRIKAFCGI  314



>emb|CAN66061.1| hypothetical protein VITISV_007808 [Vitis vinifera]
Length=330

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 213/332 (64%), Gaps = 20/332 (6%)
 Frame = -1

Query  1142  RKMGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESM  963
             R  G E+  K+P++DFS ENLKPG  +W    N V  AL EYGCF A +D++P+ +  ++
Sbjct  3     RIXGLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTI  62

Query  962   IDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANL-LHNTQHFTNIMW  786
               A++ELFDLP++TK +N S KP+ GY  + P  PL++ +GID+    L   + F  IMW
Sbjct  63    FGAMRELFDLPIETKKQNISEKPYQGYTSESPAXPLHQGLGIDNVTTXLEEIRXFAKIMW  122

Query  785   PQGNPNFC--------------NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNST  648
             P GN NFC               SV  YS+ ++ LD MV RM+LES G+E     H+ S 
Sbjct  123   PAGNENFCYSFISDIFSSXLISQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIZSA  180

Query  647   NYLLRVMKYKGPECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNS  471
             ++L+R++K + P+ ++T     SH+DK+ ++IL+QN+VNGLE+  KDG+WI+   PS   
Sbjct  181   SFLVRLLKSRVPKMNETNKAFPSHSDKSFISILHQNKVNGLEIQTKDGKWISHEPPSLQV  240

Query  470   FIVMIGDSLYAWTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPL  291
             F+VM G+ L AW+NGR+H   HRV++ GNEARY+ GLFS      +IK PEELVD+ HPL
Sbjct  241   FLVMAGEVLTAWSNGRIHPARHRVVVKGNEARYALGLFSTING--MIKVPEELVDDHHPL  298

Query  290   LFNPFDHVEFLGFYYSEEGQKCQSALATYCGV  195
              F PFDH   L F  ++EG+  ++AL  YCG+
Sbjct  299   QFKPFDHTGLLHFLGTKEGRNPETALKAYCGL  330



>ref|XP_003533058.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Glycine max]
 gb|KHN47794.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=319

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 212/315 (67%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++  ++PI+DF+DE LKPG   W      +  AL ++GCF A  DK+P+ L  S+  
Sbjct  1     MGSQTACQVPIVDFTDEELKPGTAKWASACLVIRSALEDHGCFYALCDKVPMDLYNSVFA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              ++ELF LPL+TK++  S+KP+HGY GQ+  +PLYES+GI+D   +   Q+FT +MWP G
Sbjct  61    LMEELFYLPLETKLQKMSDKPYHGYYGQFTHLPLYESLGINDPLTMEGVQNFTKLMWPAG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKGPECDD  600
               +FC ++  Y++ L  LD M +RM+ +  G+ +++ D  + STNY+LR  KY+ P+ D+
Sbjct  121   YDHFCETLSLYAKLLVELDHMAKRMVFDGYGLDQRHCDSLLESTNYMLRSFKYRLPQKDE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +GL++HTD +  TIL+QN VNGL+V  K+G+W++++ SP   +++ GD+   W+N R+
Sbjct  181   NNLGLHAHTDTSFFTILHQNNVNGLQVKLKNGEWVDIDLSPFMLLILAGDAFKVWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             H   HRV++ G + RYS GLFS+   G +++ PEELVDE HP  + PFDH E+L FY ++
Sbjct  241   HCCEHRVIIKGKKDRYSMGLFSL--GGKMVETPEELVDEDHPRRYKPFDHYEYLRFYATK  298

Query  239   EGQKCQSALATYCGV  195
             +  + +  +  +CG+
Sbjct  299   KALESECRIKAFCGI  313



>emb|CDO98091.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 215/316 (68%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSES-GIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             MGS +  I+LP++DF+ E L P    W   R +V +AL EYGCF A +DK+ + L +++ 
Sbjct  1     MGSVTRQIQLPVLDFTGETLNPSSTRWPSTREEVVRALEEYGCFIANYDKVSLELHQAIF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
              A +ELF+LP +TKV NTS+ P HGY+  +  +PL E++GI++A  +   Q FTN++WP 
Sbjct  61    LASQELFELPTETKVLNTSDSPSHGYIA-HRRIPLLEALGIENATTVDGVQRFTNVLWPN  119

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN +F  +  SYS+ ++ L+ +V RM+ E+ GVEK  +  + S  YLLR++KY+ P  D+
Sbjct  120   GNNHFSETALSYSKLVAELNHVVMRMVAETYGVEKDCESLLGSIYYLLRLIKYRAPREDE  179

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP-SPNSFIVMIGDSLYAWTNGR  423
             + +GL  H D+  ++IL+Q +VNGLE++ K+G W+ ++  SP+SFIVM GD   AWTNGR
Sbjct  180   SNVGLFPHADQTFMSILHQAQVNGLEIMTKNGDWMLIDSLSPSSFIVMAGDVCMAWTNGR  239

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             +  P HRV MSG+E RYS  LF+  +   +++ PE+LVD++HPL + PFD  ++L F  +
Sbjct  240   IEPPLHRVTMSGSEERYSLSLFAFMR-DVMVQVPEKLVDDEHPLQYKPFDPFKYLLFCVT  298

Query  242   EEGQKCQSALATYCGV  195
             EEGQK +  + +YCGV
Sbjct  299   EEGQKSKCQIKSYCGV  314



>ref|XP_006306220.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
 gb|EOA39118.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
Length=315

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 202/308 (66%), Gaps = 3/308 (1%)
 Frame = -1

Query  1115  KLPIIDF-SDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             K+PI+DF S ++LKP    W  +  +  +AL EYGCF A +D +   L +++  A K+LF
Sbjct  10    KVPILDFTSQQDLKPNTSAWRSISREACEALEEYGCFVAVYDGVTQKLEDNVFAAAKDLF  69

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
              LP +TK++N + KP+HGYVGQ P++PL+E +GID      + Q FTN+MWPQGN  FC 
Sbjct  70    HLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAQRFTNLMWPQGNDQFCK  129

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             ++ S+S  ++ LD +V RMI E+ GVEK+ + H+ S  YLL+ + Y  P    +      
Sbjct  130   TIHSFSNAVAELDKLVVRMIFENYGVEKHYESHVGSKTYLLKFLMYLAPPESISMPAFPQ  189

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             HTDK  +TIL+QN+VNGLEV +KDG+WI++     S++VM GD    W+N R+ S  HRV
Sbjct  190   HTDKTFLTILHQNDVNGLEVKSKDGEWISLQLPLKSYVVMAGDISMGWSNDRIRSCVHRV  249

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQS  219
              M G++ RYS GLFS      ++  PEELVD++HPL++ PFD++  + F+ ++EG++  S
Sbjct  250   TMEGDKVRYSIGLFSFLTG--LVSIPEELVDDEHPLMYKPFDNIALINFFATKEGRETNS  307

Query  218   ALATYCGV  195
              L  YCGV
Sbjct  308   TLKAYCGV  315



>ref|XP_002284931.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
Length=316

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 208/317 (66%), Gaps = 6/317 (2%)
 Frame = -1

Query  1136  MGSESGIK-LPIIDF--SDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MG    I+ +P ++F   D +L+     W  +R++V +A   YGCF    D IP  LR+ 
Sbjct  1     MGEADHIQEIPFLEFPGDDLDLEQESEEWKGLRSKVREACETYGCFGLVCDAIPAKLRQE  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             M   +K LFDLP +TK +++S KP+H Y G+ P+VPL ES GIDDA      Q FTN++W
Sbjct  61    MFMVMKTLFDLPEETKKKHSSTKPYHSYQGKCPIVPLLESFGIDDAPQPQAAQAFTNLLW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             P+GNP FC ++ S + K+  L+ +V ++ILESLG+EKY +    ++  + R+MKY  P  
Sbjct  121   PEGNPAFCGALISMATKMLELNFIVLKLILESLGMEKYYNSQKENSASVFRLMKYTVPPS  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
             +D+ IGL +HTDKNI+TIL QNEV GLEVL+K+G WI +N   +SFIV+IGD L AWTNG
Sbjct  181   NDSAIGLVTHTDKNILTILCQNEVQGLEVLSKEGNWIRLNFCKDSFIVIIGDLLKAWTNG  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             RLH+  HRV+M+G++ RYS G+F +P     I+ PEELVD  HPL + PF + +++ F+ 
Sbjct  241   RLHAVRHRVVMNGDKDRYSCGMFVLPGDTVTIEVPEELVDNDHPLRYRPFTYSDYMSFFT  300

Query  245   SEEGQKCQSALATYCGV  195
             S     C  AL  Y GV
Sbjct  301   S---NICDDALEVYAGV  314



>ref|XP_004165032.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=321

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 211/310 (68%), Gaps = 11/310 (4%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELFD  936
             +LP++ F  +NLK G   W     +V +AL EYGCF A +D +   +  +M D+LKELFD
Sbjct  9     QLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMFDSLKELFD  68

Query  935   -LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWP-QGNPNFC  762
              +PL+ K++N S KP+HGY GQ P++P++ESMGI+   L  N   FTN+MWP +GN +F 
Sbjct  69    EVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWPSRGNHSFR  128

Query  761   NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLN  582
              +V +Y+  +S LD  V+ M+ ES GV   +  HM ST YL+R++KY+ P+  +  +G  
Sbjct  129   ENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKEKEMNLGAF  188

Query  581   SHTDKNIVTILYQNEVNGLEVLNKDGQWINVNP----SPNSFIVMIGDSLYAWTNGRLHS  414
              HTDK+ +TIL+QNEVNGL++  +D +WI  +P    S +SFIVM GD+ +AW+NGR++S
Sbjct  189   PHTDKSFLTILHQNEVNGLQIKTRDNKWIQYHPFSSSSTSSFIVMAGDAFFAWSNGRIYS  248

Query  413   PYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEG  234
             P HRV+MSGN+ RYS GLFS      I++ P+ELVD++HP LF PFDH ++L FY +E G
Sbjct  249   PPHRVIMSGNKERYSVGLFSFNNG--IVQIPKELVDDKHPQLFKPFDHQDYLRFYSTERG  306

Query  233   QK---CQSAL  213
             QK   C  +L
Sbjct  307   QKFSLCHQSL  316



>gb|KDO58208.1| hypothetical protein CISIN_1g044747mg [Citrus sinensis]
Length=322

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 208/324 (64%), Gaps = 12/324 (4%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS++  K+P+ID S ++LK G  TW      V  A  E+GCFEA + KI    R  ++ 
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVLA  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             + +ELFD+P++ KV+NTS KP+  Y GQY ++PLYES+ ID  +  + TQ FTN+MWP  
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAE  120

Query  776   NPNF---C-----NSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKY  621
                F   C      S  S SE +  LD MV RM+ ES GVE Y D ++ S NYLLR  KY
Sbjct  121   MIAFGMICPYSLLESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKY  180

Query  620   KGPECDDTKIGLNSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSL  444
             + PE ++TK+GL  HTDK + +I++Q N +NGL+V  KDG+WI+V PSP+SFIVM GD+L
Sbjct  181   RAPEPNETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIVMAGDAL  240

Query  443   YAWTNGRLHSPYHRVMM-SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHV  267
              AW N R+    H+V+M + +E RYS GLFS      ++  P+EL DE  PL + PFDH 
Sbjct  241   MAWGNDRIRPCRHQVIMDNASETRYSLGLFSFSSG--VVDIPKELGDETQPLKYKPFDHF  298

Query  266   EFLGFYYSEEGQKCQSALATYCGV  195
              FL F  SEEG+K  S++  YCG+
Sbjct  299   GFLHFNQSEEGKKSASSIKAYCGI  322



>ref|XP_010545796.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Tarenaya hassleriana]
Length=310

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 209/308 (68%), Gaps = 4/308 (1%)
 Frame = -1

Query  1112  LPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELFD  936
             +P +DFS E+LKPG   W+     + +AL +YGCF     +K P  L   + D+LK+LFD
Sbjct  5     IPTLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQLFD  64

Query  935   LPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNS  756
             LP  TK++N  +KP +GYVGQ P +PL+ES+GID+A  L +T+ FT++MWP+GN  FC+ 
Sbjct  65    LPTPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGNDRFCDC  124

Query  755   VQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSH  576
             +  Y+E ++ +D MV RMI  S GV KY + +M ST+YLLR++K + P+ ++  +   +H
Sbjct  125   MHRYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSYLLRLLKNRAPKDENPYLAFVTH  184

Query  575   TDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             TDK+  TIL+Q+++NGLE+  + G+ INV+  SP+ F+V+ GD+L AW+N R+ SP HRV
Sbjct  185   TDKSFTTILHQDQINGLEMETRLGERINVDLSSPSLFMVIAGDALMAWSNDRILSPRHRV  244

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQS  219
             ++SG   RYS G F+       ++ PEELVD +HPL++ PFDH+  L FY ++ G + + 
Sbjct  245   LVSGETDRYSLGQFAFSNG--TLQVPEELVDNEHPLMYKPFDHIGLLHFYRTDIGYRAEC  302

Query  218   ALATYCGV  195
              +  YCGV
Sbjct  303   PIKAYCGV  310



>ref|XP_009393623.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Musa 
acuminata subsp. malaccensis]
Length=333

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 207/325 (64%), Gaps = 12/325 (4%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENL-KPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI-D  957
             S +  K P IDFS  ++  PG P W+ VR QV +AL   G FEA F ++   LRES+   
Sbjct  6     SAAKQKYPKIDFSGLDIASPGKPRWEAVREQVMEALASCGFFEAVFPQVTQELRESLFGT  65

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A+KELF LPL TK+RNTSNKPFHGY+GQ P +  YES+ I DA+L      FT++MWP G
Sbjct  66    AMKELFALPLDTKLRNTSNKPFHGYLGQIPYLS-YESLAILDASLPQGVDSFTSLMWPGG  124

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-----  612
             NP F   V S+S++++ LD++VR+MILE+LG EKY    M S  +LLRV +Y        
Sbjct  125   NPAFSEMVCSFSKQVAELDEIVRKMILETLGAEKYHKTLMESHRFLLRVSEYPAAPPKQQ  184

Query  611   --ECDDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYA  438
                 +  ++GL  H DKN + I+ QN+V+GLE+   DG W+ V PSP SFIV+ GD+  A
Sbjct  185   QASEERQQLGLVPHRDKNTLAIVCQNQVDGLEMETSDGGWVVVTPSPASFIVIAGDAFRA  244

Query  437   WTNGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHP--LLFNPFDHVE  264
             W+NGR++SP HR+M+     RYSA LFSIP+   +I+AP+EL D+ H     F PFD+  
Sbjct  245   WSNGRVYSPLHRIMVGEEATRYSAILFSIPEDDMVIRAPQELADDHHSPGFKFKPFDYGS  304

Query  263   FLGFYYSEEGQKCQSALATYCGV*N  189
             ++ F  +EEG      L  +CGV N
Sbjct  305   YVRFCVTEEGMNASCQLDAFCGVAN  329



>ref|XP_010033904.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW53770.1| hypothetical protein EUGRSUZ_J03023 [Eucalyptus grandis]
Length=318

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 209/316 (66%), Gaps = 4/316 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDK-IPIHLRESMI  960
             MGSE   KLPI++FS ENLKPG  +W     +V +AL E+G F   +D+ IP  + ++  
Sbjct  1     MGSEGSPKLPILNFSSENLKPGTTSWVATCKEVIQALEEFGFFVVNYDEVIPSQVHDATF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
               L ELF LP +TK++N   KP +GYVGQ   +PL+ES+GIDDA  L  TQ FT++MWP 
Sbjct  61    RVLHELFALPTETKMKNRYQKPLNGYVGQIAKLPLHESLGIDDATSLEATQKFTDLMWPD  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN  F + + S+++  + LD +V RMI ES   EK+ D ++ ST YLLR++K + P  ++
Sbjct  121   GNNRFRDIMNSFAKLAAELDQIVTRMIFESYNSEKHYDSYIESTTYLLRLLKNRAPLENE  180

Query  599   TKIGLNSHTDKNIVTILYQN-EVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
               +G  +HTDK+  TIL+Q+ EV+GLEV  +DG+WI V  SP+ F+V+ GD+L AW+N R
Sbjct  181   PNLGFINHTDKSFTTILHQDSEVHGLEVETRDGEWITVEMSPSKFVVIAGDALMAWSNDR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             + SP H+V ++G E RYS  LF+       ++ PEELVD+ HPL + PF+H+  L FY +
Sbjct  241   IQSPNHKVTINGKEDRYSLALFAFNNG--TLQVPEELVDDDHPLKYKPFEHLGLLRFYRT  298

Query  242   EEGQKCQSALATYCGV  195
             +EG K +  +  YCGV
Sbjct  299   DEGYKSKCPIKAYCGV  314



>ref|XP_006304019.1| hypothetical protein CARUB_v10009745mg [Capsella rubella]
 gb|EOA36917.1| hypothetical protein CARUB_v10009745mg [Capsella rubella]
Length=323

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 212/316 (67%), Gaps = 4/316 (1%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDAL  951
             ++  ++LP+IDF+  +LKPG   W+ VR  V +AL EYGCFEA FDK+ + LR+++ +A 
Sbjct  6     TKPALQLPVIDFTSRDLKPGTVEWESVRGDVRRALEEYGCFEALFDKVTVELRKAVFEAS  65

Query  950   KELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNP  771
             ++LF LP++TK R  S+  + GYVGQ P  PLYE +GID A+     + FT  +WPQGN 
Sbjct  66    EDLFGLPIETKQRIVSDVKYRGYVGQNPTTPLYEGVGIDVADNEEQVKAFTQKLWPQGNM  125

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKGPECDDTK  594
             +F  +V S+++ +S LD  +RRM++ES G+ E Y+D+H+ ST  L+R+MKY+G +  + +
Sbjct  126   SFSETVLSFTKHVSELDFKIRRMVMESFGIDENYVDKHLKSTKCLMRMMKYRGVDETEEE  185

Query  593   IGLNSHTDKNIVTILYQNEV-NGLEVLNKDGQ-WINVNPSPN-SFIVMIGDSLYAWTNGR  423
             +G+ +HTD+N++TI+ QN+V +GLEV  KDG+ WI  NPS + SF+V+ G  L+   NGR
Sbjct  186   LGMEAHTDRNVLTIVCQNDVIDGLEVKTKDGRHWIKANPSQDSSFLVIGGSILHVLLNGR  245

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             +    HRV+  G E RYSAG FS+P    +I AP+E+VD   P LFNPF    +  F   
Sbjct  246   VQPAVHRVVRMGTETRYSAGHFSMPNTEELIYAPDEMVDAAFPRLFNPFGFEAYYKFTCE  305

Query  242   EEGQKCQSALATYCGV  195
               G++  SAL TYC +
Sbjct  306   GSGRRDLSALKTYCSL  321



>ref|XP_010500902.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=323

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 211/319 (66%), Gaps = 5/319 (2%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             + ++  +KLP+IDF+  +LKPG   WD V   + +AL EYGCFEA FDK+    R+++ +
Sbjct  3     LETKPALKLPVIDFTSRDLKPGTVEWDLVSGDMRRALEEYGCFEALFDKVTAEHRKAVFE  62

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A ++LF LPL+TK R  S   + GYVGQ P  PLYE +GID A+   N + FT  +WPQG
Sbjct  63    ASEDLFRLPLETKQRTVSEVKYKGYVGQNPTNPLYEGVGIDVADHEENVKSFTQKLWPQG  122

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGV-EKYMDEHMNSTNYLLRVMKYKGPECDD  600
             N NF ++V S+++ +S LD  +RRM++ES  + E Y+DEH+ ST  L+R+MKY+G +  +
Sbjct  123   NKNFSDTVLSFTKNVSELDFKIRRMVMESFRIDENYIDEHLKSTKCLMRMMKYRGVDETE  182

Query  599   TKIGLNSHTDKNIVTILYQNEV--NGLEVLNKDGQ-WINVNPSPN-SFIVMIGDSLYAWT  432
              ++G+ +HTD+N++TI+ QN+V   GLEV  KDG  WI  NPS + SF+V+ G  L+   
Sbjct  183   EELGMEAHTDRNVLTIVCQNDVADGGLEVKIKDGSHWIKANPSKDSSFLVIGGSILHVLL  242

Query  431   NGRLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGF  252
             NGR+    HRV+  G E RYSAGLFS+P    +I AP+E+VD ++P LFNPFD   +  F
Sbjct  243   NGRVQFAVHRVVRMGTETRYSAGLFSMPNTEDLICAPDEMVDAEYPRLFNPFDFEAYYKF  302

Query  251   YYSEEGQKCQSALATYCGV  195
                  G++  S L TYC +
Sbjct  303   TCEGSGRRDLSGLKTYCSL  321



>ref|XP_006392868.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
 gb|ESQ30154.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
Length=315

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 204/317 (64%), Gaps = 5/317 (2%)
 Frame = -1

Query  1136  MGS--ESGIKLPIIDF-SDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRES  966
             MGS  +S  K+PI+D  S ++LKP   TW  +  +  +AL E+GCF    D +   L +S
Sbjct  1     MGSIVKSSSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEFGCFVVVHDGVTQQLDDS  60

Query  965   MIDALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMW  786
             +  A +ELFDLP +TK +N + KP+HGYVGQ P++PL+E +GID        Q FT++MW
Sbjct  61    IFAAAEELFDLPTETKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEYAQRFTHLMW  120

Query  785   PQGNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC  606
             PQGN  FC +V ++S  ++ +D +V RMI E+ GVEK+ D H+ S  YLL+ +KY  P  
Sbjct  121   PQGNHQFCATVHAFSNAVAEIDQLVVRMIFENYGVEKHYDSHVGSKTYLLKFLKYLAPPE  180

Query  605   DDTKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNG  426
               +      HTDK  ++IL+QN+VNGLEV +KDG+WI++     S++VM GD    W+N 
Sbjct  181   SISMPAFPQHTDKTFLSILHQNDVNGLEVKSKDGEWISLQLPSKSYVVMAGDISMGWSND  240

Query  425   RLHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
             R+ S  HRV M G + RYS GLFS      ++  P+ELVD++HPL++ PFD++  + FY 
Sbjct  241   RIRSCEHRVTMDGGKTRYSFGLFSFVTG--MVSVPKELVDDEHPLMYKPFDNIALINFYA  298

Query  245   SEEGQKCQSALATYCGV  195
             ++EG++ +S L  YCG 
Sbjct  299   TKEGREAKSTLKAYCGT  315



>ref|XP_009799661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=317

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 208/317 (66%), Gaps = 3/317 (1%)
 Frame = -1

Query  1136  MGS-ESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI  960
             MGS  +  +L ++DF++E L+PG  TW+     +  A   +GCF A +DKI   L++S+ 
Sbjct  1     MGSLTASPQLLVVDFNNEELRPGTATWEFTCKDIRFAFENHGCFIALYDKISPQLQKSIF  60

Query  959   DALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
              A ++LF+LPL+ K+ NT+ KP+HGYVGQ P +P +E+ GID A      Q F+N+MWPQ
Sbjct  61    QASQQLFELPLEKKILNTNEKPYHGYVGQIPFLPNHEAFGIDYATTSQGIQSFSNLMWPQ  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN  F  +  ++S+ ++ LD  V RM+ ES G+EK  + ++ ST YLLR +KY  P   +
Sbjct  121   GNDFFSENSLTFSKIVAELDQKVVRMLFESYGIEKNCESYLESTTYLLRYLKYDAPNTKE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
               +    HTDK   T+LYQN ++GLE+  +DGQW+ ++  P+SF+VM G++   W+N R+
Sbjct  181   NSMVFPPHTDKTFTTVLYQNHISGLEIQTRDGQWLTLDFPPSSFVVMAGEAFRGWSNDRV  240

Query  419   HSPYHRVMM--SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYY  246
              +P H+V+M  SGNE RY+ G+F+  K   +I+  EELVDE+HPL F PF H++ + F+ 
Sbjct  241   LTPVHKVIMDISGNETRYTVGIFTFLKDNKMIEVAEELVDEEHPLQFQPFVHIDLIKFFD  300

Query  245   SEEGQKCQSALATYCGV  195
             +E G++ Q+ +  +CGV
Sbjct  301   TERGRRSQNLVKDFCGV  317



>ref|XP_010061960.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Eucalyptus grandis]
Length=318

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 200/320 (63%), Gaps = 3/320 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M S     +P+IDF+ ++LK G   WD    Q+   L E+GCF A +  +P  L ++   
Sbjct  1     MASLISAVVPVIDFNGKDLKQGTSAWDSTMKQMCHGLEEFGCFIALYAGVPPELDDATFK  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A  ELFDLP + K +N ++KP+HGYVGQ  ++PL+E +GID+A        FT +MWP G
Sbjct  61    AADELFDLPTEIKSQNVNDKPYHGYVGQVSIIPLHEGLGIDNATDPEEVGKFTKLMWPHG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPEC-DD  600
             N +F     SYS K++ LD MV RMI E+ GVEK+ D H+ S +YLLR +KY+ PE  D 
Sbjct  121   NDHFGEVAYSYSMKVAELDHMVVRMIFENYGVEKHYDSHVASKSYLLRFLKYRAPETIDQ  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRL  420
                 +  HTDK  ++IL+QN +NGLE+  K+G+WI  +  PN+F+VM GD+L  W+N R+
Sbjct  181   GDNAIPRHTDKTFLSILHQNRINGLEIKTKEGEWIGFDLPPNAFVVMAGDALMGWSNDRI  240

Query  419   HSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
              S  HRV M  +  RY+ GLFS      I++ P+ELVDE HPL + PFD+V  + FY S+
Sbjct  241   RSCDHRVAMKASTTRYTLGLFSFLSG--IVQVPQELVDENHPLKYKPFDNVAMIHFYASD  298

Query  239   EGQKCQSALATYCGV*NSTC  180
             EG+K +  +  YCG+  S  
Sbjct  299   EGRKHEYTVKAYCGIETSVV  318



>ref|XP_010535123.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 201/315 (64%), Gaps = 3/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS S  K+P++DF++++L P  P W     +  KAL EYGCF A +   P HL  +   
Sbjct  1     MGSISTTKIPVLDFTNQDLIPDTPLWVSTSVEACKALEEYGCFVAVYGGAPPHLAGAAFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
             A +ELF LP +TK +N ++KP+HGYVGQ  ++PL+E +GID      + + FT +MWPQG
Sbjct  61    AAEELFCLPTETKRKNVNDKPYHGYVGQMSVIPLHEGLGIDYVTDRDHVRKFTELMWPQG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N  FC +V S+S  ++ LD +V RMI E+  V KY + H+ S  YLL+ +KY  P   + 
Sbjct  121   NDPFCETVYSFSNAIAELDRLVVRMIFENYRVGKYYESHIGSKTYLLKFLKYSPPPEANP  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
                   HTDK  ++IL QN+VNGLEV +KDG+WI +   PNS++VM GD    W+N R+ 
Sbjct  181   TPAFPMHTDKTFLSILRQNDVNGLEVKSKDGEWIALELPPNSYVVMAGDVSMGWSNDRIR  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQ-HPLLFNPFDHVEFLGFYYSE  240
             S  HRV MSGN+ RY+ GLFS       I  PEELVDE+ +PL + PFD++  + FY ++
Sbjct  241   SCEHRVTMSGNKKRYTLGLFSFVTG--TISVPEELVDEKDYPLKYKPFDNISLIEFYATD  298

Query  239   EGQKCQSALATYCGV  195
             EG+K ++ L  YCGV
Sbjct  299   EGRKAENTLKAYCGV  313



>ref|XP_002309592.1| hypothetical protein POPTR_0006s26410g [Populus trichocarpa]
 gb|EEE93115.1| hypothetical protein POPTR_0006s26410g [Populus trichocarpa]
Length=314

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 202/299 (68%), Gaps = 4/299 (1%)
 Frame = -1

Query  1124  SGIKLPIIDFSDE---NLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDA  954
             + +++P++DFS+E    L+     W ++ NQV +A   +G F   +DKIP  LRE M  A
Sbjct  4     AKVEIPVLDFSEEALTGLEVKSEKWKELCNQVREACETHGVFFLVYDKIPGSLREEMFGA  63

Query  953   LKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGN  774
             +K LFDLP +TK R+ + KP+  Y+G+ P++P +ES G+DDA  L  +Q FT +MWP+GN
Sbjct  64    MKALFDLPEETKNRHVNPKPYRSYLGKCPVIPFHESFGVDDAPTLDASQAFTTLMWPEGN  123

Query  773   PNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECD-DT  597
             P+FC ++ S S K+  L+ +V +MI ES G+EK  D  +  T  +L+VMKYK P  D ++
Sbjct  124   PSFCETIHSMSSKMQELNFLVMKMIYESFGIEKLYDSFLEETTSILKVMKYKVPPSDTES  183

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              IGL +HTDKN +TIL QNEV GLEV  K+G W  V    N+F  ++GD++ AW+NGRLH
Sbjct  184   AIGLVAHTDKNAITILCQNEVQGLEVQTKNGDWAQVMVPENAFTAIVGDTVKAWSNGRLH  243

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
             +  HRV++SG+  RYS GLFS PK   +I+ P ELVD++HPL + PF+  ++L ++ S+
Sbjct  244   AARHRVVISGDRDRYSCGLFSTPKEEAVIEVPNELVDKEHPLQYRPFNFSDYLSYFVSK  302



>ref|XP_009400514.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Musa acuminata subsp. malaccensis]
Length=343

 Score =   296 bits (759),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 205/306 (67%), Gaps = 4/306 (1%)
 Frame = -1

Query  1103  IDFSDENL-KPGCPTWDKVRNQVHKALV-EYGCFEATFDKIPIHLRESMID-ALKELFDL  933
             +DF+  +L K G P W++VR Q+ + +  E   FEA +D +   LRE++    +KELF L
Sbjct  32    LDFTGLSLEKAGTPEWERVRAQMMEVVANEENWFEAVYDGVAQELREALFGRTVKELFAL  91

Query  932   PLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCNSV  753
             P++ K+RNTSNK +HGYVGQ P +  YE++ + DA+L+  T+ FT +MWP+GNP+FC+ V
Sbjct  92    PVEVKMRNTSNKAYHGYVGQIPGLD-YEALSVFDAHLVEGTRSFTELMWPEGNPSFCDIV  150

Query  752   QSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNSHT  573
              S+  +LS L+ MVRRM+LESLGV K+ D   +   + LR+ KY      +  + L  H 
Sbjct  151   HSFGRQLSELEKMVRRMLLESLGVVKHFDRQNSELTFGLRMAKYGALTSQEATVVLPPHV  210

Query  572   DKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRVMM  393
             D+  VT++ Q++V GL+VL  DG+W+ V PSPNS+ V+IG SL  W+NGRL +  HRVM+
Sbjct  211   DETTVTLVVQHKVAGLQVLTADGEWLAVPPSPNSYTVLIGQSLQGWSNGRLRAKLHRVMV  270

Query  392   SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQSAL  213
              G + RYS+   S PK   +++ PEELVDE+HPL++ PF +  F+ F++SEEG K   AL
Sbjct  271   GGEDTRYSSIFASHPKDDVVVQVPEELVDEEHPLIYKPFGYPGFVNFHHSEEGMKSDDAL  330

Query  212   ATYCGV  195
               YCGV
Sbjct  331   KAYCGV  336



>gb|EYU21582.1| hypothetical protein MIMGU_mgv1a010360mg [Erythranthe guttata]
Length=314

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 207/315 (66%), Gaps = 2/315 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGS     LPIIDFS++NL+PG P+W     +V  AL +YGCF AT+ K    +  S+  
Sbjct  1     MGSLENPTLPIIDFSEKNLEPGSPSWFTTAEKVVHALEDYGCFIATYSKFSPEMHRSIFG  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
               ++LFDLP   K+ NTS  P HGYVGQ P++PLYE +GI++A      + FT+++WP G
Sbjct  61    VSEQLFDLPTDVKILNTSGTPSHGYVGQEPIIPLYEGLGIENATTHTGVETFTSLLWPSG  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +F  +   YS  ++ L+  V RM+ ++ G+E      + +T+YLLR +KY+ P  D+T
Sbjct  121   NHHFGETALEYSRLVAELEQEVMRMVSKNYGIEDSYQSLVGATSYLLRFIKYRAPGKDET  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G+  HTDK+ ++IL+Q +V GL++  K+G W+ V+PSP+ F+VM GD+  AWTNGR+ 
Sbjct  181   GLGIVPHTDKSFMSILHQRQVKGLQIQTKNGDWLLVDPSPSYFVVMAGDACMAWTNGRIE  240

Query  416   SPYHRVMM-SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSE  240
                HRV++  G+E RYS GLF+  K    I+ PEELVD+ +P  F PFDH +++ FYY+E
Sbjct  241   PSKHRVIIDEGSEDRYSLGLFTFIK-DVKIQVPEELVDDDNPSRFKPFDHYKYIHFYYTE  299

Query  239   EGQKCQSALATYCGV  195
             EG++ +  +  YCG+
Sbjct  300   EGKRSKCPIKDYCGI  314



>emb|CDP20247.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 198/314 (63%), Gaps = 2/314 (1%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             M   S I+LP+I+ ++E L+ G  +W + RN V +A  EYGCF A  DK P  + +S+  
Sbjct  1     MECASNIRLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVSDSLFS  60

Query  956   ALKELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQG  777
              L++LF+LPL+ KV+NTS  P  GY    P V LYESM I+DA  L   + F N MWP  
Sbjct  61    ELQDLFNLPLEIKVQNTSQTPLSGYARPRPNVNLYESMCIEDATNLEAVEKFANQMWPSK  120

Query  776   NPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDT  597
             N +FC     Y+ +++ LD MV +++ ES GVEKY + H+ S  Y +R ++Y+ PE ++ 
Sbjct  121   NNHFCELFHCYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYNVRFIRYRVPEQNEM  180

Query  596   KIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLH  417
              +G+  HTDKN +TIL QNE +GLEV  K+G WI ++  P+S ++M GD   AW+NGR+H
Sbjct  181   NVGVAPHTDKNFITILQQNETDGLEVQLKNGSWIPIDFPPSSVVIMAGDVFSAWSNGRVH  240

Query  416   SPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             SP+HRV M G   RYS   FS  K   ++K P ELVD++HPLL+ PFD   +L F  + E
Sbjct  241   SPFHRVTMKGRGTRYSIAQFSYCKK--LVKTPTELVDDEHPLLYKPFDCFGYLRFLSTNE  298

Query  236   GQKCQSALATYCGV  195
                  ++L  YCGV
Sbjct  299   DWNIPNSLKVYCGV  312



>ref|XP_004241717.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=318

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 205/310 (66%), Gaps = 3/310 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMI-DALKELF  939
             KL ++DF++E L+PG  TW+    ++  A   +GCF A +DKI   L++S+  D  ++LF
Sbjct  9     KLLVVDFNNEELRPGTTTWESTCKEIRHAFENHGCFIALYDKISPQLQKSIFQDNSQQLF  68

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             +LPL+ KV N S KP+HGYVGQ   +P +E+ GID A      Q F+N+MWPQGN +FC 
Sbjct  69    ELPLERKVLNISEKPYHGYVGQISFLPNHEAFGIDYATTSQGIQTFSNLMWPQGNDSFCE  128

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             S   +S+ ++ LD+ V RM+ ES G+ K  + ++ ST YLLR +KY  P+  +T +    
Sbjct  129   SSLMFSKIVAALDNKVVRMLFESYGITKNCESYVESTTYLLRYLKYNTPKTKETSMVFPP  188

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             HTDK   TILYQN ++GLEV  +D QWI +   P+SF+VM G++L  W+N R+ +P HRV
Sbjct  189   HTDKTFTTILYQNHISGLEVQTRDLQWITLEFPPSSFVVMAGEALRGWSNDRVLTPIHRV  248

Query  398   MM--SGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKC  225
             +M  +G+E RY+ GLF+  K   II+  EEL+DE+HPL F PF H++ + F+ +E G++ 
Sbjct  249   IMDINGSETRYTIGLFTFLKNDKIIEVDEELIDEEHPLKFKPFVHLDLIKFFDTERGRRS  308

Query  224   QSALATYCGV  195
             Q+ +  +CGV
Sbjct  309   QNLVEDFCGV  318



>ref|XP_006305421.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
 gb|EOA38319.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
Length=310

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 203/309 (66%), Gaps = 4/309 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LK G   W+     + +AL EYGCF     +K P+ L + +  +L +LF
Sbjct  4     KIPTLDFSREDLKQGTQYWETTSKNIRQALEEYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK++N  +KP  GYVGQ P +PL+ES+GID+A  L  T+ FT +MWPQGN +F  
Sbjct  64    DLPTQTKMKNKYDKPLSGYVGQIPALPLHESLGIDNATSLKETRSFTGLMWPQGNEHFSE  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              +  Y+E  + LD MV +M+ ES  VEKY D ++ ST YLLRV+K   P  +   +G  +
Sbjct  124   CLHKYAEFAAKLDQMVVQMVFESYNVEKYYDPYIESTTYLLRVLKNCAPNNEKPTLGFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+Q++VNGLE+  ++G+ +N+N  SP+ F+V  GD+L AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQDQVNGLELETREGERVNINLSSPSLFMVFAGDALRAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG   RYS  +F+       ++ PEEL+D QHPL++ PFDH+  L FY ++ G K +
Sbjct  244   VLVSGKTDRYSLAMFAFNNG--TLQVPEELIDHQHPLMYKPFDHLGLLSFYRTDTGYKSE  301

Query  221   SALATYCGV  195
               +  YCG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_010462133.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 205/309 (66%), Gaps = 4/309 (1%)
 Frame = -1

Query  1115  KLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATF-DKIPIHLRESMIDALKELF  939
             K+P +DFS E+LKPG   W+  R  + +AL EYGCF     DK P++L + +  +L +LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRKNITQALEEYGCFIIDLQDKTPLNLLDQVFGSLVDLF  63

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP QTK++N  NKP  GYVGQ P +PL+ES+GID+A  L  T+ FT +MWPQGN +F  
Sbjct  64    DLPTQTKMKNKYNKPLSGYVGQIPTLPLHESLGIDNATSLEATRSFTGLMWPQGNEHFSA  123

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
              + +Y+E  + LD +V +++ ES  VEKY + +M ST YLLR++K   P   +  +G  +
Sbjct  124   CLHNYAEFAAKLDQIVIQIVFESYNVEKYYNPYMESTTYLLRMLKNCAPNIKNPTLGFVT  183

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGRLHSPYHR  402
             HTDK+  TIL+Q++VNGLE+  ++G+ I +N  SP+ F+V  GD+  AW+N R+ SP H+
Sbjct  184   HTDKSFTTILHQDQVNGLEMETREGERIIINLSSPSLFMVFAGDAFRAWSNDRVWSPRHQ  243

Query  401   VMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQ  222
             V++SG   RYS  +F+       ++ PEEL+D QHPL++ PFDH+  L FY ++ G K +
Sbjct  244   VLVSGETDRYSLAMFAFNSG--TLQVPEELIDHQHPLMYKPFDHLGLLRFYRTDTGYKSE  301

Query  221   SALATYCGV  195
               +  YCG+
Sbjct  302   CPIKAYCGI  310



>ref|XP_003535849.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=307

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 199/316 (63%), Gaps = 11/316 (3%)
 Frame = -1

Query  1136  MGSESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMID  957
             MGSE    LP++DF+ E+LKPG  +W      V +A  E G F A +DK  I L+  +  
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVFG  60

Query  956   ALKELFDLPLQTKVRNT-SNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQ  780
             ++KELFDLP +TK RN     P  GYVGQ+P +PL+ESMGID    L   Q F   MWP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWPH  120

Query  779   GNPNFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDD  600
             GN  FC  +  Y++    L+ MV RMI ES G+ ++ D  + STNYLLR++ +K  E ++
Sbjct  121   GNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQNE  180

Query  599   TKIGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVN-PSPNSFIVMIGDSLYAWTNGR  423
              ++G  +HTDK+  TIL+QN VN L V   +G WI+V+  SP SF+VM GD+L AW+N R
Sbjct  181   PQLGFVAHTDKSFTTILHQNHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWSNDR  240

Query  422   LHSPYHRVMMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYS  243
             + SP H VMM+GNE RYS GLF+  +   I+K PEEL+DE+HPL + PFDH+  L F YS
Sbjct  241   IKSPNHMVMMNGNETRYSLGLFAFYRG--ILKVPEELIDEEHPLQYKPFDHLALLNFTYS  298

Query  242   EEGQKCQSALATYCGV  195
                    + +  YCGV
Sbjct  299   -------ANMKAYCGV  307



>gb|EYU31921.1| hypothetical protein MIMGU_mgv1a010132mg [Erythranthe guttata]
Length=321

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 201/318 (63%), Gaps = 8/318 (3%)
 Frame = -1

Query  1130  SESGIKLPIIDFSDENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDAL  951
             S+   K+PI D S +NL PG  +W +    V +AL EYG F A +D++P  L + + + L
Sbjct  4     SQEPSKVPIFDLSPKNLNPGSSSWPQACKNVKQALEEYGFFIAHYDRVPYELDKQLFEEL  63

Query  950   KELFDLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNP  771
             +ELFDLPL+TK RNTS+  F+GYVGQ P  PL+ESMGI D       Q+FTN+MWP GN 
Sbjct  64    QELFDLPLETKTRNTSDLVFYGYVGQLPHAPLHESMGIPDVTTFDAVQNFTNLMWPSGNK  123

Query  770   NFCNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTK-  594
              FC S+ SY++ +S L+ +V +M+ ES G +K+   H+ ST YLLR +KY  P+  D K 
Sbjct  124   TFCESILSYAKLVSELEQIVDKMVFESYGTQKHYKSHIESTTYLLRTIKYSVPKIADDKS  183

Query  593   ---IGLNSHTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGR  423
                IG N HTDK+ ++IL+QN++NGL +  ++G+W+ V   P SF+VM GD+  AW+NGR
Sbjct  184   KDNIGTNVHTDKSFLSILHQNQINGLYIQLRNGEWLAVEVPPGSFVVMAGDAYQAWSNGR  243

Query  422   LHSPYHRVMMSGN--EARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFY  249
             + +  H+V+M G+    R+   LFS      +   PEELVD +HPL FNPFD+     FY
Sbjct  244   IFAAKHQVVMKGDVRMPRFCLALFSFNHG--MTHVPEELVDPEHPLRFNPFDNFGLARFY  301

Query  248   YSEEGQKCQSALATYCGV  195
              S   Q  +S    YCG+
Sbjct  302   LSGVTQMTESTAQAYCGI  319



>ref|XP_004302942.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 202/314 (64%), Gaps = 9/314 (3%)
 Frame = -1

Query  1118  IKLPIIDFSD-ENLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKEL  942
             +KLP++DFS+ E+L PG  +W   R  V  AL E+GCF   +D I    R +++  ++EL
Sbjct  10    LKLPVLDFSNKESLNPGTNSWLSARKHVQGALEEFGCFVVLYDGISPDFRNTLLATMQEL  69

Query  941   FDLPLQTKVRNT-SNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNF  765
             FDLP +TK+ N    KP +GYVGQ P +PL+ESMGID+A  L  TQ FT +MWP GN NF
Sbjct  70    FDLPTKTKMTNKYEAKPLNGYVGQIPKLPLHESMGIDNATSLEETQRFTELMWPGGNDNF  129

Query  764   CNSVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGL  585
             C SV S+++    LD MV RMI ES GVEK  D ++ S  YLLR++K K P+ +   +G 
Sbjct  130   CESVYSFAKVAEELDKMVTRMIFESYGVEKCYDSYVGSITYLLRLLKNKLPQENQPNLGF  189

Query  584   NSHTDKNIVTILYQ-NEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPY  408
               HTDK+  TILYQ N+V+ LE+  ++ +W  V   P+SFIVM GD+L AW+N R+ SP 
Sbjct  190   VPHTDKSFTTILYQNNQVHALEIETRNHEWFKVEFPPSSFIVMAGDALMAWSNDRILSPN  249

Query  407   HRVMMSG---NEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEE  237
             HRV+MS     EARYS   F+       I+ P+ELVD+QHPL + PFDHV  L F+ + E
Sbjct  250   HRVVMSTGHETEARYSMAQFAFSNGE--IRVPDELVDDQHPLRYKPFDHVGLLRFFRTAE  307

Query  236   GQKCQSALATYCGV  195
                  SA+  YCGV
Sbjct  308   -DNSNSAIKAYCGV  320



>ref|XP_010500899.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=320

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 198/308 (64%), Gaps = 3/308 (1%)
 Frame = -1

Query  1115  KLPIIDFSDE-NLKPGCPTWDKVRNQVHKALVEYGCFEATFDKIPIHLRESMIDALKELF  939
             K+PI+DF+ E +LKP    W  +     +AL EYGCF A +D I   L +S+  A K+LF
Sbjct  13    KVPILDFTREQDLKPRTSAWRSISRDACEALEEYGCFVAVYDGITQQLDDSVFAAAKDLF  72

Query  938   DLPLQTKVRNTSNKPFHGYVGQYPMVPLYESMGIDDANLLHNTQHFTNIMWPQGNPNFCN  759
             DLP +TK++N + KP+HGYVGQ P++PL+E +GID      + + FTN+MWPQGN  FC 
Sbjct  73    DLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGNDQFCK  132

Query  758   SVQSYSEKLSGLDDMVRRMILESLGVEKYMDEHMNSTNYLLRVMKYKGPECDDTKIGLNS  579
             ++ S+S  ++ LD +V RM+ E+  VEKY + H  S  YLL+ + Y  P    +      
Sbjct  133   TIHSFSNAVAELDRLVVRMLFENYDVEKYYESHFESKTYLLKFLMYLAPPESVSMPAFPQ  192

Query  578   HTDKNIVTILYQNEVNGLEVLNKDGQWINVNPSPNSFIVMIGDSLYAWTNGRLHSPYHRV  399
             HTDK  +TIL+QN+VNGLEV +KDG+WI++     S++VM GD    W+N R+ S  HRV
Sbjct  193   HTDKTFLTILHQNDVNGLEVKSKDGEWISLQLPLQSYVVMAGDISMGWSNDRIRSCEHRV  252

Query  398   MMSGNEARYSAGLFSIPKAGYIIKAPEELVDEQHPLLFNPFDHVEFLGFYYSEEGQKCQS  219
              M G++ RY+ GLFS       +  PEELVD++HPL++ PF+++  + F+ ++EG++  S
Sbjct  253   TMVGDKVRYTIGLFSFLTGS--VSIPEELVDDEHPLMYKPFNNIALINFFATKEGREANS  310

Query  218   ALATYCGV  195
              L  YCG 
Sbjct  311   TLKAYCGT  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2998031543124