BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32383_g1_i1 len=1688 path=[1:0-1573 1575:1574-1630 1575:1631-1687]

Length=1688
                                                                      Score     E

ref|XP_009784409.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    634   0.0      
ref|XP_009607748.1|  PREDICTED: uncharacterized protein LOC104101...    630   0.0      
ref|XP_007032652.1|  Calcium/lipid-binding (CaLB) phosphatase           608   0.0      
ref|XP_010034399.1|  PREDICTED: uncharacterized protein LOC104423633    603   0.0      
ref|XP_011098698.1|  PREDICTED: putative tyrosine-protein phospha...    598   0.0      
emb|CDP02279.1|  unnamed protein product                                595   0.0      
gb|EYU44161.1|  hypothetical protein MIMGU_mgv1a007614mg                590   0.0      
ref|XP_006349574.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    589   0.0      
ref|XP_004306107.1|  PREDICTED: uncharacterized protein LOC101309574    582   0.0      
ref|XP_003621351.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    578   0.0      
ref|XP_010317527.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    577   0.0      
ref|XP_008341625.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    577   0.0      
ref|XP_006482710.1|  PREDICTED: uncharacterized protein LOC102621...    577   0.0      
ref|XP_009365953.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    576   0.0      
ref|XP_006848727.1|  hypothetical protein AMTR_s00177p00053100          578   0.0      
gb|KDO72687.1|  hypothetical protein CISIN_1g014325mg                   575   0.0      
ref|XP_010258182.1|  PREDICTED: uncharacterized protein LOC104598017    574   0.0      
ref|XP_006431247.1|  hypothetical protein CICLE_v10011769mg             571   0.0      
ref|XP_004491862.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    570   0.0      
ref|XP_010936365.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    570   0.0      
ref|XP_010089585.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    568   0.0      
ref|XP_008230834.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    567   0.0      
ref|XP_007215462.1|  hypothetical protein PRUPE_ppa006437mg             566   0.0      
ref|XP_003531839.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    565   0.0      
ref|XP_007139516.1|  hypothetical protein PHAVU_008G036300g             565   0.0      
ref|XP_008443370.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    564   0.0      
ref|XP_008795462.1|  PREDICTED: uncharacterized protein LOC103711183    563   0.0      
gb|KGN59536.1|  hypothetical protein Csa_3G824810                       556   0.0      
ref|XP_010661109.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    550   0.0      
ref|XP_006405632.1|  hypothetical protein EUTSA_v10027783mg             549   0.0      
ref|XP_002324090.2|  hypothetical protein POPTR_0017s12540g             548   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP27203.1|  hypothetical protein JCGZ_19902                         544   0.0      
ref|XP_002870781.1|  hypothetical protein ARALYDRAFT_330553             542   0.0      
ref|XP_009139848.1|  PREDICTED: putative tyrosine-protein phospha...    541   0.0      
ref|XP_011035829.1|  PREDICTED: uncharacterized protein LOC105133497    540   0.0      
ref|XP_010435891.1|  PREDICTED: uncharacterized protein LOC104719634    540   0.0      
ref|NP_198756.2|  protein PHOSPHATASE AND TENSIN HOMOLOG DELETED ...    539   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125103.1|  PREDICTED: uncharacterized protein LOC103850140    539   0.0      
ref|XP_010441061.1|  PREDICTED: putative tyrosine-protein phospha...    538   0.0      
emb|CDY37003.1|  BnaC06g12600D                                          537   0.0      
emb|CDX67428.1|  BnaA07g14680D                                          536   0.0      
ref|XP_010528377.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    535   0.0      
ref|XP_006285053.1|  hypothetical protein CARUB_v10006361mg             534   0.0      
emb|CDY37863.1|  BnaC04g31430D                                          531   0.0      
ref|XP_002532895.1|  pten, putative                                     528   1e-180   Ricinus communis
ref|XP_010450812.1|  PREDICTED: uncharacterized protein LOC104732908    526   4e-180   
ref|XP_009784410.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    508   2e-174   
ref|XP_002969038.1|  hypothetical protein SELMODRAFT_91219              468   1e-157   
ref|XP_002990704.1|  hypothetical protein SELMODRAFT_132165             468   2e-157   
ref|XP_009607749.1|  PREDICTED: uncharacterized protein LOC104101...    451   4e-152   
ref|XP_009784411.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    447   9e-151   
emb|CBI22276.3|  unnamed protein product                                333   9e-108   
gb|EFW43384.2|  pten protein                                            221   3e-62    
ref|XP_009492856.1|  hypothetical protein H696_00701                    224   6e-61    
ref|XP_004924449.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    216   4e-60    
ref|NP_001161638.1|  phosphatase and tensin homolog                     215   7e-60    Saccoglossus kowalevskii
gb|EPZ34584.1|  Protein-tyrosine phosphatase domain-containing pr...    209   9e-59    
ref|XP_008547428.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    210   3e-58    
dbj|GAM17605.1|  hypothetical protein SAMD00019534_007800               210   8e-58    
ref|XP_008207911.1|  PREDICTED: phosphatase and tensin homolog is...    213   1e-57    
ref|XP_008207907.1|  PREDICTED: phosphatase and tensin homolog is...    213   1e-57    
ref|XP_008207910.1|  PREDICTED: phosphatase and tensin homolog is...    212   2e-57    
ref|NP_001128398.1|  phosphatase and tensin homolog                     211   3e-57    Nasonia vitripennis
ref|XP_008207909.1|  PREDICTED: phosphatase and tensin homolog is...    213   3e-57    
ref|XP_009022389.1|  hypothetical protein HELRODRAFT_120014             204   4e-57    
ref|XP_001625001.1|  predicted protein                                  204   2e-56    Nematostella vectensis
ref|XP_004988095.1|  hypothetical protein PTSG_10560                    206   3e-56    
ref|XP_002036459.1|  GM11890                                            208   3e-56    Drosophila sechellia
gb|EZA50068.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    206   3e-56    
gb|ELU06519.1|  hypothetical protein CAPTEDRAFT_90711                   204   4e-56    
ref|XP_005183453.1|  PREDICTED: dentin sialophosphoprotein-like i...    214   6e-56    
ref|XP_001749050.1|  hypothetical protein                               205   6e-56    Monosiga brevicollis MX1
ref|XP_009063523.1|  hypothetical protein LOTGIDRAFT_195725             202   9e-56    
ref|NP_477424.1|  pten, isoform C                                       204   1e-55    Drosophila melanogaster
ref|XP_005406534.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   1e-55    
gb|AAL99958.1|  PteN                                                    206   1e-55    Dictyostelium discoideum
gb|EFA07760.1|  hypothetical protein TcasGA2_TC005314                   204   2e-55    
ref|XP_002610383.1|  hypothetical protein BRAFLDRAFT_209333             202   2e-55    Branchiostoma floridae
ref|XP_008180621.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   2e-55    
ref|XP_003242877.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   2e-55    
ref|XP_637576.1|  protein tyrosine phosphatase                          206   2e-55    Dictyostelium discoideum AX4
ref|XP_007895108.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   2e-55    
dbj|GAM16849.1|  hypothetical protein SAMD00019534_000240               205   3e-55    
ref|NP_599147.1|  pten, isoform A                                       205   3e-55    Drosophila melanogaster
gb|AAF23236.1|AF201905_1  phosphatase and tensin homolog                205   3e-55    Drosophila melanogaster
ref|NP_477423.1|  pten, isoform B                                       205   3e-55    Drosophila melanogaster
ref|XP_008197501.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   3e-55    
gb|AAD45363.1|AF161258_1  PTEN2                                         205   4e-55    Drosophila melanogaster
gb|KDO29952.1|  hypothetical protein SPRG_05142                         203   4e-55    
ref|XP_002678142.1|  predicted protein                                  194   5e-55    Naegleria gruberi strain NEG-M
ref|XP_010863040.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   5e-55    
ref|XP_008610796.1|  hypothetical protein SDRG_06772                    202   5e-55    
ref|XP_005092511.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   5e-55    
ref|XP_003402815.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    203   6e-55    
ref|XP_010863046.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   6e-55    
ref|XP_003486174.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    203   6e-55    
ref|XP_004035605.1|  phosphatase and tensin, putative                   202   7e-55    
gb|EHJ66567.1|  phosphatase and tensin-like protein                     206   7e-55    
gb|EFX81708.1|  phosphatase and tensin-like protein                     198   8e-55    
ref|XP_003486173.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    204   8e-55    
ref|XP_003402814.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    204   9e-55    
ref|XP_009830137.1|  hypothetical protein, variant                      201   9e-55    
ref|XP_003708160.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    204   1e-54    
ref|XP_974994.2|  PREDICTED: phosphatidylinositol 3,4,5-trisphosp...    204   2e-54    Tribolium castaneum [rust-red flour beetle]
ref|XP_009038041.1|  hypothetical protein AURANDRAFT_28007              193   2e-54    
gb|EKC26943.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    202   2e-54    
ref|XP_008302817.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-54    
gb|KFH66727.1|  hypothetical protein MVEG_07252                         206   3e-54    
ref|XP_009830136.1|  hypothetical protein H257_06564                    201   3e-54    
ref|XP_001427413.1|  hypothetical protein                               199   4e-54    Paramecium tetraurelia strain d4-2
ref|XP_001363283.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    199   5e-54    Monodelphis domestica
ref|XP_003382733.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    201   6e-54    
ref|XP_004362272.1|  protein tyrosine phosphatase                       204   6e-54    
ref|XP_008487688.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    199   7e-54    
ref|XP_006169808.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   7e-54    
ref|XP_003698646.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    201   7e-54    
ref|XP_010564236.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   7e-54    
gb|ACR55737.1|  phosphatase and tensin-like C                           200   7e-54    Apis mellifera [bee]
ref|XP_006557297.1|  PREDICTED: phosphatase and tensin-like isofo...    201   8e-54    
ref|XP_004521565.1|  PREDICTED: serine-rich adhesin for platelets...    209   8e-54    
ref|XP_002405586.1|  TPIP alpha lipid phosphatase, putative             197   8e-54    Ixodes scapularis [blacklegged tick]
gb|ACR55736.1|  phosphatase and tensin-like B                           200   9e-54    Apis mellifera [bee]
ref|NP_001155985.1|  phosphatase and tensin-like                        201   1e-53    Apis mellifera [bee]
ref|XP_008860956.1|  hypothetical protein, variant                      199   1e-53    
ref|XP_007433696.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   1e-53    
ref|XP_006622018.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   2e-53    
gb|ABM21567.1|  PTEN transcript variant 5                               192   2e-53    Aedes aegypti
ref|XP_006557296.1|  PREDICTED: phosphatase and tensin-like isofo...    201   2e-53    
ref|XP_005406457.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    198   2e-53    
ref|XP_008860955.1|  hypothetical protein H310_00098                    200   2e-53    
emb|CDQ61574.1|  unnamed protein product                                198   2e-53    
ref|XP_006622017.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   2e-53    
ref|XP_006557295.1|  PREDICTED: phosphatase and tensin-like isofo...    201   2e-53    
ref|XP_006622015.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_006557293.1|  PREDICTED: phosphatase and tensin-like isofo...    202   2e-53    
ref|XP_010564235.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   2e-53    
ref|XP_421555.2|  PREDICTED: phosphatidylinositol 3,4,5-trisphosp...    197   2e-53    Gallus gallus [bantam]
ref|XP_006622014.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   3e-53    
ref|XP_006273492.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
ref|XP_006557292.1|  PREDICTED: phosphatase and tensin-like isofo...    201   3e-53    
ref|XP_005495952.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
ref|XP_005474272.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
ref|XP_005474271.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
ref|XP_009243870.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
gb|AAX36413.1|  phosphatase and tensin-like                             197   3e-53    
ref|XP_005727537.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
ref|XP_005385943.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
ref|XP_005352208.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-53    
gb|ADM26749.1|  phosphatase and tensin-like protein                     197   3e-53    
ref|NP_113794.1|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    197   3e-53    Rattus norvegicus [brown rat]
ref|NP_032986.1|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    197   3e-53    Mus musculus [mouse]
gb|EAW50175.1|  phosphatase and tensin homolog (mutated in multip...    197   4e-53    
ref|XP_008836075.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_010603291.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_004464588.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|NP_001137168.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    197   4e-53    Sus scrofa [pigs]
ref|XP_004409753.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|NP_001003192.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    197   4e-53    Canis lupus familiaris [dogs]
gb|ADM26750.1|  phosphatase and tensin-like protein                     197   4e-53    
ref|XP_004680952.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
gb|AAL08419.1|  PTEN                                                    197   4e-53    Takifugu rubripes [tiger puffer]
ref|XP_006831181.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_005875998.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_005339247.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_003409298.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|NP_001277906.1|  phosphatase and tensin homolog                     197   4e-53    
ref|XP_006755914.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_004701143.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_003964007.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_007520820.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_004653255.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_006926039.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   4e-53    
ref|XP_001427479.1|  hypothetical protein                               197   4e-53    Paramecium tetraurelia strain d4-2
ref|XP_008285018.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   5e-53    
ref|XP_006009982.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   5e-53    
gb|AAX41578.1|  phosphatase and tensin-like                             197   5e-53    
gb|ERE79056.1|  phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    197   5e-53    
gb|EFN90161.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    201   5e-53    
ref|XP_010742537.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   5e-53    
gb|AAX43209.1|  phosphatase and tensin-like                             196   5e-53    
ref|XP_006622016.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   5e-53    
gb|AAX36861.1|  phosphatase and tensin-like                             196   6e-53    
ref|XP_003438317.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   6e-53    
ref|XP_006557294.1|  PREDICTED: phosphatase and tensin-like isofo...    201   6e-53    
ref|XP_005743479.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   7e-53    
ref|XP_010782489.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   7e-53    
ref|XP_004086824.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   7e-53    
ref|XP_002065075.1|  GK15265                                            199   7e-53    Drosophila willistoni
pdb|1D5R|A  Chain A, Crystal Structure Of The Pten Tumor Suppressor     194   7e-53    
ref|XP_003449455.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   8e-53    
ref|XP_003764603.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    200   9e-53    
ref|XP_010750896.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   9e-53    
ref|XP_004565290.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   9e-53    
ref|XP_007071643.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   9e-53    
ref|XP_005292555.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   9e-53    
ref|XP_006121547.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   1e-52    
ref|XP_002089058.1|  GE26252                                            198   1e-52    Drosophila yakuba
ref|XP_001382218.2|  GA19047                                            197   1e-52    Drosophila pseudoobscura pseudoobscura
ref|XP_003964008.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
gb|EAW50173.1|  phosphatase and tensin homolog (mutated in multip...    196   1e-52    
ref|XP_008268354.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
ref|XP_005474270.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
ref|XP_004077141.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
ref|XP_004551620.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
ref|XP_004086825.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
ref|XP_010742529.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
gb|ADM26757.1|  phosphatase and tensin-like protein                     195   1e-52    
ref|XP_004565289.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-52    
ref|XP_008285017.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
ref|XP_008320667.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
ref|XP_005743477.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
ref|XP_004551621.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
ref|XP_001455854.1|  hypothetical protein                               194   2e-52    Paramecium tetraurelia strain d4-2
ref|XP_010868420.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
ref|XP_001993525.1|  GH13854                                            197   2e-52    Drosophila grimshawi
ref|XP_010782488.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
gb|ABM21566.1|  PTEN transcript variant 4                               192   2e-52    Aedes aegypti
ref|XP_003723944.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-52    
gb|EHH64853.1|  hypothetical protein EGM_18176                          195   2e-52    
gb|KHJ40971.1|  dual-specificity protein phosphatase PTEN family ...    194   2e-52    
ref|XP_003224419.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-52    
ref|XP_005804949.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-52    
emb|CDQ60841.1|  unnamed protein product                                196   2e-52    
ref|XP_005727536.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   2e-52    
ref|XP_005810521.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-52    
ref|XP_008436305.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-52    
ref|XP_007541048.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   3e-52    
gb|ADM26748.1|  phosphatase and tensin-like protein                     194   3e-52    
ref|XP_004551619.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   3e-52    
ref|XP_004077142.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   3e-52    
ref|XP_005914180.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   3e-52    
ref|XP_005474269.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   3e-52    
ref|XP_008320666.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   4e-52    
ref|XP_008427604.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   4e-52    
ref|XP_002014403.1|  GL19174                                            197   4e-52    Drosophila persimilis
ref|XP_007244646.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   4e-52    
tpg|DAA64597.1|  TPA: mitochondrial PTENalpha                           197   5e-52    
ref|XP_007545364.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    194   6e-52    
tpg|DAA64601.1|  TPA: mitochondrial PTENalpha                           197   6e-52    
ref|XP_010868419.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   6e-52    
tpg|DAA64600.1|  TPA: mitochondrial PTENalpha                           197   6e-52    
ref|NP_001288689.1|  phosphatase and tensin homolog                     197   6e-52    
tpg|DAA64599.1|  TPA: mitochondrial PTENalpha                           197   6e-52    
gb|ABM21563.1|  PTEN transcript variant 1                               192   7e-52    Aedes aegypti
tpg|DAA64595.1|  TPA: mitochondrial PTENalpha                           197   7e-52    
ref|XP_005804948.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   8e-52    
gb|AAH93110.1|  Ptenb protein                                           190   9e-52    Danio rerio [leopard danio]
ref|XP_007244645.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   9e-52    
ref|XP_008427603.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   1e-51    
ref|NP_001001822.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    193   1e-51    Danio rerio [leopard danio]
ref|XP_005482477.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   1e-51    
ref|XP_008956739.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    193   1e-51    
gb|KFO23280.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    196   1e-51    
ref|XP_002677109.1|  predicted protein                                  194   1e-51    Naegleria gruberi strain NEG-M
ref|XP_005807119.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   1e-51    
ref|XP_009291324.1|  PREDICTED: phosphatase and tensin homolog A ...    193   2e-51    
ref|XP_001457620.1|  hypothetical protein                               192   2e-51    Paramecium tetraurelia strain d4-2
ref|XP_009031594.1|  hypothetical protein HELRODRAFT_151946             185   2e-51    
ref|XP_005330305.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-51    
ref|XP_005420846.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-51    
ref|XP_005482478.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   2e-51    
ref|XP_005765622.1|  hypothetical protein EMIHUDRAFT_437207             198   2e-51    
gb|AAR04346.1|  phosphatase and tensin-like protein B long splice...    192   3e-51    Danio rerio [leopard danio]
gb|KFD50012.1|  hypothetical protein M513_09105                         194   3e-51    
ref|XP_001969427.1|  GG23962                                            194   3e-51    Drosophila erecta
gb|AAI28147.1|  TPTE2 protein                                           192   3e-51    Homo sapiens [man]
ref|XP_003262607.2|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   3e-51    
dbj|BAE28651.1|  unnamed protein product                                192   3e-51    Mus musculus [mouse]
ref|NP_001135440.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    192   3e-51    Homo sapiens [man]
ref|NP_001116943.1|  phosphatase and tensin homolog                     191   4e-51    Xenopus tropicalis [western clawed frog]
ref|NP_001124955.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    191   4e-51    Pongo abelii [orang utan]
gb|KFV53283.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    192   4e-51    
emb|CAF94889.1|  unnamed protein product                                191   4e-51    Tetraodon nigroviridis
gb|AAR04345.1|  phosphatase and tensin-like protein A long splice...    192   4e-51    Danio rerio [leopard danio]
ref|XP_009966843.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   4e-51    
ref|XP_001963068.1|  GF14124                                            194   4e-51    Drosophila ananassae
gb|AAH59457.1|  Phosphatase and tensin homolog A                        192   4e-51    Danio rerio [leopard danio]
ref|NP_957002.2|  phosphatase and tensin homolog A                      192   4e-51    Danio rerio [leopard danio]
ref|XP_004887384.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   5e-51    
gb|KFQ76880.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    192   5e-51    
ref|XP_009424948.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   5e-51    
emb|CAD13144.1|  TPIP alpha lipid phosphatase                           192   6e-51    
dbj|GAM20421.1|  hypothetical protein SAMD00019534_035960               198   6e-51    
gb|EFN66467.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    195   6e-51    
ref|XP_004632175.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   7e-51    
ref|XP_010287305.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   7e-51    
ref|NP_570141.3|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    192   7e-51    
gb|KFQ23966.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    193   8e-51    
emb|CBI22275.3|  unnamed protein product                                183   8e-51    
ref|XP_002004101.1|  GI18266                                            195   8e-51    
ref|XP_001441833.1|  hypothetical protein                               191   8e-51    
gb|KFQ18929.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   9e-51    
ref|XP_007251223.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-50    
ref|XP_010185786.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   1e-50    
ref|XP_008330889.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   1e-50    
ref|XP_008940020.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   1e-50    
ref|XP_009083884.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   1e-50    
gb|AAC52017.1|  phosphatase and tensin homolog 2                        190   1e-50    
gb|KFP73016.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    192   1e-50    
ref|XP_004341976.1|  mammalian PTEN tumor suppressorlike, putative      189   1e-50    
ref|XP_009189880.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   1e-50    
ref|XP_004076268.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   1e-50    
ref|XP_009081824.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   1e-50    
ref|XP_008330888.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   1e-50    
ref|XP_007555911.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   2e-50    
ref|XP_001453274.1|  hypothetical protein                               191   2e-50    
gb|AAI21584.1|  LOC548705 protein                                       189   2e-50    
ref|XP_001327946.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    187   2e-50    
gb|AAP45146.1|  phosphatase TPIP gamma isoform                          192   2e-50    
gb|KFV42417.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   2e-50    
ref|XP_010351469.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   2e-50    
ref|XP_005746687.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   2e-50    
ref|NP_954863.2|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    192   2e-50    
ref|XP_008425411.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   3e-50    
ref|XP_009809257.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   3e-50    
gb|EAX08220.1|  transmembrane phosphoinositide 3-phosphatase and ...    192   3e-50    
ref|XP_001461345.1|  hypothetical protein                               189   3e-50    
ref|XP_007555877.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   3e-50    
ref|XP_010351465.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   3e-50    
ref|XP_005501910.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   3e-50    
ref|XP_002130240.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   3e-50    
gb|KFQ41554.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   4e-50    
gb|KFW64266.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   4e-50    
ref|XP_010351461.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   4e-50    
gb|EAX08221.1|  transmembrane phosphoinositide 3-phosphatase and ...    187   4e-50    
ref|XP_008425410.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   4e-50    
ref|XP_005472302.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   4e-50    
ref|XP_007421266.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   4e-50    
ref|XP_003446945.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   4e-50    
ref|XP_008425408.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   4e-50    
ref|XP_005596114.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    194   4e-50    
ref|XP_010351459.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   4e-50    
gb|AAI54862.1|  LOC548705 protein                                       190   5e-50    
emb|CAD13145.1|  TPIP beta                                              186   5e-50    
gb|ABM21568.1|  PTEN transcript variant 6                               191   5e-50    
ref|XP_010022632.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   5e-50    
gb|KFQ63416.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   5e-50    
gb|KFO89277.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   5e-50    
ref|NP_001184205.1|  uncharacterized protein LOC100505440               188   5e-50    
gb|KFV91304.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   5e-50    
gb|KFP73811.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   5e-50    
ref|XP_009485544.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   5e-50    
ref|XP_007958685.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   5e-50    
gb|KFV10038.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   5e-50    
gb|KFQ95421.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   5e-50    
ref|XP_005516390.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   5e-50    
gb|EAX08222.1|  transmembrane phosphoinositide 3-phosphatase and ...    192   5e-50    
gb|KGL91120.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   5e-50    
ref|XP_006800129.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   6e-50    
gb|EHH28882.1|  hypothetical protein EGK_09163                          189   6e-50    
ref|XP_009877520.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   6e-50    
ref|XP_001455948.1|  hypothetical protein                               189   6e-50    
gb|KFP95246.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   6e-50    
ref|XP_005928077.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   6e-50    
gb|KFP41038.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   6e-50    
gb|KFP19179.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   6e-50    
gb|KFM02299.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   6e-50    
gb|EMC87706.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    190   6e-50    
ref|XP_005746683.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   6e-50    
ref|XP_010145052.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   6e-50    
ref|XP_417079.2|  PREDICTED: phosphatidylinositol 3,4,5-trisphosp...    191   6e-50    
gb|KFW87985.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   7e-50    
gb|KFW85262.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   7e-50    
ref|XP_009288435.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
gb|KFV99213.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   7e-50    
ref|XP_009461340.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_009880661.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_009977182.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_009318211.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_005501909.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_010133718.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_009925120.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_009586137.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   7e-50    
ref|XP_001326101.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    186   7e-50    
ref|XP_002052397.1|  GJ17528                                            191   7e-50    
ref|XP_008499877.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   7e-50    
ref|XP_010727063.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   8e-50    
ref|XP_010116810.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   8e-50    
gb|ABM21564.1|  PTEN transcript variant 2                               190   8e-50    
ref|XP_009640915.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   8e-50    
ref|XP_009498550.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   8e-50    
ref|XP_008927328.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   8e-50    
gb|KFO07436.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   8e-50    
gb|KFZ61090.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   9e-50    
ref|XP_005147697.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   9e-50    
ref|XP_005746686.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   9e-50    
gb|KGL80805.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   1e-49    
ref|NP_001015951.1|  transmembrane phosphoinositide 3-phosphatase...    190   1e-49    
ref|XP_010307733.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-49    
gb|AAB70558.1|  putative protein tyrosine phosphatase homologue         186   1e-49    
gb|KFZ56895.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   1e-49    
ref|NP_001083831.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    187   1e-49    
ref|XP_005240290.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-49    
gb|KFQ86492.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   1e-49    
ref|XP_653141.2|  hypothetical protein                                  193   1e-49    
ref|XP_005446669.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-49    
ref|XP_001733578.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    182   1e-49    
gb|KFV75322.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   1e-49    
ref|XP_004938795.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-49    
dbj|BAO96085.1|  voltage-sensor containing phosphatase                  190   1e-49    
ref|XP_004938786.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-49    
ref|XP_010164918.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-49    
gb|ABM21565.1|  PTEN transcript variant 3                               191   1e-49    
gb|EAX08224.1|  transmembrane phosphoinositide 3-phosphatase and ...    192   2e-49    
ref|XP_005037985.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-49    
ref|XP_010735309.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-49    
ref|XP_010218014.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-49    
ref|XP_001748597.1|  hypothetical protein                               192   2e-49    
gb|KFP24722.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   2e-49    
ref|XP_009906975.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-49    
ref|XP_003971378.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-49    
ref|XP_004035773.1|  lim-type zinc finger protein, putative             181   2e-49    
ref|XP_010195870.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-49    
gb|EMD43888.1|  phosphatidylinositol3,4,5-trisphosphate 3-phospha...    192   2e-49    
ref|XP_002195057.2|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   2e-49    
gb|KFP98330.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   2e-49    
ref|XP_010634938.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-49    
ref|XP_002824087.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-49    
ref|XP_006628294.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   3e-49    
gb|EOB04857.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    187   3e-49    
ref|XP_009948642.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   3e-49    
gb|KFV83220.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   3e-49    
gb|KFV02010.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   3e-49    
ref|XP_004254275.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    192   3e-49    
ref|XP_010082815.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   4e-49    
ref|XP_003291148.1|  hypothetical protein DICPUDRAFT_155722             192   4e-49    
ref|XP_009676868.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   4e-49    
gb|KFO81927.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   4e-49    
ref|XP_004550094.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   4e-49    
ref|XP_010398676.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   5e-49    
ref|XP_008313193.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   5e-49    
gb|KFP06891.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    187   5e-49    
gb|KFO57358.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    187   5e-49    
ref|XP_007958683.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   6e-49    
ref|XP_004258968.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    191   6e-49    
ref|XP_005014905.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   6e-49    
ref|XP_008629628.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   6e-49    
ref|XP_007958684.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   6e-49    
ref|XP_007958682.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   6e-49    
ref|XP_009567002.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   7e-49    
dbj|GAM27881.1|  hypothetical protein SAMD00019534_110570               192   7e-49    
ref|XP_010398674.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   7e-49    
gb|KFR17156.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    187   7e-49    
emb|CCI39847.1|  unnamed protein product                                190   8e-49    
ref|XP_001913464.1|  phosphatidylinositol-3,4,5-trisphosphate3-ph...    181   8e-49    
ref|XP_004367580.1|  dual specificity phosphatase, catalytic doma...    194   8e-49    
ref|NP_001267536.1|  voltage-sensitive phosphatase 2                    187   8e-49    
dbj|BAG63204.1|  unnamed protein product                                187   9e-49    
ref|XP_007958680.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   9e-49    
ref|XP_010343244.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   9e-49    
ref|XP_009941074.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   9e-49    
gb|ENN73206.1|  hypothetical protein YQE_10185                          187   1e-48    
ref|XP_010343245.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-48    
sp|Q4R6N0.1|TPTE2_MACFA  RecName: Full=Phosphatidylinositol 3,4,5...    188   1e-48    
ref|XP_008313192.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   1e-48    
emb|CCI39848.1|  unnamed protein product                                190   1e-48    
ref|XP_004344005.1|  Protein-tyrosine-phosphatase                       192   1e-48    
ref|XP_002800726.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    188   1e-48    
gb|KFU90152.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    186   1e-48    
emb|CEI92862.1|  hypothetical protein RMCBS344292_07110                 182   1e-48    
ref|XP_008150314.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   2e-48    
ref|XP_008250854.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-48    
ref|XP_006748536.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    185   2e-48    
ref|XP_009996621.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-48    
ref|XP_001639134.1|  predicted protein                                  183   2e-48    
ref|XP_001740325.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    189   2e-48    
ref|NP_001090072.1|  transmembrane phosphoinositide 3-phosphatase...    186   2e-48    
ref|XP_003477330.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   2e-48    
ref|XP_010343243.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    185   3e-48    
ref|XP_001917678.2|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    183   4e-48    
emb|CAG00470.1|  unnamed protein product                                185   4e-48    
ref|XP_008276080.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   4e-48    
ref|XP_638022.2|  LIM-type zinc finger-containing protein               190   4e-48    
ref|XP_008019882.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    187   4e-48    
gb|EFZ18116.1|  hypothetical protein SINV_09976                         187   4e-48    
ref|XP_009246738.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   5e-48    
ref|XP_007495440.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   5e-48    
ref|XP_008996426.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   5e-48    
ref|XP_009538710.1|  hypothetical protein PHYSODRAFT_319997             183   5e-48    
ref|XP_003273170.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    182   7e-48    
ref|XP_010777346.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    185   7e-48    
ref|XP_003742103.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    183   7e-48    
ref|XP_008250853.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   7e-48    
ref|XP_008250850.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   9e-48    
ref|XP_008705122.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    181   9e-48    
ref|XP_003273168.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    185   9e-48    
ref|XP_008113809.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    183   1e-47    
ref|XP_008996424.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-47    
ref|XP_002749061.2|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-47    
ref|XP_008847367.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    183   1e-47    
ref|XP_001444340.1|  hypothetical protein                               183   1e-47    
ref|XP_008996425.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-47    
ref|XP_008705121.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    181   1e-47    
ref|XP_008250847.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   1e-47    
ref|XP_003273169.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    183   1e-47    
ref|XP_006124971.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-47    
ref|XP_008272045.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   1e-47    
ref|XP_006124968.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-47    
ref|XP_008250842.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   1e-47    
ref|XP_006124969.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    184   1e-47    



>ref|XP_009784409.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Nicotiana sylvestris]
Length=418

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/409 (76%), Positives = 352/409 (86%), Gaps = 5/409 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG RL KQG KK      LS      +L+ +L  S YIRNLVSKQRRR+LVGGYDLDMTY
Sbjct  1     MGPRLSKQGFKKPV---NLSITDLHHNLINYLSKSLYIRNLVSKQRRRMLVGGYDLDMTY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+DR+LAMSFPAEH+RAM+RNPLWQVKSVLDMRH+GHYKVYNLC+EQ+YD +HFHGRVER
Sbjct  58    ISDRILAMSFPAEHVRAMFRNPLWQVKSVLDMRHAGHYKVYNLCVEQAYDASHFHGRVER  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YP DDNHVPPLQM+KEFCEDV+SWLSNDPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAE
Sbjct  118   YPMDDNHVPPLQMIKEFCEDVYSWLSNDPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRG-LPDVNLPKPCARELRRI  975
             EAL++YA+KRTTNN GVSIPSQRRYV YWE +LSF   V RG  P V LPK C RELRRI
Sbjct  178   EALRLYAEKRTTNNEGVSIPSQRRYVRYWEHILSFSKGVPRGPPPTVKLPKSCKRELRRI  237

Query  976   RLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegn  1155
             RLYDT+NV+SIFFVVSELQ +PGE+YCPP EVSKSCCR  KN   R  SPRY+YSF+   
Sbjct  238   RLYDTINVESIFFVVSELQRVPGEKYCPPAEVSKSCCRRIKNGIQRTYSPRYFYSFV-EE  296

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
              E++  +E+KEPRLV+QMDTESSMLYQKTCLD++Y+ P+QV GDVRIIFYEKLIGGRLFY
Sbjct  297   NEDEMKQEKKEPRLVVQMDTESSMLYQKTCLDHFYDKPVQVCGDVRIIFYEKLIGGRLFY  356

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSIL  1482
             ACFNT+FI++ LLQFSLRELDKVGKKG+S+ G +FC+EL FGPAN + L
Sbjct  357   ACFNTAFIRNDLLQFSLRELDKVGKKGRSMTGSSFCLELFFGPANGNCL  405



>ref|XP_009607748.1| PREDICTED: uncharacterized protein LOC104101904 isoform X1 [Nicotiana 
tomentosiformis]
Length=419

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/409 (75%), Positives = 353/409 (86%), Gaps = 4/409 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG RL KQG +K      LS      +L+ +L  S YIRNLVSKQRRR+LVGGYDLDMTY
Sbjct  1     MGPRLSKQGFRKPV---NLSITDLHHNLINYLSRSFYIRNLVSKQRRRMLVGGYDLDMTY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+DR+LAMSFPAEH+RAM+RNPLWQVKSVLD RH+GHYKVYNLC+EQ+YD +HF+GRVER
Sbjct  58    ISDRILAMSFPAEHVRAMFRNPLWQVKSVLDSRHAGHYKVYNLCVEQAYDASHFYGRVER  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YP DDNHVPPLQM++EFCEDV+SWLSNDPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAE
Sbjct  118   YPMDDNHVPPLQMIREFCEDVYSWLSNDPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA+KRTTNN GVSIPSQRRYV YWE VLSF   V RG P V LPK C RELRRIR
Sbjct  178   EALRLYAEKRTTNNEGVSIPSQRRYVRYWEHVLSFSKGVPRGPPIVKLPKSCKRELRRIR  237

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegn-  1155
             LYDT+NV+SIFFVVSELQ +PGE+YCPP EVSKSCCR  KN   R  SPRY+YSF+E   
Sbjct  238   LYDTINVESIFFVVSELQRVPGEKYCPPTEVSKSCCRRIKNGIQRTYSPRYFYSFVELED  297

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
              E++  +E+KEPRLV+QMDTESSMLYQKTCLD++Y+ P+QV+GDVRIIFYEKLIGGRLFY
Sbjct  298   NEDEMKQEKKEPRLVVQMDTESSMLYQKTCLDHFYDKPVQVSGDVRIIFYEKLIGGRLFY  357

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSIL  1482
             ACFNT+FI++ LLQFSLRELDKVGKKG+S+ G +FC+EL FGPAN + L
Sbjct  358   ACFNTAFIRNDLLQFSLRELDKVGKKGRSMTGSSFCLELFFGPANGNCL  406



>ref|XP_007032652.1| Calcium/lipid-binding (CaLB) phosphatase [Theobroma cacao]
 gb|EOY03578.1| Calcium/lipid-binding (CaLB) phosphatase [Theobroma cacao]
Length=421

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/405 (71%), Positives = 339/405 (84%), Gaps = 5/405 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  + G  K   A+ L     Q  ++ +L  + +IRNLVSK+RRR++VGGYDLDM+Y
Sbjct  10    MGLKFARPGPGKNGNATLL----LQHRMLAYLTATSFIRNLVSKKRRRMVVGGYDLDMSY  65

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDRLLAMSFPAE MRAMYRNPLWQVKSVL+MRH GHYK+YNLCIE+ YDP HFHGRVE+
Sbjct  66    ITDRLLAMSFPAERMRAMYRNPLWQVKSVLEMRHQGHYKIYNLCIEEDYDPLHFHGRVEK  125

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP LQM+K FCE VHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVY+GM AE
Sbjct  126   FPFDDNHVPSLQMMKLFCESVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYSGMLAE  185

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YA KRTTNN GVSIPSQRRYV YWE +LSFP  V  GLPDVNLP PC+RELRRIR
Sbjct  186   EALQLYAQKRTTNNEGVSIPSQRRYVGYWENILSFPRGVRNGLPDVNLPPPCSRELRRIR  245

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT+   S+FFVVSELQ IP + YCPPVEV+KSCCR     +   +SPRY+ +F+   E
Sbjct  246   LYDTIATTSVFFVVSELQEIPSQMYCPPVEVAKSCCREINKGYEVNSSPRYFLTFI-EGE  304

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             EE    E ++PR+V+QMDTES +LYQKTCLDY++  P+QV+GDVR+IFY+K+IGGRLFYA
Sbjct  305   EEGNTSESEKPRVVVQMDTESPVLYQKTCLDYHFSKPVQVSGDVRVIFYQKMIGGRLFYA  364

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANP  1473
             CFNT+FIK+ LLQF++R+LDKVG  G+SICGPAFC+EL+FGPANP
Sbjct  365   CFNTAFIKNSLLQFTIRDLDKVGSTGRSICGPAFCMELLFGPANP  409



>ref|XP_010034399.1| PREDICTED: uncharacterized protein LOC104423633 [Eucalyptus grandis]
 gb|KCW51912.1| hypothetical protein EUGRSUZ_J01367 [Eucalyptus grandis]
Length=417

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/417 (69%), Positives = 338/417 (81%), Gaps = 7/417 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  KQ   +A     +S  HA Q ++ +L T+ +IRNLVSK+RRRLLVGGYDLDM+Y
Sbjct  1     MGLKFSKQSHGRA---DNMSLAHAHQQVIHYLITNFFIRNLVSKKRRRLLVGGYDLDMSY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPAE MRA+YRNPLWQVKSVLDMRH GHYK+YNLCIE++YDP+HF+GRVE 
Sbjct  58    ITDRILAMSFPAERMRAVYRNPLWQVKSVLDMRHQGHYKIYNLCIEETYDPSHFYGRVET  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVPPLQMVK+FCE VH+WLS DPKN+AV+HCMAGKGRTGLMVC YLVY G+SAE
Sbjct  118   YPFDDNHVPPLQMVKQFCESVHTWLSRDPKNVAVVHCMAGKGRTGLMVCTYLVYIGLSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YA KRTTNN GVSIPSQRRYV YW   LSFP     G  DVNLP PC+RELRRIR
Sbjct  178   EALQLYAQKRTTNNEGVSIPSQRRYVGYWANTLSFPRGASAGPLDVNLPHPCSRELRRIR  237

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDTVN +SIFFV+SELQ IP + Y P +EV+K CCR  K  F R NSPRYY SF     
Sbjct  238   LYDTVNTESIFFVISELQEIPNQLYRPSMEVTKGCCRPIKKGFQRNNSPRYYLSF--DRG  295

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             +     E +EP +++QMDTES +LYQKTCLDYY++ PL VTGDVR+IFY+K+ GGRLFYA
Sbjct  296   KIVGESESEEPHVIVQMDTESPVLYQKTCLDYYFDKPLHVTGDVRVIFYQKMKGGRLFYA  355

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANP--SILMKKDDDI  1503
             CFNT+FI+  LLQFSLR+LDKV  KG+SICG AFC+EL+FGPAN   S++   D+D+
Sbjct  356   CFNTAFIRQCLLQFSLRDLDKVASKGRSICGNAFCLELLFGPANAKSSLMPPSDNDL  412



>ref|XP_011098698.1| PREDICTED: putative tyrosine-protein phosphatase auxilin [Sesamum 
indicum]
 ref|XP_011098699.1| PREDICTED: putative tyrosine-protein phosphatase auxilin [Sesamum 
indicum]
Length=409

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/396 (74%), Positives = 334/396 (84%), Gaps = 6/396 (2%)
 Frame = +1

Query  313   LSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAM  492
             LS+I +Q  LV  L+ + Y+RNLVSKQRRR+LV GYDLDMTYITDRLLAMSFPAE +RAM
Sbjct  18    LSFIQSQ--LVNCLWRN-YLRNLVSKQRRRMLVAGYDLDMTYITDRLLAMSFPAERVRAM  74

Query  493   YRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFC  672
             YRNP+WQVKSVLDMRH G+YKVYNLCIE+ YD +HFHGRVERYPFDDNHVPPL M+KEFC
Sbjct  75    YRNPMWQVKSVLDMRHQGYYKVYNLCIEEDYDESHFHGRVERYPFDDNHVPPLAMIKEFC  134

Query  673   EDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVS  852
             EDVHSWLS+DPKNIAV+HCMAGKGRTGLMV  YLVYTGMSAE+ALQVYA++RTTNN GVS
Sbjct  135   EDVHSWLSSDPKNIAVVHCMAGKGRTGLMVSCYLVYTGMSAEKALQVYAERRTTNNEGVS  194

Query  853   IPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQ  1032
             I SQRRYV YWEK LSF +  D   P V LPKPC+REL+ IRLYDTVN+D IF VVSELQ
Sbjct  195   IASQRRYVAYWEKALSFAEGADHPSPYVYLPKPCSRELQHIRLYDTVNIDQIFVVVSELQ  254

Query  1033  NIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVIQMD  1212
              IPG+RYCPP EV+KSCCR    +  R N PRYYYSF+   E E+  +E  EP LV+QMD
Sbjct  255   PIPGQRYCPPTEVAKSCCRRIGTDHERCNKPRYYYSFV---ESEEGKKEVVEPHLVVQMD  311

Query  1213  TESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNTSFIKSGLLQFSLRE  1392
             TESS++YQKTCL  YYE P+QVTGDVRIIFY+KLIG RLFY CFNT+FI S LLQF++R+
Sbjct  312   TESSIIYQKTCLGCYYEKPVQVTGDVRIIFYQKLIGSRLFYVCFNTAFITSSLLQFTIRD  371

Query  1393  LDKVGKKGKSICGPAFCVELIFGPANPSILMKKDDD  1500
             LDKVGK+G+SICGP+FC+EL FGP+N + LM   DD
Sbjct  372   LDKVGKRGRSICGPSFCLELFFGPSNANCLMPPSDD  407



>emb|CDP02279.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/406 (72%), Positives = 336/406 (83%), Gaps = 4/406 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  + G  +         +H    L+ FL TS YIRNLVSKQRRR++VGGYDLDMTY
Sbjct  1     MGLKFSRHGLPRTGDPG---LVHVHNKLINFLSTSFYIRNLVSKQRRRMIVGGYDLDMTY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPAE MR++YRNPLWQVKSVLDMRH  HYKVYNLCIE++YDP+HFHGRVER
Sbjct  58    ITDRILAMSFPAERMRSVYRNPLWQVKSVLDMRHPEHYKVYNLCIEEAYDPSHFHGRVER  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVPPL M+KEFCEDV+SWLS+DP+N+AVIHCMAGKGRTGLMV +YLVY GMSAE
Sbjct  118   FPFDDNHVPPLPMIKEFCEDVYSWLSSDPRNVAVIHCMAGKGRTGLMVSSYLVYMGMSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +ALQVY +KRTTNN GVSIPSQRRYV YWEK+L FP  +  G PDVNLPKP  REL RIR
Sbjct  178   KALQVYGEKRTTNNEGVSIPSQRRYVNYWEKLLCFPKSLQHGPPDVNLPKPVTRELIRIR  237

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYD  +VDS+F VVSELQN+ GERY  PVEVSKSCCR  K+ F R N PRYYYSF++ + 
Sbjct  238   LYDMQHVDSVFCVVSELQNVHGERYYRPVEVSKSCCRKIKDGFQRTNRPRYYYSFVDKDN  297

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             EE + ++ +   LV QMDTE S+LY+KTCL  YY+ P++VTGDVRIIFYEKLIGGRLFY 
Sbjct  298   EETDADKREA-HLVAQMDTECSILYRKTCLGCYYDNPVRVTGDVRIIFYEKLIGGRLFYC  356

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPS  1476
             CFNT+FIKS LLQF+L +LDKVGKKG+SI GPAFC+EL FGPAN S
Sbjct  357   CFNTAFIKSSLLQFTLSDLDKVGKKGRSISGPAFCLELFFGPANVS  402



>gb|EYU44161.1| hypothetical protein MIMGU_mgv1a007614mg [Erythranthe guttata]
Length=402

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/392 (73%), Positives = 328/392 (84%), Gaps = 3/392 (1%)
 Frame = +1

Query  325   HAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNP  504
             H Q  LV  L+ + YIRNLVSK+RRR+LV GYDLDMTYITDR+LAMSFPAE MRA+YRNP
Sbjct  6     HVQSQLVSCLYKN-YIRNLVSKKRRRMLVAGYDLDMTYITDRVLAMSFPAESMRAVYRNP  64

Query  505   LWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVH  684
             +WQVKSVL+MRH GHYKVYNLCIEQ+YD +HF GRVERYPFDDNHVP + MVK FCEDVH
Sbjct  65    MWQVKSVLEMRHPGHYKVYNLCIEQAYDASHFDGRVERYPFDDNHVPTISMVKAFCEDVH  124

Query  685   SWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQ  864
             SW+ +DPKNIAV+HCMAGKGRTGLMV  YLVYTGMSAE+ALQVYA+KRTTNN GVSI SQ
Sbjct  125   SWILSDPKNIAVVHCMAGKGRTGLMVSCYLVYTGMSAEKALQVYAEKRTTNNEGVSIASQ  184

Query  865   RRYVEYWEKVLSFPDRVDRGL-PDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIP  1041
             RRYVEYWEKVLS   RV+    P ++LPKPC+REL+ IRLYDT N+D IF VVS LQNIP
Sbjct  185   RRYVEYWEKVLSLSKRVNISTSPILDLPKPCSRELQHIRLYDTTNIDQIFVVVSVLQNIP  244

Query  1042  GERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVIQMDTES  1221
             G+RYCPP EVSK+CCR    E  R N PRYYYSF+   +EE + +   EPRLV+QMDTES
Sbjct  245   GQRYCPPAEVSKNCCRRIGKENERLNKPRYYYSFV-EGDEEGKKDVAAEPRLVVQMDTES  303

Query  1222  SMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNTSFIKSGLLQFSLRELDK  1401
             S++Y+KTCL YY+E P+QVTGDVRIIFYEKLIGGRLFY CFNT+FI   LLQFS+R+LDK
Sbjct  304   SIIYEKTCLGYYFEKPVQVTGDVRIIFYEKLIGGRLFYVCFNTAFITGSLLQFSMRDLDK  363

Query  1402  VGKKGKSICGPAFCVELIFGPANPSILMKKDD  1497
             VGK+G SICGP+FC+EL FGP+N +  +   D
Sbjct  364   VGKRGHSICGPSFCLELFFGPSNCNSFLPPSD  395



>ref|XP_006349574.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Solanum 
tuberosum]
Length=414

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 348/418 (83%), Gaps = 10/418 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG+RL KQG K+    S +S +H    L+ +L  S  IRNLVSKQRRR+LVGGYDLDMTY
Sbjct  1     MGVRLSKQGFKRPDTPS-ISDLHL--GLINYLSRSFCIRNLVSKQRRRMLVGGYDLDMTY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+DR+LAMSFPAEH+RA++RNPLWQVKSVLDMRH+GHYKVYNLCIEQ+YD +HFHGRVER
Sbjct  58    ISDRILAMSFPAEHVRAVFRNPLWQVKSVLDMRHAGHYKVYNLCIEQAYDASHFHGRVER  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YP DDNHVP L M+K+FCEDV+SWLS+D KNI VIHCMAGKGRTGLMVC+YLVYTGMSAE
Sbjct  118   YPIDDNHVPSLDMIKDFCEDVYSWLSSDSKNIVVIHCMAGKGRTGLMVCSYLVYTGMSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +AL+VYA+KRT NN GVSIPSQRRYV+YWE  LS+   V    P V LP+ C RELRRIR
Sbjct  178   DALRVYAEKRTINNEGVSIPSQRRYVKYWENALSYTKGVP---PTVKLPQSCKRELRRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT+N++SIFFV+SELQ +PGE+Y P VEVSKS CR  K+   R  SP+Y YSF+    
Sbjct  235   LYDTINIESIFFVLSELQRVPGEKYRPSVEVSKSSCRRIKSGIQRTYSPQYVYSFV-EEN  293

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E++  +E+KEPRLV+QMDTESSMLYQKTCLD++Y+ P+Q+ GDVRIIFYEKLIGGRLFYA
Sbjct  294   EDEMKQEKKEPRLVVQMDTESSMLYQKTCLDHFYDIPVQICGDVRIIFYEKLIGGRLFYA  353

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSILMK---KDDDI  1503
             CFNT+FI++ LLQFS+RELDKVGKKG+SI G +FC+EL FGPAN + L      DDD+
Sbjct  354   CFNTAFIRNDLLQFSIRELDKVGKKGRSITGSSFCLELFFGPANGNCLPTPPLHDDDL  411



>ref|XP_004306107.1| PREDICTED: uncharacterized protein LOC101309574 [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/404 (68%), Positives = 331/404 (82%), Gaps = 1/404 (0%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG +L K+         +L  +  Q  L+  +  S YIRNLVSKQRRR+LV GYDLDM+Y
Sbjct  1     MGTKLTKEQAVPLPVPGKLESLTLQHHLINCVSNSFYIRNLVSKQRRRMLVAGYDLDMSY  60

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+DR+LAMSFP+E +RAM+RNPLWQVKSVLDMRH  HYK+YNLCIE+ YDP+HF+GRVER
Sbjct  61    ISDRILAMSFPSERIRAMFRNPLWQVKSVLDMRHPEHYKIYNLCIEEQYDPSHFYGRVER  120

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVPPL MVK FCE V SWL++DP+NIAVIHCMAGKGRTGLMVCAYLVY GMSAE
Sbjct  121   FPFDDNHVPPLAMVKLFCESVQSWLNSDPENIAVIHCMAGKGRTGLMVCAYLVYCGMSAE  180

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             E LQ+YA +RTTNN GVSIPSQRRYV YWE  LSFP   D G P+V LP+PC+RELRRIR
Sbjct  181   EGLQLYAHRRTTNNEGVSIPSQRRYVGYWESCLSFPSEADEGPPEVKLPQPCSRELRRIR  240

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
              YDT+N+D IFFVVSEL+ IPG+RY P  EVS+S C+  K  + R +SPRYY SF    +
Sbjct  241   FYDTLNIDKIFFVVSELREIPGQRYRPSSEVSRSSCKKIKKGYQRTSSPRYYLSF-TEGD  299

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
              ED+  +  EPR+V+QMDTESS+LYQK CL+YY++ P+QVTGDVR+IFY+K+ GGRLFYA
Sbjct  300   GEDKKPDPDEPRVVVQMDTESSILYQKACLEYYFDNPVQVTGDVRVIFYQKMNGGRLFYA  359

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FIK+ LLQ ++R+LDK+GKKG+SICGP FC+EL+FGPAN
Sbjct  360   CFNTAFIKNSLLQLTVRDLDKIGKKGRSICGPKFCLELLFGPAN  403



>ref|XP_003621351.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Medicago truncatula]
 gb|AES77569.1| calcium/lipid-binding (CaLB) phosphatase [Medicago truncatula]
Length=420

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/406 (68%), Positives = 333/406 (82%), Gaps = 7/406 (2%)
 Frame = +1

Query  259   MGLRLGKQGQ--KKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDM  432
             MGL+L KQG   K ++PAS    +   + ++ +L T  +IRNLVSKQRRR+L+ GYDLDM
Sbjct  1     MGLKLTKQGSPPKISSPAS----LQLHERMIHYL-TKNFIRNLVSKQRRRILIAGYDLDM  55

Query  433   TYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRV  612
             +YITDR+LAMSFPAE MRAMYRNPLWQVKSVLDMRH  HYKVYNLCIE+ YDP  F+GRV
Sbjct  56    SYITDRVLAMSFPAERMRAMYRNPLWQVKSVLDMRHLEHYKVYNLCIEEHYDPAQFYGRV  115

Query  613   ERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMS  792
             E YPFDDNHVP L+M+K+FCE V+SWL+ DPKNI VIHCMAGKGRTGLMV +YL Y GMS
Sbjct  116   EEYPFDDNHVPSLEMIKDFCESVNSWLTRDPKNIVVIHCMAGKGRTGLMVSSYLTYCGMS  175

Query  793   AEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRR  972
             A+EALQ+YAD+RTTNN GVSIPSQRRYV YWE +LS P     G P V LP+PC+RELRR
Sbjct  176   ADEALQLYADRRTTNNEGVSIPSQRRYVGYWESLLSVPRGAGYGPPKVTLPQPCSRELRR  235

Query  973   IRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLeg  1152
             +RLYDTVN+D++FFV+SELQ IP E Y P VEV +SCCR  K  + R NSPRYY S +  
Sbjct  236   VRLYDTVNIDTVFFVISELQEIPNEVYRPSVEVCRSCCREVKKGYQRTNSPRYYISTIPQ  295

Query  1153  neeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLF  1332
              +E+ E  E +EPR+V+QMDTES  +YQK+CLD+Y++ P+QVTGDVR+IFYEK+IGGRLF
Sbjct  296   GDEDGEQSEIEEPRVVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRVIFYEKMIGGRLF  355

Query  1333  YACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             Y CFNT+FI++ LLQ ++ ELDKVGKKG+SICGP FC+EL+FGPAN
Sbjct  356   YCCFNTAFIRNSLLQLTVNELDKVGKKGRSICGPTFCLELLFGPAN  401



>ref|XP_010317527.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Solanum 
lycopersicum]
Length=413

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/409 (71%), Positives = 342/409 (84%), Gaps = 10/409 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG+ L KQG K+    S +S +H    L+ ++  S  IRNLVSKQRRR+LVGGYDLDMTY
Sbjct  1     MGVGLSKQGFKRGDTPS-ISDLHL--GLINYVSRSFCIRNLVSKQRRRMLVGGYDLDMTY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+DR+LAMSFPAEH+RA++RNPLWQVKSVLDMRH+GHYKVYNLCIEQ+YD +HFHGRVER
Sbjct  58    ISDRILAMSFPAEHVRAVFRNPLWQVKSVLDMRHAGHYKVYNLCIEQAYDASHFHGRVER  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YP DDNHVP L M+K+FCEDV+SWLS+D KNI VIHCMAGKGRTGLMVC+YLVYTGMSAE
Sbjct  118   YPIDDNHVPSLDMIKDFCEDVYSWLSSDSKNIVVIHCMAGKGRTGLMVCSYLVYTGMSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL-SFPDRVDRGLPDVNLPKPCARELRRI  975
             +AL+VYA+KRTTNN GVSIPSQRRYV+YWE  L S+   V    P V LPK   RELRRI
Sbjct  178   DALRVYAEKRTTNNEGVSIPSQRRYVKYWENALISYTKGVP---PTVKLPKSYKRELRRI  234

Query  976   RLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegn  1155
             RLYDT+N++SIFFV+SELQ +PGE+Y P VEVSKS CR  K+   R  SP+Y YS +   
Sbjct  235   RLYDTINIESIFFVLSELQRVPGEKYRPSVEVSKSSCRRIKSGIQRTYSPQYVYSLV---  291

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             EE +E EE KEPRLV+QMDTESSMLYQKTCLD++Y+ P+Q++GDVRIIFYEKLIGGRLFY
Sbjct  292   EENEEEEENKEPRLVVQMDTESSMLYQKTCLDHFYDIPVQISGDVRIIFYEKLIGGRLFY  351

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSIL  1482
             ACFNT+F+++ LLQFS+RELDKVGKK +SI G +FC+EL FGPAN + L
Sbjct  352   ACFNTAFVRNDLLQFSIRELDKVGKKARSITGSSFCLELFFGPANGNCL  400



>ref|XP_008341625.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Malus domestica]
Length=413

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/404 (69%), Positives = 329/404 (81%), Gaps = 6/404 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  +Q      PA +   +  Q  L+  L  S YIRNLVSKQRRR+LV GYDLDMTY
Sbjct  1     MGLKFSRQ-----VPAGKFESLTLQHKLINCLSKSFYIRNLVSKQRRRMLVAGYDLDMTY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPAE MRAMYRNPLWQVKSVLDMRH  HYK+YNLCIE++YDP+HFHGRVER
Sbjct  56    ITDRILAMSFPAERMRAMYRNPLWQVKSVLDMRHQDHYKIYNLCIEENYDPSHFHGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M+K FCE V SWLS DP+NIAVIHCMAGKGRTGLM+CAYLVY GM AE
Sbjct  116   FPFDDNHVPHLEMIKLFCESVDSWLSQDPENIAVIHCMAGKGRTGLMLCAYLVYCGMPAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YA +RT NN GVSIPSQRRYVEYW   LSFP  V+   PDVNLP+ C+RELRRIR
Sbjct  176   EALQLYAQRRTVNNEGVSIPSQRRYVEYWSNCLSFPRGVEDVPPDVNLPQQCSRELRRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
              YDT+N++ IFFVVSELQ I G+ Y P +EVS+S C+  +    R +SPRYY SF+   E
Sbjct  236   FYDTINIEKIFFVVSELQEISGQLYRPSLEVSRSSCKQIQKGCQRTSSPRYYVSFV-EGE  294

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             EED+  E  EP +V+QMDTESS+LYQK CL+YY++ P+Q+TGDVR+IFY+K+ G RLFYA
Sbjct  295   EEDKKAESDEPHVVVQMDTESSVLYQKACLEYYFDMPVQITGDVRVIFYQKMYGSRLFYA  354

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FI++ LLQ ++R+LDKVGKKG S+CGPAFC+EL+FGPAN
Sbjct  355   CFNTAFIRNSLLQLTVRDLDKVGKKGGSVCGPAFCLELLFGPAN  398



>ref|XP_006482710.1| PREDICTED: uncharacterized protein LOC102621298 isoform X1 [Citrus 
sinensis]
 ref|XP_006482711.1| PREDICTED: uncharacterized protein LOC102621298 isoform X2 [Citrus 
sinensis]
Length=425

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/401 (68%), Positives = 332/401 (83%), Gaps = 2/401 (0%)
 Frame = +1

Query  274   GKQGQKKAAPASQLSYIHAQQ-DLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDR  450
             GK  + + A   + S  H    +++  L  S YIRNLVSK+RRR+LV GYDLDM+YITDR
Sbjct  3     GKSSKHEIAKTKRSSSFHDLHFEVINILTKSFYIRNLVSKKRRRMLVEGYDLDMSYITDR  62

Query  451   LLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFD  630
             LLAMSFPAEHMRA+YRNPLWQVK+VLDMRH  HYKVYNLCIE+SYDP HF+GRVERYPFD
Sbjct  63    LLAMSFPAEHMRAVYRNPLWQVKAVLDMRHQEHYKVYNLCIEESYDPEHFYGRVERYPFD  122

Query  631   DNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQ  810
             DNHVPPL+M+K  CE VHSWLS+DPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAEEALQ
Sbjct  123   DNHVPPLEMIKLLCESVHSWLSSDPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAEEALQ  182

Query  811   VYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDT  990
             +YA KRTTNN GVSIPSQRRYV YW  ++SFP  V  G PDVNLPK C+REL R+RLYDT
Sbjct  183   LYAHKRTTNNEGVSIPSQRRYVGYWNNIISFPRGVHSGTPDVNLPKRCSRELLRVRLYDT  242

Query  991   VNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeede  1170
             +N D++FFVVSELQ + G+ + P +E+S+S CR  K    R  + +YY S +  +EEE  
Sbjct  243   INTDAVFFVVSELQEVTGQLHRPAMELSRSSCRPVKKGNQRNTNHKYYVSCI-EDEEEGS  301

Query  1171  veeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNT  1350
               E +EPR+V+QMDTE+S++YQKTCLD+Y++ PLQV+GDVR+IFY+K+IG R FYACFN 
Sbjct  302   KLESEEPRVVVQMDTENSIIYQKTCLDHYFDKPLQVSGDVRVIFYQKMIGSRFFYACFNA  361

Query  1351  SFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANP  1473
             +FI++ +LQFS+R+LDKVG +G+SICGP+FC+EL+FGPANP
Sbjct  362   AFIRNSMLQFSIRDLDKVGSRGRSICGPSFCLELVFGPANP  402



>ref|XP_009365953.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Pyrus 
x bretschneideri]
Length=413

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/414 (68%), Positives = 330/414 (80%), Gaps = 8/414 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  +Q      PA +   +  Q  L+  L  S YIRNLVSKQRRR+LV GYDLDMTY
Sbjct  1     MGLKFSRQ-----VPAGKFESLTLQHKLINCLSKSLYIRNLVSKQRRRMLVAGYDLDMTY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFP+E MRAMYRNPLWQVKSVLDMRH  HYK+YNLCIE+SYDP+HFHGRVER
Sbjct  56    ITDRILAMSFPSERMRAMYRNPLWQVKSVLDMRHQDHYKIYNLCIEESYDPSHFHGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M+K FCE V SWLS DPKNIAVIHCMAGKGRTGLMVCAYLVY GM AE
Sbjct  116   FPFDDNHVPHLEMIKLFCESVDSWLSQDPKNIAVIHCMAGKGRTGLMVCAYLVYCGMPAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL +YA +RT NN GVSIPSQRRYV YW   LSFP  V+   PDVNLP+ C+RELRRIR
Sbjct  176   EALLLYAQRRTINNEGVSIPSQRRYVGYWSNCLSFPRGVEDAPPDVNLPQQCSRELRRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
              YDTVN++ IFFVVSELQ I G+ Y P +EVS+S C+  +    R +SPRYY SF+   +
Sbjct  236   FYDTVNIEKIFFVVSELQEISGQVYRPSLEVSRSSCKQIRKGCQRTSSPRYYLSFI-EGD  294

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             EED+  E  EP +V+QMDTESS LYQK CL+YY++ P+QVTGDVR+IFY+K+ G RLFYA
Sbjct  295   EEDKKSESDEPHVVVQMDTESSALYQKACLEYYFDKPVQVTGDVRVIFYQKMYGSRLFYA  354

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN--PSILMKKD  1494
             CFNT+FI++ LLQ ++R+LDKVGKKG+S+CGPAFC+EL+FGP N  PS +   D
Sbjct  355   CFNTAFIRNSLLQLTVRDLDKVGKKGRSVCGPAFCLELLFGPINARPSFITPSD  408



>ref|XP_006848727.1| hypothetical protein AMTR_s00177p00053100 [Amborella trichopoda]
 gb|ERN10308.1| hypothetical protein AMTR_s00177p00053100 [Amborella trichopoda]
Length=465

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 338/418 (81%), Gaps = 11/418 (3%)
 Frame = +1

Query  226   NWPHGPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRL  405
             +WP       T G +  K+G   A     L  +   Q L+ +L    +IRNLVSK+RRRL
Sbjct  27    DWPSSFSDRFTTGAKFSKEG---AGHDGTLGALDGHQSLLNYLARVFFIRNLVSKKRRRL  83

Query  406   LVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSY  585
             +V GYDLDM+YITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH GHYKVYNLC EQ+Y
Sbjct  84    VVAGYDLDMSYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHEGHYKVYNLCAEQNY  143

Query  586   DPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVC  765
             D +HFHGRVE YPFDDNHVPPL ++K FCE VH+WLS DP+N+AVIHCMAGKGRTGLMVC
Sbjct  144   DVSHFHGRVEVYPFDDNHVPPLSLIKLFCESVHAWLSRDPQNVAVIHCMAGKGRTGLMVC  203

Query  766   AYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGL---PDV  936
             +YLV+TGMSA+ ALQ+YAD+RTTNN GVSIPSQRRYV YW ++LSFP    RGL   PDV
Sbjct  204   SYLVFTGMSADNALQLYADRRTTNNEGVSIPSQRRYVRYWSEILSFP----RGLNTTPDV  259

Query  937   NLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRP  1116
             N+P+P +RELRRIRLYDT++++S+FFVVSELQ  PG+ Y PPVE+++  CR  K   H  
Sbjct  260   NVPQPQSRELRRIRLYDTLDINSVFFVVSELQENPGQAYQPPVELTRKYCRQMKQGQHHT  319

Query  1117  NSPRYYYSFLegneeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRI  1296
             +SPRYY SF+   E +++V+E++ PR V+QMDTESS  Y+KTCLDYY++ PLQV GDVR+
Sbjct  320   SSPRYYLSFV-KKEGDEKVKEQEVPRFVVQMDTESSDPYKKTCLDYYFDCPLQVAGDVRV  378

Query  1297  IFYEKLIGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             +FYEK IGGRLFYACF+T+FI S LLQFS R+LDKVG+KG+SICGP FC+EL+FGPAN
Sbjct  379   VFYEKTIGGRLFYACFHTAFITSSLLQFSRRDLDKVGRKGRSICGPTFCLELLFGPAN  436



>gb|KDO72687.1| hypothetical protein CISIN_1g014325mg [Citrus sinensis]
Length=426

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/401 (68%), Positives = 332/401 (83%), Gaps = 2/401 (0%)
 Frame = +1

Query  274   GKQGQKKAAPASQLSYIHAQQ-DLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDR  450
             GK  + + A   + S  H    +++  L  S YIRNLVSK+RRR+LV GYDLDM+YITDR
Sbjct  3     GKSSKHEIAKTKRSSSFHDLHFEVINILTKSFYIRNLVSKKRRRMLVEGYDLDMSYITDR  62

Query  451   LLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFD  630
             LLAMSFPAEHMRA+YRNPLWQVK+VLDMRH  HYKVYNLCIE++YDP HF+ RVERYPFD
Sbjct  63    LLAMSFPAEHMRAVYRNPLWQVKAVLDMRHQEHYKVYNLCIEETYDPEHFYSRVERYPFD  122

Query  631   DNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQ  810
             DNHVPPL+M+K  CE VHSWLS+DPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAEEALQ
Sbjct  123   DNHVPPLEMIKLLCESVHSWLSSDPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAEEALQ  182

Query  811   VYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDT  990
             +YA KRTTNN GVSIPSQRRYV YW  ++SFP  V  G PDVNLPK C+REL R+RLYDT
Sbjct  183   LYAHKRTTNNEGVSIPSQRRYVGYWNNIISFPRGVHSGTPDVNLPKRCSRELLRVRLYDT  242

Query  991   VNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeede  1170
             +N D++FFVVSELQ + G+ + P +E+S+S CR  K    R  + +YY S +  +EEE  
Sbjct  243   INTDAVFFVVSELQEVTGQLHRPAMELSRSSCRPVKKGNQRNTNHKYYVSCI-EDEEEGS  301

Query  1171  veeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNT  1350
               E +EPR+V+QMDTE+S++YQKTCLD+Y++ PLQV+GDVR+IFY+K+IG R FYACFNT
Sbjct  302   KLESEEPRVVVQMDTENSIIYQKTCLDHYFDKPLQVSGDVRVIFYQKMIGSRFFYACFNT  361

Query  1351  SFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANP  1473
             +FI++ +LQFS+R+LDKVG +G+SICGP+FC+EL+FGPANP
Sbjct  362   AFIRNSMLQFSIRDLDKVGSRGRSICGPSFCLELLFGPANP  402



>ref|XP_010258182.1| PREDICTED: uncharacterized protein LOC104598017 [Nelumbo nucifera]
Length=420

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 333/418 (80%), Gaps = 9/418 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL++  QG         L   H    L+ +L  + YI +LVSKQRRR+LVGGYDLDM+Y
Sbjct  1     MGLKISTQG---PGTIGNLVEFHHPYYLLNYLTRTLYIHHLVSKQRRRMLVGGYDLDMSY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDM+H GHYKVYNLC E+SYDP+HFHG VE 
Sbjct  58    ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMKHLGHYKVYNLCAEESYDPSHFHGCVEI  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDD+HVP L M+K FCE VHSWLS DP+NIAVIHCMAGKGRTGLMVCAYL+Y GMSAE
Sbjct  118   FPFDDHHVPSLPMIKLFCESVHSWLSLDPQNIAVIHCMAGKGRTGLMVCAYLIYCGMSAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YA +RTTNN GVSI SQ RYVEYW K+L+FP  V  G PDVNLP+PC+RELRRIR
Sbjct  178   EALQLYAQRRTTNNEGVSIASQLRYVEYWSKILTFPRGVGNGPPDVNLPQPCSRELRRIR  237

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDTVN DS+FFV+SE+Q IPG+ Y P VEV ++ CR  K  + R NS  YY SF+  N 
Sbjct  238   LYDTVNTDSVFFVISEVQEIPGQLYRPYVEVCRNGCRQIKKGYQRTNSQCYYLSFI--NN  295

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             +ED  E    P +V+QMDTE+ ++YQKTCLDY ++ PLQVTGDVR++FY+K+IGGRLFYA
Sbjct  296   DEDSKETSDVPHVVVQMDTENPVIYQKTCLDYCFDKPLQVTGDVRVVFYQKMIGGRLFYA  355

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANP----SILMKKDDD  1500
             CFNT+FI + +LQFS+R+LDKVG KGKS+CG AFCVEL+FGPAN     S  M  DDD
Sbjct  356   CFNTAFITNSVLQFSIRDLDKVGYKGKSVCGSAFCVELLFGPANARCSLSPPMNNDDD  413



>ref|XP_006431247.1| hypothetical protein CICLE_v10011769mg [Citrus clementina]
 gb|ESR44487.1| hypothetical protein CICLE_v10011769mg [Citrus clementina]
Length=432

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 323/378 (85%), Gaps = 1/378 (0%)
 Frame = +1

Query  340   LVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVK  519
             ++  L  S YIRNLVSK+RRR+LV GYDLDM+YITDRLLAMSFPAEHMRA+YRNPLWQVK
Sbjct  32    VINILTKSFYIRNLVSKKRRRMLVEGYDLDMSYITDRLLAMSFPAEHMRAVYRNPLWQVK  91

Query  520   SVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSN  699
             +VLDMRH  HYKVYNLCIE++YDP HF+ RVERYPFDDNHVPPL+M+K  CE VHSWLS+
Sbjct  92    AVLDMRHQEHYKVYNLCIEETYDPEHFYSRVERYPFDDNHVPPLEMIKLLCESVHSWLSS  151

Query  700   DPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVE  879
             DPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAEEALQ+YA KRTTNN GVSIPSQRRYV 
Sbjct  152   DPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAEEALQLYAHKRTTNNEGVSIPSQRRYVG  211

Query  880   YWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCP  1059
             YW  ++SFP  V  G PDVNLPK C+REL R+RLYDT+N D++FFVVSELQ + G+ Y P
Sbjct  212   YWNNIISFPRGVHSGTPDVNLPKRCSRELLRVRLYDTINTDAVFFVVSELQEVTGQLYRP  271

Query  1060  PVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVIQMDTESSMLYQK  1239
              +E+S+S CR  K    R  + +YY S +  +EEE    E +EPR+V+QMDTE+S++YQK
Sbjct  272   AMELSRSSCRPVKKGNQRNTNHKYYVSCI-EDEEEGSKLESEEPRVVVQMDTENSIIYQK  330

Query  1240  TCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGK  1419
             TCLD+Y++ PLQV+GDVR+IFY+K+IG R FYACFNT+FI++ +LQFS+R+LDKVG +G+
Sbjct  331   TCLDHYFDKPLQVSGDVRVIFYQKMIGSRFFYACFNTAFIRNSMLQFSIRDLDKVGSRGR  390

Query  1420  SICGPAFCVELIFGPANP  1473
             SICGP+FC+EL+FGPANP
Sbjct  391   SICGPSFCLELLFGPANP  408



>ref|XP_004491862.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Cicer 
arietinum]
Length=421

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/406 (69%), Positives = 329/406 (81%), Gaps = 6/406 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  KQ   +  P      +     ++ +L T  +IRNLVSKQRRR+L+ GYDLDM+Y
Sbjct  1     MGLKFSKQ---EPPPKMNSPSLELHHRMISYL-TKNFIRNLVSKQRRRMLIAGYDLDMSY  56

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPAE MRAMYRNPLWQVKSVLDMRH  HYKVYNLCIE++YDP  F+GRVE 
Sbjct  57    ITDRVLAMSFPAERMRAMYRNPLWQVKSVLDMRHQEHYKVYNLCIEENYDPAQFYGRVEA  116

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVP L+MVK FCE V SWLS DPKNIAVIHCMAGKGRTGLMV +YL Y GMSAE
Sbjct  117   YPFDDNHVPSLEMVKAFCESVDSWLSRDPKNIAVIHCMAGKGRTGLMVSSYLTYCGMSAE  176

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YAD+RTTNN GVSIPSQRRYV YWE +LS P     G P+VNLP+ C+RELRRIR
Sbjct  177   EALQLYADRRTTNNEGVSIPSQRRYVGYWESLLSVPRGTGYGSPNVNLPQQCSRELRRIR  236

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDTVN+D+IFFV+SELQ IP E Y P VE+ +SCCR  K  + R NSPRYY S  E +E
Sbjct  237   LYDTVNIDTIFFVISELQEIPNEVYRPAVEIYRSCCREVKKGYQRTNSPRYYISIPESDE  296

Query  1159  --eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLF  1332
                + E+EE +EPR+V+QMDTES  +YQK+CLD+Y++ P+QVTGDVR+IFYEK+IGGRLF
Sbjct  297   DGIQSEIEERQEPRVVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRVIFYEKMIGGRLF  356

Query  1333  YACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             Y CFNTSFI++ LLQ ++++LDKVGKKGKSICGP F +EL+FGPAN
Sbjct  357   YCCFNTSFIRNSLLQLTVKDLDKVGKKGKSICGPTFGLELLFGPAN  402



>ref|XP_010936365.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Elaeis guineensis]
Length=407

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/404 (67%), Positives = 329/404 (81%), Gaps = 6/404 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG +  KQG  K    +     H    L+ ++    YIR  VS++RRR+LV GYDLDM+Y
Sbjct  1     MGSKFSKQGTAKVKTVAGPDGPH---KLLSYVANVFYIRYFVSRKRRRMLVAGYDLDMSY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDRLLAMSFPAE MRAMYRNPLWQVK+VLDMRH G Y+VYNLC E+SY+P+HFHG VE 
Sbjct  58    ITDRLLAMSFPAERMRAMYRNPLWQVKTVLDMRHPGAYRVYNLCAEESYNPSHFHGHVEV  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVPPL M+K FCE V+SWLSNDP+NIAV+HCMAGKGRTGLMVCAYLVY+GMSA+
Sbjct  118   FPFDDNHVPPLSMIKIFCESVYSWLSNDPQNIAVVHCMAGKGRTGLMVCAYLVYSGMSAD  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YA++RT NN GVSIPSQRRYV YW K+L+FP  +  G P V LP+P  RELRRIR
Sbjct  178   EALQLYANRRTINNEGVSIPSQRRYVGYWSKLLTFP--MVNGPPSVTLPRPTKRELRRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDTVN++S+FFVV+ELQ + G+ Y P VEV++ CCR  K+  HR +SPRYY SF+  ++
Sbjct  236   LYDTVNINSVFFVVAELQEVSGQLYRPSVEVARGCCRQIKHGHHRASSPRYYLSFV-NSD  294

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
              E++  E + PR V+QMDTESS +YQKTCLDYY++ PLQVTGD+R+IFYEK+IGGRLFY 
Sbjct  295   SEEDNYERETPRYVVQMDTESSAIYQKTCLDYYFDKPLQVTGDLRVIFYEKMIGGRLFYV  354

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FI+S LLQFSLR+LDKVG +GKSICG  FC+EL+FGPAN
Sbjct  355   CFNTAFIRSSLLQFSLRDLDKVGSRGKSICGSDFCLELLFGPAN  398



>ref|XP_010089585.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Morus notabilis]
 gb|EXB38056.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Morus notabilis]
Length=423

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/404 (67%), Positives = 329/404 (81%), Gaps = 6/404 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG+RL KQ Q +     ++ Y   Q  L+ ++  S  +RNLVS++RRR+L+ GYDLDM+Y
Sbjct  1     MGIRLSKQEQPR-----KIEYHSLQNHLINYVTKSFCLRNLVSRKRRRMLIQGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITD LLAMSFPA+ MRAMYRNPLWQVKSVLDMRH GHYK+YNLCIE+SYDP+ F+GRVE 
Sbjct  56    ITDHLLAMSFPAQRMRAMYRNPLWQVKSVLDMRHYGHYKIYNLCIEESYDPSLFYGRVEN  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVP L+M+K FCE V +W S DPKNIAV+HCMAGKGRTGLMVCAYLVY GMSAE
Sbjct  116   YPFDDNHVPQLEMIKAFCESVSAWHSADPKNIAVVHCMAGKGRTGLMVCAYLVYNGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EALQ+YA +RTTNN GVSIPSQRRYV YWE VLSF      G   V LP+PC+RELRRIR
Sbjct  176   EALQLYAHRRTTNNEGVSIPSQRRYVGYWESVLSFLRGAANGRSIVKLPQPCSRELRRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDTVN+DS++FVVSE+Q IPGE Y P VEV +SCCR  K  F R +S RYY SF+  ++
Sbjct  236   LYDTVNIDSVYFVVSEMQEIPGELYRPAVEVFRSCCRSVKKGFERTDSLRYYLSFM-QSD  294

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             ++ +  E K+  +V+QMDTES ++Y KTCLD +++ P+QVTGDVR+IF++K+ GGRLFYA
Sbjct  295   KDGKKREAKKSNVVVQMDTESPVIYHKTCLDCHFQKPVQVTGDVRVIFFQKMNGGRLFYA  354

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FIKS +LQ ++RELDKVG KGKSICGPAFC+EL+FGPAN
Sbjct  355   CFNTAFIKSSVLQLTVRELDKVGSKGKSICGPAFCLELLFGPAN  398



>ref|XP_008230834.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Prunus mume]
 ref|XP_008230835.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Prunus mume]
Length=412

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/406 (67%), Positives = 331/406 (82%), Gaps = 7/406 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  +Q   K      +  +  Q  L+  L  S YIRNLVSKQRRR+LV GYDLDMTY
Sbjct  1     MGLKFSRQVPGK------MESLTIQHKLINCLSKSFYIRNLVSKQRRRMLVAGYDLDMTY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPAE MRAMYRNPLWQVKSVLDMRH+ HYK+YNLCIE++YDP+HF+GRVE 
Sbjct  55    ITDRILAMSFPAERMRAMYRNPLWQVKSVLDMRHADHYKIYNLCIEENYDPSHFYGRVEW  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVPPL M+K FCE+V SWLS++PKNIAVIHCMAGKGRTGLMVCAYLVY G+SAE
Sbjct  115   FPFDDNHVPPLDMMKLFCENVDSWLSHNPKNIAVIHCMAGKGRTGLMVCAYLVYCGISAE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RT NN GVSIPSQRRYV YW   LSF   VD G P VNLP PC+RELRRIR
Sbjct  175   EALELYAQRRTINNEGVSIPSQRRYVGYWSHCLSFHPEVDDGPPSVNLPPPCSRELRRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
              YDTVN+D IFFVV ELQ I G+ Y P +EV++S C+  K  + R +SPRYY SF+   +
Sbjct  235   FYDTVNIDKIFFVVLELQEISGQIYRPSLEVARSSCKQIKKGYQRTSSPRYYLSFI-EGD  293

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
               D+  E++EP +V+QMDTESS+LYQK CL+YY++ P+QVTGD+R+IFY+K+ GGRLFYA
Sbjct  294   GADKKSEQEEPHVVVQMDTESSILYQKACLEYYFDKPVQVTGDIRVIFYQKMNGGRLFYA  353

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPS  1476
             CFNT+FI++ LLQ ++ +LDK+GKKG+SICGPAFC+EL+FGPAN +
Sbjct  354   CFNTAFIRNSLLQLTVPDLDKMGKKGRSICGPAFCLELLFGPANTT  399



>ref|XP_007215462.1| hypothetical protein PRUPE_ppa006437mg [Prunus persica]
 gb|EMJ16661.1| hypothetical protein PRUPE_ppa006437mg [Prunus persica]
Length=412

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/406 (67%), Positives = 333/406 (82%), Gaps = 7/406 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG++  +Q   K      +  +  Q  L+  L  S YIRNLVSKQRRR+LV GYDLDMTY
Sbjct  1     MGMKFSRQVPGK------MESLTIQHKLINCLSKSFYIRNLVSKQRRRMLVAGYDLDMTY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPAE MRAMYRNPLWQVKSVLDMRH+ HYK+YNLCIE++YDP+HF+GRVER
Sbjct  55    ITDRILAMSFPAERMRAMYRNPLWQVKSVLDMRHADHYKIYNLCIEENYDPSHFYGRVER  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVPPL ++K FCE+V SWLS++PKNIAVIHCMAGKGRTGLMVCAYLVY G+SAE
Sbjct  115   FPFDDNHVPPLDLMKLFCENVDSWLSHNPKNIAVIHCMAGKGRTGLMVCAYLVYCGISAE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RT NN GVSIPSQRRYV YW   LSF   VD G P VNLP PC+RELRRIR
Sbjct  175   EALELYAQRRTINNEGVSIPSQRRYVGYWSHCLSFHPEVDDGPPSVNLPPPCSRELRRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
              YDTVN+D IFFVV EL+ I G+ Y P +EV++S C+  K  + R +SPRYY SF+   +
Sbjct  235   FYDTVNIDKIFFVVLELKEISGQIYRPSLEVARSSCKQIKKGYQRTSSPRYYLSFV-EGD  293

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
              ED+  E+++P +V+QMDTESS+LYQK CL+YY++ P+QVTGD+R+IFY+K+ GGRLFYA
Sbjct  294   GEDKKSEQEKPHVVVQMDTESSILYQKACLEYYFDKPVQVTGDIRVIFYQKMNGGRLFYA  353

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPS  1476
             CFNT+FI++ LLQ ++ +LDK+GKKG+SICGPAFC+EL+FGPAN +
Sbjct  354   CFNTAFIRNSLLQLTVPDLDKMGKKGRSICGPAFCLELLFGPANTT  399



>ref|XP_003531839.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Glycine 
max]
 gb|KHM98807.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Glycine soja]
Length=417

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/406 (67%), Positives = 325/406 (80%), Gaps = 10/406 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  KQG  K    S    +H Q  ++ +L T  +IRNLVSKQRRR+L+ GYDLDM+Y
Sbjct  1     MGLKFTKQGPPKIEDPS----LHNQ--MINYL-TKNFIRNLVSKQRRRMLIAGYDLDMSY  53

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFPA+ MRAMYRNPLWQVKSVLDMRH  HYK+YNLCIE+SYDP +F+GRVE 
Sbjct  54    ITDRVLAMSFPAQRMRAMYRNPLWQVKSVLDMRHYDHYKIYNLCIEESYDPDNFYGRVEA  113

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVP L+M+K FCE V SWLS+DPKNIAVIHCMAGKGRTGLMV AYL Y GMSA+
Sbjct  114   YPFDDNHVPSLEMIKAFCESVDSWLSSDPKNIAVIHCMAGKGRTGLMVSAYLTYCGMSAD  173

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL--SFPDRVDRGLPDVNLPKPCARELRR  972
             EALQ+YAD+RTTNN GVSIPSQRRYV YW+ +L  S P     G   VNLP+PC RELRR
Sbjct  174   EALQLYADRRTTNNEGVSIPSQRRYVAYWDSLLSNSVPRGTGNGPTKVNLPQPCGRELRR  233

Query  973   IRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLeg  1152
             IRLYDT+N+D+IFFV+SEL  IP E Y PPVE  + CCR  K  + R NSPRYY S L  
Sbjct  234   IRLYDTINIDTIFFVISELHEIPNEVYRPPVEAYRGCCRQIKKGYQRNNSPRYYISIL-E  292

Query  1153  neeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLF  1332
              +++    E +EPR+V+QMDTES  +YQK+CLD+Y++ P+QVTGDVR+ FYEK+IGGRLF
Sbjct  293   GDKDGNQSETEEPRIVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRLTFYEKMIGGRLF  352

Query  1333  YACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             Y CFNT+FI++ LLQ  ++ELDKVGKKG SICGP FC+EL+FGPAN
Sbjct  353   YCCFNTAFIRNSLLQLPIQELDKVGKKGTSICGPDFCLELLFGPAN  398



>ref|XP_007139516.1| hypothetical protein PHAVU_008G036300g [Phaseolus vulgaris]
 gb|ESW11510.1| hypothetical protein PHAVU_008G036300g [Phaseolus vulgaris]
Length=417

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/408 (68%), Positives = 329/408 (81%), Gaps = 14/408 (3%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L KQ   KA   S          ++ +L T  +IRNLVSKQRRR+L+ GYDLDM+Y
Sbjct  1     MGLKLTKQDPPKAEDLS------LHHHMISYL-TKNFIRNLVSKQRRRMLIAGYDLDMSY  53

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDR+LAMSFP++ MRAMYRNPLWQVKSVLDMRH  HYK+YNLCIE+SYDP HF+GRVE 
Sbjct  54    ITDRVLAMSFPSQRMRAMYRNPLWQVKSVLDMRHYDHYKIYNLCIEESYDPAHFYGRVEA  113

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVP L+M++ FCE V SWLS+DPKNIAVIHCMAGKGRTGLMVCAYL Y GMSA+
Sbjct  114   YPFDDNHVPSLEMIRAFCESVDSWLSSDPKNIAVIHCMAGKGRTGLMVCAYLSYCGMSAD  173

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGL----PDVNLPKPCAREL  966
             EALQ+YAD+RTTNN GVSIPSQRRYV YW+ +LS  + V RG     P V LP P +REL
Sbjct  174   EALQLYADRRTTNNEGVSIPSQRRYVTYWDTLLS--NSVLRGTGNEPPKVKLPPPSSREL  231

Query  967   RRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFL  1146
             RRIRLYDTVN+D+IFFV+SELQ IP E Y P VE  +S CR  K  + R NSPRYY S L
Sbjct  232   RRIRLYDTVNIDTIFFVISELQEIPNEVYRPSVEAYRSSCRQIKKGYQRNNSPRYYISIL  291

Query  1147  egneeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGR  1326
               ++++ +  E +EPR+V+QMDTES  +YQK+CLD+Y++ P+QVTGDVR+IFYEK+IGGR
Sbjct  292   -EDDDDGKQSETEEPRIVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRVIFYEKMIGGR  350

Query  1327  LFYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             LFY CFNT+FIK+ LLQ +++ELDKVGKKG SICGP FC+EL+FGPAN
Sbjct  351   LFYCCFNTAFIKNSLLQLTIQELDKVGKKGSSICGPDFCLELLFGPAN  398



>ref|XP_008443370.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Cucumis 
melo]
 ref|XP_008443371.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Cucumis 
melo]
 ref|XP_008443372.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Cucumis 
melo]
Length=415

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/404 (69%), Positives = 325/404 (80%), Gaps = 8/404 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG++L K  Q K    S       Q  L+ +L  S YIRNLVSKQRRR+LV GYDLDM+Y
Sbjct  1     MGIKLSKPNQGKVENLS------LQHHLINYLSKSFYIRNLVSKQRRRMLVAGYDLDMSY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITD +LAMSFPAE MRAMYRNPLWQVKSVLDMRH GHYK+YNLCIE+SYDP+HFHGRVE 
Sbjct  55    ITDHVLAMSFPAERMRAMYRNPLWQVKSVLDMRHQGHYKIYNLCIEESYDPSHFHGRVES  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP LQM+K FCE+V SWLS+ PKNIAVIHCMAGKGRTGLMVCAYLVY GMS E
Sbjct  115   FPFDDNHVPHLQMIKIFCENVSSWLSSHPKNIAVIHCMAGKGRTGLMVCAYLVYCGMSVE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +ALQ+YA +RTTNN GVSIPSQRRYV YW K LSFP  V  G P+V LPKPC REL+RIR
Sbjct  175   DALQLYAQRRTTNNEGVSIPSQRRYVGYWSKCLSFPKGVHNGPPEVKLPKPCRRELQRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDTVN +SIFFVVSELQ +P + Y P +E+++ CCR  K  + R NSPRY+ SF+    
Sbjct  235   LYDTVNTESIFFVVSELQEVPSQLYRPSMELTRKCCRQFKRGYERSNSPRYFLSFV--EG  292

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E +  + E EP L++QMDTE S LY KTCLDY +E PL +TGDVRIIFY K+ GGRLFYA
Sbjct  293   ENEGNKSEVEPHLIVQMDTECSALYNKTCLDYNFEKPLPLTGDVRIIFYAKMFGGRLFYA  352

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FIK+ LLQ  L++LDKVGKKG+S+CGP+FC+EL+FGPAN
Sbjct  353   CFNTAFIKNSLLQLRLQDLDKVGKKGRSLCGPSFCLELVFGPAN  396



>ref|XP_008795462.1| PREDICTED: uncharacterized protein LOC103711183 [Phoenix dactylifera]
Length=452

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/411 (65%), Positives = 331/411 (81%), Gaps = 6/411 (1%)
 Frame = +1

Query  238   GPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGG  417
             G L   T G +  KQG  K  P +     H    L+ ++    YIR LVS++RRR+LV G
Sbjct  39    GLLGQVTTGSKFSKQGPAKVKPVAGPDDPH---KLLSYVANFFYIRYLVSRKRRRMLVAG  95

Query  418   YDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTH  597
             +DLDM+YITDRLLAMS+PAE MRAMYRNPLWQVK+VLD+RH G YKVYNLC E+SY+P+H
Sbjct  96    FDLDMSYITDRLLAMSYPAERMRAMYRNPLWQVKTVLDLRHPGGYKVYNLCAEESYNPSH  155

Query  598   FHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLV  777
             FHGRVE +PFDDNHVPPL M+K FCE +HSWLS+DP NIAV+HCMAGKGRTGLMVCAYLV
Sbjct  156   FHGRVEVFPFDDNHVPPLSMIKHFCESIHSWLSHDPHNIAVVHCMAGKGRTGLMVCAYLV  215

Query  778   YTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCA  957
             Y+GMSA+EALQ+YA++RT NN GVSIPSQRRYV YW K+L+FP  +  G P V LP+   
Sbjct  216   YSGMSADEALQLYANRRTINNEGVSIPSQRRYVGYWSKLLTFP--MVNGPPSVTLPQLTK  273

Query  958   RELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYY  1137
             RELRRIRLYDTVN++S+FFVV+ELQ + G+ Y P VEV++ CCR  K+ +HR +SPRYY 
Sbjct  274   RELRRIRLYDTVNINSVFFVVAELQEVSGQLYRPSVEVARRCCRQIKHGYHRASSPRYYL  333

Query  1138  SFLegneeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLI  1317
             SF+  ++ +++  E + P  V+QMDTESS +YQKTCLD+Y++ PLQVTGD+R+IFYEK+I
Sbjct  334   SFI-NSDSDEDNCESETPHYVVQMDTESSAIYQKTCLDHYFDKPLQVTGDLRVIFYEKMI  392

Query  1318  GGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             GGRLFY CFNT+FI S LLQFS+R+LDKVG +GKSICG  FC+EL+FGPAN
Sbjct  393   GGRLFYVCFNTAFISSSLLQFSVRDLDKVGSRGKSICGSDFCLELLFGPAN  443



>gb|KGN59536.1| hypothetical protein Csa_3G824810 [Cucumis sativus]
Length=416

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/414 (67%), Positives = 325/414 (79%), Gaps = 8/414 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG++  K  Q K      +  +  Q  L+ +L  S YIRNLVSKQRRR+LV GYDLDM+Y
Sbjct  1     MGIKFSKPNQVK------VDNLSLQHHLINYLSKSFYIRNLVSKQRRRMLVAGYDLDMSY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITD +LAMSFPAE MRA+YRNPLWQVKSVLDMRH GHYK+YNLCIE+SYDP+HFHGRVE 
Sbjct  55    ITDHVLAMSFPAERMRAVYRNPLWQVKSVLDMRHQGHYKIYNLCIEESYDPSHFHGRVES  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP LQM+K FC++V SWLS+ PKNIAVIHCMAGKGRTGLMVCAYLVY GMS E
Sbjct  115   FPFDDNHVPHLQMIKIFCDNVSSWLSSHPKNIAVIHCMAGKGRTGLMVCAYLVYCGMSVE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +ALQ+YA +RTTNN GVSIPSQRRYV YW + LSFP  V  G P+V LPKPC REL+RIR
Sbjct  175   DALQLYAQRRTTNNEGVSIPSQRRYVGYWSRCLSFPRGVYNGPPEVKLPKPCRRELQRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYD VN +SIFFVVSE Q +P + Y P  E+++ CCR  K+ + R NSPRY+ SF+    
Sbjct  235   LYDAVNTESIFFVVSESQEVPSQLYRPSAELTRKCCRQFKSGYERSNSPRYFLSFV--EG  292

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E +  + E EP LV+QMDTE S LY KTCLDY +E PL +TGDVRIIFY K+ GGRLFYA
Sbjct  293   ENEGNKSEVEPHLVVQMDTECSALYNKTCLDYNFEKPLPLTGDVRIIFYAKMFGGRLFYA  352

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSILMKKDDD  1500
             CFNT+FIK+ LLQ  L++LDKVGKKG+SICGP+FC+EL+FGPAN   L     D
Sbjct  353   CFNTAFIKNSLLQLRLQDLDKVGKKGRSICGPSFCLELVFGPANAKHLFSTSSD  406



>ref|XP_010661109.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100254134 
[Vitis vinifera]
Length=412

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 331/418 (79%), Gaps = 10/418 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL   +QG  + A  S L Y      L+ +L  + YIRNLVSKQRRR+LVGGYDLDM++
Sbjct  1     MGLTFSEQGPGRFASNSLLQY-----QLINYLTRTLYIRNLVSKQRRRMLVGGYDLDMSF  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             IT RLLAMSFPAE M+A++RNPLWQVK VLDMRH+GHYKVYNL +E+SYDP HFHGRVE 
Sbjct  56    ITGRLLAMSFPAERMQAIFRNPLWQVKDVLDMRHNGHYKVYNLRVEESYDPLHFHGRVET  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDD+H+PPLQ +K FC++VHSWLS+ PKNIAV+HCMAGKGRTGL VCAYLVYTGMSAE
Sbjct  116   FPFDDHHIPPLQTIKLFCKNVHSWLSSHPKNIAVVHCMAGKGRTGLTVCAYLVYTGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL+++ADKRTTNN GVSIPSQRRYV YWE +L+F   VD   P VNLP+PC+REL+RIR
Sbjct  176   EALKLHADKRTTNNEGVSIPSQRRYVGYWESLLAFTRGVDYRPPXVNLPQPCSRELKRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYD V   ++FF+VSELQ + G+ Y P +EV++SCCR  K  + R NSPRYY SF   ++
Sbjct  236   LYDIV-XQAVFFMVSELQEVTGQLYRPSLEVARSCCRQIKKGYQRTNSPRYYLSFGNNDQ  294

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             +  + E+ +   +V+QMDTES +LYQK CLDY ++ PL+VTGDV IIFY+K +GGRLFY 
Sbjct  295   QGTKSEQGERC-VVVQMDTESPVLYQKACLDYNFDKPLKVTGDVHIIFYQKSMGGRLFYT  353

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSILMK---KDDDI  1503
             CFNT+FI++ LLQF++  LDK+G KGKSICGPAF +EL+FGPAN     +    DDD+
Sbjct  354   CFNTAFIRNSLLQFTVSNLDKMGHKGKSICGPAFGLELLFGPANAEHSFQPTLDDDDL  411



>ref|XP_006405632.1| hypothetical protein EUTSA_v10027783mg [Eutrema salsugineum]
 gb|ESQ47085.1| hypothetical protein EUTSA_v10027783mg [Eutrema salsugineum]
Length=414

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/403 (65%), Positives = 330/403 (82%), Gaps = 5/403 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K     +++  H    ++ +L TS Y+R+LVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGLKLSR-GPGKEKSTLEITRGH----ILTYLTTSSYLRSLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+DRLLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDRLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPDNFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FC+ VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCQSVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF   +  G P+V LP+  +REL RIR
Sbjct  176   EALEMYASRRTTNNNGVSIPSQRRYVKYWSNLLSFRKGIGNGPPEVRLPQEHSRELLRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT NVDS+FFVVSELQ +P E Y P VE+++ CCR  +  + R +SPRYY S +  +E
Sbjct  236   LYDTANVDSVFFVVSELQEVPNEIYRPSVELARGCCRQFRRGYCRSSSPRYYISHVNDSE  295

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E++ + + +EPR V+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY 
Sbjct  296   EDEVLTDGEEPRFVVQMDTESSIIDEKTCLDFYFDKPVKVSGDIRITFYQKMIGSRLFYT  355

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPA  1467
             CFNT+FI +GLLQFS+RELDKVG  G+SI GP F +EL+FGPA
Sbjct  356   CFNTAFITNGLLQFSIRELDKVGGNGRSISGPDFSLELLFGPA  398



>ref|XP_002324090.2| hypothetical protein POPTR_0017s12540g [Populus trichocarpa]
 gb|EEF04223.2| hypothetical protein POPTR_0017s12540g [Populus trichocarpa]
Length=434

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/411 (69%), Positives = 335/411 (82%), Gaps = 10/411 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  KQG  KA   + LS  HAQ  L+  +  S YIRN VSK RRR+LV GYDLDM+Y
Sbjct  1     MGLKFAKQGPGKAL-NTDLS--HAQLSLINCITKSIYIRNWVSKHRRRMLVAGYDLDMSY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             IT R+LAMSFPAE +RAMYRNPLWQVKSVLDMRH  HYK+YNLCIE++YDP+HFHGRVE 
Sbjct  58    ITGRILAMSFPAERVRAMYRNPLWQVKSVLDMRHGEHYKIYNLCIEEAYDPSHFHGRVET  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVPPL+M+K FCE V SWLS+DP+NIAV+HCMAGKGRTGLMVCAYLVY+GM+ E
Sbjct  118   YPFDDNHVPPLEMMKLFCESVGSWLSSDPRNIAVVHCMAGKGRTGLMVCAYLVYSGMTPE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRV---DRG----LPDVNLPKPCA  957
             +ALQ+YA+KRTTNN GVSIPSQRRYV YW + LSFP RV    RG     P+V LP+   
Sbjct  178   DALQLYANKRTTNNQGVSIPSQRRYVGYWAEALSFPKRVYDSHRGDGHTPPEVILPQSRI  237

Query  958   RELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYY  1137
             RELRRIRLYD VN +S+FFVVSELQ IPG+ Y P VEV+KSC R     + R +SP+YY 
Sbjct  238   RELRRIRLYDMVNTESVFFVVSELQEIPGQLYRPSVEVAKSCLRPIIKGYQRNSSPQYYI  297

Query  1138  SFLegneeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLI  1317
             SF EGNEEE+E  +  E RL++QMDTES ++YQKT LDYY++ P++V GDVR+IFY+K+I
Sbjct  298   SFTEGNEEEEEDLKPAESRLIVQMDTESPIIYQKTTLDYYFDKPIRVKGDVRVIFYQKMI  357

Query  1318  GGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             GGRLFY CFNT+FI++GLLQFS R+LDKVG KG+SICGPAFC+EL+F PAN
Sbjct  358   GGRLFYVCFNTAFIRNGLLQFSTRDLDKVGTKGRSICGPAFCLELLFAPAN  408



>gb|KDP27203.1| hypothetical protein JCGZ_19902 [Jatropha curcas]
Length=375

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 302/356 (85%), Gaps = 1/356 (0%)
 Frame = +1

Query  403   LLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQS  582
             +LV GYDLDM+YITDR+LAMSFPAE MRAMYRNPLWQVK+VLDMRH GHYKVYNLCIEQS
Sbjct  1     MLVAGYDLDMSYITDRVLAMSFPAERMRAMYRNPLWQVKNVLDMRHGGHYKVYNLCIEQS  60

Query  583   YDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMV  762
             YDP HFHGRVE YPFDDNHVPPL+MVK+FCE V+SWLS DPKNIAV+HCMAGKGRTGLMV
Sbjct  61    YDPEHFHGRVESYPFDDNHVPPLEMVKQFCESVNSWLSQDPKNIAVVHCMAGKGRTGLMV  120

Query  763   CAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNL  942
              +YLVY+GM  EEALQ+YA+KRTTNN GVSIPSQRRYV YW  VL+FP+ +  G P V+L
Sbjct  121   SSYLVYSGMVVEEALQLYANKRTTNNQGVSIPSQRRYVGYWGSVLAFPNGIGNGPPKVSL  180

Query  943   PKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNS  1122
             P+PC+RELRRIRLYDTVN DSIFFVVSELQ I G+ Y PP EV+K  C+     + R  S
Sbjct  181   PQPCSRELRRIRLYDTVNTDSIFFVVSELQEISGQVYRPPGEVAKGYCKPISEGYQRNYS  240

Query  1123  PRYYYSFLegneeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIF  1302
             PRYY SF+   +EE +  + +EP +V+QMDTE  ++ +K CLD+Y+ TP+QV GD+R+IF
Sbjct  241   PRYYISFI-EGDEEGKRSQAEEPHVVVQMDTERPIIDRKNCLDFYFNTPVQVKGDIRVIF  299

Query  1303  YEKLIGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             Y+K+IGGRLFY CFNT+FIKS LLQFS++ELDK+GKKG+SICG  FC+EL+FGPAN
Sbjct  300   YQKMIGGRLFYVCFNTAFIKSSLLQFSVKELDKIGKKGESICGSTFCLELLFGPAN  355



>ref|XP_002870781.1| hypothetical protein ARALYDRAFT_330553 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47040.1| hypothetical protein ARALYDRAFT_330553 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 331/404 (82%), Gaps = 9/404 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K     + + +H    ++ +L TS Y+R+LVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGLKLSR-GPVKEKSTLEFTRVH----ILTYLSTSSYLRSLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPENFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCESVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF     RG P+V LP+  +REL RIR
Sbjct  176   EALEMYASRRTTNNNGVSIPSQRRYVKYWSDLLSFR---KRGPPEVKLPQEHSRELLRIR  232

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLe-gn  1155
             LYDT NVDS+FFVVSELQ +P E Y P VE+++ CCR  K  + R +SPRYY S +   +
Sbjct  233   LYDTANVDSVFFVVSELQEVPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHVNCDS  292

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             EE++EV + +EPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY
Sbjct  293   EEDEEVTDGEEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFY  352

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPA  1467
              CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+FGPA
Sbjct  353   TCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPA  396



>ref|XP_009139848.1| PREDICTED: putative tyrosine-protein phosphatase TPTE [Brassica 
rapa]
 emb|CDX74467.1| BnaA04g09220D [Brassica napus]
Length=413

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 333/416 (80%), Gaps = 10/416 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K     QL+ +H    ++ +L TS Y+RNLVSK+RRRL+ GGYDLDM+Y
Sbjct  1     MGLKLSR-GPGKEKSTLQLTRVH----ILTYLTTSYYLRNLVSKKRRRLITGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYK+YNLCIE+ YDP +F+GRVER
Sbjct  56    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKIYNLCIEECYDPENFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FC+ VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCQSVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +L   +R+ +G P+V LP+  +REL RIR
Sbjct  176   EALEMYASRRTTNNNGVSIPSQRRYVKYWSHLLG--ERIGKGPPEVKLPQEHSRELLRIR  233

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLe-gn  1155
             LYDT NVDS+FFVVSELQ +P E Y P VE+++ CCR  K  + R +SPRYY S +   +
Sbjct  234   LYDTANVDSVFFVVSELQEVPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHINCDS  293

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             EE++ +   +EPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY
Sbjct  294   EEDEVLTAGEEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFY  353

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN--PSILMKKDD  1497
              CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+F PA      L+ +DD
Sbjct  354   TCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFSPATSISGKLLSRDD  409



>ref|XP_011035829.1| PREDICTED: uncharacterized protein LOC105133497 [Populus euphratica]
Length=434

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/412 (68%), Positives = 332/412 (81%), Gaps = 11/412 (3%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  KQG  KA   + LS  HAQ  L+  +  S YIRN VSK RRR+LV GYDLDM+Y
Sbjct  1     MGLKFAKQGPGKAL-NTDLS--HAQLSLINCITKSIYIRNWVSKHRRRMLVAGYDLDMSY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             IT R+LAMSFPAE +RAMYRNPLWQVKSVLDMRH  HYK+YNLCIE++YDP+HFHGRVE 
Sbjct  58    ITGRILAMSFPAERVRAMYRNPLWQVKSVLDMRHGEHYKIYNLCIEEAYDPSHFHGRVET  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             YPFDDNHVPPL+M+K FCE V SWLS+DP+NIAV+HCMAGKGRTGLMVCAYLVY+GM+ E
Sbjct  118   YPFDDNHVPPLEMMKLFCESVGSWLSSDPRNIAVVHCMAGKGRTGLMVCAYLVYSGMTPE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGL-------PDVNLPKPCA  957
             +ALQ+YA+KRTTNN GVSIPSQRRYV YW + L FP R   G        P+V LP+   
Sbjct  178   DALQLYANKRTTNNQGVSIPSQRRYVGYWAEALFFPKRGYDGHRGDGHTPPEVILPQSRI  237

Query  958   RELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYY  1137
             RELRRIRLYD VN++S+FFVVSELQ IPG+ Y PPVEV+K C R     + R  SP+YY 
Sbjct  238   RELRRIRLYDMVNIESVFFVVSELQEIPGQLYRPPVEVAKGCLRPIIKGYQRNISPQYYI  297

Query  1138  SFLegneeedeveee-kePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKL  1314
             SF EG EEE+E + +  E RL++QMDTES ++YQKT LDYY++ P+QV GDVR+IFY+K+
Sbjct  298   SFTEGGEEEEEEDLKPAESRLIVQMDTESPIIYQKTTLDYYFDKPIQVKGDVRVIFYQKM  357

Query  1315  IGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             IGGRLFY CFN++FI++GLLQFS R+LDKVG KG+SICGPAFC+EL+F PAN
Sbjct  358   IGGRLFYVCFNSAFIRNGLLQFSTRDLDKVGTKGRSICGPAFCLELLFAPAN  409



>ref|XP_010435891.1| PREDICTED: uncharacterized protein LOC104719634 [Camelina sativa]
Length=410

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 330/404 (82%), Gaps = 9/404 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K     +L+ +H    ++ +L TS Y+RNLVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGLKLSR-GPVKEKSTLELTRVH----ILTYLTTSSYLRNLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPENFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE V+SW++ DPKNIAVIHCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQIFCESVYSWIALDPKNIAVIHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +AL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF     +G P+V LP+  +REL RIR
Sbjct  176   DALEMYASRRTTNNNGVSIPSQRRYVKYWSDLLSFG---KKGPPEVKLPQEDSRELLRIR  232

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT NVDS+FFVVSELQ +P E Y P VE+++ CCR  K  + R +SPRYY S +   E
Sbjct  233   LYDTANVDSVFFVVSELQEVPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHV-NPE  291

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E++EV + +EPRLV+QMDTESS++ +KTCLD+Y++   Q++GD+RI FY+K+IG RLFY 
Sbjct  292   EDEEVTDGEEPRLVVQMDTESSIIDEKTCLDFYFDXXXQLSGDIRITFYQKMIGSRLFYT  351

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+FGPAN
Sbjct  352   CFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPAN  395



>ref|NP_198756.2| protein PHOSPHATASE AND TENSIN HOMOLOG DELETED ON CHROMOSOME 
TEN 1 [Arabidopsis thaliana]
 dbj|BAB11013.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAD35363.1| phosphatase and tensin homolog [Arabidopsis thaliana]
 dbj|BAC42741.1| PTEN like protein [Arabidopsis thaliana]
 gb|AAO63980.1| putative PTEN protein [Arabidopsis thaliana]
 gb|AED94429.1| Calcium/lipid-binding (CaLB) phosphatase [Arabidopsis thaliana]
Length=412

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 331/404 (82%), Gaps = 9/404 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L +   K+ +P  + + +H    ++ +  T+ Y+RNLVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGLKLSRGPVKEKSPL-EFTRVH----ILTYFTTNSYLRNLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPDNFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCESVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF     +G P+V LP+  +REL RIR
Sbjct  176   EALEMYASRRTTNNNGVSIPSQRRYVKYWSDLLSFS---KKGPPEVKLPQEHSRELLRIR  232

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLe-gn  1155
             LYDT NVDS+FFVVSELQ +P E Y P VE+++ CCR  K  + R +SPRYY S +   +
Sbjct  233   LYDTANVDSVFFVVSELQEVPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHVNCDS  292

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             EE++EV + +EP LV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY
Sbjct  293   EEDEEVTDGEEPHLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFY  352

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPA  1467
              CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+FGPA
Sbjct  353   TCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPA  396



>ref|XP_009125103.1| PREDICTED: uncharacterized protein LOC103850140 [Brassica rapa]
 ref|XP_009125104.1| PREDICTED: uncharacterized protein LOC103850140 [Brassica rapa]
Length=416

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 331/418 (79%), Gaps = 11/418 (3%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L +       P  + S +  +  ++ +L T+ Y+RNLVSK+RRRL +GGYDLDM+Y
Sbjct  1     MGLKLSR------GPGKEKSALELRPHILTYLTTNSYLRNLVSKKRRRLTMGGYDLDMSY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+ YDP +F+GRVER
Sbjct  55    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHHNHYKVYNLCIEECYDPENFYGRVER  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  115   FPFDDNHVPTLKMIQLFCESVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF  R+    P+V LP+  +REL RIR
Sbjct  175   EALEMYASRRTTNNNGVSIPSQRRYVKYWSHLLSFCKRIGNRPPEVKLPQEHSRELLRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLeg--  1152
             LYDTVNVDS+FFVVSELQ +P E Y P VE+S+ CCR  K  + R  SPRYY S      
Sbjct  235   LYDTVNVDSVFFVVSELQEVPNEMYPPSVELSRGCCRQFKKGYCRSLSPRYYISHSHMNC  294

Query  1153  -neeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRL  1329
              +EE++ ++  +EPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RL
Sbjct  295   DSEEDEVLKNRQEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRL  354

Query  1330  FYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSI--LMKKDD  1497
             FY CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+F PA+     L+ +DD
Sbjct  355   FYTCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFTPASSKSGKLLSRDD  412



>ref|XP_010441061.1| PREDICTED: putative tyrosine-protein phosphatase TPTE [Camelina 
sativa]
Length=410

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/404 (65%), Positives = 332/404 (82%), Gaps = 9/404 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MG++L + G  K     +L+ +H    ++ +L TS Y+R+LVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGIKLSR-GPVKEKSTLELARVH----ILTYLTTSSYLRSLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPENFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE V+SW++ DPKNIAVIHCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCESVYSWIALDPKNIAVIHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +AL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF     +G P+V LP+  +REL RIR
Sbjct  176   DALEMYASRRTTNNNGVSIPSQRRYVKYWSDLLSFG---KKGPPEVKLPQEDSRELLRIR  232

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT NVDS+FFVVSELQ +P E Y P VE+++ CCR  K  + R +SPRYY S +   E
Sbjct  233   LYDTANVDSVFFVVSELQEVPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHV-NPE  291

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E++EV + +EPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY 
Sbjct  292   EDEEVTDGEEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFYT  351

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+FGPA+
Sbjct  352   CFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPAS  395



>emb|CDY37003.1| BnaC06g12600D [Brassica napus]
Length=416

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/418 (63%), Positives = 331/418 (79%), Gaps = 11/418 (3%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L +       P  + S +  +  ++ +L T+ Y+RNLVSK+RRRL +GGYDLDM+Y
Sbjct  1     MGLKLSR------GPGKEKSALELRPHILTYLTTNSYLRNLVSKKRRRLTMGGYDLDMSY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+ YDP +F+GRVER
Sbjct  55    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHHNHYKVYNLCIEECYDPENFYGRVER  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GM+AE
Sbjct  115   FPFDDNHVPTLKMIQLFCESVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMAAE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF  R+    P+V LP+  +REL RIR
Sbjct  175   EALEMYASRRTTNNNGVSIPSQRRYVKYWSHLLSFGKRIGNRPPEVKLPQEHSRELLRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLeg--  1152
             +YDTVNVDS+FFVVSELQ +P E Y P VE+S+ CCR  K  + R  SPRYY S      
Sbjct  235   VYDTVNVDSVFFVVSELQEVPNEMYPPSVELSRGCCRQFKKGYCRSLSPRYYISHSHMNC  294

Query  1153  -neeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRL  1329
              +EE++ + + KEPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RL
Sbjct  295   DSEEDEVLTKRKEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRL  354

Query  1330  FYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSI--LMKKDD  1497
             FY CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+F PA+     L+ +DD
Sbjct  355   FYTCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFTPASSKSGKLLSRDD  412



>emb|CDX67428.1| BnaA07g14680D [Brassica napus]
Length=416

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/407 (64%), Positives = 324/407 (80%), Gaps = 9/407 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L +       P    S +  +  ++ +L T+ Y+RNLVSK+RRRL +GGYDLDM+Y
Sbjct  1     MGLKLSR------GPGKDKSALELRPHILTYLTTNSYLRNLVSKKRRRLTMGGYDLDMSY  54

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+ YDP +F+GRVER
Sbjct  55    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHHNHYKVYNLCIEECYDPENFYGRVER  114

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE VHSWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  115   FPFDDNHVPTLKMIQLFCESVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  174

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +LSF  R+    P+V LP+  +REL RIR
Sbjct  175   EALEMYASRRTTNNNGVSIPSQRRYVKYWSHLLSFCKRIGNRPPEVKLPQEHSRELLRIR  234

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLeg--  1152
             LYDTVNVDS+FFVVSELQ +P E Y P VE+S+ CCR  K  + R  SPRYY S      
Sbjct  235   LYDTVNVDSVFFVVSELQEVPNEMYPPSVELSRGCCRQFKKGYCRSLSPRYYISHSHMNC  294

Query  1153  -neeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRL  1329
              +EE++ +   +EPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RL
Sbjct  295   DSEEDEVLRNRQEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRL  354

Query  1330  FYACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             FY CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+F PA+
Sbjct  355   FYTCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFTPAS  401



>ref|XP_010528377.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Tarenaya 
hassleriana]
Length=423

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/405 (65%), Positives = 320/405 (79%), Gaps = 5/405 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L K G  +   A   +  H    ++ +L  S Y+R+LVS++RRR+++GGYDLDM+Y
Sbjct  1     MGLKLSK-GSARDKSALDCTRAH----ILTYLTASAYLRSLVSRKRRRMVIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITDRLLAMSFPAE MRA YRNPLWQVKSVLDMRH  HYK+YNLCIE++YDP +F+GRVER
Sbjct  56    ITDRLLAMSFPAERMRAFYRNPLWQVKSVLDMRHPDHYKIYNLCIEEAYDPANFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L M+K FCE V++WLS D +NIAVIHCMAGKGRTGLMV AYLVY+GM+AE
Sbjct  116   FPFDDNHVPSLHMIKLFCESVYAWLSQDSRNIAVIHCMAGKGRTGLMVSAYLVYSGMTAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW   L FP  V   LP+V LP   +RELRRIR
Sbjct  176   EALEMYAQRRTTNNNGVSIPSQRRYVKYWSDSLRFPRGVGNRLPEVKLPLQHSRELRRIR  235

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT N+D++FFVVSE Q IP E Y PPVEV + CCR  K    R  SPRYY S L  + 
Sbjct  236   LYDTANIDAVFFVVSEQQEIPNELYRPPVEVVRGCCRQVKKGCCRNTSPRYYVSHLSCDS  295

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             EE+E  E +  RLV+QMDTESS++ +KTCLDYY+E P +V+GD+ I FY+K+IG RLFY 
Sbjct  296   EEEEEIEREHIRLVVQMDTESSIIDEKTCLDYYFEKPERVSGDICITFYQKMIGTRLFYT  355

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANP  1473
             CFNT+FI +GLLQFS+ ELDKVG +G+SICGP F +EL+FGPA P
Sbjct  356   CFNTAFITNGLLQFSIAELDKVGGQGRSICGPDFSLELLFGPAYP  400



>ref|XP_006285053.1| hypothetical protein CARUB_v10006361mg [Capsella rubella]
 gb|EOA17951.1| hypothetical protein CARUB_v10006361mg [Capsella rubella]
Length=412

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/416 (63%), Positives = 334/416 (80%), Gaps = 11/416 (3%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K      L+ +H    ++ +L TS Y+R+LVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGLKLSR-GPVKEKSTLGLTRVH----ILTYLTTSYYLRSLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDKLLAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPENFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE V+SWL+ DPKNI V+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCESVYSWLAQDPKNITVVHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +AL++YA +RTTNN+GVSIPSQRRYV+YW  +L+F  R+ +G P+V LP+  +REL RIR
Sbjct  176   DALEMYARRRTTNNNGVSIPSQRRYVKYWSDLLTF--RL-KGPPEVKLPQEDSRELLRIR  232

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT NVDS+FFVVSELQ +PGE Y P VE+++ CCR  K  + R  SPRYY S +  + 
Sbjct  233   LYDTANVDSVFFVVSELQEVPGEMYRPSVELARGCCRQFKKGYCRSLSPRYYISHVNSDS  292

Query  1159  eedeveee-kePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             ++DE   + +E RLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY
Sbjct  293   QDDEAVTDGEEARLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFY  352

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSI--LMKKDD  1497
              CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+FGPA+      + +DD
Sbjct  353   TCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPASSKFGKFLSRDD  408



>emb|CDY37863.1| BnaC04g31430D [Brassica napus]
Length=488

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/416 (63%), Positives = 328/416 (79%), Gaps = 10/416 (2%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K     QL+ +H    ++ +L TS Y+RNLVSK+RRRL+ GGYDLDM+Y
Sbjct  76    MGLKLSR-GPGKEKSTLQLTRVH----ILTYLTTSYYLRNLVSKKRRRLIAGGYDLDMSY  130

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LLAMS PAE MRA+YRNPLWQVKSVLDMRH  HYK+YNLCIE+ YDP +F GRVER
Sbjct  131   ISDKLLAMSLPAERMRAVYRNPLWQVKSVLDMRHHDHYKIYNLCIEECYDPENFDGRVER  190

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FC+ V SWLS DPKNIAV+HCMAGKGRTGLMV AYLVY GMSAE
Sbjct  191   FPFDDNHVPSLKMIQRFCQSVRSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAE  250

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             EAL++YA +RTTNN+GVSIPSQRRYV+YW  +L     +  G P+V LP+  +REL RIR
Sbjct  251   EALEMYASRRTTNNNGVSIPSQRRYVKYWSHLLG--KGIGNGPPEVRLPQEHSRELLRIR  308

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLe-gn  1155
             LYDT NVDS+FFVVSELQ +P E Y P VE++K CCR  K  + R +SPRYY S +   +
Sbjct  309   LYDTANVDSVFFVVSELQEVPNEMYRPSVELAKGCCRQFKKGYCRSSSPRYYISHINCDS  368

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             EE++ + + +EPRLV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY
Sbjct  369   EEDEVLTDGEEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFY  428

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN--PSILMKKDD  1497
              CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+F PA      L+ +DD
Sbjct  429   TCFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFSPATSISGKLLSRDD  484



>ref|XP_002532895.1| pten, putative [Ricinus communis]
 gb|EEF29475.1| pten, putative [Ricinus communis]
Length=420

 Score =   528 bits (1360),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 261/415 (63%), Positives = 312/415 (75%), Gaps = 4/415 (1%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+  KQG  KA  ++     HAQ  ++ +L  S Y+RNLVSK RRR+LV GYDLDMTY
Sbjct  1     MGLQFAKQGLGKAGTSN---LQHAQYSIINYLTKSIYLRNLVSKHRRRMLVAGYDLDMTY  57

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             ITD+LLAMSFPAE MRAMYRNPLWQVKSVLDMRH GHYKVYNLCIE++YDP HFHGRVE 
Sbjct  58    ITDKLLAMSFPAERMRAMYRNPLWQVKSVLDMRHGGHYKVYNLCIEETYDPAHFHGRVEA  117

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
              PFDDNHVPPL++VK+FCE VHSWLS DPKNIAV+HCMAGKGRTGLMVCAYLVY+GM+AE
Sbjct  118   CPFDDNHVPPLELVKQFCESVHSWLSQDPKNIAVVHCMAGKGRTGLMVCAYLVYSGMTAE  177

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPK-PCARELRRI  975
             EALQ+YA+KRTTNN GVSIPSQRRYV YW  VLSFP  +  G  +V+L     AR     
Sbjct  178   EALQLYANKRTTNNEGVSIPSQRRYVAYWASVLSFPKEIGSGPXEVDLLYLRIARGEVHS  237

Query  976   RLYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegn  1155
               Y  + +       S    +  + Y PP EV+K CCR  +    +  SPRYY SF+   
Sbjct  238   VCYLLLLLLKYKQTQSFFCQVNSQLYRPPGEVAKGCCRPIREGDQKNKSPRYYISFIGDA  297

Query  1156  eeedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFY  1335
             +EE +  E +EPR+V+QMDTE S++ QK CLDY +  P++V GDVR+IFY+K+IGGRLFY
Sbjct  298   DEEGKKSETEEPRVVVQMDTERSIIDQKNCLDYSFNKPVEVKGDVRVIFYQKMIGGRLFY  357

Query  1336  ACFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSILMKKDDD  1500
              CFNT+FIK+ LLQFS+R+LDK+GKKG+SICG  FC+EL+FGPAN        DD
Sbjct  358   VCFNTAFIKNSLLQFSVRDLDKIGKKGQSICGSTFCLELLFGPANSKSSYDNYDD  412



>ref|XP_010450812.1| PREDICTED: uncharacterized protein LOC104732908 [Camelina sativa]
Length=407

 Score =   526 bits (1355),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 258/404 (64%), Positives = 327/404 (81%), Gaps = 12/404 (3%)
 Frame = +1

Query  259   MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
             MGL+L + G  K     +L+ +H    ++ +L TS Y+R+LVSK+RRRL++GGYDLDM+Y
Sbjct  1     MGLKLSR-GPVKEKSTLELTRVH----ILTYLTTSSYLRSLVSKKRRRLIIGGYDLDMSY  55

Query  439   ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
             I+D+LL MSFPAE MRA+YRNPLWQVKSVLDMRH  HYKVYNLCIE+SYDP +F+GRVER
Sbjct  56    ISDKLLVMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPENFYGRVER  115

Query  619   YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
             +PFDDNHVP L+M++ FCE V+SW++ DPKNIAVIHCMAGKGRTGLMV AYLVY GMSAE
Sbjct  116   FPFDDNHVPSLKMIQLFCESVYSWITLDPKNIAVIHCMAGKGRTGLMVSAYLVYGGMSAE  175

Query  799   EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR  978
             +AL+ YA +RTTNN+GVSIPSQRRYV+YW  +LSF     +G P+V LP+  +REL RIR
Sbjct  176   DALETYASRRTTNNNGVSIPSQRRYVKYWSDLLSFG---KKGPPEVKLPQEDSRELLRIR  232

Query  979   LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegne  1158
             LYDT NVDS+FFVVSE   +P E Y P VE+++ CCR  K  + R +SPRYY S +   E
Sbjct  233   LYDTANVDSVFFVVSE---VPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHV-NQE  288

Query  1159  eedeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA  1338
             E++EV + +EP LV+QMDTESS++ +KTCLD+Y++ P++V+GD+RI FY+K+IG RLFY 
Sbjct  289   EDEEVTDGEEPHLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFYT  348

Query  1339  CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPAN  1470
             CFNT+FI +GLLQFS+ ELDKVG  G+SI GP F +EL+FGPA+
Sbjct  349   CFNTAFITNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPAS  392



>ref|XP_009784410.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Nicotiana sylvestris]
Length=330

 Score =   508 bits (1309),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 280/318 (88%), Gaps = 2/318 (1%)
 Frame = +1

Query  532   MRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKN  711
             MRH+GHYKVYNLC+EQ+YD +HFHGRVERYP DDNHVPPLQM+KEFCEDV+SWLSNDPKN
Sbjct  1     MRHAGHYKVYNLCVEQAYDASHFHGRVERYPMDDNHVPPLQMIKEFCEDVYSWLSNDPKN  60

Query  712   IAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             IAVIHCMAGKGRTGLMVC+YLVYTGMSAEEAL++YA+KRTTNN GVSIPSQRRYV YWE 
Sbjct  61    IAVIHCMAGKGRTGLMVCSYLVYTGMSAEEALRLYAEKRTTNNEGVSIPSQRRYVRYWEH  120

Query  892   VLSFPDRVDRG-LPDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPVE  1068
             +LSF   V RG  P V LPK C RELRRIRLYDT+NV+SIFFVVSELQ +PGE+YCPP E
Sbjct  121   ILSFSKGVPRGPPPTVKLPKSCKRELRRIRLYDTINVESIFFVVSELQRVPGEKYCPPAE  180

Query  1069  VSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVIQMDTESSMLYQKTCL  1248
             VSKSCCR  KN   R  SPRY+YSF+    E++  +E+KEPRLV+QMDTESSMLYQKTCL
Sbjct  181   VSKSCCRRIKNGIQRTYSPRYFYSFV-EENEDEMKQEKKEPRLVVQMDTESSMLYQKTCL  239

Query  1249  DYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGKSIC  1428
             D++Y+ P+QV GDVRIIFYEKLIGGRLFYACFNT+FI++ LLQFSLRELDKVGKKG+S+ 
Sbjct  240   DHFYDKPVQVCGDVRIIFYEKLIGGRLFYACFNTAFIRNDLLQFSLRELDKVGKKGRSMT  299

Query  1429  GPAFCVELIFGPANPSIL  1482
             G +FC+EL FGPAN + L
Sbjct  300   GSSFCLELFFGPANGNCL  317



>ref|XP_002969038.1| hypothetical protein SELMODRAFT_91219, partial [Selaginella moellendorffii]
 gb|EFJ30154.1| hypothetical protein SELMODRAFT_91219, partial [Selaginella moellendorffii]
Length=393

 Score =   468 bits (1204),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/376 (61%), Positives = 282/376 (75%), Gaps = 5/376 (1%)
 Frame = +1

Query  340   LVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVK  519
             L++F+  S Y+R+LVSK+RRRL++GGY+LDM+YITDRL+AMSFPAE M AMYRNP+WQV+
Sbjct  6     LIEFIAGSHYLRSLVSKERRRLVLGGYNLDMSYITDRLVAMSFPAEDMTAMYRNPMWQVQ  65

Query  520   SVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSN  699
               LD++H  +YKVYNLC+E SYDP  FHGRVE +PFDD HVPPL +++ FCE V  WL  
Sbjct  66    RALDLKHGSYYKVYNLCVECSYDPGSFHGRVETFPFDDMHVPPLSLIQLFCESVEDWLLQ  125

Query  700   DPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVE  879
             DP+N+AVIHC AGKGRTGLMVCAYLVY GM AEEALQ+Y  +RT NN GV+IPSQRRYV 
Sbjct  126   DPRNVAVIHCKAGKGRTGLMVCAYLVYKGMPAEEALQLYGSRRTYNNQGVTIPSQRRYVR  185

Query  880   YWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCP  1059
             YW K+L FP   D G+PDV +P P  RELRRIRLYDT + D++ F + E+Q  PGE Y  
Sbjct  186   YWSKILVFPS--DGGVPDVRIPPPKPRELRRIRLYDTNSTDAVKFSIKEIQEEPGELYKS  243

Query  1060  PVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVIQMDTESSMLYQK  1239
             PVE++   C   K  F R  SPRYY SFL   +E DE  +E +PR V+QMDTE   L +K
Sbjct  244   PVEIASGQCEPLKKGFVRTVSPRYYLSFL--PKEGDEKSKENQPRFVVQMDTERPNLLKK  301

Query  1240  TCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGK  1419
              CLD+Y++ P+ V+GDVR IFY K  GGRLFY CFNT FI   ++Q    +LDKV + G+
Sbjct  302   DCLDHYFDKPICVSGDVRAIFYNK-NGGRLFYFCFNTYFISGSMMQLGKGDLDKVTRNGR  360

Query  1420  SICGPAFCVELIFGPA  1467
             SI G  FCVELIFGPA
Sbjct  361   SIIGQNFCVELIFGPA  376



>ref|XP_002990704.1| hypothetical protein SELMODRAFT_132165, partial [Selaginella 
moellendorffii]
 gb|EFJ08336.1| hypothetical protein SELMODRAFT_132165, partial [Selaginella 
moellendorffii]
Length=393

 Score =   468 bits (1204),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/376 (61%), Positives = 282/376 (75%), Gaps = 5/376 (1%)
 Frame = +1

Query  340   LVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVK  519
             L++F+  S Y+R+LVSK+RRRL++GGY+LDM+YITDRL+AMSFPAE M AMYRNP+WQV+
Sbjct  6     LIEFIAGSHYLRSLVSKERRRLVLGGYNLDMSYITDRLVAMSFPAEDMTAMYRNPMWQVQ  65

Query  520   SVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSN  699
               LD++H  +YKVYNLC+E SYDP  FHGRVE +PFDD HVPPL +++ FCE V  WL  
Sbjct  66    RALDVKHGSYYKVYNLCVECSYDPGSFHGRVETFPFDDMHVPPLSLIQLFCESVEDWLLQ  125

Query  700   DPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVE  879
             DP+N+AVIHC AGKGRTGLMVCAYLVY GM AEEALQ+Y  +RT NN GV+IPSQRRYV 
Sbjct  126   DPRNVAVIHCKAGKGRTGLMVCAYLVYKGMPAEEALQLYGSRRTYNNQGVTIPSQRRYVR  185

Query  880   YWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCP  1059
             YW K+L FP   D G+PDV +P P  RELRRIRLYDT + D++ F + E+Q  PGE Y  
Sbjct  186   YWSKILVFPS--DGGVPDVRIPPPKPRELRRIRLYDTNSTDAVKFSIKEIQEEPGELYKS  243

Query  1060  PVEVSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVIQMDTESSMLYQK  1239
             PVE++   C   K  F R  SPRYY SFL   +E DE  +E +PR V+QMDTE   L +K
Sbjct  244   PVEIASGLCEPLKKGFVRTVSPRYYLSFL--PKEGDEKSKENQPRFVVQMDTERPNLLKK  301

Query  1240  TCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYACFNTSFIKSGLLQFSLRELDKVGKKGK  1419
              CLD+Y++ P+ V+GDVR IFY K  GGRLFY CFNT FI   ++Q    +LDKV + G+
Sbjct  302   DCLDHYFDKPICVSGDVRAIFYNK-NGGRLFYFCFNTYFISGSMMQLGKGDLDKVTRNGR  360

Query  1420  SICGPAFCVELIFGPA  1467
             SI G  FCVELIFGPA
Sbjct  361   SIIGQNFCVELIFGPA  376



>ref|XP_009607749.1| PREDICTED: uncharacterized protein LOC104101904 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009607750.1| PREDICTED: uncharacterized protein LOC104101904 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009607751.1| PREDICTED: uncharacterized protein LOC104101904 isoform X2 [Nicotiana 
tomentosiformis]
Length=300

 Score =   451 bits (1159),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 221/287 (77%), Positives = 252/287 (88%), Gaps = 1/287 (0%)
 Frame = +1

Query  625   FDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEA  804
              DDNHVPPLQM++EFCEDV+SWLSNDPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAEEA
Sbjct  1     MDDNHVPPLQMIREFCEDVYSWLSNDPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAEEA  60

Query  805   LQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIRLY  984
             L++YA+KRTTNN GVSIPSQRRYV YWE VLSF   V RG P V LPK C RELRRIRLY
Sbjct  61    LRLYAEKRTTNNEGVSIPSQRRYVRYWEHVLSFSKGVPRGPPIVKLPKSCKRELRRIRLY  120

Query  985   DTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegn-ee  1161
             DT+NV+SIFFVVSELQ +PGE+YCPP EVSKSCCR  KN   R  SPRY+YSF+E    E
Sbjct  121   DTINVESIFFVVSELQRVPGEKYCPPTEVSKSCCRRIKNGIQRTYSPRYFYSFVELEDNE  180

Query  1162  edeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYAC  1341
             ++  +E+KEPRLV+QMDTESSMLYQKTCLD++Y+ P+QV+GDVRIIFYEKLIGGRLFYAC
Sbjct  181   DEMKQEKKEPRLVVQMDTESSMLYQKTCLDHFYDKPVQVSGDVRIIFYEKLIGGRLFYAC  240

Query  1342  FNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSIL  1482
             FNT+FI++ LLQFSLRELDKVGKKG+S+ G +FC+EL FGPAN + L
Sbjct  241   FNTAFIRNDLLQFSLRELDKVGKKGRSMTGSSFCLELFFGPANGNCL  287



>ref|XP_009784411.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X3 
[Nicotiana sylvestris]
Length=299

 Score =   447 bits (1150),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 250/287 (87%), Gaps = 2/287 (1%)
 Frame = +1

Query  625   FDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAEEA  804
              DDNHVPPLQM+KEFCEDV+SWLSNDPKNIAVIHCMAGKGRTGLMVC+YLVYTGMSAEEA
Sbjct  1     MDDNHVPPLQMIKEFCEDVYSWLSNDPKNIAVIHCMAGKGRTGLMVCSYLVYTGMSAEEA  60

Query  805   LQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRG-LPDVNLPKPCARELRRIRL  981
             L++YA+KRTTNN GVSIPSQRRYV YWE +LSF   V RG  P V LPK C RELRRIRL
Sbjct  61    LRLYAEKRTTNNEGVSIPSQRRYVRYWEHILSFSKGVPRGPPPTVKLPKSCKRELRRIRL  120

Query  982   YDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLegnee  1161
             YDT+NV+SIFFVVSELQ +PGE+YCPP EVSKSCCR  KN   R  SPRY+YSF+    E
Sbjct  121   YDTINVESIFFVVSELQRVPGEKYCPPAEVSKSCCRRIKNGIQRTYSPRYFYSFV-EENE  179

Query  1162  edeveeekePRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYAC  1341
             ++  +E+KEPRLV+QMDTESSMLYQKTCLD++Y+ P+QV GDVRIIFYEKLIGGRLFYAC
Sbjct  180   DEMKQEKKEPRLVVQMDTESSMLYQKTCLDHFYDKPVQVCGDVRIIFYEKLIGGRLFYAC  239

Query  1342  FNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSIL  1482
             FNT+FI++ LLQFSLRELDKVGKKG+S+ G +FC+EL FGPAN + L
Sbjct  240   FNTAFIRNDLLQFSLRELDKVGKKGRSMTGSSFCLELFFGPANGNCL  286



>emb|CBI22276.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   333 bits (855),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 182/215 (85%), Gaps = 5/215 (2%)
 Frame = +1

Query  259  MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY  438
            MGL   +QG  + A  S L Y      L+ +L  + YIRNLVSKQRRR+LVGGYDLDM++
Sbjct  1    MGLTFSEQGPGRFASNSLLQY-----QLINYLTRTLYIRNLVSKQRRRMLVGGYDLDMSF  55

Query  439  ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER  618
            IT RLLAMSFPAE M+A++RNPLWQVK VLDMRH+GHYKVYNL +E+SYDP HFHGRVE 
Sbjct  56   ITGRLLAMSFPAERMQAIFRNPLWQVKDVLDMRHNGHYKVYNLRVEESYDPLHFHGRVET  115

Query  619  YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE  798
            +PFDD+H+PPLQ +K FC++VHSWLS+ PKNIAV+HCMAGKGRTGL VCAYLVYTGMSAE
Sbjct  116  FPFDDHHIPPLQTIKLFCKNVHSWLSSHPKNIAVVHCMAGKGRTGLTVCAYLVYTGMSAE  175

Query  799  EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
            EAL+++ADKRTTNN GVSIPSQRRYV YWE +L+F
Sbjct  176  EALKLHADKRTTNNEGVSIPSQRRYVGYWESLLAF  210



>gb|EFW43384.2| pten protein [Capsaspora owczarzaki ATCC 30864]
Length=384

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 130/181 (72%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S +++ LVSKQ+RR    G+DLD+TYITD+++AM FP+E +  +YRN +  V    D +H
Sbjct  2    SSFMKQLVSKQKRRFKQDGFDLDLTYITDKIVAMGFPSEKLEGVYRNGMEDVVRFFDQKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYKVYNLC E+ YDP  FH RV  YPFDD++ PP +++K FC+DVH WL+ D +N+AV
Sbjct  62   QDHYKVYNLCSEREYDPAKFHNRVATYPFDDHNAPPFELIKPFCDDVHEWLTEDARNVAV  121

Query  721  IHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYLV+      AE+AL  Y   RT N  GV+IPSQ+RYV+ +  +
Sbjct  122  IHCKAGKGRTGVMICAYLVHCNHWEKAEDALAFYGAARTQNAKGVTIPSQQRYVKMYASL  181

Query  895  L  897
            +
Sbjct  182  I  182



>ref|XP_009492856.1| hypothetical protein H696_00701 [Fonticula alba]
 gb|KCV73155.1| hypothetical protein H696_00701 [Fonticula alba]
Length=656

 Score =   224 bits (571),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 134/370 (36%), Positives = 188/370 (51%), Gaps = 39/370 (11%)
 Frame = +1

Query  361   SCYIRNLVSKQRRRLLV---GGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLD  531
             S + R LVSK++RR +    GG+DLD+TY+T  ++AM FP+E    +YRNP+  V   LD
Sbjct  2     STFARKLVSKKKRRFVTKDDGGFDLDLTYVTPNIIAMGFPSESFEGVYRNPMSSVVRFLD  61

Query  532   MRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKN  711
              RH   Y+VYNLC E+ YDP+ F+GRV R+PFDD++ P L ++  FCED  SWLS  P N
Sbjct  62    SRHPERYRVYNLCSERCYDPSKFYGRVARFPFDDHNAPMLSLIPAFCEDAASWLSQHPDN  121

Query  712   IAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             +  +HC AGKGRTG+M+CAYL+Y+     A EAL  Y   RT N  GV+IPSQ+RY++Y+
Sbjct  122   VIAVHCKAGKGRTGVMICAYLLYSRQWQVAAEALAFYGAARTENGKGVTIPSQQRYIDYF  181

Query  886   EKVLSFPDRVDRGLPDVNLPKPCARELRRIRLYDTVNVDSIFFVVSELQNIPGERYCPPV  1065
               +LS  +     LP ++L +P       +        D    V       P  RY P  
Sbjct  182   AMMLSELEAAGHTLPLISLERPAPLSPTSLGTVVAAITDGPLPVAPLTVPAP-YRYVPRT  240

Query  1066  EVSKSCCRGNKNEFHRPNSPRYYYSFLegneeedeveeekePRLVI-----QMDTESSML  1230
              + ++   G+                               P  V+     ++DT +   
Sbjct  241   LLLENIVLGD---------------------LLVGSSSSLHPFAVVYCNEQKIDTTAPFT  279

Query  1231  YQKTC---LDYYYETPLQVTGDVRIIFYEK---LIGGRLFYACFNTSFIKS-GLLQFSLR  1389
                TC   +      PL V GDVR+ F+ K       +LF+  FNT FI + G+L     
Sbjct  280   VTSTCKKTVSLTLSPPLPVFGDVRVEFFTKDKFKKSEKLFHMWFNTFFIPADGVLSVPKS  339

Query  1390  ELDKVGKKGK  1419
              +DK  K  K
Sbjct  340   GIDKACKDKK  349



>ref|XP_004924449.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like, partial 
[Bombyx mori]
Length=412

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+N+VSK+R R    G++LD+ YITDRL+AM FPAE +  +YRN + +V   L+  H  H
Sbjct  58   IKNMVSKRRIRYTKHGFNLDLAYITDRLIAMGFPAEKLEGVYRNHIDEVYRFLETMHKDH  117

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E++YDP+ FH RVERY F+D+  P +++++ FCE+VHSWLS D +N+AV+HC
Sbjct  118  YKIYNLCSERTYDPSKFHKRVERYAFEDHTPPHMELIQPFCENVHSWLSADTRNVAVVHC  177

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG MVC YL+Y+G   +A+EAL+ Y  KRT +  GV+IPSQRRYVEY+  +L
Sbjct  178  KAGKGRTGTMVCCYLLYSGDQPNADEALKFYGRKRTLDEKGVTIPSQRRYVEYYGALL  235



>ref|NP_001161638.1| phosphatase and tensin homolog [Saccoglossus kowalevskii]
 gb|ACY92627.1| PTEN [Saccoglossus kowalevskii]
Length=399

 Score =   215 bits (547),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+NLVSK++RR   GG+DLD++YI   ++AM FPAE + + YRN +  V   LD++H  H
Sbjct  5    IKNLVSKKKRRYQEGGFDLDLSYIYPNIIAMGFPAEKIESYYRNSIDDVVRFLDLKHKDH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F  RV  YPFDD+H P L+++K FCEDV  WL  +  N+AVIHC
Sbjct  65   YKIYNLCSERCYDISKFRNRVVHYPFDDHHPPKLELIKTFCEDVDEWLRKNEANVAVIHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWE  888
             AGKGRTG+M+C+YL++ G  +SA++AL+ Y   RT N  GV+IPSQRRYVEY+E
Sbjct  125  KAGKGRTGVMICSYLIHIGKFLSAQKALEYYGKTRTLNEKGVTIPSQRRYVEYYE  179



>gb|EPZ34584.1| Protein-tyrosine phosphatase domain-containing protein [Rozella 
allomycis CSF55]
Length=319

 Score =   209 bits (533),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR LVSK++RR  + G+DLD+TYIT+R++AM FP++++  +YRN +  V   LD RH   
Sbjct  5    IRRLVSKKKRRYNLDGFDLDLTYITERIIAMGFPSDNLEGVYRNKMADVVRFLDSRHPDK  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E++YD ++F+ RV  YPFDD++ P + +V  FC DV  WL  +PKN+ VIHC
Sbjct  65   YKVYNLCSERNYDTSNFNNRVSSYPFDDHNAPTMNLVINFCRDVDEWLMKNPKNVVVIHC  124

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+C+YL+++G+  S EE+L+ Y   RT N+ GV+IPSQ+RYV Y++ ++
Sbjct  125  KAGKGRTGVMICSYLIHSGICKSFEESLEFYGVARTQNSKGVTIPSQKRYVMYYDLLI  182



>ref|XP_008547428.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Microplitis 
demolitor]
Length=375

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 148/226 (65%), Gaps = 18/226 (8%)
 Frame = +1

Query  370   IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
             I+ LVSK+R+R    G+DLD+TYI   L+AM FPAE +  +YRN +  V   L+ RH  H
Sbjct  104   IKGLVSKRRKRFTEDGFDLDLTYIQTNLIAMGFPAEKLEGVYRNHIDDVVKFLESRHKDH  163

Query  550   YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
             YK+YNLC E+SYDP  F  RV  YPFDD++ P ++ +K FCEDVH+WLS D KNIA +HC
Sbjct  164   YKIYNLCKERSYDPRKFKNRVAEYPFDDHNPPNIEQIKPFCEDVHNWLSQDCKNIAAVHC  223

Query  730   MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
              AGKGRTG+MV  YL++T    +A +AL  Y  KRTT++ GV+IPSQRRYV Y+    SF
Sbjct  224   KAGKGRTGVMVACYLLHTKQFPTALDALTFYGSKRTTDSKGVTIPSQRRYVGYYA---SF  280

Query  904   PDRVDRGLPDVNLPKPCARELRRIRLYDTV-----NVDSIFFVVSE  1026
                V +GL    + +P    LR+I L D +     N   + FV+SE
Sbjct  281   ---VQKGL----IYQPVTLLLRQITL-DPIPIFNGNQGYLHFVISE  318



>dbj|GAM17605.1| hypothetical protein SAMD00019534_007800 [Acytostelium subglobosum 
LB1]
Length=434

 Score =   210 bits (535),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 144/225 (64%), Gaps = 11/225 (5%)
 Frame = +1

Query  361   SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
             S  +RN VSKQ+RR    GYDLD++YIT R++AM FP+E M  ++RNP+ +V   LD +H
Sbjct  2     SSILRNAVSKQKRRYQKDGYDLDLSYITPRIIAMGFPSEKMEGVFRNPMKEVVKFLDHKH  61

Query  541   SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
               H+KVYNLC E+ YD + F+GRV  +PFDD++ P   ++++FC+DVH WL  D  NIAV
Sbjct  62    KDHFKVYNLCSERDYDHSKFYGRVGHFPFDDHNAPEFSLIEKFCQDVHEWLR-DKDNIAV  120

Query  721   IHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
             IHC AGKGRTGLM+C YL+Y G     E +L+ YA  RT N  GV+IPSQ RYV Y+ + 
Sbjct  121   IHCKAGKGRTGLMICCYLIYCGEWPETENSLKFYAAARTYNQKGVTIPSQIRYVHYFSRY  180

Query  895   L------SFPDRVDRGLPDVNLPKPCARELRRIRLYDTVNVDSIF  1011
             L      + P+RV R +  V  P P    L  I     V   ++F
Sbjct  181   LREKLPYNPPERVLRKI--VLKPLPNVANLGDINFNVCVGKKTVF  223



>ref|XP_008207911.1| PREDICTED: phosphatase and tensin homolog isoform X4 [Nasonia 
vitripennis]
Length=542

 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 170/299 (57%), Gaps = 28/299 (9%)
 Frame = +1

Query  160   ICLFQLIRNSQLQFHNPPFFIPNWPHGPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQ-Q  336
             +C    +R  Q++  N        P    C    G  L + G      AS+L    A   
Sbjct  49    LCDITSLRQQQIEGGNSKRGSREDP----CEDDTGAELLQSG------ASELKQTQASMA  98

Query  337   DLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQV  516
             + +  +  +  I+ LVSK+R+R    G++LD+TYI D L+AM FPAE +  +YRN + +V
Sbjct  99    NTISNMKMTNPIKGLVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKLEGVYRNNIDEV  158

Query  517   KSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLS  696
                L+ RH  HY +YNLC E+SYD T F GRV  Y FDD++ PPL+++K FCEDV SWL 
Sbjct  159   ARFLESRHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLL  218

Query  697   NDPKNIAVIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRR  870
                +N++V+HC AGKGRTG+MVC YL+++    +A EAL  Y ++RTT+  GV+IPSQRR
Sbjct  219   QHDENVSVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRR  278

Query  871   YVEYWEKVLSFPDRVDRGLPDVNLP-KPCARELRRIRL---YDTVNVDSIFFVVSELQN  1035
             YV+Y+  ++             NL  +P    LR I+L     T       FV+SE +N
Sbjct  279   YVDYYATLVQ-----------ENLSYQPVTLILREIKLEPISATNGGQGYHFVISEAKN  326



>ref|XP_008207907.1| PREDICTED: phosphatase and tensin homolog isoform X1 [Nasonia 
vitripennis]
 ref|XP_008207908.1| PREDICTED: phosphatase and tensin homolog isoform X1 [Nasonia 
vitripennis]
Length=593

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 170/299 (57%), Gaps = 28/299 (9%)
 Frame = +1

Query  160   ICLFQLIRNSQLQFHNPPFFIPNWPHGPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQ-Q  336
             +C    +R  Q++  N        P    C    G  L + G      AS+L    A   
Sbjct  49    LCDITSLRQQQIEGGNSKRGSREDP----CEDDTGAELLQSG------ASELKQTQASMA  98

Query  337   DLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQV  516
             + +  +  +  I+ LVSK+R+R    G++LD+TYI D L+AM FPAE +  +YRN + +V
Sbjct  99    NTISNMKMTNPIKGLVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKLEGVYRNNIDEV  158

Query  517   KSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLS  696
                L+ RH  HY +YNLC E+SYD T F GRV  Y FDD++ PPL+++K FCEDV SWL 
Sbjct  159   ARFLESRHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLL  218

Query  697   NDPKNIAVIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRR  870
                +N++V+HC AGKGRTG+MVC YL+++    +A EAL  Y ++RTT+  GV+IPSQRR
Sbjct  219   QHDENVSVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRR  278

Query  871   YVEYWEKVLSFPDRVDRGLPDVNLP-KPCARELRRIRL---YDTVNVDSIFFVVSELQN  1035
             YV+Y+  ++             NL  +P    LR I+L     T       FV+SE +N
Sbjct  279   YVDYYATLVQ-----------ENLSYQPVTLILREIKLEPISATNGGQGYHFVISEAKN  326



>ref|XP_008207910.1| PREDICTED: phosphatase and tensin homolog isoform X3 [Nasonia 
vitripennis]
Length=543

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 170/300 (57%), Gaps = 28/300 (9%)
 Frame = +1

Query  157   SICLFQLIRNSQLQFHNPPFFIPNWPHGPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQ-  333
              +C    +R  Q++  N        P    C    G  L + G      AS+L    A  
Sbjct  48    GLCDITSLRQQQIEGGNSKRGSREDP----CEDDTGAELLQSG------ASELKQTQASM  97

Query  334   QDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQ  513
              + +  +  +  I+ LVSK+R+R    G++LD+TYI D L+AM FPAE +  +YRN + +
Sbjct  98    ANTISNMKMTNPIKGLVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKLEGVYRNNIDE  157

Query  514   VKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWL  693
             V   L+ RH  HY +YNLC E+SYD T F GRV  Y FDD++ PPL+++K FCEDV SWL
Sbjct  158   VARFLESRHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWL  217

Query  694   SNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQR  867
                 +N++V+HC AGKGRTG+MVC YL+++    +A EAL  Y ++RTT+  GV+IPSQR
Sbjct  218   LQHDENVSVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQR  277

Query  868   RYVEYWEKVLSFPDRVDRGLPDVNLP-KPCARELRRIRL---YDTVNVDSIFFVVSELQN  1035
             RYV+Y+  ++             NL  +P    LR I+L     T       FV+SE +N
Sbjct  278   RYVDYYATLVQ-----------ENLSYQPVTLILREIKLEPISATNGGQGYHFVISEAKN  326



>ref|NP_001128398.1| phosphatase and tensin homolog [Nasonia vitripennis]
Length=497

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 147/228 (64%), Gaps = 17/228 (7%)
 Frame = +1

Query  370   IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
             I+ LVSK+R+R    G++LD+TYI D L+AM FPAE +  +YRN + +V   L+ RH  H
Sbjct  14    IKGLVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKLEGVYRNNIDEVARFLESRHRNH  73

Query  550   YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
             Y +YNLC E+SYD T F GRV  Y FDD++ PPL+++K FCEDV SWL    +N++V+HC
Sbjct  74    YTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENVSVVHC  133

Query  730   MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
              AGKGRTG+MVC YL+++    +A EAL  Y ++RTT+  GV+IPSQRRYV+Y+  ++  
Sbjct  134   KAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYATLVQ-  192

Query  904   PDRVDRGLPDVNLP-KPCARELRRIRL---YDTVNVDSIFFVVSELQN  1035
                        NL  +P    LR I+L     T       FV+SE +N
Sbjct  193   ----------ENLSYQPVTLILREIKLEPISATNGGQGYHFVISEAKN  230



>ref|XP_008207909.1| PREDICTED: phosphatase and tensin homolog isoform X2 [Nasonia 
vitripennis]
Length=592

 Score =   213 bits (541),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 161/270 (60%), Gaps = 24/270 (9%)
 Frame = +1

Query  247   CSQTMGLRLGKQGQKKAAPASQLSYIHAQ-QDLVKFLFTSCYIRNLVSKQRRRLLVGGYD  423
             C    G  L + G      AS+L    A   + +  +  +  I+ LVSK+R+R    G++
Sbjct  73    CEDDTGAELLQSG------ASELKQTQASMANTISNMKMTNPIKGLVSKRRKRFTADGFN  126

Query  424   LDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFH  603
             LD+TYI D L+AM FPAE +  +YRN + +V   L+ RH  HY +YNLC E+SYD T F 
Sbjct  127   LDLTYIKDNLIAMGFPAEKLEGVYRNNIDEVARFLESRHRNHYTIYNLCSERSYDHTKFK  186

Query  604   GRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYT  783
             GRV  Y FDD++ PPL+++K FCEDV SWL    +N++V+HC AGKGRTG+MVC YL+++
Sbjct  187   GRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENVSVVHCKAGKGRTGVMVCCYLLHS  246

Query  784   GM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLP-KPC  954
                 +A EAL  Y ++RTT+  GV+IPSQRRYV+Y+  ++             NL  +P 
Sbjct  247   KQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYATLVQ-----------ENLSYQPV  295

Query  955   ARELRRIRL---YDTVNVDSIFFVVSELQN  1035
                LR I+L     T       FV+SE +N
Sbjct  296   TLILREIKLEPISATNGGQGYHFVISEAKN  325



>ref|XP_009022389.1| hypothetical protein HELRODRAFT_120014, partial [Helobdella robusta]
 gb|ESN99638.1| hypothetical protein HELRODRAFT_120014, partial [Helobdella robusta]
Length=284

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK +RRL   G+DLD+TYI   ++AM FPAE+   +YRN +  V   LD +H  H
Sbjct  7    IKGIVSKNKRRLQEDGFDLDLTYIYPNIIAMGFPAENFEGVYRNNIHDVVRFLDSKHKDH  66

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+SY+ + FH RVE YPF+D+H PPL+++K FCEDV  WL    +N+AVIHC
Sbjct  67   YKVYNLCSERSYNKSRFHHRVEYYPFNDHHPPPLELLKPFCEDVDKWLCQHCQNVAVIHC  126

Query  730  MAGKGRTGLMVCAYLVY--TGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLS  900
             AGKGRTG+MVC+YL++     +AEEAL  Y + RT N  GV+IPSQ RYV+Y+  +++
Sbjct  127  KAGKGRTGVMVCSYLLHREKHKTAEEALSYYGETRTRNKKGVTIPSQIRYVKYYGHLVA  185



>ref|XP_001625001.1| predicted protein [Nematostella vectensis]
 gb|EDO32901.1| predicted protein [Nematostella vectensis]
Length=338

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 125/179 (70%), Gaps = 2/179 (1%)
 Frame = +1

Query  367  YIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSG  546
            Y + LVSK++RR    G+DLD+TYI   ++AM FP+E +  +YRN + +V   L+ +H  
Sbjct  3    YFKQLVSKKKRRFQEDGFDLDLTYIKPNIVAMGFPSEKLEGVYRNHMDEVYRFLEQKHKD  62

Query  547  HYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIH  726
             YKVYNLC E+ YDP  FH RV  YPFDD++ PP +++K FC+DV  WL     N+A+IH
Sbjct  63   SYKVYNLCSERQYDPMRFHNRVATYPFDDHNAPPFELIKPFCDDVDEWLKASNLNVAIIH  122

Query  727  CMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
            C AGKGRTG+M+CAYL++ G     +EA++ Y + RT N  GV+IPSQRRYVEY+  +L
Sbjct  123  CKAGKGRTGVMICAYLLHNGHFKDTKEAMEYYGNARTRNAKGVTIPSQRRYVEYYGYLL  181



>ref|XP_004988095.1| hypothetical protein PTSG_10560 [Salpingoeca rosetta]
 gb|EGD80305.1| hypothetical protein PTSG_10560 [Salpingoeca rosetta]
Length=415

 Score =   206 bits (523),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +1

Query  373  RNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHY  552
            ++LVSK++RR +  G+DLDMT+IT  ++AM FPAE    +YRN +  VK   D RH  HY
Sbjct  6    KHLVSKKKRRFIEDGFDLDMTFITRNIVAMGFPAEGREGIYRNNMRDVKRFFDTRHRDHY  65

Query  553  KVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCM  732
            K+YNLC E+ YDP  F+GRV ++PFDD++ PP Q++++FCEDV  +L  D +N+AVIHC 
Sbjct  66   KIYNLCSERDYDPNKFYGRVVKFPFDDHNAPPFQLIEKFCEDVAEYLERDSRNVAVIHCK  125

Query  733  AGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
            AGKGRTG+M+ A+L++  +     EAL+ Y   RT N  GV+IPSQ RYV Y+ ++L
Sbjct  126  AGKGRTGVMITAFLLHLRLFTDTNEALEFYGHARTMNGKGVTIPSQVRYVHYYGRLL  182



>ref|XP_002036459.1| GM11890 [Drosophila sechellia]
 gb|EDW52382.1| GM11890 [Drosophila sechellia]
Length=514

 Score =   208 bits (530),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GY+LD+TYI D ++AM +PA + +  ++RN L  V  +L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYNLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYKVYNLC E+SYD   FHGRV  YPFDD++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKVYNLCSERSYDVDKFHGRVAVYPFDDHNPPTIELIQRFCSDVDLWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLVY+G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVYSGLKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>gb|EZA50068.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Cerapachys biroi]
Length=448

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 146/226 (65%), Gaps = 18/226 (8%)
 Frame = +1

Query  370   IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
             I+ LVSK+R+R    G+DLD+TYITD L+AM FPAE +  +YRN +  V  +L+ +H  H
Sbjct  14    IKGLVSKRRKRFTEDGFDLDLTYITDNLIAMGFPAEKLEGVYRNHIDDVVKLLESKHKDH  73

Query  550   YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
             YK+YNLC E+SYD   F  RV  Y FDD++ P L+ +K FCEDVHSWLS    N+AV+HC
Sbjct  74    YKIYNLCSERSYDCKKFKQRVATYAFDDHNPPKLEQIKPFCEDVHSWLSQHKDNVAVVHC  133

Query  730   MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
              AGKGRTG+MVC YL+++    +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  +   
Sbjct  134   KAGKGRTGVMVCCYLLHSKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATL---  190

Query  904   PDRVDRGLPDVNLPKPCARELRRIRLYDTVNV-----DSIFFVVSE  1026
                V  GL      +P    LR I+L D V +      S+ FV+SE
Sbjct  191   ---VQDGLN----YQPVTLILREIQL-DPVPIFNGGQGSLHFVISE  228



>gb|ELU06519.1| hypothetical protein CAPTEDRAFT_90711 [Capitella teleta]
Length=378

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ LVSK +RR    G+DLD++YI   ++AM FPAE +  +YRN +  V   L+ RH   
Sbjct  5    IKGLVSKNKRRYQEDGFDLDLSYIYPNIIAMGFPAEKLEGVYRNNIDDVVRFLEARHRDQ  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ YD + FH RV  +PFDD+H P L++++ FCED+  WLS + +N+AVIHC
Sbjct  65   YKVYNLCSERMYDTSKFHKRVAHFPFDDHHPPRLELIRPFCEDMDDWLSRNSQNVAVIHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    AEEAL+ Y D RT +  GV+IPSQRRYV Y+ +++
Sbjct  125  KAGKGRTGVMICAYLLHCGRFKDAEEALRFYGDARTMDQKGVTIPSQRRYVNYYGQLI  182



>ref|XP_005183453.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Musca 
domestica]
 ref|XP_005183454.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Musca 
domestica]
 ref|XP_005183455.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Musca 
domestica]
 ref|XP_005183456.1| PREDICTED: dentin sialophosphoprotein-like isoform X4 [Musca 
domestica]
Length=1325

 Score =   214 bits (546),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            +RN+VSKQR R    G++LD+ Y+ D ++AM +PAE   +MYRN L  V+  L+  H  H
Sbjct  12   LRNVVSKQRIRYKEKGFNLDLAYVCDNIIAMGYPAEKYESMYRNRLEDVQKFLEENHRDH  71

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC+E+SYD + FHGRV  YPF+D++ P ++++++FCEDV SWL  DP N+A +HC
Sbjct  72   YKIYNLCLERSYDISKFHGRVSVYPFEDHNPPTIELIQQFCEDVDSWLKADPLNVAAVHC  131

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+Y+G   +A++AL  Y +KRT +  GV+IPSQRRYV+Y+ K++
Sbjct  132  KAGKGRTGTMICCYLLYSGQQRTADDALACYDEKRTKDRKGVTIPSQRRYVQYFSKLI  189



>ref|XP_001749050.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86125.1| predicted protein [Monosiga brevicollis MX1]
Length=422

 Score =   205 bits (521),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = +1

Query  373  RNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHY  552
            ++LVSK++RR +  G+DLD+T+IT  ++AM FPAE    +YRN +  VK   D R   HY
Sbjct  6    KHLVSKKKRRFMDEGFDLDLTFITRNIVAMGFPAEGREGIYRNHMRDVKRFFDYRCKDHY  65

Query  553  KVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCM  732
            +VYNLC E+ YDP  F+GRV +YPFDD++ PP  +++ FCEDVH +LS D +N+AVIHC 
Sbjct  66   RVYNLCSERDYDPQKFYGRVAKYPFDDHNAPPFLLMQPFCEDVHQYLSEDSRNVAVIHCK  125

Query  733  AGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
            AGKGRTG+M+ AYL++ G+    EEAL+ Y   RT N  GV+IPSQ RYV Y+ +
Sbjct  126  AGKGRTGVMISAYLMHCGLFEKTEEALEFYGHARTMNGKGVTIPSQVRYVHYYGR  180



>ref|XP_009063523.1| hypothetical protein LOTGIDRAFT_195725, partial [Lottia gigantea]
 gb|ESO85792.1| hypothetical protein LOTGIDRAFT_195725, partial [Lottia gigantea]
Length=337

 Score =   202 bits (514),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 138/206 (67%), Gaps = 12/206 (6%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ LVSK +RR    GYDLD+TYI   ++AM FPA  +  +YRN +  V   L+ RH  H
Sbjct  5    IKGLVSKNKRRFQDYGYDLDLTYIYPNIIAMGFPAMRLEGVYRNNIDDVVGFLEERHRDH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ YD + F  RV  YPFDD+H P L+++K FCED+ +WL  D +N+A IHC
Sbjct  65   YKVYNLCSERKYDASKFWSRVANYPFDDHHPPRLELIKPFCEDLDNWLLEDEQNVAAIHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
             AGKGRTG+M+CAY+++     ++E+AL+ YA  RT ++ GV+IPSQRRYV+Y+E +   
Sbjct  125  KAGKGRTGVMICAYMLHRHKFKTSEQALEYYAKTRTRDHKGVTIPSQRRYVKYYEHL---  181

Query  904  PDRVDRGLPDVNLPKPCARELRRIRL  981
               V R L      KPC+  L+RIR 
Sbjct  182  ---VTRQLE----YKPCSLLLQRIRF  200



>ref|NP_477424.1| pten, isoform C [Drosophila melanogaster]
 gb|AAD45362.1|AF161257_1 PTEN1 [Drosophila melanogaster]
 gb|AAN10730.1| pten, isoform C [Drosophila melanogaster]
Length=418

 Score =   204 bits (520),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GYDLD+TYI D ++AM +PA + +  ++RN L  V  +L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYK+YNLC E+SYD   F GRV  YPFDD++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLV++G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>ref|XP_005406534.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Chinchilla 
lanigera]
Length=333

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK ++R    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H   
Sbjct  5    IKEMVSKNKKRYQEDGFDLDLTYIYPNIIAMGFPAEKLEGIYRNNIVDVVRFLDSKHKNQ  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YDP  F+G+V RYPF+D++ P L+++K FCED+  WLS D  ++A +HC
Sbjct  65   YKIYNLCAERHYDPAKFNGKVARYPFEDHNPPQLELIKAFCEDLDQWLSEDDNHVAAVHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  125  KAGKGRTGVMICAYLLHRGKFLRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLL  182



>gb|AAL99958.1| PteN [Dictyostelium discoideum]
Length=515

 Score =   206 bits (525),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  +R  VSKQ+RR    GYDLD+ YITD ++AM FP+E +  ++RNP+  V+  LD  H
Sbjct  2    SNLLRVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEKVEGVFRNPMKDVQRFLDQYH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              H+KVYNLC E+ YD + F+GRV  YPFDD++ P  +M+  FC DV +W+  D KNIAV
Sbjct  62   KDHFKVYNLCSERVYDHSKFYGRVGYYPFDDHNAPQFEMIDAFCRDVDAWMKEDSKNIAV  121

Query  721  IHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTGLM+C +L+Y GM  + E++L+ YA  RT N  GV+IPSQ RYV Y+ + 
Sbjct  122  IHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGYFGRS  181

Query  895  L  897
            +
Sbjct  182  I  182



>gb|EFA07760.1| hypothetical protein TcasGA2_TC005314 [Tribolium castaneum]
Length=444

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR LVSK+R R    G++LD+TYITD ++AM +PA ++  +YRN +  V  +LD +H+ H
Sbjct  14   IRGLVSKRRIRYKQDGFNLDLTYITDSIIAMGYPASNIEGVYRNHIDDVVKLLDSKHNNH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            Y +YNLC E++YD + FH RV+ +PFDD++ P +++++ FC  VH WLS DP+N+AV+HC
Sbjct  74   YFIYNLCSERTYDTSKFHNRVQTFPFDDHNPPKIELIQPFCHSVHDWLSKDPENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+++G   +A+EAL  Y   RT ++ GV+IPSQ RY+ Y+E +L
Sbjct  134  KAGKGRTGTMICCYLLHSGAFATADEALDHYGQARTQDHKGVTIPSQVRYIRYYETLL  191



>ref|XP_002610383.1| hypothetical protein BRAFLDRAFT_209333 [Branchiostoma floridae]
 gb|EEN66393.1| hypothetical protein BRAFLDRAFT_209333 [Branchiostoma floridae]
Length=351

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 126/174 (72%), Gaps = 2/174 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            +++LVSK++RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   L+ +H GH
Sbjct  5    LKSLVSKKKRRFQEDGFDLDLTYIYPNIIAMGFPAEKLEGVYRNNIDDVVRFLESKHKGH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+SYDP+ F+ RV  Y F+D++ P L+++K FC D+  WL+ D  N+A +HC
Sbjct  65   YKVYNLCSERSYDPSKFNQRVAVYAFEDHNPPKLELIKPFCNDLDEWLAEDEDNVAAVHC  124

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTG+M+CAYL++ G   + +EAL+ Y   RT N  GV+IPSQRRYVEY+
Sbjct  125  KAGKGRTGVMICAYLLHRGKFPTPDEALRFYGQARTKNEKGVTIPSQRRYVEYY  178



>ref|XP_008180621.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Acyrthosiphon pisum]
Length=436

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 132/185 (71%), Gaps = 7/185 (4%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAM-YRNPLWQVKSVLDMRHSG  546
            I+ LVSKQR+R    G++LD+TYI   ++AM FPAE++  + YRN +  V  +LD +H  
Sbjct  29   IKKLVSKQRKRYTEDGFNLDLTYIQHNVIAMGFPAENLEGVVYRNHIDDVSRLLDQKHPN  88

Query  547  HYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIH  726
            HYK+YNLC E+SYD   FH RV  YPF D++ P ++++K FCEDVH WL+ D +N+A +H
Sbjct  89   HYKIYNLCSERSYDSRKFHQRVATYPFQDHNPPSIEVIKPFCEDVHQWLARDSRNVAAVH  148

Query  727  CMAGKGRTGLMVCAYLVYT--GMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW----E  888
            C AGKGRTG+M+C YL+++   +SAEEAL  Y  KRT +  GV+IPSQRRYV Y+    E
Sbjct  149  CKAGKGRTGVMICCYLIHSLQCLSAEEALNYYGQKRTFDKKGVTIPSQRRYVNYYALLVE  208

Query  889  KVLSF  903
            K L++
Sbjct  209  KNLNY  213



>ref|XP_003242877.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Acyrthosiphon pisum]
Length=440

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 132/185 (71%), Gaps = 7/185 (4%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAM-YRNPLWQVKSVLDMRHSG  546
            I+ LVSKQR+R    G++LD+TYI   ++AM FPAE++  + YRN +  V  +LD +H  
Sbjct  29   IKKLVSKQRKRYTEDGFNLDLTYIQHNVIAMGFPAENLEGVVYRNHIDDVSRLLDQKHPN  88

Query  547  HYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIH  726
            HYK+YNLC E+SYD   FH RV  YPF D++ P ++++K FCEDVH WL+ D +N+A +H
Sbjct  89   HYKIYNLCSERSYDSRKFHQRVATYPFQDHNPPSIEVIKPFCEDVHQWLARDSRNVAAVH  148

Query  727  CMAGKGRTGLMVCAYLVYT--GMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW----E  888
            C AGKGRTG+M+C YL+++   +SAEEAL  Y  KRT +  GV+IPSQRRYV Y+    E
Sbjct  149  CKAGKGRTGVMICCYLIHSLQCLSAEEALNYYGQKRTFDKKGVTIPSQRRYVNYYALLVE  208

Query  889  KVLSF  903
            K L++
Sbjct  209  KNLNY  213



>ref|XP_637576.1| protein tyrosine phosphatase [Dictyostelium discoideum AX4]
 sp|Q8T9S7.1|PTEN_DICDI RecName: Full=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN; AltName: 
Full=Pten 3-phosphoinositide phosphatase alpha [Dictyostelium 
discoideum]
 gb|AAL75566.1|AF467431_1 Pten 3-phosphoinositide phosphatase alpha [Dictyostelium discoideum 
AX3]
 gb|EAL64034.1| protein tyrosine phosphatase [Dictyostelium discoideum AX4]
Length=533

 Score =   206 bits (524),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  +R  VSKQ+RR    GYDLD+ YITD ++AM FP+E +  ++RNP+  V+  LD  H
Sbjct  2    SNLLRVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEKVEGVFRNPMKDVQRFLDQYH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              H+KVYNLC E+ YD + F+GRV  YPFDD++ P  +M+  FC DV +W+  D KNIAV
Sbjct  62   KDHFKVYNLCSERVYDHSKFYGRVGYYPFDDHNAPQFEMIDAFCRDVDAWMKEDSKNIAV  121

Query  721  IHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTGLM+C +L+Y GM  + E++L+ YA  RT N  GV+IPSQ RYV Y+ + 
Sbjct  122  IHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGYFGRS  181

Query  895  L  897
            +
Sbjct  182  I  182



>ref|XP_007895108.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Callorhinchus 
milii]
Length=406

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 126/179 (70%), Gaps = 2/179 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ LVS+ +RR    G+DLD+TYI   ++AM FPA+ +  +YRN +  V   LD +H  H
Sbjct  5    IKELVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVKFLDAKHKNH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD T F+ RV +YPF+D++ P L+++K FCED+ +WLS D  N+A IHC
Sbjct  65   YKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDNWLSEDDNNVAAIHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLS  900
             AGKGRTG+M+CAYL++ G  + A+EAL  Y   RT +  GV+IPSQRRYV Y+  +L 
Sbjct  125  KAGKGRTGVMICAYLLHRGKFLKAQEALDFYGQARTIDKKGVTIPSQRRYVHYYSYLLK  183



>dbj|GAM16849.1| hypothetical protein SAMD00019534_000240, partial [Acytostelium 
subglobosum LB1]
Length=481

 Score =   205 bits (521),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 125/174 (72%), Gaps = 2/174 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            +R  VSKQ+RR    G+DLD+ YIT+R++AM FP+E M  ++RNP+ +V+  L+ +H  H
Sbjct  5    LRLAVSKQKRRYQKDGFDLDLAYITERIIAMGFPSEKMEGVFRNPMKEVQRFLETKHKDH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            Y+VYNLC E+ YD   FHGRV  YPFDD++ P   +++EFC+DV +W+S   KNIAVIHC
Sbjct  65   YRVYNLCSERDYDHGKFHGRVACYPFDDHNAPEFTLIEEFCKDVDNWMSRSEKNIAVIHC  124

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTGLM+C +L+Y  M    E +L+ YA  RT N  GV+IPSQ RYV Y+
Sbjct  125  KAGKGRTGLMICCWLLYCRMWTDTESSLKFYAALRTYNQKGVTIPSQIRYVHYF  178



>ref|NP_599147.1| pten, isoform A [Drosophila melanogaster]
 ref|NP_599148.1| pten, isoform E [Drosophila melanogaster]
 gb|AAD45364.1|AF161259_1 PTEN3 [Drosophila melanogaster]
 gb|AAF23235.1|AF201904_1 phosphatase and tensin homolog [Drosophila melanogaster]
 gb|AAF52889.1| pten, isoform E [Drosophila melanogaster]
 gb|AAF52887.2| pten, isoform A [Drosophila melanogaster]
Length=509

 Score =   205 bits (522),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GYDLD+TYI D ++AM +PA + +  ++RN L  V  +L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYK+YNLC E+SYD   F GRV  YPFDD++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLV++G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>gb|AAF23236.1|AF201905_1 phosphatase and tensin homolog [Drosophila melanogaster]
Length=506

 Score =   205 bits (522),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GYDLD+TYI D ++AM +PA + +  ++RN L  V  +L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYK+YNLC E+SYD   F GRV  YPFDD++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLV++G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>ref|NP_477423.1| pten, isoform B [Drosophila melanogaster]
 ref|NP_599149.1| pten, isoform D [Drosophila melanogaster]
 ref|NP_001162933.1| pten, isoform G [Drosophila melanogaster]
 ref|NP_477422.2| pten, isoform H [Drosophila melanogaster]
 gb|AAF08382.1|AF144232_1 phosphatase PTEN [Drosophila melanogaster]
 gb|AAF52888.1| pten, isoform D [Drosophila melanogaster]
 gb|AAN10731.1| pten, isoform B [Drosophila melanogaster]
 gb|ABE73224.1| IP16020p [Drosophila melanogaster]
 gb|ACZ94222.1| pten, isoform G [Drosophila melanogaster]
 gb|AAN10732.2| pten, isoform H [Drosophila melanogaster]
Length=514

 Score =   205 bits (522),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GYDLD+TYI D ++AM +PA + +  ++RN L  V  +L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYK+YNLC E+SYD   F GRV  YPFDD++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLV++G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>ref|XP_008197501.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Tribolium castaneum]
Length=469

 Score =   204 bits (519),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR LVSK+R R    G++LD+TYITD ++AM +PA ++  +YRN +  V  +LD +H+ H
Sbjct  77   IRGLVSKRRIRYKQDGFNLDLTYITDSIIAMGYPASNIEGVYRNHIDDVVKLLDSKHNNH  136

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            Y +YNLC E++YD + FH RV+ +PFDD++ P +++++ FC  VH WLS DP+N+AV+HC
Sbjct  137  YFIYNLCSERTYDTSKFHNRVQTFPFDDHNPPKIELIQPFCHSVHDWLSKDPENVAVVHC  196

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+++G   +A+EAL  Y   RT ++ GV+IPSQ RY+ Y+E +L
Sbjct  197  KAGKGRTGTMICCYLLHSGAFATADEALDHYGQARTQDHKGVTIPSQVRYIRYYETLL  254



>gb|AAD45363.1|AF161258_1 PTEN2 [Drosophila melanogaster]
Length=511

 Score =   205 bits (522),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GYDLD+TYI D ++AM +PA + +  ++RN L  V  +L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYK+YNLC E+SYD   F GRV  YPFDD++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLV++G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>gb|KDO29952.1| hypothetical protein SPRG_05142 [Saprolegnia parasitica CBS 223.65]
Length=442

 Score =   203 bits (517),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 142/223 (64%), Gaps = 6/223 (3%)
 Frame = +1

Query  223  PNWPHGPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRR  402
            P+  HGP+   +     G  G   +APAS    +     +   LF S  ++ LVS+++RR
Sbjct  16   PSMRHGPVTVLSPSSHTGSFGS--SAPASPAG-LKKPSSMSTSLF-SLQLKKLVSRKKRR  71

Query  403  LLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQS  582
             +  G+DLDMTY+T RL+A  +PAE++  MYRN    V +  + RH  HYKVYNLC E+ 
Sbjct  72   FIEDGFDLDMTYVTSRLIAFGYPAENLEGMYRNHYKDVFNCFEHRHKDHYKVYNLCSERH  131

Query  583  YDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMV  762
            YD   FH RV  YPFDD++ PPL ++   C+D+  WL+  P N+A IHC AGKGRTG+M+
Sbjct  132  YDKDKFHNRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHCKAGKGRTGVMI  191

Query  763  CAYLVY--TGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
            CAYL+Y  T ++A  A+  Y   R+ N+ GV+IPSQRR++EY+
Sbjct  192  CAYLLYSSTWLTAYGAMGFYGGARSLNHQGVTIPSQRRFIEYF  234



>ref|XP_002678142.1| predicted protein [Naegleria gruberi]
 gb|EFC45398.1| predicted protein [Naegleria gruberi]
Length=170

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 119/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  373  RNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHY  552
            R LVSK+++R   GG+DLD+TY+T  ++AM FP+    A++RNP+ +V+ +L   H  HY
Sbjct  5    RRLVSKKKKRYQEGGFDLDLTYVTPNIIAMGFPSVGKEALFRNPMEEVQRMLKRNHGEHY  64

Query  553  KVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCM  732
            KVYNLC E++Y+P+ F GRVER+PFDD++ PP +M+   C  +  WL  DP+N+A+IHC 
Sbjct  65   KVYNLCSEKTYEPSSFEGRVERFPFDDHNAPPFEMMLPCCRSMDEWLKQDPRNVAIIHCK  124

Query  733  AGKGRTGLMVCAYLVYTGMSAE--EALQVYADKRTTNNHGVSIPSQ  864
            AGKGRTG M+CAYL+Y G   +   ++  YA+ RT N  GV+IPSQ
Sbjct  125  AGKGRTGTMICAYLLYNGSHKDPINSMDFYAESRTRNKEGVTIPSQ  170



>ref|XP_010863040.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Esox lucius]
Length=406

 Score =   202 bits (514),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+  VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN + +V   LD +H
Sbjct  2    AAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLCIE+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCIERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008610796.1| hypothetical protein SDRG_06772 [Saprolegnia diclina VS20]
 gb|EQC36034.1| hypothetical protein SDRG_06772 [Saprolegnia diclina VS20]
Length=431

 Score =   202 bits (515),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 142/223 (64%), Gaps = 6/223 (3%)
 Frame = +1

Query  223  PNWPHGPLCSQTMGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRR  402
            P+  HGP+   +     G  G   +APAS    +     +   LF S  ++ LVS+++RR
Sbjct  5    PSMRHGPVTVLSPSSHTGSFGS--SAPASPAG-LKKPSSMATSLF-SLQLKKLVSRKKRR  60

Query  403  LLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQS  582
             +  G+DLDMTY+T RL+A  +PAE++  MYRN    V +  + RH  HYKVYNLC E+ 
Sbjct  61   FIEDGFDLDMTYVTSRLIAFGYPAENLEGMYRNHYKDVFNCFEHRHKDHYKVYNLCSERH  120

Query  583  YDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMV  762
            YD   FH RV  YPFDD++ PPL ++   C+D+  WL+  P N+A IHC AGKGRTG+M+
Sbjct  121  YDKDKFHNRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHCKAGKGRTGVMI  180

Query  763  CAYLVY--TGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
            CAYL+Y  T +++  A+  Y   R+ N+ GV+IPSQRR++EY+
Sbjct  181  CAYLLYSSTWLTSYGAMGFYGGARSLNHQGVTIPSQRRFIEYF  223



>ref|XP_005092511.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Aplysia 
californica]
Length=236

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ LVS+ +RRL   G+DLD+TYIT  ++AM FPAE +   YRN +  V   L+ +H  H
Sbjct  6    IKGLVSRNKRRLKEDGFDLDLTYITPNIIAMGFPAEKLEGYYRNHMEDVIKFLEAKHKDH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+SYDP  F  RV  YPFDD++ P ++++K FCED+ +WL   P NIA IHC
Sbjct  66   YKVYNLCSERSYDPNKFLNRVAHYPFDDHNPPRIELIKPFCEDLDAWLGQHPDNIAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++       + AL+ Y   RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRKRFKDPDSALRHYGATRTRDEKGVTIPSQRRYVLYYADLL  183



>ref|XP_003402815.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Bombus terrestris]
Length=465

 Score =   203 bits (517),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++T    +A EAL  Y +KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_010863046.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Esox lucius]
Length=403

 Score =   202 bits (513),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+  VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN + +V   LD +H
Sbjct  2    AAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLCIE+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCIERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_003486174.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Bombus impatiens]
Length=465

 Score =   203 bits (517),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++T    +A EAL  Y +KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_004035605.1| phosphatase and tensin, putative, partial [Ichthyophthirius multifiliis]
 gb|EGR32119.1| phosphatase and tensin, putative [Ichthyophthirius multifiliis]
Length=439

 Score =   202 bits (515),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 131/190 (69%), Gaps = 3/190 (2%)
 Frame = +1

Query  379  LVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKV  558
            LVSK+++R    GY LD+TYIT+R++AM FPAE+   MYRN +  V+   + RH  HYK+
Sbjct  150  LVSKKKKRFDYDGYSLDLTYITERIIAMGFPAENYEKMYRNSMSDVQKFFNNRHKAHYKI  209

Query  559  YNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAG  738
            YNLC E+ YD   F G V +YPFDD+  P LQ++  FC+D+  WL+ +  N+A IHC AG
Sbjct  210  YNLCSERKYDIQAFGGMVAQYPFDDHQAPSLQLIYRFCKDLDQWLNANSNNVAGIHCKAG  269

Query  739  KGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDR  912
            KGRTG+M+C YL+Y+    +A +AL+ Y   RT N  GV+IPSQ RYV Y+EK+L    +
Sbjct  270  KGRTGVMICCYLMYSKQHGTAIDALRYYGMMRTQNKKGVTIPSQIRYVLYFEKILLSKWK  329

Query  913  VDRGLPDVNL  942
            +D+ +PD+ +
Sbjct  330  LDQ-IPDIEI  338



>gb|EHJ66567.1| phosphatase and tensin-like protein [Danaus plexippus]
Length=607

 Score =   206 bits (525),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+R+R +  G++LD+ YITDRL+AM FPAE +  +YRN + +V   L+ +H  H
Sbjct  5    IKGIVSKRRKRYVKDGFNLDLAYITDRLIAMGFPAEKLEGVYRNHIDEVYRFLEQKHKDH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            Y +YNLC E+ YD T F+ RV+ + F D+  P +  ++ FCEDVH+WLS DP+N+A +HC
Sbjct  65   YMIYNLCAEREYDYTKFNKRVQVFAFKDHEPPKIGQIQPFCEDVHNWLSKDPRNVAAVHC  124

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG MVC YL+Y+G   +A+EAL+ Y +KRT +  GV+IPSQRRYVEY+  ++
Sbjct  125  KAGKGRTGTMVCCYLLYSGQKTTADEALKYYGNKRTHDEKGVTIPSQRRYVEYYAALV  182



>gb|EFX81708.1| phosphatase and tensin-like protein [Daphnia pulex]
Length=280

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 153/239 (64%), Gaps = 12/239 (5%)
 Frame = +1

Query  370   IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
             I+ LVS++++R    G++LD+TYI D ++AM +PA  +  +YRN +  V   L+ +H  H
Sbjct  5     IKGLVSRKKKRYKEDGFNLDLTYIFDNVIAMGYPAAKLEGVYRNHIDDVYKFLETKHKDH  64

Query  550   YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
             YK+YNLC E+SYD + F+ RV  +PFDD++ P L +++ FC+D+  WL+ D  N+A IHC
Sbjct  65    YKIYNLCSERSYDYSRFNNRVSSFPFDDHNPPKLGLIEPFCKDMDEWLNQDQSNVAAIHC  124

Query  730   MAGKGRTGLMVCAYLVYTGMS--AEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
              AGKGRTGLM+C Y+++ G +  A++AL+ Y   RT +  GV+IPSQRRYVEY++++L  
Sbjct  125   KAGKGRTGLMICCYILHRGWAENADDALKHYGQTRTHDTKGVTIPSQRRYVEYYDQLLK-  183

Query  904   PDRVDRGLPDVNLPKPCARELRRIRLYDTVNVD-SIFFVVSELQNIPGERYCPPVEVSK  1077
                   G    +L   C  ELR IRL    N+      V++  +    + + PP+E++K
Sbjct  184   -----EGGSGYSL---CPLELREIRLQPIPNMSGGCVPVLTIFEAESQQEFNPPIELTK  234



>ref|XP_003486173.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Bombus impatiens]
Length=501

 Score =   204 bits (519),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++T    +A EAL  Y +KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_003402814.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Bombus terrestris]
Length=501

 Score =   204 bits (518),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++T    +A EAL  Y +KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_009830137.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV80213.1| hypothetical protein, variant [Aphanomyces astaci]
Length=399

 Score =   201 bits (512),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            ++ LVSK++RR +  G+DLDMTY+T RL+A  +PAE++  MYRN    V S  + RH  H
Sbjct  62   LKKLVSKKKRRFIDDGFDLDMTYVTPRLIAFGYPAENLEGMYRNHYKDVYSCFEHRHKDH  121

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ YD   FH RV  YPFDD++ PPL ++   C+D+  WL+  P N+A IHC
Sbjct  122  YKVYNLCSERHYDKDKFHNRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHC  181

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTG+M+CA+L+Y+   ++A+ A+  Y + R+ N  GV+IPSQRR++EY+
Sbjct  182  KAGKGRTGVMICAFLLYSSEWVTAQGAMNFYGNARSLNQQGVTIPSQRRFIEYF  235



>ref|XP_003708160.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Megachile 
rotundata]
Length=504

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ LVSK+R+R    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ +H  H
Sbjct  14   IKGLVSKRRKRFTEDGFDLDLTYIRDDLIAMGFPAEKLEGVYRNHIDDVVRLLESKHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  +K FCEDVH WLS   KN+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLNQIKPFCEDVHEWLSQHKKNVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++    ++A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHIKQFLTATEALNFYGTKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_974994.2| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Tribolium castaneum]
Length=565

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR LVSK+R R    G++LD+TYITD ++AM +PA ++  +YRN +  V  +LD +H+ H
Sbjct  77   IRGLVSKRRIRYKQDGFNLDLTYITDSIIAMGYPASNIEGVYRNHIDDVVKLLDSKHNNH  136

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            Y +YNLC E++YD + FH RV+ +PFDD++ P +++++ FC  VH WLS DP+N+AV+HC
Sbjct  137  YFIYNLCSERTYDTSKFHNRVQTFPFDDHNPPKIELIQPFCHSVHDWLSKDPENVAVVHC  196

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+++G   +A+EAL  Y   RT ++ GV+IPSQ RY+ Y+E +L
Sbjct  197  KAGKGRTGTMICCYLLHSGAFATADEALDHYGQARTQDHKGVTIPSQVRYIRYYETLL  254



>ref|XP_009038041.1| hypothetical protein AURANDRAFT_28007, partial [Aureococcus anophagefferens]
 gb|EGB07424.1| hypothetical protein AURANDRAFT_28007 [Aureococcus anophagefferens]
Length=179

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            +R LVSK++RRL   G+DLD+TY+T R++AM FPA      YRN +  V+   D +H GH
Sbjct  5    VRALVSKKKRRLKEDGFDLDLTYVTPRIIAMGFPASDFEGAYRNDIDDVQRFFDAKHGGH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK YNLC E++Y    FHG+  R+PFDD++ PPL +   FC+DV ++L+ DP N+  IHC
Sbjct  65   YKFYNLCSERTYPSDRFHGQFVRFPFDDHNPPPLGLFYFFCKDVEAYLAADPANVVAIHC  124

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTG+M+ AYL++ G     +EA++ Y   RT N  GV+IPSQRR+V+Y+
Sbjct  125  KAGKGRTGVMISAYLMWCGDWPDPDEAMKFYGFARTANQKGVTIPSQRRFVDYF  178



>gb|EKC26943.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN [Crassostrea 
gigas]
Length=481

 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = +1

Query  367  YIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSG  546
            +I+NLVSK +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V + LD RH  
Sbjct  4    FIKNLVSKHKRRYTEDGFDLDLTYIYPNIIAMGFPAEKLEGVYRNKMADVVNFLDERHKD  63

Query  547  HYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIH  726
            HY+VYNLC E+SYD + FH RV  YPFDD++ P L+++K FCED+  WL  D +NIA IH
Sbjct  64   HYRVYNLCSERSYDVSKFHNRVVSYPFDDHNPPRLELIKPFCEDLDEWLRQDGRNIAAIH  123

Query  727  CMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
            C AGKGRTG+M+CAY+++      A  AL+ Y   RT +  GV+IPSQ RYVEY+
Sbjct  124  CKAGKGRTGVMICAYMLHRKKFTDAGAALRYYGQTRTRDEKGVTIPSQVRYVEYY  178



>ref|XP_008302817.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Stegastes 
partitus]
Length=291

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  6    IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F+ RV +YPF+D++ P L+++K FCED+  WLS D +++A IHC
Sbjct  66   YKIYNLCAERHYDTSKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEQHVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVVYYSFLL  183



>gb|KFH66727.1| hypothetical protein MVEG_07252 [Mortierella verticillata NRRL 
6337]
Length=682

 Score =   206 bits (523),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLV--GGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHS  543
            +R+ VSKQ+RR +    G DLD+ YIT  L+AM +P++ + + YRNP+ +V+  LD RH 
Sbjct  4    LRHAVSKQKRRFIDKDTGMDLDLAYITPNLIAMGYPSKSLESFYRNPMSEVEKFLDSRHE  63

Query  544  GHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVI  723
            G YKVYNLC E++Y    FHGRV ++PF D+  PP Q++  FCEDV  WL  D  N+  I
Sbjct  64   GTYKVYNLCSEKTYSDQRFHGRVAQFPFPDHSPPPFQLIHPFCEDVSDWLHTDIGNVVAI  123

Query  724  HCMAGKGRTGLMVCAYLVYTGMSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
            HC AGKGRTG+M+C++LV+ G +AEEA+++Y +KRT +  GV+IPSQ RY+ Y+E+ L
Sbjct  124  HCKAGKGRTGVMICSFLVHCGATAEEAIRLYGEKRTLDGLGVTIPSQLRYIRYYEQFL  181



>ref|XP_009830136.1| hypothetical protein H257_06564 [Aphanomyces astaci]
 gb|ETV80212.1| hypothetical protein H257_06564 [Aphanomyces astaci]
Length=464

 Score =   201 bits (512),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            ++ LVSK++RR +  G+DLDMTY+T RL+A  +PAE++  MYRN    V S  + RH  H
Sbjct  62   LKKLVSKKKRRFIDDGFDLDMTYVTPRLIAFGYPAENLEGMYRNHYKDVYSCFEHRHKDH  121

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ YD   FH RV  YPFDD++ PPL ++   C+D+  WL+  P N+A IHC
Sbjct  122  YKVYNLCSERHYDKDKFHNRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHC  181

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTG+M+CA+L+Y+   ++A+ A+  Y + R+ N  GV+IPSQRR++EY+
Sbjct  182  KAGKGRTGVMICAFLLYSSEWVTAQGAMNFYGNARSLNQQGVTIPSQRRFIEYF  235



>ref|XP_001427413.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60015.1| unnamed protein product [Paramecium tetraurelia]
Length=373

 Score =   199 bits (505),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 137/206 (67%), Gaps = 6/206 (3%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            +++LVSKQ+ R ++ G+DLD+TYIT++++AM FPA    A+YRN +  V+   + RH  H
Sbjct  60   LKSLVSKQKNRFIMDGFDLDLTYITEQVIAMGFPAIDYEAIYRNSMEDVQRFFNQRHKNH  119

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+ NLC E+ YD  +F G V  YPFDD+  P   M+ E C ++H++++ D +N+  IHC
Sbjct  120  YKIINLCSERKYDHAYFDGNVSEYPFDDHQAPQFNMIYELCAEIHNYVTQDKQNVVAIHC  179

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
             AGKGRTG+M+C YL+++ +  S+ EA++ Y   RT NN GV+IPSQ RY+ Y+EK L  
Sbjct  180  KAGKGRTGIMICCYLLFSELFKSSFEAMRYYGMMRTKNNKGVTIPSQIRYILYFEKAL--  237

Query  904  PDRVDRGLPDVNLPKPCARELRRIRL  981
              ++   + DV  PK    ++R I +
Sbjct  238  --QMGYTVQDVPQPKIQILQIRLITI  261



>ref|XP_001363283.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Monodelphis 
domestica]
Length=404

 Score =   199 bits (507),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_003382733.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Amphimedon 
queenslandica]
Length=457

 Score =   201 bits (510),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
             R+LVSK++RR +  G+DLDMT+I   ++AM FP+E +  +YRN +  V+   D  ++ H
Sbjct  6    FRHLVSKRKRRFIADGFDLDMTFIKPNIVAMGFPSEKLEGVYRNKMSDVQRYFDTHYTDH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ YDP  FH +V  YPFDD++ PP ++++ FCEDV  WL  D +N+AVIHC
Sbjct  66   YKVYNLCSERFYDPKKFH-KVTVYPFDDHNPPPFELIQPFCEDVDGWLKEDNRNVAVIHC  124

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTG+M+C+YL++  +  + ++ALQ Y + RT N  GV+IPSQRRYV+Y+
Sbjct  125  KAGKGRTGVMICSYLLHDRLFDTVKDALQFYGEARTQNAKGVTIPSQRRYVQYY  178



>ref|XP_004362272.1| protein tyrosine phosphatase [Dictyostelium fasciculatum]
 gb|EGG24421.1| protein tyrosine phosphatase [Dictyostelium fasciculatum]
Length=663

 Score =   204 bits (520),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 134/197 (68%), Gaps = 7/197 (4%)
 Frame = +1

Query  313  LSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAM  492
            LS    QQD +  +  S  +R  VSKQ+RR    GYDLD+ YITDR++AM FP+E +  +
Sbjct  141  LSKQQHQQDRINRM--SNLLRVAVSKQKRRYQKNGYDLDLAYITDRVIAMGFPSEKVEGV  198

Query  493  YRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFC  672
            +RNP+ +V+  LD  H  HY+VYNLC E+ YD   F+GRV  YPFDD++ P  +++++FC
Sbjct  199  FRNPMKEVQKFLDQYHKDHYRVYNLCSERDYDHNKFYGRVGCYPFDDHNAPAFELIQKFC  258

Query  673  EDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHG  846
            +DV  W   DPKNIAV+HC AGK   GLM+C +L+Y GM  + EE+L+ YA  RT N  G
Sbjct  259  QDVDEWFKEDPKNIAVVHCKAGK---GLMICCWLLYCGMWKNTEESLRFYAALRTYNQKG  315

Query  847  VSIPSQRRYVEYWEKVL  897
            V+IPSQ RYV Y+ + +
Sbjct  316  VTIPSQIRYVHYFGRSM  332



>ref|XP_008487688.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Diaphorina 
citri]
Length=429

 Score =   199 bits (507),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 139/207 (67%), Gaps = 9/207 (4%)
 Frame = +1

Query  301  PASQLSYIHAQQ------DLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAM  462
            P+  LSYI  Q       + +  +     I+ LVSK+R+R    G++LD+TYIT+ L+AM
Sbjct  32   PSHSLSYIDLQTFAQRMANTISNMKIHNPIKTLVSKRRQRYTKDGFNLDLTYITNNLIAM  91

Query  463  SFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHV  642
             FPAE + A+YRN +  V   L+  H  HYK+YNLC E+SYD T F  +V  YPFDD++ 
Sbjct  92   GFPAEKLEAVYRNHIDDVVKFLEAYHKDHYKIYNLCSERSYDKTRFQ-QVAHYPFDDHNP  150

Query  643  PPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVY  816
            P +++++ FC DVH WLS D  N+A +HC AGKGRTG+MVC YL+++   ++A++AL  Y
Sbjct  151  PRMEVIQPFCNDVHQWLSQDKNNVAAVHCKAGKGRTGVMVCCYLLHSQQYITAKDALNFY  210

Query  817  ADKRTTNNHGVSIPSQRRYVEYWEKVL  897
              +RTT+  GV+IPSQRRYV Y+  ++
Sbjct  211  GSQRTTDKKGVTIPSQRRYVGYYATLV  237



>ref|XP_006169808.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN, partial 
[Tupaia chinensis]
Length=299

 Score =   196 bits (498),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 126/182 (69%), Gaps = 2/182 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  LS  900
            L 
Sbjct  182  LK  183



>ref|XP_003698646.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Apis 
florea]
Length=465

 Score =   201 bits (510),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_010564236.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Haliaeetus leucocephalus]
Length=328

 Score =   197 bits (500),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|ACR55737.1| phosphatase and tensin-like C [Apis mellifera]
Length=457

 Score =   200 bits (509),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHIEQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_006557297.1| PREDICTED: phosphatase and tensin-like isoform X6 [Apis mellifera]
 ref|XP_006557298.1| PREDICTED: phosphatase and tensin-like isoform X7 [Apis mellifera]
Length=501

 Score =   201 bits (512),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_004521565.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521566.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Ceratitis capitata]
Length=1664

 Score =   209 bits (532),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 132/179 (74%), Gaps = 2/179 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            +RN+VSKQR R    GY+LD+ YI D ++AM +PA+++ +++RN L  V   L   H  H
Sbjct  102  LRNVVSKQRIRYKENGYNLDLAYICDNIIAMGYPADNIESIFRNRLEDVYKFLQEIHQNH  161

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC+E+SYD   FHGRV  YPF+D++ P +++++ FC DV +WL  D +N+A +HC
Sbjct  162  YKIYNLCLERSYDSNKFHGRVAVYPFEDHNPPTIELIQRFCLDVDTWLKADIQNVAAVHC  221

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLS  900
             AGKGRTG M+C YL+Y+G   +A +AL+ YA+KRT +  GV+IPSQRRYV+Y+ K++S
Sbjct  222  KAGKGRTGTMICCYLLYSGQQHTAADALECYAEKRTKDRKGVTIPSQRRYVQYFAKLIS  280



>ref|XP_002405586.1| TPIP alpha lipid phosphatase, putative [Ixodes scapularis]
 gb|EEC15363.1| TPIP alpha lipid phosphatase, putative [Ixodes scapularis]
Length=363

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            ++ +VSK ++R     +DLD++YI D ++AM FPAE +  ++RN +  V   L+ +H GH
Sbjct  7    LKQVVSKNKKRYQDEDFDLDLSYIRDNIIAMGFPAEKLEGVFRNHVDDVHKFLEKKHGGH  66

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD   F  RV  YPF D++ P + ++K FCEDV  WLS  P N+AVIHC
Sbjct  67   YKIYNLCSERQYDAKKFENRVAVYPFKDHNPPKIDLIKPFCEDVERWLSEHPDNVAVIHC  126

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC+YLV++ +  +A++AL  Y++KRT +  GV+IPSQRRYVEY+ +++
Sbjct  127  KAGKGRTGVMVCSYLVHSKIFSTAKDALSFYSEKRTKDLKGVTIPSQRRYVEYYSELV  184



>gb|ACR55736.1| phosphatase and tensin-like B [Apis mellifera]
Length=465

 Score =   200 bits (509),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHIEQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|NP_001155985.1| phosphatase and tensin-like [Apis mellifera]
 gb|ACR55735.1| phosphatase and tensin-like A [Apis mellifera]
Length=501

 Score =   201 bits (511),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  14   IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  74   YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  133

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  134  KAGKGRTGVMVCCYLLHIEQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  191



>ref|XP_008860956.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETW09545.1| hypothetical protein, variant [Aphanomyces invadans]
Length=430

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            ++ LVSK++RR +  G+DLDMTY+T R++A  +PAEH+  MYRN    V S  + RH  H
Sbjct  62   LKKLVSKKKRRFIDDGFDLDMTYVTPRIIAFGYPAEHLEGMYRNHYKDVFSCFEHRHKDH  121

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ Y    FH RV  YPFDD++ PPL ++   C+D+  WL+  P N+A IHC
Sbjct  122  YKVYNLCSERHYGKEKFHSRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHC  181

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
             AGKGRTG+M+CA+L+Y+   ++A+ A+  Y + R+ N  GV+IPSQRR++EY+  ++  
Sbjct  182  KAGKGRTGVMICAFLLYSSEWVTAQGAMNFYGNARSLNQQGVTIPSQRRFIEYFA-LMCH  240

Query  904  PDRVD  918
             D+ D
Sbjct  241  ADQFD  245



>ref|XP_007433696.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like, partial 
[Python bivittatus]
Length=266

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 125/182 (69%), Gaps = 2/182 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDRWLSEDGNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGRFQKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  LS  900
            L 
Sbjct  182  LK  183



>ref|XP_006622018.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X5 [Apis dorsata]
Length=527

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>gb|ABM21567.1| PTEN transcript variant 5 [Aedes aegypti]
Length=216

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IRNLVSK+R R    G+DLD+TYI DR++AM +PAEHM ++YRN +  V+ +L+  H+G 
Sbjct  14   IRNLVSKRRIRYTQDGFDLDLTYINDRIIAMGYPAEHMESIYRNKIEDVQKMLEKNHAGC  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SY+   F      YPF D++ P ++++  FC DV   L  D KN+  +HC
Sbjct  74   YKIYNLCSERSYNHKRF-PYYSGYPFKDHNPPDIELITSFCRDVDEHLRADSKNVVAVHC  132

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+Y+    +A EAL  YA +RT+++ GV+IPSQRRYVEY+  +L
Sbjct  133  KAGKGRTGTMICCYLLYSRQFNTAAEALHYYAQRRTSDSKGVTIPSQRRYVEYYASLL  190



>ref|XP_006557296.1| PREDICTED: phosphatase and tensin-like isoform X5 [Apis mellifera]
Length=527

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>ref|XP_005406457.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Chinchilla 
lanigera]
Length=403

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VSK +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSKNKRRYQEDGFDLDLTYIYPNIIAMGFPAEKLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
               YK+YNLC E+ YDP  F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNQYKIYNLCAERHYDPAKFNCRVAQYPFEDHNPPQLELIKAFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            +HC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  VHCKAGKGRTGVMICAYLLHRGKFLRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008860955.1| hypothetical protein H310_00098 [Aphanomyces invadans]
 gb|ETW09544.1| hypothetical protein H310_00098 [Aphanomyces invadans]
Length=491

 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            ++ LVSK++RR +  G+DLDMTY+T R++A  +PAEH+  MYRN    V S  + RH  H
Sbjct  62   LKKLVSKKKRRFIDDGFDLDMTYVTPRIIAFGYPAEHLEGMYRNHYKDVFSCFEHRHKDH  121

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E+ Y    FH RV  YPFDD++ PPL ++   C+D+  WL+  P N+A IHC
Sbjct  122  YKVYNLCSERHYGKEKFHSRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHC  181

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYW  885
             AGKGRTG+M+CA+L+Y+   ++A+ A+  Y + R+ N  GV+IPSQRR++EY+
Sbjct  182  KAGKGRTGVMICAFLLYSSEWVTAQGAMNFYGNARSLNQQGVTIPSQRRFIEYF  235



>emb|CDQ61574.1| unnamed protein product [Oncorhynchus mykiss]
Length=423

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDLWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006622017.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X4 [Apis dorsata]
Length=560

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>ref|XP_006557295.1| PREDICTED: phosphatase and tensin-like isoform X4 [Apis mellifera]
Length=560

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>ref|XP_006622015.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Apis dorsata]
Length=594

 Score =   202 bits (513),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  107  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  166

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  167  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  226

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  227  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  284



>ref|XP_006557293.1| PREDICTED: phosphatase and tensin-like isoform X2 [Apis mellifera]
Length=594

 Score =   202 bits (513),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  107  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  166

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  167  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  226

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  227  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  284



>ref|XP_010564235.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Haliaeetus leucocephalus]
Length=403

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_421555.2| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Gallus gallus]
Length=403

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006622014.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Apis dorsata]
Length=596

 Score =   201 bits (512),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>ref|XP_006273492.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Alligator 
mississippiensis]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006557292.1| PREDICTED: phosphatase and tensin-like isoform X1 [Apis mellifera]
Length=596

 Score =   201 bits (512),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>ref|XP_005495952.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Zonotrichia 
albicollis]
 ref|XP_005530790.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pseudopodoces 
humilis]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005474272.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X6 [Oreochromis niloticus]
 ref|XP_005914181.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Haplochromis burtoni]
Length=394

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005474271.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X5 [Oreochromis niloticus]
Length=400

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_009243870.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Pongo abelii]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|AAX36413.1| phosphatase and tensin-like [synthetic construct]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005727537.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Pundamilia nyererei]
Length=394

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005385943.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Chinchilla lanigera]
 ref|XP_005385944.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Chinchilla lanigera]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005352208.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Microtus 
ochrogaster]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|ADM26749.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26751.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26752.1| phosphatase and tensin-like protein [Homo sapiens]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|NP_113794.1| phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Rattus norvegicus]
 gb|AAO31948.1|AF455569_1 protein tyrosine phosphatase and tensin-like protein [Rattus 
norvegicus]
 gb|AAB96620.1| protein tyrosine phosphatase and tensin homolog/mutated in multiple 
advanced cancers protein [Rattus norvegicus]
 gb|EDM13141.1| phosphatase and tensin homolog, isoform CRA_a [Rattus norvegicus]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|NP_032986.1| phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Mus musculus]
 ref|XP_003510358.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Cricetulus 
griseus]
 ref|XP_005063745.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Mesocricetus 
auratus]
 ref|XP_006996261.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Peromyscus 
maniculatus bairdii]
 ref|XP_007632109.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Cricetulus 
griseus]
 sp|O08586.1|PTEN_MOUSE RecName: Full=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN; AltName: 
Full=Mutated in multiple advanced cancers 1; AltName: Full=Phosphatase 
and tensin homolog [Mus musculus]
 gb|AAC53118.1| MMAC1 [Mus musculus]
 gb|AAH21445.1| Pten protein [Mus musculus]
 dbj|BAC36545.1| unnamed protein product [Mus musculus]
 dbj|BAC40525.1| unnamed protein product [Mus musculus]
 gb|ABK42354.1| PTEN [synthetic construct]
 gb|EDL41729.1| phosphatase and tensin homolog [Mus musculus]
Length=403

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|EAW50175.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1), isoform CRA_d [Homo sapiens]
Length=402

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008836075.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Nannospalax 
galili]
Length=403

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_010603291.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Fukomys 
damarensis]
 ref|XP_010603292.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Fukomys 
damarensis]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004464588.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Dasypus 
novemcinctus]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|NP_001137168.1| phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Sus scrofa]
 gb|ACK36972.1| phosphatase and tensin-like protein [Sus scrofa]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004409753.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Odobenus 
rosmarus divergens]
 ref|XP_006732678.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Leptonychotes 
weddellii]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|NP_001003192.1| phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Canis lupus familiaris]
 ref|NP_000305.3| phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Homo sapiens]
 ref|NP_001247894.1| phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Macaca mulatta]
 ref|XP_002718539.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Oryctolagus cuniculus]
 ref|XP_002756414.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Callithrix 
jacchus]
 ref|XP_002914431.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Ailuropoda 
melanoleuca]
 ref|XP_003255221.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Nomascus 
leucogenys]
 ref|XP_521544.3| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pan troglodytes]
 ref|XP_003904004.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Papio anubis]
 ref|XP_003922485.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Saimiri 
boliviensis boliviensis]
 ref|XP_003993913.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Felis catus]
 ref|XP_004049787.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Gorilla 
gorilla gorilla]
 ref|XP_004279416.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Orcinus 
orca]
 ref|XP_004440049.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Ceratotherium 
simum simum]
 ref|XP_004607556.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Sorex araneus]
 ref|XP_004858402.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Heterocephalus 
glaber]
 ref|XP_005565939.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Macaca fascicularis]
 ref|XP_006188976.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Camelus 
ferus]
 ref|XP_006206703.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Vicugna 
pacos]
 ref|XP_007079321.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Panthera 
tigris altaica]
 ref|XP_007125605.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Physeter catodon]
 ref|XP_007179216.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007470361.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Lipotes 
vexillifer]
 ref|XP_007942223.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Orycteropus 
afer afer]
 ref|XP_007961662.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Chlorocebus 
sabaeus]
 ref|XP_008069943.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Tarsius 
syrichta]
 ref|XP_008268355.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Oryctolagus cuniculus]
 ref|XP_008534287.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Equus przewalskii]
 ref|XP_008574034.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Galeopterus 
variegatus]
 ref|XP_008687806.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Ursus maritimus]
 ref|XP_010377926.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Rhinopithecus 
roxellana]
 ref|XP_010969558.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Camelus 
bactrianus]
 ref|XP_010978236.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Camelus 
dromedarius]
 sp|P60483.1|PTEN_CANFA RecName: Full=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN; AltName: 
Full=Mutated in multiple advanced cancers 1; AltName: Full=Phosphatase 
and tensin homolog [Canis lupus familiaris]
 sp|P60484.1|PTEN_HUMAN RecName: Full=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN; AltName: 
Full=Mutated in multiple advanced cancers 1; AltName: Full=Phosphatase 
and tensin homolog [Homo sapiens]
 gb|AAC48709.1| MMAC1 [Canis lupus familiaris]
 gb|AAC51182.1| MMAC1 [Homo sapiens]
 gb|AAC51183.1| putative protein tyrosine phosphatase [Homo sapiens]
 gb|AAB66902.1| protein tyrosine phosphatase [Homo sapiens]
 gb|AAC08699.1| putative protein tyrosine phosphatase [Homo sapiens]
 gb|AAD13528.1| PTEN [Homo sapiens]
 gb|AAD38372.1| PTEN [Homo sapiens]
 gb|AAH05821.1| Phosphatase and tensin homolog [Homo sapiens]
 emb|CAG29302.1| PTEN [Homo sapiens]
 gb|AAX32639.1| phosphatase and tensin-like [synthetic construct]
 gb|AAY57327.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1) [Homo sapiens]
 gb|EAW50174.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1), isoform CRA_c [Homo sapiens]
 gb|ABM83530.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1) [synthetic construct]
 gb|ABM86488.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1) [synthetic construct]
 gb|ABW03514.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1) [synthetic construct]
 dbj|BAG36351.1| unnamed protein product [Homo sapiens]
 dbj|BAI46677.1| phosphatase and tensin homolog [synthetic construct]
 gb|EFB20295.1| hypothetical protein PANDA_002317 [Ailuropoda melanoleuca]
 gb|ADM26753.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26754.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26755.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26756.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26759.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|AHK05717.1| PTEN [Tupaia chinensis]
 gb|AHW56562.1| phosphatase and tensin-like protein isoform A, partial [Homo 
sapiens]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|ADM26750.1| phosphatase and tensin-like protein [Homo sapiens]
 gb|ADM26758.1| phosphatase and tensin-like protein [Homo sapiens]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004680952.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Condylura 
cristata]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|AAL08419.1| PTEN [Takifugu rubripes]
Length=412

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006831181.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Chrysochloris 
asiatica]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005875998.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Myotis brandtii]
 ref|XP_006096694.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Myotis lucifugus]
 ref|XP_008151182.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Eptesicus 
fuscus]
Length=402

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005339247.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Ictidomys 
tridecemlineatus]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_003409298.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Loxodonta 
africana]
 ref|XP_003783725.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Otolemur 
garnettii]
 ref|XP_004369959.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Trichechus 
manatus latirostris]
 ref|XP_006880379.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Elephantulus 
edwardii]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|NP_001277906.1| phosphatase and tensin homolog [Bubalus bubalis]
 ref|XP_002698416.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X3 
[Bos taurus]
 ref|XP_004020061.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Ovis aries]
 ref|XP_005698232.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Capra hircus]
 ref|XP_005906630.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Bos mutus]
 ref|XP_005982308.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pantholops 
hodgsonii]
 ref|XP_010836780.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Bison bison bison]
 tpg|DAA14994.1| TPA: phosphatase and tensin homolog [Bos taurus]
 gb|AFH66808.1| phosphatase and tensin-like protein [Bubalus bubalis]
 gb|ELR48481.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Bos mutus]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006755914.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Myotis davidii]
 gb|ELK36152.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Myotis davidii]
Length=402

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004701143.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Echinops 
telfairi]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_003964007.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Takifugu rubripes]
Length=412

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_007520820.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Erinaceus 
europaeus]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004653255.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Jaculus 
jaculus]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006926039.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pteropus 
alecto]
 gb|ELK00944.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Pteropus alecto]
Length=403

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_001427479.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60081.1| unnamed protein product [Paramecium tetraurelia]
Length=412

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 131/202 (65%), Gaps = 4/202 (2%)
 Frame = +1

Query  343  VKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKS  522
            VK  F+  YI+ +VSK ++R  V G++LD+TYI D L+AM FPAE+  A+YRNP+ +V+ 
Sbjct  88   VKRAFSRDYIKEIVSKSKKRFKVDGFNLDLTYIEDNLIAMGFPAENFEAIYRNPMSEVQK  147

Query  523  VLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSND  702
             L+ RH  +Y V NLC E+ Y    F  +V  +PFDD+  PP  ++ EFC  VHSWL ++
Sbjct  148  FLNTRHPNNYMVINLCSERKYKHESFF-KVAEFPFDDHQAPPFNLIVEFCAMVHSWLMSN  206

Query  703  PKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYV  876
            P N+  +HC AGKGRTGLM+C YL+Y G  +S+++AL  Y   RT N  GV+IPSQ RYV
Sbjct  207  PNNVIAVHCKAGKGRTGLMICCYLLYCGKYVSSQDALAYYGLVRTLNQKGVTIPSQIRYV  266

Query  877  EYWEKVLSFPDRVDRGLPDVNL  942
             Y+   L   D + R    V L
Sbjct  267  HYFSFALK-NDLIKRPFLQVEL  287



>ref|XP_008285018.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Stegastes partitus]
Length=422

 Score =   197 bits (501),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006009982.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Latimeria 
chalumnae]
Length=404

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++    + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRSKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|AAX41578.1| phosphatase and tensin-like [synthetic construct]
Length=403

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   RNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|ERE79056.1| phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Cricetulus griseus]
Length=410

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  9    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  68

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  69   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  128

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  129  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  188

Query  895  L  897
            L
Sbjct  189  L  189



>gb|EFN90161.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN [Harpegnathos 
saltator]
Length=591

 Score =   201 bits (510),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 147/226 (65%), Gaps = 18/226 (8%)
 Frame = +1

Query  370   IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
             I+ LVSK+R+R    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ +H  H
Sbjct  108   IKGLVSKRRKRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESKHKDH  167

Query  550   YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
             YK+YNLC E+SYD   F  RV  Y FDD++ P L+ +K FCEDVH WLS   +N+AV+HC
Sbjct  168   YKIYNLCSERSYDCKKFKQRVATYAFDDHNPPKLEQIKPFCEDVHEWLSLHKENVAVVHC  227

Query  730   MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSF  903
              AGKGRTG+MVC YL+++   ++A +AL  Y  KRT +  GV+IPSQRRYV+Y+  +   
Sbjct  228   KAGKGRTGVMVCCYLLHSKQFVTAMDALNYYGTKRTHDRKGVTIPSQRRYVDYYATL---  284

Query  904   PDRVDRGLPDVNLPKPCARELRRIRLYDTVNV-----DSIFFVVSE  1026
                V  GL      +P    LR+I+L D V +      S+ FV+SE
Sbjct  285   ---VQGGLN----YQPVTLILRKIQL-DPVPIFNGGQGSLRFVISE  322



>ref|XP_010742537.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Larimichthys crocea]
Length=422

 Score =   197 bits (501),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|AAX43209.1| phosphatase and tensin-like [synthetic construct]
Length=404

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   RNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006622016.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Apis dorsata]
Length=586

 Score =   201 bits (510),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>gb|AAX36861.1| phosphatase and tensin-like [synthetic construct]
Length=404

 Score =   196 bits (499),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   RNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_003438317.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoformX2 
[Oreochromis niloticus]
Length=414

 Score =   197 bits (500),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006557294.1| PREDICTED: phosphatase and tensin-like isoform X3 [Apis mellifera]
Length=584

 Score =   201 bits (510),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VSK+RRR    G+DLD+TYI D L+AM FPAE +  +YRN +  V  +L+ RH  H
Sbjct  109  IKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHKDH  168

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SYD   F  RV  Y FDD++ P L  ++ FCEDVH WLS   +N+AV+HC
Sbjct  169  YKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVVHC  228

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+MVC YL++     +A EAL  Y  KRT +  GV+IPSQRRYV+Y+  ++
Sbjct  229  KAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLV  286



>ref|XP_005743479.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Pundamilia nyererei]
Length=409

 Score =   196 bits (499),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  IR +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TALIRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD + F+ +V +YPF+D++ P L+++K FCED+  WLS D +++A 
Sbjct  62   KNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVYYNFL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_010782489.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Notothenia coriiceps]
Length=432

 Score =   197 bits (500),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004086824.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Oryzias latipes]
Length=404

 Score =   196 bits (498),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  6    IKEIVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS +  ++A IHC
Sbjct  66   YKIYNLCAERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENEHHVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRGKFREAQEALDFYGEVRTRDKKGVTIPSQRRYVVYYNYLL  183



>ref|XP_002065075.1| GK15265 [Drosophila willistoni]
 gb|EDW76061.1| GK15265 [Drosophila willistoni]
Length=547

 Score =   199 bits (507),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 128/182 (70%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    G++LD+TYI + ++AM +PA +    +YRN    V   L+  
Sbjct  9    SNVIRNVVSKKRIRYKENGFNLDLTYICENIIAMGYPAPDKFEGLYRNRFEDVFKFLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H  HYK+YNLC+E+ YD   FHGRV  YPF+D++ P +++++ FC+DV SWL  D  N+ 
Sbjct  69   HGQHYKIYNLCLEREYDINKFHGRVAIYPFEDHNPPTIELIQRFCQDVDSWLKEDSLNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYL+Y+GM  +A+EAL  Y +KRT +  GV+IPSQRRYV+Y+  
Sbjct  129  AVHCKAGKGRTGTMICAYLLYSGMQKTADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSN  188

Query  892  VL  897
            ++
Sbjct  189  LI  190



>pdb|1D5R|A Chain A, Crystal Structure Of The Pten Tumor Suppressor
Length=324

 Score =   194 bits (492),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 123/176 (70%), Gaps = 2/176 (1%)
 Frame = +1

Query  379  LVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKV  558
            +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  HYK+
Sbjct  2    IVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKI  61

Query  559  YNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAG  738
            YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A IHC AG
Sbjct  62   YNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAG  121

Query  739  KGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLS  900
            KGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L 
Sbjct  122  KGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLK  177



>ref|XP_003449455.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Oreochromis niloticus]
Length=411

 Score =   196 bits (499),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  7    IRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  66

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F+ +V +YPF+D++ P L+++K FCED+  WLS D +++A IHC
Sbjct  67   YKIYNLCAERHYDASKFNCQVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEQHVAAIHC  126

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  127  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVYYNFLL  184



>ref|XP_003764603.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Sarcophilus harrisii]
Length=589

 Score =   200 bits (509),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = +1

Query  373  RNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHY  552
            R LVS+ +RR    G+DLD+TYITD ++AMSFP+   R++YRNP+ +V   LD +H  HY
Sbjct  266  RKLVSENKRRYRKDGFDLDLTYITDNVIAMSFPSSGSRSLYRNPIKEVARFLDTKHKDHY  325

Query  553  KVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCM  732
            K+YNLC E++Y+P+HFH RVER+P DD++VP +  + +F + V  W+  DPKNI V+HCM
Sbjct  326  KIYNLCSEKTYNPSHFHNRVERFPIDDHNVPTIIDMLKFVDSVFEWMEKDPKNIIVVHCM  385

Query  733  AGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRT-----TNNHGVSIPSQRRYVEYW  885
             GKGRTG M+C +L+ +    +A+E+L+ +  +RT     +   GV  PSQRRY+EY+
Sbjct  386  GGKGRTGTMICIWLIASEHFNTAKESLEYFGKRRTDTASSSKYQGVETPSQRRYIEYF  443



>ref|XP_010750896.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Larimichthys 
crocea]
Length=414

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 126/182 (69%), Gaps = 2/182 (1%)
 Frame = +1

Query  358  TSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMR  537
             + + + +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +
Sbjct  2    AAAFFKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK  61

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D +++A
Sbjct  62   HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQHVA  121

Query  718  VIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  
Sbjct  122  AIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYSF  181

Query  892  VL  897
            +L
Sbjct  182  LL  183



>ref|XP_004565290.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Maylandia zebra]
 ref|XP_005743478.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Pundamilia nyererei]
Length=411

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  7    IRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  66

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F+ +V +YPF+D++ P L+++K FCED+  WLS D +++A IHC
Sbjct  67   YKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQHVAAIHC  126

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  127  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVYYNFLL  184



>ref|XP_007071643.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Chelonia 
mydas]
Length=402

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPA+ +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005292555.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Chrysemys 
picta bellii]
Length=402

 Score =   196 bits (497),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPA+ +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_006121547.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pelodiscus 
sinensis]
Length=435

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 133/209 (64%), Gaps = 2/209 (1%)
 Frame = +1

Query  277  KQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLL  456
            +Q Q  A P +      A   L+  L      +  V K +RR    G+DLD+TYI   ++
Sbjct  6    QQVQGTAIPQNDYRGQQASMALMSQLLYRAREQPPVGKNKRRYQEDGFDLDLTYIYPNII  65

Query  457  AMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDN  636
            AM FPAE +  +YRN +  V   LD +H  HYK+YNLC E+ YD T F+ RV +YPF+D+
Sbjct  66   AMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTTKFNCRVAQYPFEDH  125

Query  637  HVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQ  810
            + P L+++K FCED+  WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL 
Sbjct  126  NPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALD  185

Query  811  VYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  186  FYGEVRTRDKKGVTIPSQRRYVYYYSYLL  214



>ref|XP_002089058.1| GE26252 [Drosophila yakuba]
 gb|EDW88770.1| GE26252 [Drosophila yakuba]
Length=515

 Score =   198 bits (504),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK+R R    GY+LD+TYI D ++AM +PA + +  +YRN L  V   L+  
Sbjct  9    SNVIRNVVSKKRIRYKEKGYNLDLTYIYDNIIAMGYPATDKLEGLYRNRLEDVFKFLEEN  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H+ HYK+YNLC E+SYD   FHGRV   PF+D++ P +++++ FC DV  WL  D  N+ 
Sbjct  69   HAQHYKIYNLCSERSYDVAKFHGRVAVLPFEDHNPPTIELIQRFCMDVDLWLKEDSSNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYLV++G+  SA++AL  Y +KRT +  GV+IPSQRRYV+Y+ K
Sbjct  129  AVHCKAGKGRTGTMICAYLVFSGLQKSADDALAWYDEKRTKDRKGVTIPSQRRYVQYFSK  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>ref|XP_001382218.2| GA19047 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL29329.2| GA19047 [Drosophila pseudoobscura pseudoobscura]
Length=480

 Score =   197 bits (502),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK R R     +DLD+TYI D ++AM +P+ + +  MYRN    V   LD +
Sbjct  9    SNVIRNVVSKNRIRYKGERFDLDLTYIYDNIIAMGYPSPDKLERMYRNCQEDVLKFLDEK  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H  HYK+YNLC+E+ YD   FHGRV  +PF+D++ P ++++++FC+DV SWL  D  N+ 
Sbjct  69   HGDHYKIYNLCLERIYDSNKFHGRVAIFPFEDHNPPTIELIQKFCKDVDSWLKEDVLNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYL+Y+G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+  
Sbjct  129  AVHCKAGKGRTGTMICAYLLYSGLQKSADEALAWYDEKRTKDGKGVTIPSQRRYVQYFSN  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>ref|XP_003964008.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Takifugu rubripes]
Length=435

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|EAW50173.1| phosphatase and tensin homolog (mutated in multiple advanced 
cancers 1), isoform CRA_b [Homo sapiens]
Length=434

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008268354.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Oryctolagus cuniculus]
Length=431

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  30   TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  89

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  90   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  149

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  150  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  209

Query  895  L  897
            L
Sbjct  210  L  210



>ref|XP_005474270.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X4 [Oreochromis niloticus]
Length=441

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004077141.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Oryzias latipes]
Length=416

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVCYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004551620.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Maylandia zebra]
Length=441

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004086825.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Oryzias latipes]
Length=417

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  6    IKEIVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD T F+ RV +YPF+D++ P L+++K FCED+  WLS +  ++A IHC
Sbjct  66   YKIYNLCAERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENEHHVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRGKFREAQEALDFYGEVRTRDKKGVTIPSQRRYVVYYNYLL  183



>ref|XP_010742529.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Larimichthys crocea]
Length=445

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|ADM26757.1| phosphatase and tensin-like protein [Homo sapiens]
Length=403

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y   +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYXSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004565289.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Maylandia zebra]
Length=437

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  7    IRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  66

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F+ +V +YPF+D++ P L+++K FCED+  WLS D +++A IHC
Sbjct  67   YKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQHVAAIHC  126

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  127  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVYYNFLL  184



>ref|XP_008285017.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Stegastes partitus]
Length=445

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008320667.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Cynoglossus semilaevis]
Length=422

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++    M A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRRKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005743477.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Pundamilia nyererei]
Length=437

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  7    IRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  66

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F+ +V +YPF+D++ P L+++K FCED+  WLS D +++A IHC
Sbjct  67   YKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQHVAAIHC  126

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  127  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVYYNFLL  184



>ref|XP_004551621.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Maylandia zebra]
Length=437

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_001455854.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK88457.1| unnamed protein product [Paramecium tetraurelia]
Length=368

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = +1

Query  346  KFLFTSCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSV  525
            K LFT+  I+ LVSKQ+ R +  G+DLD++YIT++++AM +PA    A+YRN +  V+  
Sbjct  48   KGLFTNP-IKQLVSKQKNRFVQDGFDLDLSYITEQIIAMGYPANDYEAIYRNSMEDVQKF  106

Query  526  LDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDP  705
             + RH  HY++ NLC E+ Y+  +F G V  YPF+D+  P   M+ E C ++H+++  D 
Sbjct  107  FNQRHKDHYRIINLCSERKYNHAYFDGNVSEYPFEDHQAPQFSMIFELCNEIHNFICQDK  166

Query  706  KNIAVIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVE  879
            +N+  IHC AGKGRTG+M+C Y++++GM  ++ EA++ Y   RT N  GV+IPSQ RY+ 
Sbjct  167  QNVVAIHCKAGKGRTGVMICCYMLFSGMFNNSYEAMRFYGIMRTKNKKGVTIPSQIRYIL  226

Query  880  YWEKVLSF  903
            Y+EK LSF
Sbjct  227  YFEKALSF  234



>ref|XP_010868420.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Esox lucius]
Length=415

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV ++PF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KDHYKIYNLCAERHYDAAKFNCRVAQFPFEDHNPPQLELIKPFCEDLDQWLSKDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_001993525.1| GH13854 [Drosophila grimshawi]
 gb|EDV99450.1| GH13854 [Drosophila grimshawi]
Length=475

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/250 (42%), Positives = 157/250 (63%), Gaps = 23/250 (9%)
 Frame = +1

Query  370   IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMRHSG  546
             IRN+VSK+R R    G++LD++YI   ++AM +PA + +  +YRN L  V   L+  H G
Sbjct  12    IRNVVSKKRIRYKEKGFNLDLSYICPNIIAMGYPAPDKLEGIYRNRLDDVYKFLEENHRG  71

Query  547   HYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIH  726
              YK+YNLC+E+SYD   FHGRV  YPF+D++ P +Q+++ FC DV +WL+ DP N+  +H
Sbjct  72    RYKIYNLCLERSYDTNKFHGRVAIYPFEDHNPPTIQLMQRFCHDVGTWLNADPLNVVAVH  131

Query  727   CMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLS  900
             C AGKGRTG M+CAYLV++ +  +A+EAL  Y +KRT +  GV+IPSQRRYV+Y+  +  
Sbjct  132   CKAGKGRTGTMICAYLVHSRLMRTADEALAYYDEKRTIDKKGVTIPSQRRYVQYYSNL--  189

Query  901   FPDRVDRGLPDVNLPKPCARELRRIRLYDTV---NVDSIFFVVSELQNIPGERYCP----  1059
                     +PDV   K  +  +  IR  +T    N+ ++   +S++Q+   E+  P    
Sbjct  190   --------IPDVQY-KVISLYVCEIRFTETNILHNLGTVQCSISDMQDSATEKVKPHRLK  240

Query  1060  --PVEVSKSC  1083
                ++  KSC
Sbjct  241   TWTIDFQKSC  250



>ref|XP_010782488.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Notothenia coriiceps]
Length=455

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|ABM21566.1| PTEN transcript variant 4 [Aedes aegypti]
Length=299

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IRNLVSK+R R    G+DLD+TYI DR++AM +PAEHM ++YRN +  V+ +L+  H+G 
Sbjct  14   IRNLVSKRRIRYTQDGFDLDLTYINDRIIAMGYPAEHMESIYRNKIEDVQKMLEKNHAGC  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SY+   F      YPF D++ P ++++  FC DV   L  D KN+  +HC
Sbjct  74   YKIYNLCSERSYNHKRF-PYYSGYPFKDHNPPDIELITSFCRDVDEHLRADSKNVVAVHC  132

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+Y+    +A EAL  YA +RT+++ GV+IPSQRRYVEY+  +L
Sbjct  133  KAGKGRTGTMICCYLLYSRQFNTAAEALHYYAQRRTSDSKGVTIPSQRRYVEYYASLL  190



>ref|XP_003723944.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Strongylocentrotus 
purpuratus]
Length=417

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+++VSK + RL  G +DLD+TYI   ++AM FPAE +  MYRN +  V   L+  H  H
Sbjct  6    IKSIVSKNKIRLRDGNFDLDLTYICPNIIAMGFPAESLERMYRNDMEHVVKFLNSHHQDH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YKVYNLC E++YD + F  RV  YPFDD++ P +++++ FCEDV  WL+ D  N+A IHC
Sbjct  66   YKVYNLCSERNYDTSRFDHRVAHYPFDDHNPPRIELIRPFCEDVMQWLAEDKDNVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CA L++ G  ++A E+++ Y   RTT+  GV+IPSQRRYV+Y+ +++
Sbjct  126  KAGKGRTGVMICALLLHQGRCLTAAESMEYYGKIRTTDGKGVTIPSQRRYVQYYGELV  183



>gb|EHH64853.1| hypothetical protein EGM_18176, partial [Macaca fascicularis]
Length=400

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ Y+   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYNTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|KHJ40971.1| dual-specificity protein phosphatase PTEN family protein [Trichuris 
suis]
Length=369

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IR LVSK +RR   GG+DLD++YI   ++AM FPAE +  ++RN +  V   ++ +H  H
Sbjct  5    IRCLVSKNKRRYQEGGFDLDLSYIRPNIIAMGFPAEKLEGVFRNHIDDVVRFMETKHKDH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ Y+ + F+ RV  YPF D+  P L+ +  FCEDVH WLS D +N+  IHC
Sbjct  65   YKIYNLCNERCYNASRFNNRVAYYPFVDHQPPCLENMLPFCEDVHQWLSQDSRNVVAIHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL+Y G    A+EAL+ Y  +RT + +GV+IPSQRRYV Y+  +L
Sbjct  125  KAGKGRTGVMICAYLLYVGEFTCADEALEYYGQQRTVDMNGVTIPSQRRYVGYFSHLL  182



>ref|XP_003224419.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Anolis carolinensis]
Length=404

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDRWLSEDGNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGRFHKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005804949.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Xiphophorus maculatus]
Length=398

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A++AL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>emb|CDQ60841.1| unnamed protein product [Oncorhynchus mykiss]
Length=465

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN + +V   LD +H  H
Sbjct  26   IKLMVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSKHKNH  85

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A IHC
Sbjct  86   YKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHC  145

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  146  KAGKGRTGVMICAYLLHRGKFQDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHLL  203



>ref|XP_005727536.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Pundamilia nyererei]
Length=464

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005810521.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Xiphophorus 
maculatus]
Length=412

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  6    IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F  RV +YPF+D++ P L+++K FCED+  WLS D  ++A IHC
Sbjct  66   YKIYNLCAERHYDTSKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEHHVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYNFLL  183



>ref|XP_008436305.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Poecilia 
reticulata]
 ref|XP_008436306.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Poecilia 
reticulata]
Length=412

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  6    IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F  RV +YPF+D++ P L+++K FCED+  WLS D  ++A IHC
Sbjct  66   YKIYNLCAERHYDTSKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEHHVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYNFLL  183



>ref|XP_007541048.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Poecilia 
formosa]
Length=412

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  6    IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH  65

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD + F  RV +YPF+D++ P L+++K FCED+  WLS D  ++A IHC
Sbjct  66   YKIYNLCAERHYDTSKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEHHVAAIHC  125

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  126  KAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYNFLL  183



>gb|ADM26748.1| phosphatase and tensin-like protein [Homo sapiens]
Length=403

 Score =   194 bits (494),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+  V +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCTVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004551619.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Maylandia zebra]
Length=464

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_004077142.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Oryzias latipes]
Length=437

 Score =   195 bits (496),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVCYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005914180.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Haplochromis burtoni]
Length=464

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_005474269.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Oreochromis niloticus]
 ref|XP_006783824.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Neolamprologus 
brichardi]
Length=464

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            S  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    SSIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008320666.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Cynoglossus semilaevis]
Length=445

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++    M A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRRKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008427604.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Poecilia reticulata]
Length=422

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A++AL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_002014403.1| GL19174 [Drosophila persimilis]
 gb|EDW28399.1| GL19174 [Drosophila persimilis]
Length=546

 Score =   197 bits (502),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPA-EHMRAMYRNPLWQVKSVLDMR  537
            S  IRN+VSK R R     +DLD+TYI D ++AM +P+ + +  MYRN    V   LD +
Sbjct  9    SNVIRNVVSKNRIRYKGERFDLDLTYIYDNIIAMGYPSPDKLERMYRNCQEDVLKFLDEK  68

Query  538  HSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIA  717
            H  HYK+YNLC+E+ YD   FHGRV  +PF+D++ P ++++++FC+DV SWL  D  N+ 
Sbjct  69   HGDHYKIYNLCLERIYDSNKFHGRVAIFPFEDHNPPTIELIQKFCKDVDSWLKEDVLNVV  128

Query  718  VIHCMAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEK  891
             +HC AGKGRTG M+CAYL+Y+G+  SA+EAL  Y +KRT +  GV+IPSQRRYV+Y+  
Sbjct  129  AVHCKAGKGRTGTMICAYLLYSGLQKSADEALAWYDEKRTKDGKGVTIPSQRRYVQYFSN  188

Query  892  VL  897
            ++
Sbjct  189  LV  190



>ref|XP_007244646.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Astyanax mexicanus]
Length=449

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   RNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++    M A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>tpg|DAA64597.1| TPA_exp: mitochondrial PTENalpha [Sus scrofa]
Length=576

 Score =   197 bits (502),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +1

Query  340  LVKFLFT------SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRN  501
            L  F F+      +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN
Sbjct  162  LSSFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRN  221

Query  502  PLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDV  681
             +  V   LD +H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+
Sbjct  222  NIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDL  281

Query  682  HSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSI  855
              WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+I
Sbjct  282  DQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI  341

Query  856  PSQRRYVEYWEKVL  897
            PSQRRYV Y+  +L
Sbjct  342  PSQRRYVYYYSYLL  355



>ref|XP_007545364.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3,4,5-trisphosphate 
3-phosphatase and dual-specificity protein phosphatase 
PTEN-like [Poecilia formosa]
Length=426

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A++AL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>tpg|DAA64601.1| TPA_exp: mitochondrial PTENalpha [Homo sapiens]
Length=576

 Score =   197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +1

Query  340  LVKFLFT------SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRN  501
            L  F F+      +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN
Sbjct  162  LSSFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRN  221

Query  502  PLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDV  681
             +  V   LD +H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+
Sbjct  222  NIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDL  281

Query  682  HSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSI  855
              WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+I
Sbjct  282  DQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI  341

Query  856  PSQRRYVEYWEKVL  897
            PSQRRYV Y+  +L
Sbjct  342  PSQRRYVYYYSYLL  355



>ref|XP_010868419.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Esox lucius]
Length=438

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV ++PF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KDHYKIYNLCAERHYDAAKFNCRVAQFPFEDHNPPQLELIKPFCEDLDQWLSKDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>tpg|DAA64600.1| TPA_exp: mitochondrial PTENalpha [Bos taurus]
Length=573

 Score =   197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +1

Query  340  LVKFLFT------SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRN  501
            L  F F+      +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN
Sbjct  159  LSSFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRN  218

Query  502  PLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDV  681
             +  V   LD +H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+
Sbjct  219  NIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDL  278

Query  682  HSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSI  855
              WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+I
Sbjct  279  DQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI  338

Query  856  PSQRRYVEYWEKVL  897
            PSQRRYV Y+  +L
Sbjct  339  PSQRRYVYYYSYLL  352



>ref|NP_001288689.1| phosphatase and tensin homolog [Pan paniscus]
 tpg|DAA64596.1| TPA_exp: mitochondrial PTENalpha [Pan paniscus]
Length=577

 Score =   197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +1

Query  340  LVKFLFT------SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRN  501
            L  F F+      +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN
Sbjct  163  LSSFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRN  222

Query  502  PLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDV  681
             +  V   LD +H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+
Sbjct  223  NIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDL  282

Query  682  HSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSI  855
              WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+I
Sbjct  283  DQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI  342

Query  856  PSQRRYVEYWEKVL  897
            PSQRRYV Y+  +L
Sbjct  343  PSQRRYVYYYSYLL  356



>tpg|DAA64599.1| TPA_exp: mitochondrial PTENalpha [Orcinus orca]
Length=573

 Score =   197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +1

Query  340  LVKFLFT------SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRN  501
            L  F F+      +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN
Sbjct  159  LSSFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRN  218

Query  502  PLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDV  681
             +  V   LD +H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+
Sbjct  219  NIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDL  278

Query  682  HSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSI  855
              WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+I
Sbjct  279  DQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI  338

Query  856  PSQRRYVEYWEKVL  897
            PSQRRYV Y+  +L
Sbjct  339  PSQRRYVYYYSYLL  352



>gb|ABM21563.1| PTEN transcript variant 1 [Aedes aegypti]
Length=339

 Score =   192 bits (487),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            IRNLVSK+R R    G+DLD+TYI DR++AM +PAEHM ++YRN +  V+ +L+  H+G 
Sbjct  14   IRNLVSKRRIRYTQDGFDLDLTYINDRIIAMGYPAEHMESIYRNKIEDVQKMLEKNHAGC  73

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+SY+   F      YPF D++ P ++++  FC DV   L  D KN+  +HC
Sbjct  74   YKIYNLCSERSYNHKRF-PYYSGYPFKDHNPPDIELITSFCRDVDEHLRADSKNVVAVHC  132

Query  730  MAGKGRTGLMVCAYLVYTGM--SAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG M+C YL+Y+    +A EAL  YA +RT+++ GV+IPSQRRYVEY+  +L
Sbjct  133  KAGKGRTGTMICCYLLYSRQFNTAAEALHYYAQRRTSDSKGVTIPSQRRYVEYYASLL  190



>tpg|DAA64595.1| TPA_exp: mitochondrial PTENalpha [Mus musculus]
Length=572

 Score =   197 bits (501),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +1

Query  340  LVKFLFT------SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRN  501
            L  F F+      +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN
Sbjct  158  LSSFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRN  217

Query  502  PLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDV  681
             +  V   LD +H  HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+
Sbjct  218  NIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDL  277

Query  682  HSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSI  855
              WLS D  ++A IHC AGKGRTG+M+CAYL++ G  + A+EAL  Y + RT +  GV+I
Sbjct  278  DQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI  337

Query  856  PSQRRYVEYWEKVL  897
            PSQRRYV Y+  +L
Sbjct  338  PSQRRYVYYYSYLL  351



>ref|XP_005804948.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Xiphophorus maculatus]
Length=441

 Score =   194 bits (493),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A++AL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>gb|AAH93110.1| Ptenb protein, partial [Danio rerio]
Length=289

 Score =   190 bits (482),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +1

Query  370  IRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGH  549
            I+  VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H  H
Sbjct  5    IKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKDH  64

Query  550  YKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHC  729
            YK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED   WLS +  ++A IHC
Sbjct  65   YKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDSDKWLSENDNHVAAIHC  124

Query  730  MAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKVL  897
             AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +L
Sbjct  125  KAGKGRTGVMICAYLLHRGKFKKAQEALDFYDEVRTRDKKGVTIPSQRRYVYYYSYLL  182



>ref|XP_007244645.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Astyanax mexicanus]
Length=472

 Score =   195 bits (495),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   RNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++    M A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|XP_008427603.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Poecilia reticulata]
Length=445

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+ +VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS D  ++A 
Sbjct  62   KNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A++AL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNYL  181

Query  895  L  897
            L
Sbjct  182  L  182



>ref|NP_001001822.1| phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Danio rerio]
 gb|AAR04347.1| phosphatase and tensin-like protein B short splice variant [Danio 
rerio]
 gb|AAI07963.1| Phosphatase and tensin homolog B (mutated in multiple advanced 
cancers 1) [Danio rerio]
Length=399

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  361  SCYIRNLVSKQRRRLLVGGYDLDMTYITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRH  540
            +  I+  VS+ +RR    G+DLD+TYI   ++AM FPAE +  +YRN +  V   LD +H
Sbjct  2    AAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKH  61

Query  541  SGHYKVYNLCIEQSYDPTHFHGRVERYPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAV  720
              HYK+YNLC E+ YD   F+ RV +YPF+D++ P L+++K FCED+  WLS +  ++A 
Sbjct  62   KDHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSENDNHVAA  121

Query  721  IHCMAGKGRTGLMVCAYLVYTG--MSAEEALQVYADKRTTNNHGVSIPSQRRYVEYWEKV  894
            IHC AGKGRTG+M+CAYL++ G    A+EAL  Y + RT +  GV+IPSQRRYV Y+  +
Sbjct  122  IHCKAGKGRTGVMICAYLLHRGKFKKAQEALDFYDEVRTRDKKGVTIPSQRRYVYYYSYL  181

Query  895  L  897
            L
Sbjct  182  L  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791649556738