BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32376_g1_i1 len=214 path=[1:0-213]

Length=214
                                                                      Score     E

gb|KCW86671.1|  hypothetical protein EUGRSUZ_B032972                    146   7e-41   
gb|AGZ20104.1|  copper methylamine oxidase-like protein                 151   1e-40   
emb|CBI14968.3|  unnamed protein product                                150   9e-40   
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    148   1e-39   
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    147   4e-39   
ref|XP_008351782.1|  PREDICTED: peroxisomal primary amine oxidase...    144   6e-39   
ref|XP_008782506.1|  PREDICTED: peroxisomal primary amine oxidase       144   7e-39   
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  146   7e-39   
gb|KDP26650.1|  hypothetical protein JCGZ_17808                         144   1e-38   
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          144   4e-38   
gb|AIS23647.1|  amine oxidase 4                                         144   4e-38   
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             144   4e-38   
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             144   5e-38   
gb|KHN00390.1|  Copper methylamine oxidase                              143   6e-38   
ref|XP_010100391.1|  Copper methylamine oxidase                         144   7e-38   
emb|CAN62304.1|  hypothetical protein VITISV_023689                     143   7e-38   Vitis vinifera
gb|AIS23648.1|  amine oxidase 5                                         143   7e-38   
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             143   7e-38   
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             143   7e-38   
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       143   7e-38   Vitis vinifera
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             143   8e-38   
ref|XP_002527922.1|  copper amine oxidase, putative                     143   8e-38   Ricinus communis
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             143   8e-38   
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       142   8e-38   
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             143   9e-38   
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    143   1e-37   
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    143   1e-37   
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             142   1e-37   
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             142   1e-37   
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             142   1e-37   
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    142   1e-37   
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    142   2e-37   
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             142   2e-37   
emb|CDP12746.1|  unnamed protein product                                142   2e-37   
gb|AIS23644.1|  amine oxidase 1                                         142   2e-37   
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             142   2e-37   
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             142   2e-37   
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     143   2e-37   
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    142   2e-37   
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             142   2e-37   
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             141   2e-37   
emb|CAN76391.1|  hypothetical protein VITISV_023592                     142   3e-37   Vitis vinifera
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             142   3e-37   
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         141   3e-37   
ref|XP_003613133.1|  Copper amine oxidase                               141   3e-37   
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    141   3e-37   
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             141   3e-37   Populus trichocarpa [western balsam poplar]
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             141   3e-37   
ref|XP_002314600.1|  copper amine oxidase family protein                141   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             141   3e-37   
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    141   3e-37   
ref|XP_007044780.1|  Copper amine oxidase family protein isoform 4      140   3e-37   
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  141   3e-37   
ref|XP_002511334.1|  copper amine oxidase, putative                     142   3e-37   Ricinus communis
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             141   4e-37   Vitis vinifera
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    141   4e-37   
ref|XP_006584632.1|  PREDICTED: peroxisomal copper-containing ami...    140   4e-37   
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      140   6e-37   
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   140   6e-37   
ref|XP_006411506.1|  hypothetical protein EUTSA_v100163160mg            137   6e-37   
gb|KHG02854.1|  Copper methylamine oxidase                              140   7e-37   
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    140   7e-37   
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             140   8e-37   
ref|XP_010102489.1|  Putative primary amine oxidase 2                   140   8e-37   
ref|XP_004309984.1|  PREDICTED: copper methylamine oxidase-like         140   9e-37   
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             140   9e-37   
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      140   1e-36   
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   140   1e-36   
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             140   1e-36   
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    140   1e-36   
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    139   1e-36   
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      140   1e-36   
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   139   1e-36   
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             139   2e-36   
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       139   2e-36   
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             139   2e-36   
gb|KEH20164.1|  copper amine oxidase, enzyme domain protein             138   2e-36   
gb|KHN13432.1|  Copper methylamine oxidase                              139   2e-36   
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       139   2e-36   
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   139   2e-36   
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    139   2e-36   
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             138   3e-36   
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         139   3e-36   
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   139   3e-36   
ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             139   3e-36   
gb|KEH20162.1|  copper amine oxidase, enzyme domain protein             137   3e-36   
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    139   3e-36   
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        138   3e-36   
gb|KEH20161.1|  copper amine oxidase, enzyme domain protein             138   3e-36   
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             139   3e-36   
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         139   3e-36   
gb|ACW82416.1|  putative copper amine oxidase                           137   3e-36   Olea europaea
gb|KEH20160.1|  copper amine oxidase, enzyme domain protein             137   3e-36   
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             139   3e-36   
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    139   3e-36   
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             139   4e-36   
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    138   4e-36   
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             138   5e-36   
dbj|BAD95322.1|  putative copper amine oxidase                          136   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHG07734.1|  Primary amine oxidase                                   138   6e-36   
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         138   6e-36   
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      137   7e-36   
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             137   9e-36   
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      137   9e-36   
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  137   1e-35   
gb|AES71447.2|  copper amine oxidase, enzyme domain protein             135   1e-35   
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             137   1e-35   
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             137   1e-35   
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             137   1e-35   
ref|XP_004301007.1|  PREDICTED: copper methylamine oxidase-like         137   1e-35   
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             136   1e-35   
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             137   1e-35   
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             137   1e-35   
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             137   2e-35   
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             137   2e-35   
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    137   2e-35   
ref|NP_181777.2|  copper amine oxidase family protein                   137   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47975.1|  BnaA04g24530D                                          137   2e-35   
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             137   2e-35   
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                137   2e-35   
gb|KHG02564.1|  Primary amine oxidase                                   136   2e-35   
emb|CDY14839.1|  BnaC04g48360D                                          137   2e-35   
dbj|BAF49520.1|  N-methylputrescine oxidase                             136   2e-35   Nicotiana tabacum [American tobacco]
emb|CDY22564.1|  BnaC03g23740D                                          137   2e-35   
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    136   2e-35   
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             136   2e-35   
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             136   2e-35   
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             136   2e-35   
emb|CDY35376.1|  BnaA03g19840D                                          137   2e-35   
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             136   3e-35   
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             136   3e-35   
ref|XP_003601196.1|  Primary amine oxidase                              135   3e-35   
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             136   3e-35   
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             135   3e-35   
ref|XP_003601195.1|  Primary amine oxidase                              136   3e-35   
tpg|DAA37329.1|  TPA: hypothetical protein ZEAMMB73_085776              133   4e-35   
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         135   4e-35   
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             135   5e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             135   5e-35   
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    135   6e-35   
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    134   9e-35   
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    134   1e-34   
gb|EPS66989.1|  hypothetical protein M569_07787                         132   1e-34   
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    133   2e-34   
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    133   2e-34   
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    133   3e-34   
dbj|BAJ87935.1|  predicted protein                                      131   3e-34   
gb|EMS63127.1|  Primary amine oxidase                                   132   5e-34   
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          132   6e-34   Sorghum bicolor [broomcorn]
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    132   6e-34   
ref|XP_004289862.1|  PREDICTED: copper methylamine oxidase-like         132   6e-34   
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             133   6e-34   
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             132   6e-34   
ref|NP_001053078.1|  Os04g0476100                                       130   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             132   7e-34   
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             132   1e-33   
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             131   1e-33   
emb|CAE05498.2|  OSJNBa0022H21.18                                       131   1e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67316.1|  OSIGBa0106G07.12                                       130   2e-33   Oryza sativa [red rice]
gb|EAY94528.1|  hypothetical protein OsI_16305                          131   2e-33   Oryza sativa Indica Group [Indian rice]
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          131   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             130   2e-33   
ref|XP_006600619.1|  PREDICTED: copper amine oxidase 1-like isofo...    129   4e-33   
ref|XP_006600618.1|  PREDICTED: copper amine oxidase 1-like isofo...    129   4e-33   
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    129   7e-33   
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    129   8e-33   
gb|KHN18421.1|  Copper methylamine oxidase                              129   9e-33   
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550          128   1e-32   Sorghum bicolor [broomcorn]
emb|CDP13212.1|  unnamed protein product                                126   1e-32   
gb|EMS61925.1|  Copper methylamine oxidase                              128   2e-32   
gb|EEC73513.1|  hypothetical protein OsI_07883                          126   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_001759255.1|  predicted protein                                  126   6e-32   
gb|EEE57286.1|  hypothetical protein OsJ_07344                          125   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMT09520.1|  Copper methylamine oxidase                              125   2e-31   
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          123   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001753509.1|  predicted protein                                  122   1e-30   
emb|CAE02362.2|  OSJNBb0016B03.15                                       123   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76708.1|  hypothetical protein OsI_14715                          121   4e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_001757203.1|  predicted protein                                  120   1e-29   
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642             119   5e-29   
gb|ABR16250.1|  unknown                                                 118   6e-29   Picea sitchensis
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358             118   6e-29   
gb|AFK35388.1|  unknown                                                 103   1e-25   
gb|AAD23730.1|  putative copper amine oxidase                           108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001774529.1|  predicted protein                                  108   2e-25   
ref|XP_002985875.1|  hypothetical protein SELMODRAFT_123165             103   1e-23   
ref|XP_002984811.1|  hypothetical protein SELMODRAFT_121227             102   2e-23   
ref|WP_034266611.1|  tyramine oxidase                                 92.4    7e-20   
ref|WP_027416719.1|  tyramine oxidase                                 91.3    2e-19   
ref|WP_003350826.1|  tyramine oxidase                                 90.5    4e-19   
ref|WP_006456034.1|  tyramine oxidase                                 90.5    4e-19   
ref|WP_016205391.1|  tyramine oxidase                                 89.7    7e-19   
ref|WP_036002001.1|  tyramine oxidase                                 87.8    3e-18   
ref|WP_015186652.1|  Copper amine oxidase domain-containing protein   86.7    9e-18   
ref|WP_017299862.1|  tyramine oxidase                                 86.3    1e-17   
ref|WP_027555623.1|  tyramine oxidase                                 86.3    1e-17   
ref|WP_008314860.1|  Cu2+-containing amine oxidase                    85.9    2e-17   
ref|WP_035986372.1|  tyramine oxidase                                 85.5    2e-17   
ref|WP_028147545.1|  tyramine oxidase                                 85.5    2e-17   
ref|WP_038942896.1|  tyramine oxidase                                 85.5    3e-17   
ref|WP_038975474.1|  tyramine oxidase                                 85.1    3e-17   
ref|WP_036725089.1|  tyramine oxidase                                 84.7    4e-17   
ref|WP_006520181.1|  Cu2+-containing amine oxidase                    84.3    6e-17   
ref|WP_024341794.1|  tyramine oxidase                                 84.0    9e-17   
gb|AIQ12487.1|  tyramine oxidase                                      83.6    1e-16   
ref|WP_028158892.1|  tyramine oxidase                                 83.6    1e-16   
ref|WP_014495317.1|  tyramine oxidase                                 83.6    1e-16   
emb|CEG30995.1|  Primary amine oxidase precursor                      83.2    1e-16   
gb|AHY48354.1|  Cu2+-containing amine oxidase                         83.2    1e-16   
ref|WP_034315126.1|  tyramine oxidase                                 83.2    1e-16   
ref|WP_039148680.1|  tyramine oxidase                                 83.2    1e-16   
ref|WP_038957242.1|  tyramine oxidase                                 83.2    1e-16   
ref|WP_028065493.1|  tyramine oxidase                                 82.8    2e-16   
ref|WP_038932845.1|  tyramine oxidase                                 82.8    2e-16   
ref|WP_015686158.1|  tyramine oxidase                                 82.4    3e-16   
ref|WP_035666101.1|  tyramine oxidase                                 82.4    3e-16   
ref|WP_036028043.1|  tyramine oxidase                                 82.0    3e-16   
ref|WP_036039528.1|  tyramine oxidase                                 82.0    4e-16   
ref|WP_035999308.1|  tyramine oxidase                                 82.0    4e-16   
ref|WP_028144656.1|  MULTISPECIES: tyramine oxidase                   81.3    6e-16   
ref|WP_009633550.1|  Cu2+-containing amine oxidase                    81.3    6e-16   
ref|WP_035676607.1|  tyramine oxidase                                 81.3    7e-16   
ref|WP_018320456.1|  tyramine oxidase                                 81.3    8e-16   
ref|WP_038946771.1|  tyramine oxidase                                 80.9    9e-16   
ref|WP_038970312.1|  tyramine oxidase                                 80.9    9e-16   
ref|WP_018330660.1|  hypothetical protein                             80.1    2e-15   
ref|WP_028921142.1|  tyramine oxidase                                 79.7    2e-15   
ref|WP_036480875.1|  tyramine oxidase                                 79.7    2e-15   
ref|WP_028390396.1|  tyramine oxidase                                 79.7    2e-15   
ref|WP_015124381.1|  Cu2+-containing amine oxidase                    79.7    3e-15   
ref|WP_015595580.1|  tyramine oxidase                                 79.3    3e-15   
ref|WP_036584415.1|  tyramine oxidase                                 79.3    3e-15   
gb|EJZ30335.1|  tyramine oxidase                                      79.3    3e-15   
ref|WP_012627324.1|  tyramine oxidase                                 79.0    4e-15   
ref|WP_007920030.1|  tyramine oxidase                                 79.0    4e-15   
ref|WP_037040542.1|  tyramine oxidase                                 78.6    6e-15   
ref|WP_038310657.1|  tyramine oxidase                                 78.2    9e-15   
ref|WP_028930454.1|  tyramine oxidase                                 78.2    9e-15   
ref|WP_034299883.1|  tyramine oxidase                                 75.5    1e-14   
ref|XP_008076270.1|  Amine oxidase catalytic                          77.8    1e-14   
ref|WP_013678400.1|  tyramine oxidase                                 77.4    2e-14   
ref|WP_025696771.1|  tyramine oxidase                                 76.6    2e-14   
ref|WP_037709039.1|  tyramine oxidase                                 77.4    2e-14   
ref|WP_036534611.1|  tyramine oxidase                                 77.0    2e-14   
ref|WP_039728302.1|  tyramine oxidase                                 77.0    2e-14   
ref|WP_006611730.1|  tyramine oxidase                                 77.0    2e-14   
gb|ETX01517.1|  hypothetical protein ETSY2_37110                      75.5    2e-14   
emb|CCA68641.1|  related to peroxisomal amine oxidase (copper-con...  76.6    3e-14   
ref|WP_035952394.1|  tyramine oxidase                                 76.6    3e-14   
ref|WP_037709969.1|  tyramine oxidase                                 76.6    3e-14   
ref|WP_028063099.1|  tyramine oxidase                                 76.6    3e-14   
ref|WP_012041412.1|  tyramine oxidase                                 76.6    3e-14   
gb|EFC82890.1|  Primary-amine oxidase                                 76.6    3e-14   Frankia sp. EUN1f
ref|WP_037408872.1|  tyramine oxidase                                 76.6    3e-14   
ref|WP_037411516.1|  tyramine oxidase                                 76.3    4e-14   
ref|WP_035658970.1|  tyramine oxidase                                 75.9    5e-14   
emb|CCE02694.1|  Histamine oxidase (Copper amine oxidase)             75.9    5e-14   
dbj|GAA97553.1|  hypothetical protein E5Q_04231                       75.9    6e-14   
ref|WP_018395580.1|  hypothetical protein                             75.5    6e-14   
ref|WP_033288996.1|  tyramine oxidase                                 75.5    7e-14   
ref|WP_015307543.1|  Cu2+-containing amine oxidase                    75.5    7e-14   
ref|WP_034515887.1|  tyramine oxidase                                 75.5    8e-14   
ref|WP_015917988.1|  tyramine oxidase                                 75.5    8e-14   
ref|XP_007697185.1|  hypothetical protein COCSADRAFT_290377           75.5    8e-14   
ref|XP_007589495.1|  putative copper amine oxidase protein            75.5    8e-14   
dbj|GAJ96808.1|  putative copper-containing amine oxidase             75.5    8e-14   
ref|WP_007702131.1|  tyramine oxidase                                 75.5    8e-14   
ref|XP_007297233.1|  copper amine oxidase                             75.1    8e-14   
ref|WP_036531589.1|  tyramine oxidase                                 75.1    1e-13   
ref|WP_037198339.1|  tyramine oxidase                                 75.1    1e-13   
ref|WP_038095061.1|  tyramine oxidase                                 75.1    1e-13   
ref|WP_030340720.1|  tyramine oxidase                                 75.1    1e-13   
gb|KGO47066.1|  Copper amine oxidase, N2-terminal                     75.1    1e-13   
gb|KGO54704.1|  Copper amine oxidase, N2-terminal                     75.1    1e-13   
gb|KGO38825.1|  Copper amine oxidase, N2-terminal                     75.1    1e-13   
ref|WP_027094208.1|  tyramine oxidase                                 74.7    1e-13   
ref|WP_034284434.1|  tyramine oxidase                                 74.7    1e-13   
ref|WP_015845121.1|  tyramine oxidase                                 74.7    1e-13   
ref|WP_034285194.1|  tyramine oxidase                                 74.7    1e-13   
ref|WP_034290510.1|  tyramine oxidase                                 74.7    1e-13   
ref|WP_018393282.1|  hypothetical protein                             74.7    1e-13   
ref|WP_008317043.1|  Cu2+-containing amine oxidase                    74.7    1e-13   
ref|WP_012947896.1|  tyramine oxidase                                 74.7    1e-13   
ref|WP_007513287.1|  tyramine oxidase                                 74.7    2e-13   
ref|WP_011777249.1|  tyramine oxidase                                 74.7    2e-13   
ref|XP_006964275.1|  copper amine oxidase                             74.7    2e-13   
ref|WP_012873420.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_027683972.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_018242619.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_018516420.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_003928563.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_003802987.1|  copper-containing amine oxidase                  72.0    2e-13   
ref|WP_035640937.1|  tyramine oxidase                                 74.3    2e-13   
emb|CCD93969.1|  Histamine oxidase (Copper amine oxidase)             74.3    2e-13   
gb|EHS52805.1|  Copper amine oxidase domain-containing protein        73.9    2e-13   
ref|WP_013199664.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_014740127.1|  tyramine oxidase                                 74.3    2e-13   
ref|XP_001396211.1|  copper amine oxidase 1                           74.3    2e-13   
dbj|GAA89641.1|  amine oxidase                                        74.3    2e-13   
ref|WP_011559399.1|  MULTISPECIES: tyramine oxidase                   74.3    2e-13   
ref|WP_014677218.1|  tyramine oxidase                                 74.3    2e-13   
ref|WP_015493445.1|  tyramine oxidase                                 73.9    2e-13   
ref|WP_037109771.1|  tyramine oxidase                                 73.9    2e-13   
ref|WP_027223028.1|  tyramine oxidase                                 73.9    2e-13   
ref|WP_003797568.1|  copper-containing amine oxidase                  70.9    3e-13   
ref|XP_007715371.1|  hypothetical protein COCCADRAFT_104234           73.9    3e-13   
ref|WP_037095077.1|  tyramine oxidase                                 73.9    3e-13   
gb|EUN23448.1|  hypothetical protein COCVIDRAFT_29714                 73.9    3e-13   
ref|WP_035740546.1|  tyramine oxidase                                 73.9    3e-13   
gb|EJC82855.1|  Cu2+-containing amine oxidase                         73.9    3e-13   
ref|XP_001805482.1|  hypothetical protein SNOG_15329                  73.9    3e-13   
ref|WP_037219598.1|  tyramine oxidase                                 73.9    3e-13   
ref|WP_007570201.1|  tyramine oxidase                                 73.6    3e-13   
ref|WP_012935344.1|  tyramine oxidase                                 73.6    3e-13   
ref|WP_003886981.1|  tyramine oxidase                                 73.6    4e-13   
ref|XP_002840782.1|  hypothetical protein                             73.6    4e-13   
ref|WP_036402958.1|  tyramine oxidase                                 73.6    4e-13   
ref|WP_032395037.1|  tyramine oxidase                                 73.6    4e-13   
ref|WP_007812214.1|  tyramine oxidase                                 73.6    4e-13   
gb|KFZ12653.1|  hypothetical protein V502_07000                       73.9    4e-13   
gb|KFY76471.1|  hypothetical protein V499_03893                       73.6    4e-13   
ref|WP_024452988.1|  tyramine oxidase                                 73.6    4e-13   
ref|WP_028198765.1|  tyramine oxidase                                 73.2    4e-13   
ref|WP_027133873.1|  hypothetical protein                             73.2    4e-13   
ref|WP_035520708.1|  tyramine oxidase                                 73.2    5e-13   
gb|EMD92645.1|  hypothetical protein COCHEDRAFT_1224422               73.2    5e-13   
gb|EKV05571.1|  Primary amine oxidase                                 73.2    5e-13   
ref|XP_001246445.1|  copper amine oxidase                             72.8    6e-13   
ref|WP_011434335.1|  tyramine oxidase                                 72.8    6e-13   
gb|KFZ10907.1|  hypothetical protein V501_04995                       72.8    6e-13   
ref|WP_029114804.1|  tyramine oxidase                                 72.8    7e-13   
ref|WP_020464622.1|  tyramine oxidase                                 72.8    7e-13   
ref|XP_002567502.1|  Pc21g04560                                       72.8    7e-13   
gb|ABD03718.1|  putative copper methylamine oxidase                   72.8    7e-13   
gb|KGO40914.1|  Copper amine oxidase                                  72.8    7e-13   
gb|EHK22808.1|  hypothetical protein TRIVIDRAFT_53922                 72.8    7e-13   
ref|WP_015306289.1|  Cu2+-containing amine oxidase                    72.8    7e-13   
ref|WP_024322456.1|  tyramine oxidase                                 72.8    8e-13   
ref|WP_029870515.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_017964861.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_003540918.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_024447063.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_033180763.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_028741014.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_017961017.1|  tyramine oxidase                                 72.4    8e-13   
ref|XP_003066723.1|  copper amine oxidase, putative                   72.4    8e-13   
ref|WP_018493171.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_018074380.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_011652550.1|  tyramine oxidase                                 72.4    8e-13   
gb|EHK42683.1|  hypothetical protein TRIATDRAFT_224516                72.4    8e-13   
ref|WP_017988777.1|  tyramine oxidase                                 72.4    8e-13   
gb|EFW18265.1|  copper amine oxidase                                  72.4    8e-13   
ref|WP_018485743.1|  tyramine oxidase                                 72.4    8e-13   
ref|WP_020050558.1|  tyramine oxidase                                 72.4    9e-13   
ref|XP_007729589.1|  copper amine oxidase 1                           72.4    9e-13   
ref|WP_012030012.1|  tyramine oxidase                                 72.4    9e-13   
ref|WP_038839896.1|  tyramine oxidase                                 72.0    9e-13   
ref|WP_028379539.1|  tyramine oxidase                                 72.4    9e-13   
ref|WP_030891055.1|  tyramine oxidase                                 72.4    9e-13   
ref|WP_027228688.1|  tyramine oxidase                                 72.4    9e-13   
ref|WP_027266050.1|  tyramine oxidase                                 72.4    9e-13   
ref|WP_027224502.1|  tyramine oxidase                                 72.4    1e-12   
ref|WP_035534984.1|  tyramine oxidase                                 72.4    1e-12   
ref|WP_027487620.1|  tyramine oxidase                                 72.4    1e-12   
ref|WP_027267970.1|  tyramine oxidase                                 72.4    1e-12   
ref|WP_014327020.1|  tyramine oxidase                                 72.4    1e-12   
ref|WP_010948595.1|  tyramine oxidase                                 72.0    1e-12   
gb|EHA20960.1|  copper amine oxidase                                  72.4    1e-12   
ref|WP_014842902.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_011947803.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_027225442.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_015443894.1|  tyramine oxidase                                 72.0    1e-12   
ref|XP_007386353.1|  hypothetical protein PUNSTDRAFT_54222            72.4    1e-12   
ref|WP_027668986.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_014844950.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_031335828.1|  tyramine oxidase                                 69.7    1e-12   
ref|WP_012433003.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_036373417.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_011779445.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_028074137.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_035752309.1|  tyramine oxidase                                 72.0    1e-12   
ref|XP_002379041.1|  copper/topaquinone oxidase, putative             72.0    1e-12   
ref|WP_026556533.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_020502057.1|  hypothetical protein                             72.0    1e-12   
ref|WP_033187870.1|  tyramine oxidase                                 72.0    1e-12   
ref|XP_002953864.1|  copper amine oxidase                             71.6    1e-12   
ref|XP_001261340.1|  amine oxidase                                    72.0    1e-12   
ref|WP_037182195.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_026556508.1|  tyramine oxidase                                 72.0    1e-12   
ref|WP_036335313.1|  tyramine oxidase                                 71.6    1e-12   
ref|WP_018447118.1|  MULTISPECIES: tyramine oxidase                   72.0    1e-12   
ref|XP_003043038.1|  hypothetical protein NECHADRAFT_78479            72.0    1e-12   
ref|WP_031465870.1|  tyramine oxidase                                 71.6    1e-12   
ref|XP_007684379.1|  hypothetical protein COCMIDRAFT_2110             71.6    1e-12   
ref|XP_006667829.1|  copper methylamine oxidase precursor             71.6    2e-12   
gb|EDP53591.1|  copper amine oxidase                                  71.6    2e-12   
ref|XP_011125178.1|  hypothetical protein AOL_s00110g186              71.6    2e-12   
ref|WP_015750044.1|  tyramine oxidase                                 71.6    2e-12   
ref|XP_005651923.1|  amine oxidase                                    71.6    2e-12   
ref|XP_748389.1|  copper amine oxidase                                71.6    2e-12   
gb|KEY82926.1|  copper amine oxidase                                  71.6    2e-12   
ref|WP_036328752.1|  monoamine oxidase                                71.6    2e-12   
ref|WP_007470213.1|  tyramine oxidase                                 71.6    2e-12   
ref|WP_036436783.1|  tyramine oxidase                                 71.6    2e-12   
dbj|GAA92564.1|  copper amine oxidase                                 71.6    2e-12   
ref|WP_035743334.1|  tyramine oxidase                                 71.6    2e-12   
ref|XP_001258677.1|  copper amine oxidase                             71.6    2e-12   
ref|WP_026844103.1|  tyramine oxidase                                 71.6    2e-12   
ref|WP_015319909.1|  Cu2+-containing amine oxidase                    71.6    2e-12   
emb|CDM30948.1|  Copper amine oxidase                                 71.6    2e-12   
ref|WP_011894974.1|  tyramine oxidase                                 71.6    2e-12   
gb|EYE93260.1|  hypothetical protein EURHEDRAFT_460707                71.6    2e-12   
ref|WP_013472108.1|  tyramine oxidase                                 71.2    2e-12   
dbj|GAK65554.1|  peroxisomal copper amine oxidase                     71.6    2e-12   
ref|XP_009654514.1|  copper amine oxidase                             71.2    2e-12   
dbj|GAC73077.1|  copper amine oxidase                                 71.6    2e-12   
ref|XP_007324359.1|  hypothetical protein SERLADRAFT_418714           71.2    2e-12   
ref|WP_036445353.1|  tyramine oxidase                                 71.2    2e-12   
ref|WP_021474417.1|  tyramine oxidase                                 71.2    2e-12   
sp|Q07121.1|AMO1_ARTS1  RecName: Full=Primary amine oxidase; AltN...  71.2    3e-12   
gb|EMF12576.1|  Cu_amine_oxid-domain-containing protein               71.2    3e-12   
ref|XP_001273258.1|  amine oxidase                                    71.2    3e-12   
sp|Q07123.1|AMO2_ARTS1  RecName: Full=Copper methylamine oxidase;...  70.9    3e-12   
ref|WP_021765625.1|  putative histamine oxidase                       70.9    3e-12   
ref|XP_002544099.1|  copper amine oxidase 1                           70.9    3e-12   
ref|XP_001242972.1|  hypothetical protein CIMG_06868                  70.9    3e-12   
ref|XP_002153056.1|  copper amine oxidase, putative                   70.9    3e-12   
ref|XP_500130.1|  YALI0A16445p                                        70.9    3e-12   
ref|XP_007829021.1|  hypothetical protein PFICI_02249                 70.9    3e-12   
ref|XP_003070078.1|  Copper amine oxidase 1, putative                 70.9    3e-12   
ref|WP_014742172.1|  tyramine oxidase                                 70.9    4e-12   
ref|XP_002844054.1|  copper amine oxidase                             70.5    4e-12   
gb|KFX52850.1|  Copper amine oxidase 1                                70.9    4e-12   
ref|WP_003893887.1|  primary amine oxidase                            70.5    4e-12   
ref|WP_014816267.1|  tyramine oxidase                                 70.5    4e-12   
gb|KFY15374.1|  hypothetical protein V491_05703                       70.5    4e-12   
ref|WP_011430198.1|  tyramine oxidase                                 70.5    4e-12   
gb|KFZ02271.1|  hypothetical protein V500_00267                       70.5    4e-12   
ref|XP_007814820.1|  copper amine oxidase 1                           70.5    4e-12   
ref|XP_009161759.1|  primary-amine oxidase                            70.5    4e-12   
ref|XP_002628923.1|  copper amine oxidase 1                           70.5    4e-12   
gb|KFY54686.1|  hypothetical protein V496_07199                       70.5    4e-12   
ref|WP_039380394.1|  tyramine oxidase                                 70.5    4e-12   
gb|EEQ85248.1|  copper amine oxidase 1                                70.5    4e-12   
gb|EGE78307.1|  copper amine oxidase                                  70.5    4e-12   
ref|WP_039321363.1|  tyramine oxidase                                 70.5    4e-12   
ref|WP_004517446.1|  tyramine oxidase                                 70.5    4e-12   
emb|CCF42351.1|  copper amine oxidase 1                               70.5    4e-12   
ref|XP_002146354.1|  copper amine oxidase                             70.5    4e-12   
ref|XP_007779450.1|  copper amine oxidase 1                           70.5    5e-12   
gb|EST09541.1|  copper amine oxidase                                  70.5    5e-12   
gb|KHO01369.1|  copper amine oxidase 1                                70.5    5e-12   
ref|WP_036338604.1|  tyramine oxidase                                 70.5    5e-12   
dbj|GAM43038.1|  copper amine oxidase                                 70.5    5e-12   
ref|XP_005649283.1|  hypothetical protein COCSUDRAFT_28332            70.5    5e-12   
gb|KDB20946.1|  hypothetical protein H109_07130                       70.5    5e-12   
ref|WP_028208292.1|  tyramine oxidase                                 70.5    5e-12   
dbj|GAC93773.1|  peroxisomal copper amine oxidase                     70.5    5e-12   
gb|KFZ25486.1|  hypothetical protein V502_00037                       70.5    5e-12   
ref|WP_011774103.1|  tyramine oxidase                                 70.5    5e-12   
gb|EZF34947.1|  hypothetical protein H101_01510                       70.5    5e-12   
ref|XP_003048374.1|  hypothetical protein NECHADRAFT_63123            70.5    5e-12   
ref|WP_024819173.1|  tyramine oxidase                                 70.1    5e-12   
ref|WP_020180434.1|  hypothetical protein                             70.1    5e-12   
gb|KFM28415.1|  Copper methylamine oxidase                            70.1    5e-12   
ref|WP_024819190.1|  tyramine oxidase                                 70.1    5e-12   
ref|XP_002478648.1|  copper amine oxidase                             70.1    5e-12   
ref|XP_001213476.1|  conserved hypothetical protein                   70.1    5e-12   
ref|XP_003237110.1|  copper amine oxidase                             70.1    5e-12   
gb|EGD95907.1|  copper amine oxidase                                  70.1    5e-12   
ref|WP_028223078.1|  tyramine oxidase                                 70.1    5e-12   
ref|XP_003018586.1|  amine oxidase                                    70.1    5e-12   
emb|CDO76846.1|  hypothetical protein BN946_scf185033.g43             70.1    6e-12   
ref|WP_029947181.1|  tyramine oxidase                                 70.1    6e-12   
ref|WP_013421977.1|  tyramine oxidase                                 70.1    6e-12   
ref|WP_029372023.1|  tyramine oxidase                                 70.1    6e-12   
gb|KEF61289.1|  copper amine oxidase 1                                70.1    6e-12   
gb|EZF35299.1|  hypothetical protein H101_01179                       70.1    6e-12   
ref|XP_382455.1|  hypothetical protein FG02279.1                      70.1    6e-12   
ref|XP_002487050.1|  peroxisomal copper amine oxidase                 70.1    6e-12   
ref|XP_007677073.1|  hypothetical protein BAUCODRAFT_576846           70.1    6e-12   
ref|XP_501971.1|  YALI0C18315p                                        70.1    6e-12   
ref|WP_027931330.1|  monoamine oxidase                                70.1    6e-12   
ref|WP_011780608.1|  tyramine oxidase                                 70.1    6e-12   
ref|WP_036374987.1|  tyramine oxidase                                 70.1    7e-12   
gb|EPS34729.1|  hypothetical protein PDE_09693                        70.1    7e-12   
ref|WP_010307530.1|  tyramine oxidase                                 69.7    7e-12   
gb|EWM22333.1|  copper amine oxidase                                  70.1    7e-12   
ref|XP_003172343.1|  copper amine oxidase 1                           69.7    7e-12   
ref|WP_036425228.1|  tyramine oxidase                                 69.7    7e-12   
ref|XP_007911071.1|  putative copper amine oxidase protein            69.7    7e-12   
ref|XP_009160938.1|  copper amine oxidase 1                           69.7    7e-12   
ref|WP_036439296.1|  tyramine oxidase                                 69.7    7e-12   
gb|KID87707.1|  copper amine oxidase 1                                69.7    7e-12   
ref|WP_027820829.1|  tyramine oxidase                                 69.7    7e-12   
gb|EHB45308.1|  Copper amine oxidase domain-containing protein        69.7    7e-12   
dbj|GAA91926.1|  peroxisomal copper amine oxidase                     69.7    8e-12   
gb|KFG81137.1|  copper amine oxidase 1                                69.7    8e-12   
ref|XP_001389976.1|  copper amine oxidase 1                           69.7    8e-12   
ref|XP_009551641.1|  hypothetical protein HETIRDRAFT_460901           69.7    8e-12   



>gb|KCW86671.1| hypothetical protein EUGRSUZ_B032972, partial [Eucalyptus grandis]
 gb|KCW86672.1| hypothetical protein EUGRSUZ_B032972, partial [Eucalyptus grandis]
Length=312

 Score =   146 bits (369),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  234  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR
Sbjct  285  VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  344

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  345  EGLVIYSVAYV  355



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   150 bits (379),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV GH+V+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVHGHYVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  381  EGLVIHSVAYV  391



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  301  VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVNGHFVEWQKWNFRIGFTPR  360

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  361  EGLVIYSVAYI  371



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  381  EGLVIYSVAYV  391



>ref|XP_008351782.1| PREDICTED: peroxisomal primary amine oxidase-like [Malus domestica]
Length=570

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  318  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  377

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  378  EGLVIYSVAYV  388



>ref|XP_008782506.1| PREDICTED: peroxisomal primary amine oxidase, partial [Phoenix 
dactylifera]
Length=571

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGG DRSDVKPLHI+QPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  305  VPLPPADPLRNYTPGETRGGADRSDVKPLHILQPEGPSFRVNGYFVEWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  365  EGLVIYSVAYI  375



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPG+TRGGVDRSDVKPLHI+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  305  VPLPPADPLRNYTPGDTRGGVDRSDVKPLHILQPEGPSFRVNGHFVEWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  365  EGLVIYSVAYI  375



>gb|KDP26650.1| hypothetical protein JCGZ_17808 [Jatropha curcas]
Length=669

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GE+RGGVDRSDVKPL IIQPEGPSFRV+GHFVQWQKWNFRIGFTPR
Sbjct  319  VPLPPADPLRNYTAGESRGGVDRSDVKPLQIIQPEGPSFRVNGHFVQWQKWNFRIGFTPR  378

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  379  EGLVIYSVAYV  389



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGG+DRSD+KPLHI+QPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTPGETRGGIDRSDIKPLHILQPEGPSFRVNGYFVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  381  EGLVIYSVAYI  391



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  318  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  377

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  378  EGLVIYSVAYV  388



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  315  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  375  EGLVIYSVAYV  385



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  318  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  377

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  378  EGLVIYSVAYV  388



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  294  IPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  353

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  354  EGLVIYSVAYI  364



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+GHF+ WQKWNFRIGFTPR
Sbjct  329  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVNGHFISWQKWNFRIGFTPR  388

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  389  EGLVIYSVAYL  399



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  234  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  294  EGLVIYSVAYI  304



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSD+KPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  318  VPLPPADPLRNYTPGETRGGVDRSDIKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  377

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  378  EGLVIYSVAYV  388



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSD+KPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  318  VPLPPADPLRNYTPGETRGGVDRSDIKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  377

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  378  EGLVIYSVAYV  388



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  294  IPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  353

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  354  EGLVIYSVAYI  364



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  308  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  367

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  368  EGLVIYSVAYI  378



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  313  VPLPPADPLRNYTPGETRGGVDRSDVKPLQILQPEGPSFRVNGYFVEWQKWNFRIGFTPR  372

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  373  EGLVIYSVAYV  383



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GE+RGGVDRSDVKPL IIQPEGPSFRV+GHFVQWQKWNFRIGFTPR
Sbjct  328  VPLPPADPLRNYTAGESRGGVDRSDVKPLQIIQPEGPSFRVNGHFVQWQKWNFRIGFTPR  387

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  388  EGLVIYSVAYV  398



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  303  IPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  362

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  363  EGLVIYSVAYI  373



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  234  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  294  EGLVIYSVAYI  304



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  315  VPLPPADPLRNYTPGETRGGVDRSDVKPLQILQPEGPSFRVNGYFVEWQKWNFRIGFTPR  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  375  EGLVIYSVAYV  385



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GH+V+WQKWNFRIGFTPR
Sbjct  301  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHYVEWQKWNFRIGFTPR  360

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  361  EGLVIHSVAYV  371



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GH+V+WQKWNFRIGFTPR
Sbjct  304  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHYVEWQKWNFRIGFTPR  363

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  364  EGLVIHSVAYV  374



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  291  IPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  350

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  351  EGLVIYSVAYI  361



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVK L IIQPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  315  VPLPPADPLRNYTPGETRGGVDRSDVKLLQIIQPEGPSFRVNGHFVEWQKWNFRIGFTPR  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  375  EGLVIYSVAYI  385



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  313  VPLPPADPLRNYTPGETRGGVDRSDVKPLQILQPEGPSFRVNGYFVEWQKWNFRIGFTPR  372

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  373  EGLVIYSVAYV  383



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHFV+WQKWNFRIGFT +
Sbjct  315  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFVEWQKWNFRIGFTSK  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  375  EGLVIYSVAYI  385



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  294  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGHFIQWQKWNFRIGFTPR  353

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAY+
Sbjct  354  EGLIIYSVAYI  364



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHFV+WQKWNFRIGFT +
Sbjct  311  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFVEWQKWNFRIGFTSK  370

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  371  EGLVIYSVAYI  381



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPLHI QPEGPSFRV+GH+V+WQKWNFR+GFTPR
Sbjct  303  VPLPPADPLRNYTPGETRGGVDRSDVKPLHINQPEGPSFRVNGHYVEWQKWNFRVGFTPR  362

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  363  EGLVIHSVAYV  373



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHFV+WQKWNFRIGFT +
Sbjct  309  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFVEWQKWNFRIGFTSK  368

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  369  EGLVIYSVAYI  379



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHFV+WQKWNFRIGFT +
Sbjct  311  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFVEWQKWNFRIGFTSK  370

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  371  EGLVIYSVAYI  381



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFR++GH+V+WQKWNFRIGFTPR
Sbjct  307  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRINGHYVEWQKWNFRIGFTPR  366

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  367  EGLVIHSVAYV  377



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   143 bits (361),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+GH+V WQKWNFRIGFTPR
Sbjct  299  VPLPPADPLRNYTAGETRGGVDRSDVKPLLIVQPEGPSFRVNGHYVAWQKWNFRIGFTPR  358

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  359  EGLVIHSVAYV  369



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFRV+GHFV+WQKWNFRIGFT +
Sbjct  309  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFVEWQKWNFRIGFTSK  368

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  369  EGLVIYSVAYI  379



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFR++GH+V+WQKWNFR+GFTPR
Sbjct  315  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRINGHYVEWQKWNFRVGFTPR  374

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  375  EGLVIHSVAYV  385



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPP DPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  271  IPLPPTDPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  330

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  331  EGLVIYSVAYI  341



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV GH+V+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVHGHYVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  381  EGLVIHSVAYV  391



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I QPEGPSFRV GHFV+WQKWNFRIGFTPR
Sbjct  312  VPLPPADPLRNYTPGETRGGVDRSDVKPLLISQPEGPSFRVSGHFVEWQKWNFRIGFTPR  371

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  372  EGLVIYSVAYV  382



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPP DPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  295  IPLPPTDPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  355  EGLVIYSVAYI  365



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPP DPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  271  IPLPPTDPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  330

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  331  EGLVIYSVAYI  341



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSD+KPL IIQPEGPSFRV GHF++WQKWNFRIGFTPR
Sbjct  234  IPLPPADPLRNYTSGETRGGVDRSDIKPLQIIQPEGPSFRVSGHFIEWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL IIQPEGPSFR +GH+V+WQKWNFRIGFTPR
Sbjct  301  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRANGHYVEWQKWNFRIGFTPR  360

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  361  EGLVIHSVAYV  371



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPP DPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQKWNFRIGFTPR
Sbjct  271  IPLPPTDPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQKWNFRIGFTPR  330

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  331  EGLVIYSVAYI  341



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSD+KPL IIQPEGPSFRV GHF++WQKWNFRIGFTPR
Sbjct  234  IPLPPADPLRNYTSGETRGGVDRSDIKPLQIIQPEGPSFRVSGHFIEWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  309  VPLPPADPLRNYTAGETRGGVDRSDVKPLLIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  369  EGLVIYSVAYI  379



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I QPEGPSFRV GHFV+WQKWNFRIGFTPR
Sbjct  312  VPLPPADPLRNYTPGETRGGVDRSDVKPLLISQPEGPSFRVSGHFVEWQKWNFRIGFTPR  371

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  372  EGLVIYSVAYV  382



>ref|XP_007044780.1| Copper amine oxidase family protein isoform 4 [Theobroma cacao]
 gb|EOY00612.1| Copper amine oxidase family protein isoform 4 [Theobroma cacao]
Length=646

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G F++WQKWNFRIGFTPR
Sbjct  320  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVNGKFIEWQKWNFRIGFTPR  379

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  380  EGLVIYSVAYV  390



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  309  VPLPPADPLRNYTAGETRGGVDRSDVKPLLIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  369  EGLVIYSVAYI  379



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  327  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVNGYFVEWQKWNFRIGFTPR  386

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  387  EGLVIHSVAYV  397



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV GH+V+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVHGHYVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  381  EGLVIHSVAYV  391



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPPADPLRNYT GETRGGVDRSD+KPL IIQPEGPSFRV GHF++WQKWNFRIGFTPR
Sbjct  300  IPLPPADPLRNYTSGETRGGVDRSDIKPLQIIQPEGPSFRVSGHFIEWQKWNFRIGFTPR  359

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  360  EGLVIYSVAYV  370



>ref|XP_006584632.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X2 [Glycine max]
Length=611

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GET+GGVDRSDVKPL IIQPEGPSFRV+GHF++WQKWNFRIGFTPR
Sbjct  300  VPLPPADPLRNYTSGETQGGVDRSDVKPLQIIQPEGPSFRVNGHFIEWQKWNFRIGFTPR  359

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  360  EGLVIHSVAYI  370



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G F++WQKWNFRIGFTPR
Sbjct  320  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVNGKFIEWQKWNFRIGFTPR  379

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  380  EGLVIYSVAYV  390



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  305  VPLPPADPLRNYTRGETRGGVDRSDVKPLQIVQPEGPSFRVNGYFVQWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  365  EGLVIYSVAYL  375



>ref|XP_006411506.1| hypothetical protein EUTSA_v100163160mg, partial [Eutrema salsugineum]
 gb|ESQ52959.1| hypothetical protein EUTSA_v100163160mg, partial [Eutrema salsugineum]
Length=392

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  309  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  369  EGLVIHSVAYV  379



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  322  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVSGNFVEWQKWNFRIGFTPR  381

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  382  EGLVIYSVAYV  392



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF++WQKWNFRIGFTPR
Sbjct  298  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIEWQKWNFRIGFTPR  357

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  358  EGLVIHSVAYI  368



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGG+DRSDVKPL I+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  303  VPLPPADPLRNYTPGETRGGIDRSDVKPLQILQPEGPSFRVNGYFVQWQKWNFRIGFTPR  362

Query  182  EGLVIYSVAYV  214
            EGLVI+S+AYV
Sbjct  363  EGLVIHSLAYV  373



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G+FV+WQKWNFRIGFT R
Sbjct  317  VPLPPADPLRNYTPGETRGGVDRSDVKPLRIVQPEGPSFRVNGYFVEWQKWNFRIGFTTR  376

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  377  EGLVIYSVAYV  387



>ref|XP_004309984.1| PREDICTED: copper methylamine oxidase-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+GHFV+WQKWNFRIGFT +
Sbjct  234  VPLPPADPLRNYTPGETRGGVDRSDVKPLKIVQPEGPSFRVNGHFVEWQKWNFRIGFTSK  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY 
Sbjct  294  EGLVIYSVAYT  304



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSD+KPLHI+QPEGPSFR++G+FV+WQKW+FRIGFTPR
Sbjct  311  VPLPPADPLRNYTPGETRGGVDRSDIKPLHILQPEGPSFRINGYFVEWQKWSFRIGFTPR  370

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  371  EGLVIHSVAYI  381



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G F++WQKWNFRIGFTPR
Sbjct  320  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVNGKFIEWQKWNFRIGFTPR  379

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  380  EGLVIYSVAYV  390



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  305  VPLPPADPLRNYTRGETRGGVDRSDVKPLQIVQPEGPSFRVNGYFVQWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  365  EGLVIYSVAYL  375



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  305  VPLPPADPLRNYTRGETRGGVDRSDVKPLQIVQPEGPSFRVNGYFVQWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  365  EGLVIYSVAYL  375



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  305  VPLPPADPLRNYTRGETRGGVDRSDVKPLQIVQPEGPSFRVNGYFVQWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  365  EGLVIYSVAYL  375



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  234  VPLPPADPLRNYTRGETRGGVDRSDVKPLQIVQPEGPSFRVNGYFVQWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  294  EGLVIYSVAYL  304



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G F++WQKWNFRIGFTPR
Sbjct  331  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVNGKFIEWQKWNFRIGFTPR  390

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  391  EGLVIYSVAYV  401



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  309  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  369  EGLIIYSVAYV  379



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GE RGG+DRSDVKPLHI+QPEGPSFRV+G+FVQWQKWNFRIGFTPR
Sbjct  307  VPLPPADPLRNYTAGEMRGGIDRSDVKPLHILQPEGPSFRVNGYFVQWQKWNFRIGFTPR  366

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  367  EGLVIHSVAYI  377



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G++V+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIVQPEGPSFRVNGYYVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  381  EGLVIYSVAYV  391



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+GH+V+WQKW+FRIGFTPR
Sbjct  306  VPLPPADPLRNYTPGETRGGVDRSDVKPLLILQPEGPSFRVNGHYVEWQKWSFRIGFTPR  365

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  366  EGLVIHSVAYV  376



>gb|KEH20164.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=619

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  308  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  367

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  368  EGLVIYSVAYI  378



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GET+GGVDRSDVKPL IIQPEGPSFRV+GHF++WQKWNFRIGFTPR
Sbjct  300  VPLPPADPLRNYTSGETQGGVDRSDVKPLQIIQPEGPSFRVNGHFIEWQKWNFRIGFTPR  359

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  360  EGLVIHSVAYI  370



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G++V+WQKWNFRIGFTPR
Sbjct  234  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIVQPEGPSFRVNGYYVEWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  235  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  294

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  295  EGLIIYSVAYV  305



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GET+GGVDRSDVKPL IIQPEGPSFRV+GHF++WQKWNFRIGFTPR
Sbjct  300  VPLPPADPLRNYTSGETQGGVDRSDVKPLQIIQPEGPSFRVNGHFIEWQKWNFRIGFTPR  359

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  360  EGLVIHSVAYI  370



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  235  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  294

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  295  EGLIIYSVAYV  305



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G++V+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIVQPEGPSFRVNGYYVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVIYS+AYV
Sbjct  381  EGLVIYSIAYV  391



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  309  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  369  EGLIIYSVAYV  379



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  309  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  369  EGLIIYSVAYV  379



>gb|KEH20162.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=629

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  295  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  355  EGLVIYSVAYI  365



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGETRGG DRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTP+
Sbjct  254  VPLPPVDPLRNYTPGETRGGSDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPK  313

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  314  EGLVIYSVAYV  324



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GET+GGVDRSDVKPL IIQPEGPSFRV+GHF++WQKWNFRIGFTPR
Sbjct  235  VPLPPADPLRNYTSGETQGGVDRSDVKPLQIIQPEGPSFRVNGHFIEWQKWNFRIGFTPR  294

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  295  EGLVIHSVAYI  305



>gb|KEH20161.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=642

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  308  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  367

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  368  EGLVIYSVAYI  378



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  309  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  369  EGLIIYSVAYV  379



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G++V+WQKWNFRIGFTPR
Sbjct  321  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIVQPEGPSFRVNGYYVEWQKWNFRIGFTPR  380

Query  182  EGLVIYSVAYV  214
            EGLVIYS+AYV
Sbjct  381  EGLVIYSIAYV  391



>gb|ACW82416.1| putative copper amine oxidase, partial [Olea europaea]
Length=529

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+QPEGP FRV+G +V+WQKWNFR+GFTPR
Sbjct  314  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPIFRVNGRYVEWQKWNFRVGFTPR  373

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  374  EGLVIHSVAYV  384



>gb|KEH20160.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=568

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  234  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  294  EGLVIYSVAYI  304



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGETRGG DRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTP+
Sbjct  300  VPLPPVDPLRNYTPGETRGGSDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPK  359

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  360  EGLVIYSVAYV  370



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGETRGG DRSDVKPL IIQPEGPSFRV+G+FV+WQKWNFRIGFTP+
Sbjct  304  VPLPPVDPLRNYTPGETRGGSDRSDVKPLQIIQPEGPSFRVNGYFVEWQKWNFRIGFTPK  363

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  364  EGLVIYSVAYV  374



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            V LPPADPLRNYT GETRGGVDRSD+KPL I+QPEGPSFRV+GHFV+WQKWNFRIGFTPR
Sbjct  319  VHLPPADPLRNYTAGETRGGVDRSDIKPLQIVQPEGPSFRVNGHFVEWQKWNFRIGFTPR  378

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  379  EGLIIYSVAYV  389



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = +2

Query  17   ADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVI  196
            ADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRV+GHFV+WQKWNFRIGFTPREGLVI
Sbjct  280  ADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVNGHFVEWQKWNFRIGFTPREGLVI  339

Query  197  YSVAYV  214
            YSVAY+
Sbjct  340  YSVAYI  345



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPLHIIQPEGPSFR+ G++++WQKWNFRIGFTPR
Sbjct  315  VPLPPADPLRNYTAGETRGGVDRSDVKPLHIIQPEGPSFRISGNYIEWQKWNFRIGFTPR  374

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  375  EGLVIHSVAYL  385



>dbj|BAD95322.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=502

 Score =   136 bits (342),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  32   VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  91

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  92   EGLVIHSVAYV  102



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G FV+WQKWNFR+GFTP+
Sbjct  321  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIVQPEGPSFRVNGCFVEWQKWNFRLGFTPK  380

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  381  EGLVIYSVAYV  391



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYTPGETRGGVDRSDVKPL I+Q EGPSFRV+G+FV+WQKWNFRIGFTPR
Sbjct  317  VPLPPADPLRNYTPGETRGGVDRSDVKPLQIVQSEGPSFRVNGYFVEWQKWNFRIGFTPR  376

Query  182  EGLVIYSVAYV  214
            EGLV++SVAYV
Sbjct  377  EGLVLHSVAYV  387



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G FV+WQKWNFRIGFTP+
Sbjct  327  VPLPLADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVNGCFVEWQKWNFRIGFTPK  386

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  387  EGLVIYSVAYV  397



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G F++WQKWNFRIGFTPR
Sbjct  288  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGRFIEWQKWNFRIGFTPR  347

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  348  EGLVIHSVAYI  358



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYTPGETRGGVDRSDVKPL I+QPEGPSFRV+G FV+WQKWNFRIGFTP+
Sbjct  327  VPLPLADPLRNYTPGETRGGVDRSDVKPLQIVQPEGPSFRVNGCFVEWQKWNFRIGFTPK  386

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  387  EGLVIYSVAYV  397



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+QPEGPSFRV+GH+V WQKWNFRIGFTPR
Sbjct  299  VPLPPADPLRNYTAGETRGGVDRSDVKPLLIVQPEGPSFRVNGHYVAWQKWNFRIGFTPR  358

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  359  EGLVIHSVAYV  369



>gb|AES71447.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=548

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGG DRSDVKPL IIQPEGPSFRV+G++V+WQKWNFRIGFTP+
Sbjct  78   VPLPPVDPLRNYTPGESRGGSDRSDVKPLQIIQPEGPSFRVNGYYVEWQKWNFRIGFTPK  137

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  138  EGLIIYSVAYV  148



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYT GETRGGVDRSDVKPLHIIQPEGPSFR+ G++V+WQKWNFRIGFTPR
Sbjct  314  VPLPPVDPLRNYTAGETRGGVDRSDVKPLHIIQPEGPSFRISGNYVEWQKWNFRIGFTPR  373

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  374  EGLVIHSVAYL  384



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  308  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  367

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  368  EGLVIYSVAYI  378



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  295  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  355  EGLVIYSVAYI  365



>ref|XP_004301007.1| PREDICTED: copper methylamine oxidase-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL I+Q EGPSFRVDG+FV+WQKWNFR+GFTPR
Sbjct  319  VPLPPADPLRNYTSGETRGGVDRSDVKPLKIVQAEGPSFRVDGYFVEWQKWNFRVGFTPR  378

Query  182  EGLVIYSVAY  211
            EGLVIYS+AY
Sbjct  379  EGLVIYSIAY  388



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  234  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  294  EGLVIYSVAYI  304



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYT GETRGGVDRSDVKPL IIQP+GPSFRV+G+F+QWQKWNFRIGFTPR
Sbjct  258  VPLPQADPLRNYTSGETRGGVDRSDVKPLQIIQPDGPSFRVNGNFIQWQKWNFRIGFTPR  317

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  318  EGLVIYSVAYI  328



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYT GETRGGVDRSDVKPLHIIQPEGPSFR+ G++V+WQKWNFRIGFTPR
Sbjct  319  VPLPPVDPLRNYTAGETRGGVDRSDVKPLHIIQPEGPSFRISGNYVEWQKWNFRIGFTPR  378

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  379  EGLVIHSVAYL  389



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G++V+WQKWNFR+GFTPR
Sbjct  303  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVNGNYVEWQKWNFRVGFTPR  362

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  363  EGLVIHSVAYI  373



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYT GETRGGVDRSDVKPLHIIQPEGPSFR+ G++V+WQKWNFRIGFTPR
Sbjct  316  VPLPPVDPLRNYTAGETRGGVDRSDVKPLHIIQPEGPSFRISGNYVEWQKWNFRIGFTPR  375

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  376  EGLVIHSVAYL  386



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  309  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  369  EGLVIHSVAYV  379



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  306  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  365

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  366  EGLVIHSVAYV  376



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  306  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  365

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  366  EGLVIHSVAYV  376



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  311  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  370

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  371  EGLVIHSVAYV  381



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFR+ G +V+WQKWNFRIGFTPR
Sbjct  308  VPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRIKGQYVEWQKWNFRIGFTPR  367

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  368  EGLVIHSVAYV  378



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQ EGPSFR++G+F+ WQKWNFRIGFTPR
Sbjct  304  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQTEGPSFRINGNFIAWQKWNFRIGFTPR  363

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  364  EGLVIYSVAYI  374



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  306  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  365

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  366  EGLVIHSVAYV  376



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+G++V+WQKWNFR+GFTPR
Sbjct  295  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVNGNYVEWQKWNFRVGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  355  EGLVIHSVAYL  365



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  286  VPLPPPDPLRNYTPGESRGGVDRSDVKPLEIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  345

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  346  EGLVIHSVAYV  356



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  309  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  369  EGLVIHSVAYV  379



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  301  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  360

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  361  EGLVIHSVAYV  371



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  311  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  370

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  371  EGLVIHSVAYV  381



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  305  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  364

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  365  EGLVIHSVAYV  375



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  286  VPLPPPDPLRNYTPGESRGGVDRSDVKPLEIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  345

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  346  EGLVIHSVAYV  356



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPR
Sbjct  286  VPLPPPDPLRNYTPGESRGGVDRSDVKPLEIIQPEGPSFRVRGYFVEWQKWNFRIGFTPR  345

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  346  EGLVIHSVAYV  356



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPL PADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRVDG++VQWQKWNFR+GFTPR
Sbjct  303  VPLLPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVDGNYVQWQKWNFRVGFTPR  362

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  363  EGLVIHSVAYL  373



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGG DRSDVKPL IIQPEGPSFRV+G++V+WQKWNFRIGFTP+
Sbjct  204  VPLPPVDPLRNYTPGESRGGSDRSDVKPLQIIQPEGPSFRVNGYYVEWQKWNFRIGFTPK  263

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  264  EGLIIYSVAYV  274



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPL PADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRVDG++VQWQKWNFR+GFTPR
Sbjct  298  VPLLPADPLRNYTAGETRGGVDRSDVKPLQIIQPEGPSFRVDGNYVQWQKWNFRVGFTPR  357

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  358  EGLVIHSVAYL  368



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGG DRSDVKPL IIQPEGPSFRV+G++V+WQKWNFRIGFTP+
Sbjct  234  VPLPPVDPLRNYTPGESRGGSDRSDVKPLQIIQPEGPSFRVNGYYVEWQKWNFRIGFTPK  293

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  294  EGLIIYSVAYV  304



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGG DRSDVKPL IIQPEGPSFRV+G++V+WQKWNFRIGFTP+
Sbjct  299  VPLPPVDPLRNYTPGESRGGSDRSDVKPLQIIQPEGPSFRVNGYYVEWQKWNFRIGFTPK  358

Query  182  EGLVIYSVAYV  214
            EGL+IYSVAYV
Sbjct  359  EGLIIYSVAYV  369



>tpg|DAA37329.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=442

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  315  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  375  EGLVIYSVAYV  385



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGG DRSDVKPL I+QPEGPSFRV+G++V+WQKWNFRIGFTP+
Sbjct  297  VPLPPVDPLRNYTPGESRGGSDRSDVKPLQIVQPEGPSFRVNGYYVEWQKWNFRIGFTPK  356

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  357  EGLVIYSVAYV  367



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYTPGETRGGVDRSDVKPL IIQ EGPSFRV GH+++WQKWNFRIGFTPR
Sbjct  307  VPLPLADPLRNYTPGETRGGVDRSDVKPLQIIQLEGPSFRVKGHYIEWQKWNFRIGFTPR  366

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  367  EGLVIHSVAYV  377



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP ADPLRNYTPGETRGGVDRSDVKPL IIQ EGPSFRV GH+++WQKWNFRIGFTPR
Sbjct  307  VPLPLADPLRNYTPGETRGGVDRSDVKPLQIIQLEGPSFRVSGHYIEWQKWNFRIGFTPR  366

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  367  EGLVIHSVAYV  377



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGE+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTP+
Sbjct  296  VPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPK  355

Query  182  EGLVIYSVAYV  214
            EGLVI+S+AYV
Sbjct  356  EGLVIHSIAYV  366



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP  DPLRNYTPGETRGG DRSDVKPL+I+QP+GPSFRVDG+FV+WQKWNFR+GFTPR
Sbjct  277  VPLPSPDPLRNYTPGETRGGHDRSDVKPLYILQPQGPSFRVDGYFVEWQKWNFRVGFTPR  336

Query  182  EGLVIYSVAYV  214
            EGLV+YSVAYV
Sbjct  337  EGLVLYSVAYV  347



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP  DPLRNYTPGETRGG DRSDVKPL+I+QP+GPSFRVDG+FV+WQKWNFR+GFTPR
Sbjct  277  VPLPSPDPLRNYTPGETRGGHDRSDVKPLYILQPQGPSFRVDGYFVEWQKWNFRVGFTPR  336

Query  182  EGLVIYSVAYV  214
            EGLV+YSVAYV
Sbjct  337  EGLVLYSVAYV  347



>gb|EPS66989.1| hypothetical protein M569_07787, partial [Genlisea aurea]
Length=574

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYT GE+RGGVDRSDVKPL I+QPEGPSFR+  H+V+WQKWNFRIGFTPR
Sbjct  309  VPLPPVDPLRNYTAGESRGGVDRSDVKPLQILQPEGPSFRIRDHYVEWQKWNFRIGFTPR  368

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  369  EGLVIHSVAYI  379



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQ EGPSFRV+G++V+WQKWNFR+GFTPR
Sbjct  295  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQLEGPSFRVNGNYVEWQKWNFRVGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  355  EGLVIHSVAYL  365



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQ EGPSFRV+G++V+WQKWNFR+GFTPR
Sbjct  295  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQLEGPSFRVNGNYVEWQKWNFRVGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  355  EGLVIHSVAYL  365



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQ EGPSFRV+G++V+WQKWNFR+GFTPR
Sbjct  295  VPLPPADPLRNYTAGETRGGVDRSDVKPLQIIQLEGPSFRVNGNYVEWQKWNFRVGFTPR  354

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAY+
Sbjct  355  EGLVIHSVAYL  365



>dbj|BAJ87935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  60   VPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  119

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  120  EGLVIYSVAYV  130



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  268  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  327

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  328  EGLVIYSVAYV  338



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  317  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  376

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  377  EGLVIYSVAYV  387



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  315  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  375  EGLVIYSVAYV  385



>ref|XP_004289862.1| PREDICTED: copper methylamine oxidase-like [Fragaria vesca subsp. 
vesca]
Length=696

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPPADPLRNYT  ETRGGVDRSD+KPL I+Q EGPSFRVDG+FV+WQKWNFR+GFTP+
Sbjct  234  VPLPPADPLRNYTCAETRGGVDRSDLKPLKIVQAEGPSFRVDGYFVEWQKWNFRVGFTPK  293

Query  182  EGLVIYSVAY  211
            EGLV+YS+AY
Sbjct  294  EGLVVYSIAY  303



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYT GETRGG DRSD+KPL I+Q EGPSFRVDG +V WQKWNFRIGFTPR
Sbjct  269  VPLPPVDPLRNYTHGETRGGSDRSDIKPLQIVQLEGPSFRVDGFYVAWQKWNFRIGFTPR  328

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  329  EGLVIYSVAYV  339



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  315  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  374

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  375  EGLVIYSVAYV  385



>ref|NP_001053078.1| Os04g0476100 [Oryza sativa Japonica Group]
 dbj|BAF14992.1| Os04g0476100, partial [Oryza sativa Japonica Group]
Length=518

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+KPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  53   VPLPPPDHLRNYTPGETRGGVDRSDLKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  112

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  113  EGLVIYSVAYV  123



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  305  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIIDQPEGPSFRINGYFVEWQKWNFRIGFTPK  364

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  365  EGLVIYSVAYV  375



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTPGETRGGVDRSDVKPL+I+QPEG SFRV  +FV+WQKWNFRIGFTPR
Sbjct  315  VPLPPPDPLRNYTPGETRGGVDRSDVKPLNILQPEGTSFRVRDYFVEWQKWNFRIGFTPR  374

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  375  EGLVIHSVAYV  385



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+KPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  234  VPLPPPDHLRNYTPGETRGGVDRSDLKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+KPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  234  VPLPPPDHLRNYTPGETRGGVDRSDLKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+KPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  234  VPLPPPDHLRNYTPGETRGGVDRSDLKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  293

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  294  EGLVIYSVAYV  304



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+KPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  322  VPLPPPDHLRNYTPGETRGGVDRSDLKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  381

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  382  EGLVIYSVAYV  392



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+KPL I QPEGPSFR++G+FV+WQKWNFRIGFTP+
Sbjct  373  VPLPPPDHLRNYTPGETRGGVDRSDLKPLIINQPEGPSFRINGYFVEWQKWNFRIGFTPK  432

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAYV
Sbjct  433  EGLVIYSVAYV  443



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP  DPLRNYTPGETRGGVDRSDVKPL+I+QPEGPSFRV  +FV+WQKWNFRIGFTP+
Sbjct  316  VPLPQPDPLRNYTPGETRGGVDRSDVKPLNIVQPEGPSFRVRDYFVEWQKWNFRIGFTPK  375

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  376  EGLVIHSVAYV  386



>ref|XP_006600619.1| PREDICTED: copper amine oxidase 1-like isoform X4 [Glycine max]
Length=680

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLR YT GETRGG DRSD+KPL IIQ EGPSFRVDG +V WQKWNFRIGFTPR
Sbjct  279  VPLPPVDPLRRYTHGETRGGFDRSDIKPLQIIQLEGPSFRVDGSYVAWQKWNFRIGFTPR  338

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  339  EGLVIYSVAYI  349



>ref|XP_006600618.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Glycine max]
Length=697

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLR YT GETRGG DRSD+KPL IIQ EGPSFRVDG +V WQKWNFRIGFTPR
Sbjct  279  VPLPPVDPLRRYTHGETRGGFDRSDIKPLQIIQLEGPSFRVDGSYVAWQKWNFRIGFTPR  338

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  339  EGLVIYSVAYI  349



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLR YT GETRGG DRSD+KPL IIQ EGPSFRVDG +V WQKWNFRIGFTPR
Sbjct  279  VPLPPVDPLRRYTHGETRGGFDRSDIKPLQIIQLEGPSFRVDGSYVAWQKWNFRIGFTPR  338

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  339  EGLVIYSVAYI  349



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLR YT GETRGG DRSD+KPL IIQ EGPSFRVDG +V WQKWNFRIGFTPR
Sbjct  279  VPLPPVDPLRRYTHGETRGGFDRSDIKPLQIIQLEGPSFRVDGSYVAWQKWNFRIGFTPR  338

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  339  EGLVIYSVAYI  349



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLR YT GETRGG DRSD+KPL IIQ EGPSFRVDG +V WQKWNFRIGFTPR
Sbjct  267  VPLPPVDPLRRYTHGETRGGFDRSDIKPLQIIQLEGPSFRVDGSYVAWQKWNFRIGFTPR  326

Query  182  EGLVIYSVAYV  214
            EGLVIYSVAY+
Sbjct  327  EGLVIYSVAYI  337



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +PLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSF V GHFV+WQKWNFRIGFTP 
Sbjct  206  IPLPPPDHLRNYTPGETRGGVDRSDVKPLIINQPEGPSFNVTGHFVEWQKWNFRIGFTPV  265

Query  182  EGLVIYSVAY  211
            EGLVIYSVAY
Sbjct  266  EGLVIYSVAY  275



>emb|CDP13212.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +2

Query  32   NYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            NYT GETRGGVDRSDVKP+HIIQPEGPSF VDGHFVQWQKWNFRIGFTPREGLVIYSVAY
Sbjct  225  NYTAGETRGGVDRSDVKPIHIIQPEGPSFHVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  284

Query  212  V  214
            V
Sbjct  285  V  285



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSDVKPL I QPEGPSFR+ G FV+WQKWNFR+GFTP+
Sbjct  296  VPLPPPDHLRNYTPGETRGGVDRSDVKPLIISQPEGPSFRITGSFVEWQKWNFRVGFTPK  355

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  356  EGLVIHSVAYV  366



>gb|EEC73513.1| hypothetical protein OsI_07883 [Oryza sativa Indica Group]
Length=529

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+K L I QP+GPSFRV+G+FV+WQKWNFRIGFTP+
Sbjct  174  VPLPPPDHLRNYTPGETRGGVDRSDLKTLIINQPDGPSFRVNGYFVEWQKWNFRIGFTPK  233

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  234  EGLVIHSVAYV  244



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTP  TRGGVDR+D+KPL I QPEGPSFRV+GH V+WQKWNFR+GFTPR
Sbjct  242  VPLPPPDPLRNYTPAATRGGVDRTDIKPLLITQPEGPSFRVNGHAVEWQKWNFRVGFTPR  301

Query  182  EGLVIYSVAYV  214
            EGLVI++VAY 
Sbjct  302  EGLVIHTVAYC  312



>gb|EEE57286.1| hypothetical protein OsJ_07344 [Oryza sativa Japonica Group]
Length=681

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYTPGETRGGVDRSD+K L I QP+GPSFRV+G+FV+WQKWNFRIGFTP+
Sbjct  132  VPLPPPDHLRNYTPGETRGGVDRSDLKTLIINQPDGPSFRVNGYFVEWQKWNFRIGFTPK  191

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  192  EGLVIHSVAYV  202



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D LRNYT GETRGGVDRSDVKPL I QPEGPSFR+ G FV+WQKWNFR+GFTP+
Sbjct  344  VPLPPPDHLRNYTTGETRGGVDRSDVKPLIISQPEGPSFRITGSFVEWQKWNFRVGFTPK  403

Query  182  EGLVIYSVAYV  214
            EGLVI+SVAYV
Sbjct  404  EGLVIHSVAYV  414



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP+D LRNYT GETRGGVDR+DVKPL I QP+GPSF V+G+ V+WQKWNFRIGFTP+
Sbjct  338  VPLPPSDHLRNYTSGETRGGVDRTDVKPLVINQPQGPSFHVNGYLVEWQKWNFRIGFTPK  397

Query  182  EGLVIYSVAYV  214
            EGLV++SVAYV
Sbjct  398  EGLVLHSVAYV  408



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLP  DPLRNYT   TRGGVDRSD+KPLHI QPEGPSFRV+G+ V+WQKWNFRIGFTP+
Sbjct  197  VPLPAPDPLRNYTAAATRGGVDRSDIKPLHISQPEGPSFRVNGYAVEWQKWNFRIGFTPK  256

Query  182  EGLVIYSVAY  211
            EGLVI++VAY
Sbjct  257  EGLVIHTVAY  266



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP+D LRNYT GETRGGVDR+DVKPL I QP+GPSF V+G+ V+WQKWNFRIGFTP+
Sbjct  338  VPLPPSDHLRNYTSGETRGGVDRTDVKPLVINQPQGPSFHVNGYLVEWQKWNFRIGFTPK  397

Query  182  EGLVIYSVAYV  214
            EGLV++SVAYV
Sbjct  398  EGLVLHSVAYV  408



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP+D LRNYT GETRGGVDR+DV+PL I QP+GPSF V+G+ V+WQKWNFRIGFTP+
Sbjct  248  VPLPPSDHLRNYTSGETRGGVDRTDVRPLVINQPQGPSFHVNGYLVEWQKWNFRIGFTPK  307

Query  182  EGLVIYSVAYV  214
            EGLV++SVAYV
Sbjct  308  EGLVLHSVAYV  318



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYT   +RGGVDR+D+KPL I QPEGPSFRV+G+ V+WQKWNFR+GFTPR
Sbjct  242  VPLPPPDPLRNYTAASSRGGVDRTDIKPLLITQPEGPSFRVNGYAVEWQKWNFRVGFTPR  301

Query  182  EGLVIYSVAY  211
            EGLVI++VAY
Sbjct  302  EGLVIHTVAY  311



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTP   RGG+ RSD+KPL I+QP+GPSFRVDG+ V+WQKWNFRIGFTPR
Sbjct  309  VPLPPPDPLRNYTPSHIRGGL-RSDLKPLKIMQPDGPSFRVDGYHVEWQKWNFRIGFTPR  367

Query  182  EGLVIYSVAY  211
            EGLVI++VAY
Sbjct  368  EGLVIHTVAY  377



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  29   RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVA  208
            RNYT GETRGGVDRSDVKPL I+QPEGPSFRV+G+ ++WQKWNFRIGFTPREGLVIYSVA
Sbjct  333  RNYTAGETRGGVDRSDVKPLQIVQPEGPSFRVNGYHIEWQKWNFRIGFTPREGLVIYSVA  392

Query  209  Y  211
            Y
Sbjct  393  Y  393



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP DPLRNYTP   RGG+ RSD+KPL I+QP+GPSFRVDG+ V+WQKWNFRIGFTPR
Sbjct  199  VPLPPPDPLRNYTPSHIRGGL-RSDLKPLKIMQPDGPSFRVDGYHVEWQKWNFRIGFTPR  257

Query  182  EGLVIYSVAY  211
            EGLVI++VAY
Sbjct  258  EGLVIHTVAY  267



>gb|AFK35388.1| unknown [Lotus japonicus]
Length=163

 Score =   103 bits (256),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQK  151
            VPLPPADPLRNYT GETRGGVDRSDVKPL IIQPEGPSFRV+GHF+QWQK
Sbjct  94   VPLPPADPLRNYTSGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFIQWQK  143



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  47   ETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAYV  214
            E+RGGVDRSDVKPL IIQPEGPSFRV G+FV+WQKWNFRIGFTPREGLVI+SVAYV
Sbjct  304  ESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRIGFTPREGLVIHSVAYV  359



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  29   RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVA  208
            RNYTP  +RGGVDRSD+KPL I QPEGPSFRV+G+ V+WQKWNFRIGFTPREGLVI++VA
Sbjct  246  RNYTPAASRGGVDRSDIKPLVISQPEGPSFRVNGYAVEWQKWNFRIGFTPREGLVIHTVA  305

Query  209  Y  211
            Y
Sbjct  306  Y  306



>ref|XP_002985875.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
 gb|EFJ13052.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
Length=710

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
             PLPP DP+RNYTP    GG+ R+DVKPL I+QP GPSF V+G+ V WQKW+FR+GFTPR
Sbjct  265  APLPPPDPMRNYTPACVPGGL-RTDVKPLQILQPGGPSFEVNGYEVTWQKWSFRLGFTPR  323

Query  182  EGLVIYSVAY  211
            EGLVI++VAY
Sbjct  324  EGLVIHTVAY  333



>ref|XP_002984811.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
 gb|EFJ14061.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
Length=710

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
             PLPP DP+RNYTP    GG+ R+DV+PL I+QP GPSF V+G+ V WQKW+FR+GFTPR
Sbjct  265  APLPPPDPMRNYTPACVPGGL-RTDVRPLQILQPGGPSFEVNGYEVTWQKWSFRLGFTPR  323

Query  182  EGLVIYSVAY  211
            EGLVI+SVAY
Sbjct  324  EGLVIHSVAY  333



>ref|WP_034266611.1| tyramine oxidase [Bacillus sp. Aph1]
Length=649

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  32   NYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            NYTP  T     R D+KPL I+QPEGPSF +DGHF++WQKWN R GFTPREGLV+++V Y
Sbjct  209  NYTPETTDSITFREDLKPLEIVQPEGPSFEIDGHFIKWQKWNIRFGFTPREGLVLHTVGY  268



>ref|WP_027416719.1| tyramine oxidase [Aneurinibacillus terranovensis]
Length=650

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    PLPPADPLRNYTPGETRGGVD-RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            PLPP D   NYTP ET   ++ R DVKPL IIQPEGPSF VDGH ++WQKW+FR  FTPR
Sbjct  202  PLPPFDG--NYTP-ETSDSIELRKDVKPLEIIQPEGPSFEVDGHHIRWQKWDFRFSFTPR  258

Query  182  EGLVIYSVAY  211
            EGLV+++V +
Sbjct  259  EGLVLHTVGF  268



>ref|WP_003350826.1| tyramine oxidase [Bacillus methanolicus]
 gb|EIJ82043.1| tyramine oxidase [Bacillus methanolicus PB1]
Length=651

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    PLPPADPLRNYTPGETRGGVD-RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            PLPP D   NY+P ET   ++ R D+KPL IIQPEGPSF VDGH V+WQKW+FR  FTPR
Sbjct  202  PLPPLDG--NYSP-ETSDSIEFRKDLKPLEIIQPEGPSFEVDGHHVRWQKWDFRFSFTPR  258

Query  182  EGLVIYSVAY  211
            EGLV++++ Y
Sbjct  259  EGLVLHNIGY  268



>ref|WP_006456034.1| tyramine oxidase [Synechococcus sp. PCC 7335]
 gb|EDX86269.1| Copper amine oxidase, enzyme domain protein [Synechococcus sp. 
PCC 7335]
Length=646

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D   NYTP   +    R+D+KPL I+QPEGPSF V+ H + WQKWN RIGFTPR
Sbjct  208  VPLPPKD--GNYTPEYVKNY--RTDIKPLEIVQPEGPSFEVNDHEISWQKWNIRIGFTPR  263

Query  182  EGLVIYSVAY  211
            EGL++Y+V Y
Sbjct  264  EGLILYNVTY  273



>ref|WP_016205391.1| tyramine oxidase [Bacillus nealsonii]
 gb|EOR20880.1| tyramine oxidase [Bacillus nealsonii AAU1]
Length=652

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +2

Query  8    LPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREG  187
            +PP D   NY+P  +     R+D+KPL IIQPEGPSF ++GH+++WQKW+ R GFTPREG
Sbjct  201  MPPTDA--NYSPETSDSIALRTDLKPLEIIQPEGPSFEIEGHYIKWQKWHIRFGFTPREG  258

Query  188  LVIYSVAY  211
            LV+++V Y
Sbjct  259  LVLHTVGY  266



>ref|WP_036002001.1| tyramine oxidase [Leptolyngbya sp. JSC-1]
Length=652

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R D+KPLHI QP+GPSF V+GHFV+WQKW FRIGFTPREGLV+Y+V Y
Sbjct  224  RPDIKPLHITQPQGPSFEVEGHFVRWQKWQFRIGFTPREGLVLYTVGY  271



>ref|WP_015186652.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 ref|YP_007125935.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ28775.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
Length=646

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP +P  NY+    +    RSD+KPL I+QPEG SF V GHF++WQKW FRIGFTPR
Sbjct  206  VPLPP-NP-GNYSTEFVKDL--RSDIKPLEIVQPEGTSFEVQGHFIKWQKWQFRIGFTPR  261

Query  182  EGLVIYSVAY  211
            EGLV+Y+V Y
Sbjct  262  EGLVLYTVGY  271



>ref|WP_017299862.1| tyramine oxidase [Nodosilinea nodulosa]
Length=642

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D   NY+    +    R+D+KPL IIQPEGPSF V+GH + WQKW  RIGFTPR
Sbjct  203  VPLPPRD--GNYSQEYIKNF--RTDLKPLEIIQPEGPSFTVEGHQICWQKWKMRIGFTPR  258

Query  182  EGLVIYSVAY  211
            EGLV+Y+V+Y
Sbjct  259  EGLVLYTVSY  268



>ref|WP_027555623.1| tyramine oxidase [Bradyrhizobium sp. Cp5.3]
Length=666

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   ETR    R+D+KPLHI QPEG SFRVDG  V WQKW+FR+GFTPR
Sbjct  211  VPIPRKK--RNYGAHETRN--PRADIKPLHIEQPEGASFRVDGWKVDWQKWSFRVGFTPR  266

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  267  EGLVLHQLAY  276



>ref|WP_008314860.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=643

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D   NY     +    R D+KPL IIQPEGPSF V+GH ++WQKW  R+GFTPR
Sbjct  203  VPLPPKD--GNYATEYIQNY--RQDLKPLEIIQPEGPSFEVEGHEIRWQKWKMRVGFTPR  258

Query  182  EGLVIYSVAYV  214
            EGLV+Y+V+Y 
Sbjct  259  EGLVLYTVSYT  269



>ref|WP_035986372.1| tyramine oxidase [Leptolyngbya sp. KIOST-1]
Length=643

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP     NY+    +    R+D+KPL IIQPEGPSF V+GH + WQKW  RIGFTPR
Sbjct  203  VPLPPNSA--NYSQEYIKNF--RTDLKPLEIIQPEGPSFTVEGHQISWQKWKMRIGFTPR  258

Query  182  EGLVIYSVAYV  214
            EGLV+Y+V+Y 
Sbjct  259  EGLVLYTVSYT  269



>ref|WP_028147545.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKWNF
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWKVDWQKWNF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_038942896.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKWNF
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWKVDWQKWNF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_038975474.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKWNF
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWKVDWQKWNF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_036725089.1| tyramine oxidase [Paenibacillus forsythiae]
Length=648

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D   NYTP +   G  R+D+KPL IIQPEGPSF + GH + WQKW  R GFT R
Sbjct  196  VPLPPLDG--NYTPDKV--GPLRTDLKPLEIIQPEGPSFTIGGHEISWQKWKIRFGFTSR  251

Query  182  EGLVIYSVAYV  214
            EGLV+++V+Y+
Sbjct  252  EGLVLHTVSYL  262



>ref|WP_006520181.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
 gb|EKU99059.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
Length=647

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D   NYT    +    R D+KPL I+QP+GPSF V GH + WQKW  RIGFTPR
Sbjct  204  VPLPPKD--GNYTTEYVKEY--RQDLKPLEIVQPDGPSFNVKGHEISWQKWKIRIGFTPR  259

Query  182  EGLVIYSVAYV  214
            EGLV+Y+V Y 
Sbjct  260  EGLVLYTVTYT  270



>ref|WP_024341794.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=664

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E      R+D+KPLHI QPEGPSFRVDG  V WQKW+FR+GFTPR
Sbjct  209  VPIPRKK--RNYGAHEVTD--PRTDIKPLHIEQPEGPSFRVDGWKVDWQKWSFRVGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>gb|AIQ12487.1| tyramine oxidase [Paenibacillus durus]
Length=648

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VPLPP D   NYTP +   G  R+D+KPL I+QPEGPSF  +GH + WQKW  R GFT R
Sbjct  196  VPLPPLDG--NYTPDKV--GPLRTDLKPLEIVQPEGPSFTTNGHEISWQKWKIRFGFTSR  251

Query  182  EGLVIYSVAY  211
            EGLV+++V+Y
Sbjct  252  EGLVLHTVSY  261



>ref|WP_028158892.1| tyramine oxidase [Bradyrhizobium japonicum]
 gb|KGT75989.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKW+F
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWKVDWQKWSF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_014495317.1| tyramine oxidase [Bradyrhizobium japonicum]
 ref|YP_005610084.1| hypothetical protein BJ6T_52360 [Bradyrhizobium japonicum USDA 
6]
 dbj|BAL10496.1| hypothetical protein BJ6T_52360 [Bradyrhizobium japonicum USDA 
6]
 gb|AJA63309.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKW+F
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWQVDWQKWSF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>emb|CEG30995.1| Primary amine oxidase precursor [Bacillus simplex]
Length=650

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +P PP D   NYTP +   G  R DVKPL I+QP+GPSF  +GH + WQKWN R GF  R
Sbjct  202  IPFPPLDG--NYTPDQV--GDMRQDVKPLEIVQPKGPSFTTEGHVIDWQKWNIRFGFNSR  257

Query  182  EGLVIYSVAY  211
            EGLV+++V+Y
Sbjct  258  EGLVLHTVSY  267



>gb|AHY48354.1| Cu2+-containing amine oxidase [Rubrobacter radiotolerans]
Length=636

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  47   ETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            E  G   RSD+KPL I QPEG SF +DGH V+WQKW+FRIGFTPREGLV+Y+V Y
Sbjct  209  EPNGRQMRSDLKPLEITQPEGVSFEIDGHEVRWQKWSFRIGFTPREGLVLYTVGY  263



>ref|WP_034315126.1| tyramine oxidase [Bacillus simplex]
Length=650

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +P PP D   NYTP +   G  R DVKPL I+QP+GPSF  +GH + WQKWN R GF  R
Sbjct  202  IPFPPLDG--NYTPDQV--GDMRQDVKPLEIVQPKGPSFTTEGHVIDWQKWNIRFGFNSR  257

Query  182  EGLVIYSVAY  211
            EGLV+++V+Y
Sbjct  258  EGLVLHTVSY  267



>ref|WP_039148680.1| tyramine oxidase [Bradyrhizobium japonicum]
 gb|AHY50599.1| tyramine oxidase [Bradyrhizobium japonicum SEMIA 5079]
Length=666

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKW+F
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWQVDWQKWSF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_038957242.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKW+F
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWQVDWQKWSF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_028065493.1| tyramine oxidase [Solirubrobacter soli]
Length=644

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = +2

Query  2    VPLPPA----DPLRNYTPGET-RGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRI  166
            VPLPP     DP R        R    R D+KP+ I QPEGPSF VDGH V+WQKW  RI
Sbjct  197  VPLPPKAGNYDPQRMAAADNVPRYETQRGDLKPIEITQPEGPSFEVDGHHVRWQKWQLRI  256

Query  167  GFTPREGLVIYSVAY  211
            GFTPREGLV++ + Y
Sbjct  257  GFTPREGLVLHEIGY  271



>ref|WP_038932845.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=666

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF++DG  V WQKW+F
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKIDGWKVDWQKWSF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_015686158.1| tyramine oxidase [Bradyrhizobium sp. S23321]
 ref|YP_005450980.1| tyramine oxidase [Bradyrhizobium sp. S23321]
 dbj|BAL76868.1| tyramine oxidase [Bradyrhizobium sp. S23321]
Length=661

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E +    R+D+KPLHI QPEG SF+VDG  V WQKW+F
Sbjct  198  IHLADADPIVPIPRKKRNYGAHEVKN--PRTDIKPLHIEQPEGASFKVDGWKVDWQKWSF  255

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ ++Y
Sbjct  256  RVGFTPREGLVLHQLSY  272



>ref|WP_035666101.1| tyramine oxidase [Bradyrhizobium japonicum]
Length=662

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E +    R+D+KPLHI QPEG SFRVDG  V WQKW+FR+GFTPR
Sbjct  209  VPIPRKK--RNYGAHELQN--PRTDIKPLHIEQPEGASFRVDGWKVDWQKWSFRVGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>ref|WP_036028043.1| tyramine oxidase [Bradyrhizobium yuanmingense]
Length=662

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R+D+KPLHI QPEGPSF+VDG  V WQKW+FR+GFTPREGLV++ +AY
Sbjct  227  RTDIKPLHIEQPEGPSFKVDGWKVDWQKWSFRVGFTPREGLVLHQLAY  274



>ref|WP_036039528.1| tyramine oxidase [Bradyrhizobium yuanmingense]
Length=662

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R+D+KPLHI QPEGPSF+VDG  V WQKW+FR+GFTPREGLV++ +AY
Sbjct  227  RTDIKPLHIEQPEGPSFKVDGWKVDWQKWSFRVGFTPREGLVLHQLAY  274



>ref|WP_035999308.1| tyramine oxidase [Bradyrhizobium yuanmingense]
Length=662

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R+D+KPLHI QPEGPSF+VDG  V WQKW+FR+GFTPREGLV++ +AY
Sbjct  227  RTDIKPLHIEQPEGPSFKVDGWKVDWQKWSFRVGFTPREGLVLHQLAY  274



>ref|WP_028144656.1| MULTISPECIES: tyramine oxidase [Bradyrhizobium]
Length=665

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E      R+D++PLHI QPEG SFRVDG  V WQKW+FRIGFTPR
Sbjct  209  VPIPRKK--RNYGAHEMTNL--RTDIRPLHIEQPEGASFRVDGWKVDWQKWSFRIGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>ref|WP_009633550.1| Cu2+-containing amine oxidase [Synechocystis sp. PCC 7509]
Length=645

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R+D+KPL IIQP+G SF+V+GH + WQKW FRIGFTPREGLV+Y++ Y
Sbjct  224  RTDLKPLDIIQPDGASFKVEGHKISWQKWQFRIGFTPREGLVLYTIGY  271



>ref|WP_035676607.1| tyramine oxidase [Bradyrhizobium liaoningense]
Length=664

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPL-------RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            + L  ADP+       RNY   E      R+D+KPLHI QPEG SF+VDG  V WQKW+F
Sbjct  200  IDLTDADPIVPIPRKKRNYGAHEVTN--PRTDIKPLHIEQPEGVSFKVDGWKVDWQKWSF  257

Query  161  RIGFTPREGLVIYSVAY  211
            R+GFTPREGLV++ +AY
Sbjct  258  RVGFTPREGLVLHQLAY  274



>ref|WP_018320456.1| tyramine oxidase [Bradyrhizobium sp. WSM2793]
Length=665

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E      R+D+KPLHI QPEG SFRV+G  V WQKW+FRIGFTPR
Sbjct  209  VPIPRKK--RNYGAHEVAN--PRADIKPLHIEQPEGASFRVEGWKVDWQKWSFRIGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>ref|WP_038946771.1| tyramine oxidase [Bradyrhizobium sp. CCBAU 15544]
Length=665

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E      R+D+KPLHI QPEG SFRV+G  V WQKW+FRIGFTPR
Sbjct  209  VPIPRKK--RNYGAHEMTN--LRTDIKPLHIEQPEGASFRVNGWKVDWQKWSFRIGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>ref|WP_038970312.1| tyramine oxidase [Bradyrhizobium sp. CCBAU 15635]
Length=665

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E      R+D+KPLHI QPEG SFRV+G  V WQKW+FRIGFTPR
Sbjct  209  VPIPRKK--RNYGAHEMTNL--RTDIKPLHIEQPEGASFRVNGWKVDWQKWSFRIGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>ref|WP_018330660.1| hypothetical protein [Actinomycetospora chiangmaiensis]
Length=648

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R DVKP+ I QPEGPSF +DGH V WQKW+ RIGFTPREGLV++ V+Y
Sbjct  226  RDDVKPIEITQPEGPSFTIDGHAVSWQKWHLRIGFTPREGLVLHDVSY  273



>ref|WP_028921142.1| tyramine oxidase [Pseudonocardia acaciae]
Length=656

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  65   DRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            DR DVKP+ I QPEGPSF VDGH + WQKW  RIG+TPREGLV++ V Y
Sbjct  231  DRDDVKPIEITQPEGPSFTVDGHALSWQKWRLRIGYTPREGLVLHQVGY  279



>ref|WP_036480875.1| tyramine oxidase [Myxosarcina sp. GI1]
Length=634

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R D+KP+ I QP+G SF V GHFV+WQKW FRIGFTPREGL++Y++ Y
Sbjct  212  RQDLKPIEITQPQGTSFEVQGHFVRWQKWQFRIGFTPREGLILYTIGY  259



>ref|WP_028390396.1| tyramine oxidase [Bacillus sp. FJAT-14515]
Length=653

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    PLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPRE  184
            P+ P + L  Y P        R+D+KPL I+QPEGPSF V+GH ++WQKW+ RIG+T RE
Sbjct  202  PIAPKNAL--YKPELNDEINVRTDLKPLEIVQPEGPSFTVEGHNIKWQKWDIRIGYTARE  259

Query  185  GLVIYSVAY  211
            GLV+Y+V Y
Sbjct  260  GLVLYTVDY  268



>ref|WP_015124381.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
 ref|YP_007061380.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
 gb|AFY60837.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
Length=650

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+PP D   NY     +    R+D+KPL I+QP GPSF V G  ++WQKW  R+GFTPR
Sbjct  206  VPVPPTD--GNYAAEFIKN--PRTDIKPLQIVQPNGPSFEVLGQLIKWQKWQIRVGFTPR  261

Query  182  EGLVIYSVAY  211
            EGLV+Y+V Y
Sbjct  262  EGLVLYTVGY  271



>ref|WP_015595580.1| tyramine oxidase [Bacillus sp. 1NLA3E]
 ref|YP_007912037.1| tyramine oxidase [Bacillus sp. 1NLA3E]
 gb|AGK55538.1| tyramine oxidase [Bacillus sp. 1NLA3E]
Length=645

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    PLPPADPLRNYTPGETRGGVD-RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            PLPP     NY P ET   ++ R D+K L I+QP+G SF+V+GH ++WQKW+FR  FTPR
Sbjct  202  PLPPTGA--NYAP-ETSDSIELRKDLKALEIVQPDGASFQVEGHRIKWQKWDFRFSFTPR  258

Query  182  EGLVIYSVAY  211
            EGLV++++ Y
Sbjct  259  EGLVLHTIGY  268



>ref|WP_036584415.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX90377.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91103.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91955.1| tyramine oxidase [Paenibacillus darwinianus]
Length=647

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 6/70 (9%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            +P  PA    NYTP   R G  R+ +KP+ IIQPEGPSF +DGH ++WQ W FRIGF  R
Sbjct  200  IPSQPA----NYTP--DRVGPLRTGIKPIEIIQPEGPSFSIDGHEIEWQNWKFRIGFNAR  253

Query  182  EGLVIYSVAY  211
            EGL +++V+Y
Sbjct  254  EGLTLHTVSY  263



>gb|EJZ30335.1| tyramine oxidase [Bradyrhizobium sp. CCGE-LA001]
Length=665

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+P     RNY   E      R+D+KPLHI QP+G SFRV+G  V WQKW+FRIGFTPR
Sbjct  209  VPIPRKK--RNYGAHEVAN--PRTDIKPLHIEQPDGASFRVEGWQVDWQKWSFRIGFTPR  264

Query  182  EGLVIYSVAY  211
            EGLV++ +AY
Sbjct  265  EGLVLHQLAY  274



>ref|WP_012627324.1| tyramine oxidase [Cyanothece sp. PCC 7425]
 ref|YP_002482599.1| tyramine oxidase [Cyanothece sp. PCC 7425]
 gb|ACL44238.1| Amine oxidase (copper-containing) [Cyanothece sp. PCC 7425]
Length=641

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+PP     NY P   +    R D+KPL I QPEG SF V GH V+WQKW FR+GF+PR
Sbjct  201  VPVPPTP--GNYAPEFIQNY--RQDLKPLEITQPEGASFTVTGHLVRWQKWQFRVGFSPR  256

Query  182  EGLVIYSVAY  211
            EGLV+Y+++Y
Sbjct  257  EGLVLYTLSY  266



>ref|WP_007920030.1| tyramine oxidase [Ktedonobacter racemifer]
 gb|EFH82153.1| Primary-amine oxidase [Ktedonobacter racemifer DSM 44963]
Length=649

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPR  181
            VP+PP      YTP     G  R+D+KP+ I QPEGPSF V GH V+WQKW FRIGFT R
Sbjct  207  VPVPPE--AGEYTPEAV--GEMRTDLKPIQITQPEGPSFSVHGHEVRWQKWRFRIGFTTR  262

Query  182  EGLVIYSVAY  211
            EGLV++++ Y
Sbjct  263  EGLVLHTLGY  272



>ref|WP_037040542.1| tyramine oxidase [Pseudonocardia autotrophica]
Length=668

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R DVKPL I QPEGPSF VDGH V WQKW  R+G+TPREGLV++ V Y
Sbjct  229  REDVKPLEITQPEGPSFTVDGHEVSWQKWRLRVGYTPREGLVLHQVGY  276



>ref|WP_038310657.1| tyramine oxidase [bacterium YEK0313]
Length=664

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R D+KPLH++QPEGPSF V+G  V WQ W+FRIGFTPREGLV++ +AY
Sbjct  226  RQDLKPLHVVQPEGPSFTVEGWRVDWQNWSFRIGFTPREGLVLHQLAY  273



>ref|WP_028930454.1| tyramine oxidase [Pseudonocardia asaccharolytica]
Length=644

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  32   NYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            NY P        R+D+KP+ I QPEG SF VDGH V+WQ+W FR+GFTPREGLV+ +V Y
Sbjct  211  NYAPDAADVPAPRTDLKPISITQPEGTSFTVDGHEVRWQRWRFRVGFTPREGLVLNTVRY  270

Query  212  V  214
             
Sbjct  271  T  271



>ref|WP_034299883.1| tyramine oxidase, partial [Bacillus sp. 37MA]
Length=304

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  35   YTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            Y P ++     R+D+KPL I QPEGPS+ ++GH ++WQKW+ RIG+T REGLV+ +V Y
Sbjct  209  YKPEQSDAIQVRTDLKPLEITQPEGPSYEINGHNIKWQKWDIRIGYTAREGLVLNTVDY  267



>ref|XP_008076270.1| Amine oxidase catalytic [Glarea lozoyensis ATCC 20868]
 gb|EPE36955.1| Amine oxidase catalytic [Glarea lozoyensis ATCC 20868]
Length=706

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R+DVKPL+++QP+GPSF+V GH ++WQKW FR+GF PREG  ++ V Y
Sbjct  254  RTDVKPLNVVQPDGPSFKVSGHLIEWQKWRFRLGFNPREGATLHDVRY  301



>ref|WP_013678400.1| tyramine oxidase [Pseudonocardia dioxanivorans]
 ref|YP_004336371.1| Copper amine oxidase domain-containing protein [Pseudonocardia 
dioxanivorans CB1190]
 gb|AEA28518.1| Copper amine oxidase domain-containing protein [Pseudonocardia 
dioxanivorans CB1190]
Length=669

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R DVKPL I QPEGPSF VDGH V WQ W  R+G+TPREGLV++ V Y
Sbjct  230  RDDVKPLEITQPEGPSFTVDGHAVSWQNWRLRVGYTPREGLVLHQVGY  277



>ref|WP_025696771.1| tyramine oxidase, partial [Paenibacillus durus]
Length=475

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  32   NYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            NYTP   R G  R+ +KP+ I QPEGPSF +DGH V+WQ W FRIGF  REGL I++V Y
Sbjct  34   NYTP--DRVGPLRTGIKPVEITQPEGPSFTIDGHEVEWQNWKFRIGFNAREGLTIHTVTY  91



>ref|WP_037709039.1| tyramine oxidase [Streptomyces mirabilis]
Length=656

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGG-------VDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNF  160
            VPLPP     NY P              +R D+KP+ I QPEGPSF VDG+ V+WQKW+F
Sbjct  200  VPLPPLSG--NYDPAVRTADNNWPAVVEERQDLKPIDITQPEGPSFTVDGYAVEWQKWHF  257

Query  161  RIGFTPREGLVIYSVAY  211
            RIGFT REGLV++ V Y
Sbjct  258  RIGFTVREGLVLHQVGY  274



>ref|WP_036534611.1| tyramine oxidase [Oceanobacter kriegii]
Length=649

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  59   GVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAYV  214
            G  R DVKPLHI+QPEG SF+VDG  V WQ W FR+GFTPREGL +  ++YV
Sbjct  218  GTPRDDVKPLHIVQPEGVSFQVDGWKVSWQNWEFRVGFTPREGLTLNQLSYV  269



>ref|WP_039728302.1| tyramine oxidase [Lyngbya confervoides]
 gb|KIF15990.1| tyramine oxidase [Aphanocapsa montana BDHKU210001]
 gb|KIF40915.1| tyramine oxidase [Lyngbya confervoides BDU141951]
Length=638

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R D+KPL I QPEGPSF V+GH ++WQ+W  RIGFTPREGLV++ V Y
Sbjct  219  RQDLKPLSITQPEGPSFTVEGHLIRWQRWQIRIGFTPREGLVLHQVGY  266



>ref|WP_006611730.1| tyramine oxidase [Bradyrhizobium sp. ORS 285]
 emb|CCD86389.1| Histamine oxidase (Copper amine oxidase) [Bradyrhizobium sp. 
ORS 285]
Length=665

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +2

Query  29   RNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVA  208
            RNY   E      R+D+KPL+I QP+GPSF VDG  V+WQKW+FR+GFTPREGLV++ + 
Sbjct  218  RNYGAHEVT--APRADIKPLNIEQPQGPSFTVDGWKVEWQKWSFRVGFTPREGLVLHRLC  275

Query  209  Y  211
            Y
Sbjct  276  Y  276



>gb|ETX01517.1| hypothetical protein ETSY2_37110, partial [Candidatus Entotheonella 
sp. TSY2]
Length=361

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            RSDVKPL I+QPEG SF V+G  V+WQKW FR+GFT REGLV+Y V Y
Sbjct  225  RSDVKPLDIVQPEGVSFEVNGWEVKWQKWRFRVGFTHREGLVLYDVKY  272



>emb|CCA68641.1| related to peroxisomal amine oxidase (copper-containing) [Piriformospora 
indica DSM 11827]
Length=710

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  8    LPPADPLRNYTPGETRGGVDRSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREG  187
            +PP      Y P  T G   R D+KPLHI+QPEGPSF+V+GH V+WQKW   + F+ REG
Sbjct  237  IPPPTKRFEYLPDRT-GLKLRDDLKPLHILQPEGPSFKVNGHIVEWQKWKMHVAFSTREG  295

Query  188  LVIYSVAY  211
            + I +V+Y
Sbjct  296  IAISTVSY  303



>ref|WP_035952394.1| tyramine oxidase, partial [Frankia sp. EUN1f]
Length=666

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = +2

Query  2    VPLPPADPLRNYTPGETRGGVD--------RSDVKPLHIIQPEGPSFRVDGHFVQWQKWN  157
            VPLPP     NY PG      D        R D++P+ + QP+G SF VDGH ++WQ+W 
Sbjct  225  VPLPPRPG--NYIPGLMTADPDNVPAFDRLRDDLRPIEVSQPQGASFTVDGHALRWQRWE  282

Query  158  FRIGFTPREGLVIYSVAYV  214
             R+GFTPREGLV++ +AYV
Sbjct  283  LRVGFTPREGLVLHQIAYV  301



>ref|WP_037709969.1| tyramine oxidase [Streptomyces mirabilis]
Length=666

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   RSDVKPLHIIQPEGPSFRVDGHFVQWQKWNFRIGFTPREGLVIYSVAY  211
            R DV+P+ I QPEGPSF V+GH V+WQKW  RIGFTPREGLV++ V Y
Sbjct  238  RDDVRPIEITQPEGPSFSVEGHEVRWQKWRLRIGFTPREGLVLHQVGY  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511067545352