BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32370_g1_i1 len=1655 path=[1633:0-1654]

Length=1655
                                                                      Score     E

ref|XP_009768377.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    487   2e-164   
ref|XP_009608624.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    479   2e-161   
ref|XP_006348009.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    474   1e-160   
ref|XP_011093238.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    474   1e-160   
gb|KDP28861.1|  hypothetical protein JCGZ_14632                         476   6e-160   
ref|XP_009790369.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    472   1e-159   
ref|XP_009598667.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    467   1e-156   
ref|XP_006367591.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    458   2e-154   
ref|XP_007052320.1|  Alpha/beta-Hydrolases superfamily protein          461   3e-154   
ref|XP_011032110.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    459   1e-153   
ref|XP_002511581.1|  triacylglycerol lipase, putative                   459   3e-153   Ricinus communis
ref|XP_006367590.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    448   2e-150   
ref|XP_002511582.1|  triacylglycerol lipase, putative                   450   5e-150   Ricinus communis
gb|KDO85502.1|  hypothetical protein CISIN_1g035710mg                   448   2e-149   
ref|XP_002270992.2|  PREDICTED: phospholipase A(1) DAD1, chloropl...    446   2e-148   Vitis vinifera
ref|XP_006375138.1|  hypothetical protein POPTR_0014s04700g             442   7e-148   
ref|XP_007052318.1|  Alpha/beta-Hydrolases superfamily protein, p...    444   8e-148   
gb|KDP28862.1|  hypothetical protein JCGZ_14633                         443   3e-147   
ref|XP_004240207.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    437   2e-146   
ref|XP_006367588.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    437   2e-146   
ref|XP_004231145.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    438   2e-146   
emb|CAN61096.1|  hypothetical protein VITISV_007353                     437   3e-146   Vitis vinifera
emb|CBI16669.3|  unnamed protein product                                437   5e-146   
ref|XP_006397662.1|  hypothetical protein EUTSA_v10001768mg             434   4e-145   
ref|XP_004240206.2|  PREDICTED: phospholipase A(1) DAD1, chloropl...    434   6e-145   
ref|XP_006464837.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    433   2e-144   
ref|XP_008232525.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    434   1e-143   
ref|XP_002880139.1|  defective IN anther DEHISCENCE1                    433   2e-143   
emb|CDY48263.1|  BnaC04g05220D                                          433   4e-143   
ref|XP_007219371.1|  hypothetical protein PRUPE_ppa020032mg             429   4e-143   
ref|XP_003551712.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    431   1e-142   
ref|XP_010508249.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    432   1e-142   
ref|XP_009143069.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    431   1e-142   
gb|KHN40551.1|  Phospholipase A(1) DAD1, chloroplastic                  430   2e-142   
ref|XP_010058501.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    428   2e-142   
gb|ABP35955.1|  phospholipase A1                                        431   3e-142   Brassica rapa
dbj|BAC23081.1|  DAD1                                                   430   4e-142   Brassica rapa
ref|XP_008232524.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    426   6e-142   
sp|Q948R1.1|PLA11_ARATH  RecName: Full=Phospholipase A(1) DAD1, c...    429   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445433.1|  hypothetical protein CICLE_v10020217mg             428   2e-141   
ref|XP_010518086.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    429   2e-141   
ref|XP_006293380.1|  hypothetical protein CARUB_v10023210mg             428   2e-141   
ref|XP_002271065.2|  PREDICTED: phospholipase A(1) DAD1, chloropl...    426   7e-141   Vitis vinifera
gb|KCW73102.1|  hypothetical protein EUGRSUZ_E01547                     424   8e-141   
ref|XP_011032133.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    425   3e-140   
ref|XP_010544567.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    425   4e-140   
ref|NP_182008.1|  phospholipase A(1) DAD1                               421   6e-140   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31890.1|  hypothetical protein MIMGU_mgv1a020241mg                421   2e-138   
emb|CBI16668.3|  unnamed protein product                                415   1e-137   
ref|XP_010275454.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    415   1e-136   
ref|XP_010525260.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    412   3e-136   
ref|XP_006464836.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    415   4e-136   
ref|XP_007220124.1|  hypothetical protein PRUPE_ppa020861mg             412   5e-136   
ref|XP_010052797.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    410   1e-135   
ref|XP_007139643.1|  hypothetical protein PHAVU_008G047000g             411   3e-135   
gb|EPS65776.1|  hypothetical protein M569_09001                         409   4e-135   
emb|CDX74688.1|  BnaA05g04340D                                          411   6e-135   
ref|XP_006445434.1|  hypothetical protein CICLE_v10023837mg             408   1e-134   
ref|XP_006375140.1|  DEFECTIVE ANTHER DEHISCENCE family protein         408   1e-134   
ref|XP_010259174.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    408   2e-134   
ref|XP_010559205.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    406   5e-134   
gb|KCW76875.1|  hypothetical protein EUGRSUZ_D01226                     403   5e-133   
ref|XP_004248588.2|  PREDICTED: phospholipase A(1) DAD1, chloropl...    403   1e-131   
ref|XP_004308496.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    399   2e-131   
ref|XP_009353725.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    399   4e-131   
ref|XP_011017357.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    398   7e-131   
ref|XP_002302495.1|  hypothetical protein POPTR_0002s13890g             396   6e-130   Populus trichocarpa [western balsam poplar]
ref|XP_003533563.2|  PREDICTED: phospholipase A(1) DAD1, chloropl...    397   8e-130   
ref|XP_003624312.1|  Lipase                                             395   2e-128   
ref|XP_004493049.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    394   2e-128   
ref|XP_010104276.1|  Phospholipase A(1) DAD1                            395   3e-128   
ref|XP_009779306.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    394   1e-127   
ref|XP_003520425.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    392   2e-127   
ref|XP_008344420.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    389   3e-127   
ref|XP_010934644.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    387   1e-126   
gb|KHN11563.1|  Phospholipase A(1) DAD1, chloroplastic                  387   1e-126   
ref|XP_007139644.1|  hypothetical protein PHAVU_008G047100g             389   2e-126   
ref|XP_008805240.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    385   3e-126   
ref|XP_007139645.1|  hypothetical protein PHAVU_008G047200g             388   6e-126   
ref|XP_006338919.1|  PREDICTED: uncharacterized protein LOC102583663    399   7e-126   
emb|CAN79244.1|  hypothetical protein VITISV_022384                     385   7e-126   Vitis vinifera
ref|XP_003551710.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    386   3e-125   
ref|XP_010058502.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    386   3e-125   
ref|XP_004492931.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    386   5e-125   
ref|XP_009373233.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    383   5e-125   
ref|XP_008801803.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    382   1e-124   
ref|XP_008437770.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    384   1e-124   
ref|XP_003533565.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    384   2e-124   
ref|XP_008375812.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    381   4e-124   
ref|XP_011094371.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    381   4e-124   
gb|KDO85501.1|  hypothetical protein CISIN_1g037922mg                   380   6e-124   
gb|KCW73103.1|  hypothetical protein EUGRSUZ_E01548                     379   1e-123   
ref|XP_003551711.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    380   2e-123   
gb|KHN40550.1|  Phospholipase A(1) DAD1, chloroplastic                  379   3e-123   
ref|XP_010941431.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    378   3e-123   
ref|XP_009621711.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    382   5e-123   
ref|XP_004134279.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    379   9e-123   
emb|CDP09430.1|  unnamed protein product                                377   3e-122   
gb|KGN56339.1|  hypothetical protein Csa_3G116760                       377   6e-122   
ref|XP_007134467.1|  hypothetical protein PHAVU_010G049800g             372   4e-120   
ref|XP_006837391.1|  hypothetical protein AMTR_s00111p00133140          365   4e-117   
gb|EYU40369.1|  hypothetical protein MIMGU_mgv1a018694mg                359   7e-116   
ref|XP_009407578.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    363   1e-115   
ref|XP_004168164.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    357   8e-115   
ref|XP_009414077.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    358   2e-114   
ref|XP_004140625.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    355   8e-114   
gb|KEH23433.1|  glycerolipase A1                                        356   1e-113   
ref|XP_010692044.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    356   4e-113   
gb|EPS63624.1|  hypothetical protein M569_11160                         350   3e-112   
gb|EAY79924.1|  hypothetical protein OsI_35090                          322   1e-100   Oryza sativa Indica Group [Indian rice]
gb|ABA91465.1|  Lipase family protein                                   320   4e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008680711.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    320   5e-100   
ref|XP_004978370.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    320   7e-100   
gb|KGN46517.1|  hypothetical protein Csa_6G106200                       317   2e-99    
emb|CBX25385.1|  hypothetical_protein                                   317   5e-99    
ref|XP_004978369.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...    311   1e-96    
ref|XP_010440096.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    311   5e-95    
ref|XP_010434764.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    311   6e-95    
gb|KDO37674.1|  hypothetical protein CISIN_1g039426mg                   311   6e-95    
ref|XP_006477114.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    311   7e-95    
ref|XP_006440208.1|  hypothetical protein CICLE_v10019666mg             311   7e-95    
ref|XP_010449712.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    308   6e-94    
ref|XP_006282944.1|  hypothetical protein CARUB_v10007507mg             308   8e-94    
ref|XP_010104824.1|  Phospholipase A1-Ibeta2                            307   2e-93    
ref|XP_002448976.1|  hypothetical protein SORBIDRAFT_05g002750          302   4e-93    Sorghum bicolor [broomcorn]
gb|KDP39930.1|  hypothetical protein JCGZ_03461                         305   5e-93    
ref|NP_567515.1|  phospholipase A1-Ibeta2                               303   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011047585.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    303   5e-92    
ref|XP_006368966.1|  hypothetical protein POPTR_0001s15300g             303   6e-92    
ref|XP_007039723.1|  Alpha/beta-Hydrolases superfamily protein          303   6e-92    
ref|XP_002870131.1|  lipase class 3 family protein                      303   6e-92    
ref|XP_006414297.1|  hypothetical protein EUTSA_v10027304mg             301   3e-91    
ref|XP_003611369.1|  Lipase                                             302   3e-91    
ref|XP_010647255.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    301   5e-91    
emb|CAB10455.1|  triacylglycerol lipase like protein                    303   6e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CAN77244.1|  hypothetical protein VITISV_035465                     301   2e-90    Vitis vinifera
ref|XP_004245812.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    300   2e-90    
ref|XP_004241988.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    298   3e-90    
ref|XP_009136810.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    298   5e-90    
ref|XP_011031953.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    296   2e-89    
ref|XP_006359231.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    297   2e-89    
ref|XP_002532349.1|  triacylglycerol lipase, putative                   296   3e-89    Ricinus communis
ref|XP_004511725.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    296   6e-89    
ref|XP_002303372.1|  hypothetical protein POPTR_0003s07940g             295   6e-89    Populus trichocarpa [western balsam poplar]
emb|CDP08362.1|  unnamed protein product                                295   1e-88    
gb|KFK22257.1|  phospholipase a1- chloroplastic-like                    294   1e-88    
ref|XP_007208875.1|  hypothetical protein PRUPE_ppa026090mg             294   3e-88    
ref|XP_006367468.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    293   4e-88    
ref|XP_008238400.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    293   6e-88    
ref|XP_009145395.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    292   8e-88    
ref|XP_009343932.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    292   2e-87    
ref|XP_003517405.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    290   7e-87    
ref|XP_007156578.1|  hypothetical protein PHAVU_002G000600g             289   1e-86    
gb|EYU19471.1|  hypothetical protein MIMGU_mgv1a004169mg                289   2e-86    
ref|XP_009606132.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    289   3e-86    
ref|XP_008369207.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    289   3e-86    
ref|XP_008369208.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    288   4e-86    
ref|XP_011081332.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    288   5e-86    
ref|XP_004148351.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    286   6e-86    
ref|XP_009772200.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    286   6e-86    
ref|XP_009368157.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    288   6e-86    
ref|XP_008465868.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    288   7e-86    
ref|XP_009772191.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    287   1e-85    
emb|CBI29538.3|  unnamed protein product                                286   3e-85    
ref|XP_008373668.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    286   3e-85    
ref|XP_004300344.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    286   4e-85    
ref|XP_004253384.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    285   7e-85    
ref|XP_009773480.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    285   7e-85    
ref|XP_009368221.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    285   8e-85    
ref|XP_006362471.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    285   8e-85    
ref|XP_009607511.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    283   1e-84    
ref|XP_009607510.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    284   2e-84    
ref|XP_010934704.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    284   2e-84    
ref|XP_008801786.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    280   5e-84    
ref|XP_010053518.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    283   6e-84    
ref|XP_010677111.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    282   1e-83    
ref|XP_009789580.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    282   1e-83    
emb|CDX90495.1|  BnaA03g42860D                                          280   3e-83    
ref|XP_010275455.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    279   1e-82    
ref|XP_009599019.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    278   2e-82    
ref|XP_003539047.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    278   3e-82    
ref|XP_010538355.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    278   3e-82    
gb|ACZ57767.1|  glycerolipase A1                                        278   4e-82    Nicotiana attenuata
emb|CDY09664.1|  BnaC07g33970D                                          276   6e-82    
gb|KEH31635.1|  glycerolipase A1                                        273   1e-80    
emb|CBX25299.1|  hypothetical_protein                                   271   2e-80    
ref|XP_004508952.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    273   2e-80    
ref|XP_010055434.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    273   3e-80    
ref|XP_003549939.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    272   3e-80    
ref|XP_010941432.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    271   2e-79    
ref|XP_003524096.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    271   2e-79    
emb|CDY42944.1|  BnaA01g18100D                                          269   3e-79    
ref|XP_007155702.1|  hypothetical protein PHAVU_003G224000g             268   3e-78    
ref|XP_006837394.1|  hypothetical protein AMTR_s00111p00135120          267   1e-77    
ref|XP_008776009.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   2e-77    
emb|CDY35617.1|  BnaC01g21390D                                          264   2e-77    
ref|XP_009631504.1|  PREDICTED: galactolipase DONGLE, chloroplast...    261   2e-77    
gb|ABR13259.1|  defective in anther dehiscence 1                        254   4e-77    Brassica rapa var. parachinensis [cai xin]
ref|XP_008798807.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    264   4e-77    
ref|XP_010919735.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    263   9e-77    
ref|XP_006349966.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    258   4e-76    
gb|ABR13260.1|  defective in anther dehiscence 1                        252   4e-76    Brassica oleracea var. botrytis [cauliflower]
gb|ABR13261.1|  defective in anther dehiscence 1                        252   5e-76    Brassica oleracea var. italica [asparagus broccoli]
ref|XP_010314737.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    258   3e-75    
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   6e-75    
gb|ACN30274.1|  defective in anther dehiscence 1                        248   9e-75    Brassica oleracea var. alboglabra
ref|XP_004298041.1|  PREDICTED: galactolipase DONGLE, chloroplast...    255   3e-74    
ref|XP_008791829.1|  PREDICTED: galactolipase DONGLE, chloroplastic     251   6e-74    
ref|XP_009589831.1|  PREDICTED: galactolipase DONGLE, chloroplast...    253   9e-74    
ref|XP_010258763.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    256   1e-73    
ref|XP_009407137.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    255   2e-73    
ref|XP_006364696.1|  PREDICTED: galactolipase DONGLE, chloroplast...    259   2e-73    
ref|XP_009791702.1|  PREDICTED: galactolipase DONGLE, chloroplast...    251   3e-73    
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein          253   4e-73    
ref|XP_002321113.2|  hypothetical protein POPTR_0014s14860g             249   9e-73    Populus trichocarpa [western balsam poplar]
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          251   2e-72    
ref|XP_002268142.1|  PREDICTED: galactolipase DONGLE, chloroplastic     249   4e-72    Vitis vinifera
ref|XP_004300345.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    251   4e-72    
ref|XP_010326961.1|  PREDICTED: galactolipase DONGLE, chloroplastic     248   4e-72    
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     248   4e-72    
gb|EAY79528.1|  hypothetical protein OsI_34658                          251   4e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_010025922.1|  PREDICTED: galactolipase DONGLE, chloroplast...    249   5e-72    
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    250   5e-72    
ref|XP_008222660.1|  PREDICTED: galactolipase DONGLE, chloroplastic     248   9e-72    
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    248   1e-71    
gb|KHN12425.1|  Phospholipase A1-Igamma1, chloroplastic                 256   2e-71    
ref|XP_009792730.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    249   2e-71    
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    249   2e-71    
ref|XP_007033998.1|  Alpha/beta-Hydrolases superfamily protein          247   2e-71    
ref|XP_008783953.1|  PREDICTED: galactolipase DONGLE, chloroplast...    246   2e-71    
ref|XP_007223991.1|  hypothetical protein PRUPE_ppa014790mg             246   3e-71    
ref|XP_006478993.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    246   3e-71    
ref|XP_009798317.1|  PREDICTED: galactolipase DONGLE, chloroplastic     246   4e-71    
ref|XP_009605461.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    248   5e-71    
ref|XP_006443133.1|  hypothetical protein CICLE_v10024085mg             246   5e-71    
emb|CDP14642.1|  unnamed protein product                                246   6e-71    
ref|XP_011000043.1|  PREDICTED: galactolipase DONGLE, chloroplastic     245   8e-71    
ref|XP_011073877.1|  PREDICTED: galactolipase DONGLE, chloroplastic     245   1e-70    
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    247   1e-70    
gb|ABR17156.1|  unknown                                                 246   1e-70    Picea sitchensis
ref|NP_001065393.2|  Os10g0562200                                       247   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    247   2e-70    
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    247   2e-70    
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    246   2e-70    
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    246   2e-70    
ref|XP_009339909.1|  PREDICTED: galactolipase DONGLE, chloroplastic     243   2e-70    
ref|XP_009417247.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    246   3e-70    
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    246   3e-70    
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    245   4e-70    
dbj|BAK07023.1|  predicted protein                                      246   4e-70    
ref|XP_002531054.1|  triacylglycerol lipase, putative                   245   5e-70    Ricinus communis
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    245   5e-70    
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    243   5e-70    
ref|XP_004244860.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   5e-70    
ref|XP_006364888.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   6e-70    
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   6e-70    
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    244   8e-70    
ref|XP_002301637.2|  hypothetical protein POPTR_0002s23240g             241   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_010105205.1|  Galactolipase DONGLE                               243   1e-69    
ref|XP_010235782.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    244   2e-69    
ref|XP_008439078.1|  PREDICTED: galactolipase DONGLE, chloroplast...    243   3e-69    
ref|XP_008380696.1|  PREDICTED: galactolipase DONGLE, chloroplastic     241   4e-69    
ref|XP_010930439.1|  PREDICTED: galactolipase DONGLE, chloroplast...    240   7e-69    
ref|XP_010245971.1|  PREDICTED: LOW QUALITY PROTEIN: galactolipas...    241   7e-69    
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     242   8e-69    
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg             242   8e-69    
ref|XP_011042808.1|  PREDICTED: galactolipase DONGLE, chloroplast...    240   1e-68    
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                239   1e-68    
emb|CAC39051.1|  lipase-like protein                                    242   1e-68    Oryza sativa [red rice]
ref|XP_010245170.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    242   1e-68    
ref|XP_009383384.1|  PREDICTED: galactolipase DONGLE, chloroplast...    239   1e-68    
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    241   1e-68    
ref|XP_003551855.1|  PREDICTED: galactolipase DONGLE, chloroplast...    241   2e-68    
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   2e-68    
ref|NP_001148115.1|  triacylglycerol lipase like protein                241   2e-68    Zea mays [maize]
ref|XP_011096641.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   2e-68    
gb|KDP42875.1|  hypothetical protein JCGZ_23817                         240   2e-68    
ref|XP_010912884.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    238   3e-68    
dbj|BAB89948.1|  putative DAD1                                          238   3e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    240   3e-68    
ref|XP_009403651.1|  PREDICTED: galactolipase DONGLE, chloroplast...    238   3e-68    
gb|KDO75376.1|  hypothetical protein CISIN_1g037474mg                   240   3e-68    
gb|ACN34318.1|  unknown                                                 241   3e-68    
ref|XP_006468077.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    240   4e-68    
ref|XP_004148168.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    239   4e-68    
ref|XP_004164687.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    239   4e-68    
ref|NP_001047607.1|  Os02g0653900                                       241   4e-68    
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                241   4e-68    
ref|XP_008794177.1|  PREDICTED: galactolipase DONGLE, chloroplast...    239   5e-68    
gb|EEE55822.1|  hypothetical protein OsJ_04428                          234   6e-68    
dbj|BAJ88767.1|  predicted protein                                      239   6e-68    
ref|XP_003530907.1|  PREDICTED: galactolipase DONGLE, chloroplast...    239   7e-68    
ref|XP_007024952.1|  Alpha/beta-Hydrolases superfamily protein          239   8e-68    
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       239   8e-68    
ref|XP_010543058.1|  PREDICTED: galactolipase DONGLE, chloroplastic     238   1e-67    
ref|XP_002454552.1|  hypothetical protein SORBIDRAFT_04g033150          239   2e-67    
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg             238   2e-67    
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    238   2e-67    
ref|XP_009401159.1|  PREDICTED: galactolipase DONGLE, chloroplast...    236   2e-67    
emb|CDY10148.1|  BnaC05g03910D                                          237   2e-67    
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    237   4e-67    
ref|XP_009420257.1|  PREDICTED: galactolipase DONGLE, chloroplast...    241   4e-67    
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    237   5e-67    
ref|XP_007139124.1|  hypothetical protein PHAVU_008G003400g             236   5e-67    
ref|XP_010457679.1|  PREDICTED: galactolipase DONGLE, chloroplastic     236   7e-67    
ref|NP_174326.1|  DAD1-like acylhydrolase                               237   9e-67    
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    236   1e-66    
ref|XP_009387098.1|  PREDICTED: galactolipase DONGLE, chloroplast...    235   1e-66    
gb|EPS66180.1|  hypothetical protein M569_08597                         233   1e-66    
ref|XP_010475298.1|  PREDICTED: galactolipase DONGLE, chloroplast...    234   1e-66    
gb|KFK42913.1|  hypothetical protein AALP_AA1G054600                    233   2e-66    
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         236   2e-66    
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         235   2e-66    
emb|CDX77597.1|  BnaA07g07350D                                          233   2e-66    
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    233   3e-66    
ref|XP_006304384.1|  hypothetical protein CARUB_v10010888mg             234   3e-66    
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    233   3e-66    
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           236   3e-66    
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    234   3e-66    
ref|XP_006417987.1|  hypothetical protein EUTSA_v10009478mg             233   4e-66    
gb|KHN11562.1|  Phospholipase A(1) DAD1, chloroplastic                  229   4e-66    
ref|NP_850148.1|  phospholipase A1-Igamma2                              233   6e-66    
gb|ABR16123.1|  unknown                                                 235   6e-66    
ref|XP_010910337.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    232   8e-66    
ref|XP_004979188.1|  PREDICTED: galactolipase DONGLE, chloroplast...    232   9e-66    
emb|CDY02287.1|  BnaA09g26150D                                          233   1e-65    
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             233   1e-65    
ref|XP_006852124.1|  hypothetical protein AMTR_s00049p00044160          229   1e-65    
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    233   1e-65    
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             233   1e-65    
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    232   1e-65    
emb|CDY09593.1|  BnaC05g23260D                                          233   2e-65    
ref|XP_009119115.1|  PREDICTED: galactolipase DONGLE, chloroplastic     232   2e-65    
emb|CDP21091.1|  unnamed protein product                                233   2e-65    
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg             233   2e-65    
ref|XP_004489153.1|  PREDICTED: galactolipase DONGLE, chloroplast...    232   3e-65    
emb|CDY22842.1|  BnaA06g02350D                                          232   3e-65    
emb|CAN74039.1|  hypothetical protein VITISV_012945                     232   4e-65    
ref|XP_003607369.1|  Lipase                                             232   4e-65    
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    232   5e-65    
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     231   5e-65    
ref|NP_001168442.1|  uncharacterized protein LOC100382214               230   5e-65    
ref|NP_565701.1|  phospholipase A1-Igamma2                              232   5e-65    
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    231   6e-65    
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             232   6e-65    
ref|XP_008678284.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    231   6e-65    
ref|XP_006827274.1|  hypothetical protein AMTR_s00010p00263480          230   6e-65    
ref|XP_004953316.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    232   7e-65    
ref|XP_002298419.2|  hypothetical protein POPTR_0001s27040g             230   8e-65    
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    231   8e-65    
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    231   1e-64    
ref|XP_009144055.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    230   1e-64    
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       231   1e-64    
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             231   1e-64    
ref|XP_001779106.1|  predicted protein                                  229   1e-64    
ref|NP_001145956.1|  hypothetical protein                               231   1e-64    
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   1e-64    
ref|XP_003621036.1|  Lipase                                             230   2e-64    
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   2e-64    
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   2e-64    
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   2e-64    
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   2e-64    
ref|XP_002879267.1|  lipase class 3 family protein                      230   2e-64    
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    230   2e-64    
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    228   3e-64    
dbj|BAJ91507.1|  predicted protein                                      231   3e-64    
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             230   3e-64    
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   3e-64    
emb|CDY49813.1|  BnaC06g04560D                                          229   3e-64    
ref|XP_003608599.1|  Lipase                                             229   4e-64    
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    230   4e-64    
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    230   4e-64    
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    229   4e-64    
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                    229   5e-64    
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    229   5e-64    
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    229   6e-64    
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          229   6e-64    
ref|XP_002889566.1|  lipase class 3 family protein                      228   7e-64    
ref|NP_563748.1|  galactolipase DONGLE                                  227   9e-64    
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    227   1e-63    
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    228   1e-63    
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             228   1e-63    
emb|CDY34503.1|  BnaC04g12960D                                          227   1e-63    
ref|XP_002450711.1|  hypothetical protein SORBIDRAFT_05g013160          226   1e-63    
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         227   2e-63    
gb|EYU32751.1|  hypothetical protein MIMGU_mgv1a019991mg                225   2e-63    
ref|XP_004972872.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    227   2e-63    
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    226   3e-63    
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             228   3e-63    
ref|XP_008674694.1|  PREDICTED: galactolipase DONGLE, chloroplast...    225   3e-63    
ref|XP_009399030.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    226   4e-63    
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    226   4e-63    
gb|ACF88082.1|  unknown                                                 224   4e-63    
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             226   5e-63    
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          227   5e-63    
emb|CDX97819.1|  BnaC04g41200D                                          226   6e-63    
emb|CDP09265.1|  unnamed protein product                                226   6e-63    
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             227   6e-63    
ref|XP_011047360.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    226   6e-63    
ref|XP_010940258.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    226   6e-63    
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    226   7e-63    
ref|NP_563772.1|  phospholipase A1-Igamma1                              224   7e-63    
ref|XP_010460828.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    226   7e-63    
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    226   7e-63    
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    226   8e-63    
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    226   8e-63    
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    226   9e-63    
ref|XP_002891639.1|  lipase class 3 family protein                      226   9e-63    
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    226   9e-63    
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             225   9e-63    
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             225   1e-62    
ref|XP_004963940.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    224   1e-62    
ref|NP_001060978.1|  Os08g0143600                                       224   1e-62    
ref|XP_002893614.1|  lipase class 3 family protein                      226   1e-62    
ref|XP_004972293.1|  PREDICTED: galactolipase DONGLE, chloroplast...    222   1e-62    
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    225   1e-62    
ref|XP_010478423.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    225   1e-62    
ref|XP_006304825.1|  hypothetical protein CARUB_v10012471mg             225   2e-62    
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    223   2e-62    
ref|XP_002443841.1|  hypothetical protein SORBIDRAFT_07g003150          224   2e-62    
ref|XP_010499568.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    225   2e-62    
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    223   3e-62    
ref|NP_849603.1|  phospholipase A1-Igamma1                              224   3e-62    
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             223   3e-62    
ref|NP_001130738.1|  Triacylglycerol lipase like protein                224   3e-62    
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    223   3e-62    
ref|XP_002892359.1|  lipase class 3 family protein                      224   3e-62    
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   4e-62    
ref|NP_001045105.2|  Os01g0900400                                       219   4e-62    
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    224   5e-62    
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   5e-62    
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    224   5e-62    
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    223   5e-62    
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             224   5e-62    
ref|NP_564590.1|  DAD1-like lipase 2                                    224   5e-62    
ref|NP_001067729.1|  Os11g0299300                                       222   6e-62    
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    223   6e-62    
emb|CDY29665.1|  BnaA04g17620D                                          224   6e-62    
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   7e-62    
ref|XP_011025479.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    223   8e-62    
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    223   8e-62    
emb|CDY54880.1|  BnaA10g27930D                                          221   9e-62    
ref|XP_003577614.1|  PREDICTED: galactolipase DONGLE, chloroplast...    221   1e-61    
ref|XP_009399031.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   1e-61    
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    221   1e-61    
ref|XP_008656977.1|  PREDICTED: galactolipase DONGLE, chloroplast...    221   1e-61    
gb|EAY80695.1|  hypothetical protein OsI_35877                          221   1e-61    
dbj|BAD17027.1|  putative DEFECTIVE IN ANTHER DEHISCENCE1               223   1e-61    
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    222   1e-61    
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    221   1e-61    
emb|CDY10228.1|  BnaC05g04710D                                          222   1e-61    
ref|XP_009405777.1|  PREDICTED: galactolipase DONGLE, chloroplast...    220   2e-61    
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    221   2e-61    
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    221   3e-61    
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    222   3e-61    
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    221   3e-61    
ref|XP_009389788.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    222   3e-61    
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             221   3e-61    
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   4e-61    
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             221   4e-61    
gb|ACJ76846.1|  chloroplast lipase protein                              221   4e-61    
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    221   6e-61    
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   7e-61    
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    220   7e-61    
ref|XP_010469684.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    219   8e-61    
ref|XP_002464922.1|  hypothetical protein SORBIDRAFT_01g028880          221   8e-61    
ref|XP_010234304.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    220   1e-60    
ref|XP_010414097.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    219   1e-60    
ref|XP_006296490.1|  hypothetical protein CARUB_v10025676mg             219   1e-60    
ref|XP_002272780.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    220   1e-60    
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    220   1e-60    
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    219   2e-60    
ref|XP_010064368.1|  PREDICTED: galactolipase DONGLE, chloroplast...    217   2e-60    
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    219   3e-60    
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                219   3e-60    
ref|XP_006410299.1|  hypothetical protein EUTSA_v10017922mg             218   3e-60    
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    219   4e-60    
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    219   4e-60    
ref|XP_004972292.1|  PREDICTED: galactolipase DONGLE, chloroplast...    216   4e-60    
ref|XP_002314049.2|  hypothetical protein POPTR_0009s06300g             219   4e-60    
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    218   5e-60    
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    217   5e-60    
ref|XP_010510171.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...    217   6e-60    
ref|XP_004983633.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    218   7e-60    
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    218   7e-60    
ref|XP_006647618.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    215   7e-60    
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   7e-60    
gb|KDO46424.1|  hypothetical protein CISIN_1g041669mg                   213   7e-60    
gb|EAY80693.1|  hypothetical protein OsI_35875                          216   7e-60    
ref|XP_002881190.1|  lipase class 3 family protein                      217   7e-60    
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    217   9e-60    
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    217   9e-60    
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    217   1e-59    
gb|KEH23857.1|  phospholipase A1                                        216   1e-59    
ref|XP_009614944.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    214   1e-59    
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    215   1e-59    
ref|XP_008784887.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    216   2e-59    
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    217   2e-59    
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   2e-59    
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   3e-59    



>ref|XP_009768377.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nicotiana 
sylvestris]
Length=436

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 308/379 (81%), Gaps = 16/379 (4%)
 Frame = -3

Query  1482  LKNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYG  1303
              + T SW    N  S  C VA DRAA+L  +WME+QGI++WEGLLDPLDD LRKEILRYG
Sbjct  49    FRITSSW----NPGSGHCSVA-DRAAELRHRWMEFQGIKNWEGLLDPLDDDLRKEILRYG  103

Query  1302  DFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT--  1129
             +FVEAAYR FDFD +SPTYATCRY  ++++T CGL  SGYKV +NLY TCAV +P WT  
Sbjct  104   EFVEAAYRCFDFDVSSPTYATCRYPTNSMLTDCGLDKSGYKVIKNLYATCAVQMPSWTKR  163

Query  1128  --NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDM  955
               NL SP SSWIGYVAVC+DE+EI RLGRRDVVIAYRGTAT  EWLENLRATLT LPDDM
Sbjct  164   FPNLASPCSSWIGYVAVCEDEEEIARLGRRDVVIAYRGTATSCEWLENLRATLTSLPDDM  223

Query  954   APRNC-EPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAA  778
             AP N  +PMVQ GFLSLYT+ ++   SL+D+IR+EI  I+E Y DEPLSIT+TGHSLGAA
Sbjct  224   APENYDQPMVQSGFLSLYTTKNECDQSLQDTIREEIGNILEKYSDEPLSITVTGHSLGAA  283

Query  777   LATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG  598
             LAT+TAYDITT+F HAP+VTVVSFGGPRVGNK+FR QLE SGT VLRIVNSDDPITKVPG
Sbjct  284   LATLTAYDITTKFSHAPIVTVVSFGGPRVGNKSFRCQLEKSGTNVLRIVNSDDPITKVPG  343

Query  597   FVVDSDD-VSDCGTTQ--PSGMLSWLQKCV-DSQWVYAEVGKELRvsskdssyskd--VA  436
             FV+D DD V++ G+     +G+ SWLQKC+ D+QWVYAEVGKELR+SSKDS + K   VA
Sbjct  344   FVLDEDDNVAEKGSAHVATTGLPSWLQKCMEDTQWVYAEVGKELRLSSKDSKFGKAGDVA  403

Query  435   TCHDLKTYLHCIDNWSSCK  379
             TCHDLKTYLH ++N+ S K
Sbjct  404   TCHDLKTYLHLVNNFVSEK  422



>ref|XP_009608624.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   479 bits (1234),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 307/379 (81%), Gaps = 16/379 (4%)
 Frame = -3

Query  1482  LKNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYG  1303
              + T SW    N  S  C V  DRAA+L  +WME+QGI++WEGLLDPLDD LRKEILRYG
Sbjct  49    FRITSSW----NPGSGHCSVG-DRAAELRHRWMEFQGIKNWEGLLDPLDDDLRKEILRYG  103

Query  1302  DFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT--  1129
             +FVEAAYR FDFD +SPT+ATCRY   +++T CGL  SGYKV +NLY TCAV +P WT  
Sbjct  104   EFVEAAYRCFDFDVSSPTHATCRYPTSSMLTDCGLDTSGYKVIKNLYATCAVQMPSWTKR  163

Query  1128  --NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDM  955
               NL SP SSWIGYVAVC+DE+EI RLGRRDVVIAYRGTAT  EWLENLRATLT LPDDM
Sbjct  164   FPNLASPCSSWIGYVAVCEDEEEIARLGRRDVVIAYRGTATSCEWLENLRATLTSLPDDM  223

Query  954   APRNC-EPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAA  778
             AP N  +PMVQ GFLSLYT+ ++   SL+D+IR+EI  +++ Y DEPLSIT+TGHSLGAA
Sbjct  224   APENYDQPMVQSGFLSLYTTKNECDQSLQDTIREEIGNVLDKYNDEPLSITVTGHSLGAA  283

Query  777   LATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG  598
             LAT+TAYDITT+F HAP+VTVVSFGGPR+GNK+FR QLE SGT VLRIVNSDDPITKVPG
Sbjct  284   LATLTAYDITTKFSHAPIVTVVSFGGPRIGNKSFRCQLEKSGTNVLRIVNSDDPITKVPG  343

Query  597   FVVDS-DDVSDCGTTQ--PSGMLSWLQKCV-DSQWVYAEVGKELRvsskdssyskd--VA  436
             FV+D  DDV++ G+     +G+ SWLQ+C+ D+QWVYAEVGKELR+SSKDS +SK   VA
Sbjct  344   FVIDGDDDVAERGSAHVATTGLPSWLQRCMEDTQWVYAEVGKELRLSSKDSKFSKAGDVA  403

Query  435   TCHDLKTYLHCIDNWSSCK  379
             TCHDLKTYLH ++N+ S K
Sbjct  404   TCHDLKTYLHLVNNFVSEK  422



>ref|XP_006348009.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
tuberosum]
Length=365

 Score =   474 bits (1221),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/353 (69%), Positives = 290/353 (82%), Gaps = 9/353 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++W+GLLDPLD+ LR EILRYG+FVEAAY  FDFDT+S TYATCRY + +++ +
Sbjct  1     MEFQGIKNWDGLLDPLDEDLRGEILRYGEFVEAAYGCFDFDTSSATYATCRYPKRSMLMQ  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
             CGLG SGYKV +NLY TCAV +PRW     NL SP+SSWIGYVAVCDD DEI RLGRRD+
Sbjct  61    CGLGRSGYKVVKNLYATCAVQMPRWIEKFPNLKSPQSSWIGYVAVCDDVDEITRLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAP-RNCEPMVQRGFLSLYTSASDAH-PSLKDS  865
             VIAYRGTAT  EWLENLRATLTCLPDDM+P  N EPMVQ G LS+YT+  + H PSL+++
Sbjct  121   VIAYRGTATCSEWLENLRATLTCLPDDMSPDENSEPMVQSGLLSMYTTKIEGHIPSLQET  180

Query  864   IRDEITKIIETYGDE-PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVG  688
             IR+EI  I+  Y DE  LSITITGHSLGAALAT+TAYDITT+F + P+VTV+SFGGPRVG
Sbjct  181   IREEIISILNNYSDEYSLSITITGHSLGAALATLTAYDITTKFNNLPMVTVLSFGGPRVG  240

Query  687   NKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-DS  511
             NK+FR QLE +GTKVLRIVNSDDPITKVPGFV+D DD++  G    + + SWL+K + D+
Sbjct  241   NKSFRYQLEKNGTKVLRIVNSDDPITKVPGFVIDDDDMAHRGDATVARVPSWLEKYMEDT  300

Query  510   QWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNW-SSCKCPLRATAK  355
             QWVYAEVGKEL++SSKDS    +VA CHDLKTYL+ ++N+ SS  CPLRAT +
Sbjct  301   QWVYAEVGKELKLSSKDSIRKGNVAKCHDLKTYLYLVNNFVSSSTCPLRATVR  353



>ref|XP_011093238.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic, partial [Sesamum 
indicum]
Length=346

 Score =   474 bits (1219),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 246/355 (69%), Positives = 288/355 (81%), Gaps = 18/355 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI DWEGLLDPLDD LR EILRYG+FVEAAYR FDFDT+S  YA CRY + +++T+
Sbjct  1     MEFQGINDWEGLLDPLDDGLRAEILRYGEFVEAAYRCFDFDTSSLGYAMCRYPKCSMLTQ  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             CG+G  GYKVT++LY TC V++P W      N +S + SWIGYVAVC+D+DEI RLGRRD
Sbjct  61    CGMGKKGYKVTKSLYATCGVHLPDWADHRIPNWMSNQFSWIGYVAVCNDKDEIARLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSI  862
             VVIAYRGTAT  EWLENLRATLT LP DM+P NCEPMVQ GFLSLYTS+     SL+DSI
Sbjct  121   VVIAYRGTATCMEWLENLRATLTSLPADMSPDNCEPMVQSGFLSLYTSSRGRRSSLQDSI  180

Query  861   RDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNK  682
             R+EI +I+  Y DEPLSIT+TGHSLGAALAT+TA+DITT F+HAPLVTVVSFGGPRVGNK
Sbjct  181   REEIERIVHKYADEPLSITVTGHSLGAALATLTAHDITTTFKHAPLVTVVSFGGPRVGNK  240

Query  681   NFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-DSQW  505
             +FR QLE SGTKVLRIVN DDPITKVPGFV++ +      TT+ S   +WLQK V D+QW
Sbjct  241   SFRCQLEKSGTKVLRIVNCDDPITKVPGFVLEEN------TTKTS---NWLQKRVEDTQW  291

Query  504   VYAEVGKELRvsskd--ssyskdVATCHDLKTYLHCIDNW-SSCKCPLRATAKRV  349
             VYAE+GKELR+SS+D     S +VATCHDLKTYLH +DN  SS  CPLRATA+++
Sbjct  292   VYAEIGKELRLSSRDCPHLSSGNVATCHDLKTYLHLVDNLVSSSSCPLRATARKI  346



>gb|KDP28861.1| hypothetical protein JCGZ_14632 [Jatropha curcas]
Length=440

 Score =   476 bits (1224),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 296/380 (78%), Gaps = 11/380 (3%)
 Frame = -3

Query  1431  CLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASP  1252
             C +A + +AKL  KW EYQGI +WEGLLDPLDD LR+EILRYG FVEAAYRSFDFD +SP
Sbjct  57    CHLATNYSAKLGKKWQEYQGINNWEGLLDPLDDKLRREILRYGQFVEAAYRSFDFDPSSP  116

Query  1251  TYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAV  1084
             TYAT ++  +++++R G+G +GY++T+NL  TC + +PRW +     VS +SSWIG+VAV
Sbjct  117   TYATSKFPRNSLLSRSGIGQTGYRMTKNLRATCGLQLPRWIDRAPSWVSTRSSWIGFVAV  176

Query  1083  CDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD----DMAPRNCEPMVQRGF  916
             C D+DEI RLGRRDVVIAYRGTAT  EWLEN RATLTCL D    ++   N  PMV+ GF
Sbjct  177   CQDKDEIARLGRRDVVIAYRGTATCLEWLENFRATLTCLADGEGTNVVGSNNGPMVESGF  236

Query  915   LSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR  736
             LSLYTS + A PSLK+ +R+EI ++I+ YGDEPLS TITGHSLGAALAT+TAYDI + F 
Sbjct  237   LSLYTSGTAACPSLKNMVREEIARVIKMYGDEPLSFTITGHSLGAALATLTAYDINSTFA  296

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
             +AP+VTV+SFGGPRVGN++FR QLEN GT++LRIVNSDD ITKVPGFV+D +D       
Sbjct  297   NAPMVTVISFGGPRVGNRSFRCQLENKGTRILRIVNSDDLITKVPGFVIDDNDTGKNRAV  356

Query  555   QPSGMLSWLQKCVDS-QWVYAEVGKELRvsskdssyskd--VATCHDLKTYLHCIDNWSS  385
               +G+ SWLQK V+S QWVYAEVG+ELR+SSK S Y     VATCH+L TYLH ID + S
Sbjct  357   HMAGVPSWLQKRVESTQWVYAEVGQELRLSSKQSPYLNKRDVATCHELSTYLHLIDGFVS  416

Query  384   CKCPLRATAKRVIEKNHGKR  325
               CP RATA++++ K+H ++
Sbjct  417   STCPFRATARKMLSKHHREK  436



>ref|XP_009790369.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nicotiana 
sylvestris]
Length=359

 Score =   472 bits (1214),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 247/363 (68%), Positives = 289/363 (80%), Gaps = 11/363 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++W+GLLDPLDD LR+EILRYG+FVEAAY  FDFD  S TYATCRY    ++T 
Sbjct  1     MEFQGIKNWDGLLDPLDDDLREEILRYGEFVEAAYCCFDFDMLSATYATCRYPTCTMLTH  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
             CGLG SGYKV +NL+ TCAV +PRWT    NLVSP+SSWIGYVAVCDD DEI RLGRRDV
Sbjct  61    CGLGQSGYKVIKNLHATCAVQMPRWTERFPNLVSPRSSWIGYVAVCDDVDEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             VIA+RGTAT  EWLENLRATLTCLPDDMAP N EPMVQ G LSLYTS ++ +PSL+D+IR
Sbjct  121   VIAFRGTATCSEWLENLRATLTCLPDDMAPENSEPMVQSGLLSLYTSKNEGNPSLQDTIR  180

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
             +EI  I+ TY +E LSIT+TGHSLGAALAT+TAYDITT+F   P+VTVVSFGGPRVGNK+
Sbjct  181   EEIGSILNTYSNESLSITVTGHSLGAALATLTAYDITTKFSDLPMVTVVSFGGPRVGNKS  240

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-DSQWV  502
             FR QLE +G KVLRIVNSDDPITKVPGFV+  DDV   G    + + SWL K + D+QWV
Sbjct  241   FRCQLEKNGIKVLRIVNSDDPITKVPGFVI--DDVESQGAATLARLTSWLGKYMEDTQWV  298

Query  501   YAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNHGKRR  322
             YAEVGKEL+     SS   +VA CHDLKTYLH ++N+ S  CPL ATAK+V+ K   + R
Sbjct  299   YAEVGKELK----LSSKGNNVAKCHDLKTYLHLVNNFVSSSCPLGATAKKVVSKRKQRER  354

Query  321   RVL  313
             + +
Sbjct  355   KAV  357



>ref|XP_009598667.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 254/398 (64%), Positives = 306/398 (77%), Gaps = 11/398 (3%)
 Frame = -3

Query  1488  STLKNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILR  1309
             S+LK + + +   N +   C V  D+  KL  +WME+QGI+DW+GLLDPLDD LR+EILR
Sbjct  36    SSLKLSTARSIKINNSDHNCHVVDDKD-KLGERWMEFQGIKDWDGLLDPLDDDLREEILR  94

Query  1308  YGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT  1129
             YG+FVEAAY  FDFDT+S TYATCRY + +++TRCGLG SGYKV ++L+ TCAV +PRWT
Sbjct  95    YGEFVEAAYCCFDFDTSSSTYATCRYPKGSMLTRCGLGQSGYKVLKDLHATCAVQMPRWT  154

Query  1128  ----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD  961
                 NLVSP+SSWIGYVAVCDD DEI RLGRRDVVIA+RGTAT  EWLENLR TLTCLP+
Sbjct  155   ERFPNLVSPRSSWIGYVAVCDDVDEIARLGRRDVVIAFRGTATCSEWLENLRVTLTCLPN  214

Query  960   DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGA  781
             DM P N EPMVQ G LSLYTS  +++PSL+D+IR EI  I+  Y +E LSIT+TGHSLGA
Sbjct  215   DMTPENSEPMVQSGLLSLYTSKIESNPSLQDTIRKEIASILSNYSNESLSITVTGHSLGA  274

Query  780   ALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVP  601
             ALAT+TAYDITT+F   P+VTVVSFGGPRVGNK+FR QLE +GTKVLRIVNSDDPITKVP
Sbjct  275   ALATLTAYDITTKFSDLPMVTVVSFGGPRVGNKSFRCQLEKNGTKVLRIVNSDDPITKVP  334

Query  600   GFVVDSDDVSDCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskdssyskdVAT---  433
             GFV+  DDV+  G    + +  WL K + D+ WVYAEVGKEL++SSK S           
Sbjct  335   GFVI--DDVASRGAATLARLPIWLGKYMEDTVWVYAEVGKELKLSSKSSPDHLSKGNVTK  392

Query  432   CHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNHGKRRR  319
             CHDLKTYLH ++N+ S  CPLR TAK+V+ K   + R+
Sbjct  393   CHDLKTYLHLVNNFVSSSCPLRTTAKKVVLKRKQRERK  430



>ref|XP_006367591.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
tuberosum]
Length=360

 Score =   458 bits (1179),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 243/347 (70%), Positives = 282/347 (81%), Gaps = 17/347 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++WEGLLDPLDD LRKEILRYG+FVEAAYR FDFD +SPTYATC Y + +++T 
Sbjct  1     MEFQGIKNWEGLLDPLDDDLRKEILRYGEFVEAAYRCFDFDMSSPTYATCLYPKSSMLTD  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             CGL  +GYKV +NLYGTC + +PRWT     NL SP+SSWIGYVAVCDDE EI RLGRRD
Sbjct  61    CGLDKTGYKVVKNLYGTCVIQMPRWTKKTFPNLASPQSSWIGYVAVCDDEKEIARLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC---EPMVQRGFLSLYTSASDAHPSLK  871
             VVIAYRGTAT  EWLEN RATLTCLPDDM   +    +PMVQ G LSLYT+ +    SL+
Sbjct  121   VVIAYRGTATSSEWLENFRATLTCLPDDMMTSDKNYDQPMVQSGLLSLYTTNTQCDQSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D+IR+EI KI++ Y DEPLSITITGHSLGAALAT+TAYDITT+F +AP+V+VVSFGGPRV
Sbjct  181   DTIREEIGKIVDNYSDEPLSITITGHSLGAALATLTAYDITTKFSNAPIVSVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVV--DSDDVSDCGTTQPSGMLSWLQKCV  517
             GNK+FR QLE SGT VLRIVNSDDP+TKVPGFV+  D DDV++  TT  + MLSWLQKC+
Sbjct  241   GNKSFRCQLEKSGTNVLRIVNSDDPVTKVPGFVIHDDIDDVAEKETT--TRMLSWLQKCM  298

Query  516   -DSQWVYAEVGKELRvssk----dssyskdVATCHDLKTYLHCIDNW  391
              DSQWVYAEVGKELR+SSK          +V TCHDLKTYLH +DN+
Sbjct  299   EDSQWVYAEVGKELRLSSKDLCPQIINKGNVVTCHDLKTYLHLVDNF  345



>ref|XP_007052320.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX96477.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=449

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 237/398 (60%), Positives = 295/398 (74%), Gaps = 14/398 (4%)
 Frame = -3

Query  1479  KNTKSWTTLGNAA--SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRY  1306
             +  KSW  L +    +    +   +A K+ ++W +YQGI++WEGLLDPLD+ LR EILRY
Sbjct  49    QRVKSWEHLLDPVDYNQTASLFTSKAVKIGNRWEQYQGIQNWEGLLDPLDENLRGEILRY  108

Query  1305  GDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT-  1129
             G FVEAAYRSFDFD++SPTYATCRY +   + R GL  +GY++TRNL  T  + +PRW  
Sbjct  109   GFFVEAAYRSFDFDSSSPTYATCRYPKSTFLDRSGLPETGYRLTRNLRATSGIQLPRWVE  168

Query  1128  ---NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-  961
                + V+ +SSWIGYVAVC D++EI RLGRRDVVIAYRGTAT  EWLENLRATLT LP+ 
Sbjct  169   KAPSWVATQSSWIGYVAVCQDKEEIARLGRRDVVIAYRGTATGLEWLENLRATLTPLPNA  228

Query  960   --DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSL  787
                  P   EPMV+ GFLSLYTS +   PSL++ IR+EI ++++TYGDEPLS+TITGHSL
Sbjct  229   DSKPGPDGSEPMVESGFLSLYTSGTAESPSLQEMIREEILRLLQTYGDEPLSLTITGHSL  288

Query  786   GAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITK  607
             GAALAT+TAYDI T F+ APLVTV+SFGGPRVGN++FR QLE  GTKVLRIVNSDD ITK
Sbjct  289   GAALATLTAYDIKTTFKRAPLVTVMSFGGPRVGNRSFRRQLEKQGTKVLRIVNSDDLITK  348

Query  606   VPGFVVDSD-DVSDCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdV  439
             VPGFV++ D DVS       +G+ SW+QK V D+QWVYAEVG+ELR+ S       + +V
Sbjct  349   VPGFVLEEDADVSKSQDIHVAGLPSWIQKRVEDTQWVYAEVGRELRLRSRDSPYLNTINV  408

Query  438   ATCHDLKTYLHCIDNWSSCKCPLRATAKRVIE-KNHGK  328
             ATCH+LKTYLH +  + S  CP RAT  RV++  N G+
Sbjct  409   ATCHELKTYLHLVSGFVSSTCPFRATVSRVLDYHNRGQ  446



>ref|XP_011032110.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Populus 
euphratica]
Length=441

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 313/435 (72%), Gaps = 20/435 (5%)
 Frame = -3

Query  1602  MRLYYTGIRPMDLMVSLSSKHRvvvvtassggaatSEFSTLKNTKSWTTLGNAASSKCLV  1423
             MRL     RP    ++ +SKH  +     +         +  +  S  +L +  S  C  
Sbjct  1     MRLAVVSTRPSSNTLASASKHLNLTHLNIT--------HSYNSQVSLPSLKHKLSVHCRD  52

Query  1422  AADRA-AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTY  1246
                R+ AKL  KWMEYQG+ +W+GLLDPLDD LR EILRYG FVEAAYRSF+FD +S TY
Sbjct  53    FISRSTAKLGKKWMEYQGVNNWDGLLDPLDDRLRSEILRYGLFVEAAYRSFNFDPSSSTY  112

Query  1245  ATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCD  1078
             AT ++  ++++ R G+G +GY+ T++L  TC + +PRW N     VS +SSWIGYVAVC 
Sbjct  113   ATSKFSRNSLLARSGIGETGYRTTKHLRATCGLQLPRWINRAPSWVSTQSSWIGYVAVCQ  172

Query  1077  DEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLP----DDMAPRNCEPMVQRGFLS  910
             D++EI RLGRRDVVIAYRGTAT  EW+ENLRATLT LP    D + P    PMV+ GFLS
Sbjct  173   DKEEIARLGRRDVVIAYRGTATCLEWVENLRATLTFLPGKHCDYVDPDGGGPMVESGFLS  232

Query  909   LYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHA  730
             LYTS +   PSL+D +R+EI +++E YGDEPLS TITGHSLGAALAT+TAYDI + F++A
Sbjct  233   LYTSQTATCPSLRDMVREEIARVMEMYGDEPLSFTITGHSLGAALATLTAYDINSTFKNA  292

Query  729   PLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQP  550
             P+VTV+SFGGPRVGN++FR QLE SGT++LRIVNSDD ITKVPGFV+D++D++     + 
Sbjct  293   PIVTVMSFGGPRVGNRSFRCQLEKSGTRILRIVNSDDLITKVPGFVIDNNDMASNRAVRV  352

Query  549   SGMLSWL-QKCVDSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCK  379
             +G+  WL Q+  D+QWVYAEVG+ELR+SSK+S     ++VATCH+L TYLH I+ + S  
Sbjct  353   AGLPCWLRQRVEDTQWVYAEVGRELRLSSKESPYLSKRNVATCHELSTYLHLINRFVSSA  412

Query  378   CPLRATAKRVIEKNH  334
             CP RATAK+V+ ++H
Sbjct  413   CPFRATAKKVLNRHH  427



>ref|XP_002511581.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF50250.1| triacylglycerol lipase, putative [Ricinus communis]
Length=446

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 235/389 (60%), Positives = 295/389 (76%), Gaps = 19/389 (5%)
 Frame = -3

Query  1449  NAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFD  1270
             N ++S C  A+ R  KL SKWMEYQGIR+WEGLL+PLDD LR EILRYG+FVEAAY SFD
Sbjct  57    NNSTSSC-SASQRPVKLGSKWMEYQGIRNWEGLLNPLDDNLRAEILRYGNFVEAAYNSFD  115

Query  1269  FDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSW  1102
             FD +SP YATCR+ +  ++ R GL  +GY++T++L  T  + +PRW     + V+ +SSW
Sbjct  116   FDPSSPAYATCRFQKSTLLERSGLPQTGYRLTKHLRATSGIQLPRWIEKAPSWVATQSSW  175

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD------DMAPRNC  940
             IGYVAVC D++EI RLGRRDVVI+YRGTAT  EWLENLRATL  +PD         P +C
Sbjct  176   IGYVAVCQDKEEISRLGRRDVVISYRGTATCLEWLENLRATLANIPDANSETETSGPCSC  235

Query  939   EPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITA  760
              PMV+ GFLSLYTS +   PSL++ +R+EI +++++YGDEPLS+TITGHSLGAALA +TA
Sbjct  236   GPMVESGFLSLYTSRTAMGPSLQEMVREEIQRLLQSYGDEPLSLTITGHSLGAALAILTA  295

Query  759   YDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD  580
             YDI T FR APLVTV+SFGGPRVGN++FR  LE  GTKVLRIVNSDD ITKVPGFV+D D
Sbjct  296   YDIKTTFRSAPLVTVISFGGPRVGNRSFRQHLEKQGTKVLRIVNSDDLITKVPGFVIDGD  355

Query  579   DVSDCGTTQP-----SGMLSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHD  424
             + ++    +      +G+  W+QK V ++QW YAEVGKELR+SSKDS    S +VATCH+
Sbjct  356   NDNENEVIKKRDVNIAGIPGWIQKRVEETQWAYAEVGKELRLSSKDSPYINSVNVATCHE  415

Query  423   LKTYLHCIDNWSSCKCPLRATAKRVIEKN  337
             LKTYLH ++ + S  CP RATAKRV+ K+
Sbjct  416   LKTYLHLVNGFVSSSCPFRATAKRVLSKH  444



>ref|XP_006367590.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
tuberosum]
Length=356

 Score =   448 bits (1153),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 237/347 (68%), Positives = 279/347 (80%), Gaps = 18/347 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++WEGLLDPLDD LRKEILRYG+FVEAAYR FDFD +SPTYATC Y + +++T 
Sbjct  1     MEFQGIKNWEGLLDPLDDDLRKEILRYGEFVEAAYRCFDFDMSSPTYATCLYPKSSMLTD  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             CGL  +GYKV +NLY TC V +PRWT     NL SP+SSWIGY+AVCDDE EI RLGRRD
Sbjct  61    CGLDKTGYKVVKNLYATCVVQMPRWTKKTFPNLASPQSSWIGYMAVCDDEKEIARLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC---EPMVQRGFLSLYTSASDAHPSLK  871
             VVIAYRGTAT  EWLEN RATLTCLPDDM   +    +PMVQ G L+LYT+ +    SL+
Sbjct  121   VVIAYRGTATSSEWLENFRATLTCLPDDMTTSDQNYDQPMVQSGLLNLYTTNTQCDQSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D+IR+EI KI++ Y DEPLSITITGHSLGAALAT+TA DITT+F +AP+V+VVSFGGPRV
Sbjct  181   DTIREEIGKILDKYRDEPLSITITGHSLGAALATLTACDITTKFSNAPIVSVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVV--DSDDVSDCGTTQ--PSGMLSWLQK  523
             GNK+FR QLE SGT VLRIVNSDDPITKVPGFV+  D DD+++ GTT    +GM SWLQK
Sbjct  241   GNKSFRCQLEKSGTNVLRIVNSDDPITKVPGFVIEDDIDDMAEKGTTHVASTGMPSWLQK  300

Query  522   CV-DSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSS  385
             C+ D+QWVYAEVGKELR      S   D+ATCHDLKTYL  ++N+ +
Sbjct  301   CMEDTQWVYAEVGKELR-----LSSKGDIATCHDLKTYLDLVNNYEN  342



>ref|XP_002511582.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF50251.1| triacylglycerol lipase, putative [Ricinus communis]
Length=443

 Score =   450 bits (1158),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 234/389 (60%), Positives = 294/389 (76%), Gaps = 19/389 (5%)
 Frame = -3

Query  1449  NAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFD  1270
             N + S C  A+ R  KL SKWMEYQGIR+WEGLLDPLDD LR EILRYG+FVEAAY SFD
Sbjct  54    NDSVSSC-SASRRPVKLGSKWMEYQGIRNWEGLLDPLDDNLRAEILRYGNFVEAAYNSFD  112

Query  1269  FDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSW  1102
             FD +SP YATCR+ +  ++ R GL  +GY++T++L  T  + +PRW     + V+ +SSW
Sbjct  113   FDPSSPAYATCRFPKSTLLERSGLPQTGYRLTKHLRATSGIQLPRWIEKAPSWVATQSSW  172

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD------DMAPRNC  940
             +GYVA C D++EI RLGRRDVVI+YRGTAT  EWLENLRATL  +PD        +P +C
Sbjct  173   MGYVADCQDKEEISRLGRRDVVISYRGTATCLEWLENLRATLANIPDADSDTKTSSPCSC  232

Query  939   EPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITA  760
              PMV+ GFLSLYTS +   PSL++ +R+EI +++++YGDEPLS+TITGHSLGAALA +TA
Sbjct  233   GPMVESGFLSLYTSRTAMGPSLQEMVREEIQRLLQSYGDEPLSLTITGHSLGAALAILTA  292

Query  759   YDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD  580
             YDI T FR APLVTV+SFGGPRVGN++FR  LE  GTKVLRIVNSDD ITKVPGFV+D D
Sbjct  293   YDIKTTFRSAPLVTVISFGGPRVGNRSFRQHLEKQGTKVLRIVNSDDLITKVPGFVIDGD  352

Query  579   DVSDCGTTQP-----SGMLSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHD  424
             + ++    +      +G+  W+QK V ++QW YAEVGKELR+SSKDS    S +VATCH+
Sbjct  353   NDNENEVIKKRDVNIAGIPGWIQKRVEETQWAYAEVGKELRLSSKDSPYINSVNVATCHE  412

Query  423   LKTYLHCIDNWSSCKCPLRATAKRVIEKN  337
             LKTYLH ++ + S  CP RATAKRV+ K+
Sbjct  413   LKTYLHLVNGFVSSSCPFRATAKRVLGKH  441



>gb|KDO85502.1| hypothetical protein CISIN_1g035710mg [Citrus sinensis]
Length=420

 Score =   448 bits (1152),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/372 (61%), Positives = 282/372 (76%), Gaps = 13/372 (3%)
 Frame = -3

Query  1425  VAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTY  1246
             +A D AAKL + WME QG  +WEGLLDPLD  LR E+LRYG FVEA YR FDFD +SPTY
Sbjct  46    LAYDSAAKLGNNWMEIQGSNNWEGLLDPLDQNLRSELLRYGQFVEATYRCFDFDPSSPTY  105

Query  1245  ATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCD  1078
             ATC+Y  ++ +TR G+  +GY++T++L  TC V++PRW +     +S +SSWIGYVAVC 
Sbjct  106   ATCKYPRNSFLTRLGIAETGYRMTKHLRATCGVHLPRWLDRAPSWMSTQSSWIGYVAVCQ  165

Query  1077  DEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCL--PDDMAP----RNCEPMVQRGF  916
             D+ EI RLGRRDVVIAYRGTAT  EWLENLRATLT    PDD+A     R   PMVQ GF
Sbjct  166   DKKEIARLGRRDVVIAYRGTATCLEWLENLRATLTACWPPDDVATSVHLRPSTPMVQTGF  225

Query  915   LSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR  736
              SLYTS++D  PSL++ +R+EI ++++ YGDEPLSITITGHSLGAALAT+TAYDI + F 
Sbjct  226   FSLYTSSTDTCPSLQEMVREEIKRVLDLYGDEPLSITITGHSLGAALATLTAYDINSTFN  285

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
             +AP+VTV+SFGGPRVGN++FR QLE SGTK+LRIVNSDD ITKVPGFV+D  DV++    
Sbjct  286   NAPMVTVISFGGPRVGNRSFRCQLEKSGTKILRIVNSDDLITKVPGFVIDDYDVANKQAV  345

Query  555   QPSGMLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSS  385
               + + SWLQK V ++ WVYA+VGKELR+SS         +VATCHDL TYLH +  + S
Sbjct  346   NVAALPSWLQKRVQNTHWVYADVGKELRLSSRDSPFLSKVNVATCHDLSTYLHLVKGFVS  405

Query  384   CKCPLRATAKRV  349
               CP +ATA+++
Sbjct  406   STCPFKATARKL  417



>ref|XP_002270992.2| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Vitis vinifera]
Length=434

 Score =   446 bits (1146),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 297/401 (74%), Gaps = 13/401 (3%)
 Frame = -3

Query  1491  FSTLKNTKSWTTLGNAASSKCLVAAD--RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKE  1318
             F   + +K+W  L      + + +    R  KL  +WMEYQGIR+W+GLLDPLDD LR E
Sbjct  38    FMEKRGSKNWEGLRKEVEGQWVHSRGNPRLVKLGKRWMEYQGIRNWDGLLDPLDDKLRCE  97

Query  1317  ILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVP  1138
             ILRYGDFV+A Y++FDFD++SPTYATC + ++ ++   GL  +GY+ TRNL  T  + +P
Sbjct  98    ILRYGDFVDATYKAFDFDSSSPTYATCLFPKNFILDGAGLPNTGYRPTRNLRATSGIQLP  157

Query  1137  RW----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTC  970
             RW    ++ V+ +SSWIGYVAVC D++EI RLGRRDVVIAYRGTAT  EWLENLRATLT 
Sbjct  158   RWIKKASSWVATESSWIGYVAVCQDKEEIARLGRRDVVIAYRGTATCLEWLENLRATLTP  217

Query  969   LPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHS  790
             LP   A  +C  MV+RGFLSLYTS +   PSL+D +R+E+  ++++YGDEPLS+TITGHS
Sbjct  218   LPS--AHSDC--MVERGFLSLYTSRTATSPSLQDLVREEVASLLQSYGDEPLSLTITGHS  273

Query  789   LGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPIT  610
             LGAALA +TAYDI T F  APLVTVVSFGGPRVGN NFR QLE  GTKVLRIVNSDD IT
Sbjct  274   LGAALAILTAYDIKTTFSRAPLVTVVSFGGPRVGNGNFRFQLERQGTKVLRIVNSDDLIT  333

Query  609   KVPGFVVDSDDVSDCGTTQPSGMLSWL-QKCVDSQWVYAEVGKELRvsskds--syskdV  439
             KVPGFV+D + V+     + SG+ SW+ ++ VD+QW+YA+VG+ELR+ S+DS    S +V
Sbjct  334   KVPGFVIDDNGVAGDHDVRVSGLPSWIPKRVVDTQWLYADVGRELRLRSRDSPYLGSINV  393

Query  438   ATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNHGKRRRV  316
             ATCHDL+TYLH +D + S KCP R   K+VI+    ++ RV
Sbjct  394   ATCHDLRTYLHLVDGFVSSKCPFRPMIKKVIKSYGAQKIRV  434



>ref|XP_006375138.1| hypothetical protein POPTR_0014s04700g [Populus trichocarpa]
 gb|ERP52935.1| hypothetical protein POPTR_0014s04700g [Populus trichocarpa]
Length=368

 Score =   442 bits (1136),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/356 (63%), Positives = 280/356 (79%), Gaps = 11/356 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+ +W+GLLDPLDD LR EILRYG FVEAAYRSF+FD +S TYAT ++  ++++ R
Sbjct  1     MEYQGVNNWDGLLDPLDDRLRSEILRYGLFVEAAYRSFNFDPSSSTYATSKFSRNSLLAR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G+G +GY+ T++L  TC + +PRW N     VS +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    SGIGETGYRTTKHLRATCGLQLPRWINRAPSWVSAQSSWIGYVAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP----DDMAPRNCEPMVQRGFLSLYTSASDAHPSLK  871
             VIAYRGTAT  EW+ENLRATLTCLP    D + P    PMV+ GFLSLYTS +   PSL+
Sbjct  121   VIAYRGTATCLEWVENLRATLTCLPGKHCDYVDPDGGGPMVESGFLSLYTSQTATCPSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D +R+EI +++E YGDEPLS TITGHSLGAALAT+TAYDI + F++AP+VTV+SFGGPRV
Sbjct  181   DMVREEIARVMEMYGDEPLSFTITGHSLGAALATLTAYDINSTFKNAPIVTVMSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL-QKCVD  514
             GN++FR QLE SGT++LRIVNSDD ITKVPGFV+D++D++       +G+  WL Q+  D
Sbjct  241   GNRSFRCQLEKSGTRILRIVNSDDLITKVPGFVIDNNDMARNRAVHVAGLPCWLRQRVED  300

Query  513   SQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
             +QWVYAEVG+ELR+SSK+S     +DVATCHDL TYLH I+ + S  CP RATAK+
Sbjct  301   TQWVYAEVGRELRLSSKESPYLSKRDVATCHDLSTYLHLINRFVSSTCPFRATAKK  356



>ref|XP_007052318.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96475.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=436

 Score =   444 bits (1143),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 236/398 (59%), Positives = 301/398 (76%), Gaps = 19/398 (5%)
 Frame = -3

Query  1467  SWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEA  1288
             SWT L + +    L     +AKL   WMEYQG+ +W+GLLDPLDD LR EILRYG FVEA
Sbjct  44    SWTPLKHGS----LFTHSSSAKLARNWMEYQGMNNWDGLLDPLDDTLRSEILRYGQFVEA  99

Query  1287  AYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN----LV  1120
             AYRSFDFD +SPT+ATC++ +++++TR  +G +GYK T+NL  TC + +PRW +     +
Sbjct  100   AYRSFDFDPSSPTFATCKFPKNSLLTRSCIGETGYKPTKNLRATCGIQLPRWIDRGPSWL  159

Query  1119  SPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAP---  949
             S +SSWIGYVAVC D++EI RLGRRDVVIA+RGTAT  EWLENLRATLT LPDD+A    
Sbjct  160   STQSSWIGYVAVCQDKEEIARLGRRDVVIAFRGTATCLEWLENLRATLTSLPDDVANVCL  219

Query  948   --RNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAAL  775
                 C  MV+ GFLSLYTS + A PSL++ +R+EI +++E YGDEPLS+TITGHSLGAAL
Sbjct  220   KRSGCGSMVESGFLSLYTSGTAACPSLQNMVREEIGRVLEMYGDEPLSLTITGHSLGAAL  279

Query  774   ATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGF  595
             AT+ A+DI + F +AP+VTV+SFGGPRVGN++FR QLE SGTK+LRIVNSDD ITKVPGF
Sbjct  280   ATLAAHDINSTFSNAPMVTVISFGGPRVGNQSFRCQLERSGTKILRIVNSDDLITKVPGF  339

Query  594   VVDSDDVSDCGTTQPSGMLSWLQK-CVDSQWVYAEVGKELRvsskd--ssyskdVATCHD  424
             V+D++D++D      +G+ SW+QK  VDSQ VYA+VG+ELR+SSK+        VATCH+
Sbjct  340   VIDNNDMADKQAVNVAGLPSWVQKRVVDSQLVYADVGQELRLSSKECPHLSKGGVATCHE  399

Query  423   LKTYLHCIDNWSSCKCPLRATAKRVIEKNHGKRRRVLA  310
             L TYL  ++ + S  CP RATA+RV+ K+   RR  LA
Sbjct  400   LSTYLQLVNGFVSSNCPFRATARRVLSKH---RREKLA  434



>gb|KDP28862.1| hypothetical protein JCGZ_14633 [Jatropha curcas]
Length=431

 Score =   443 bits (1139),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 288/391 (74%), Gaps = 16/391 (4%)
 Frame = -3

Query  1479  KNTKSWTTLGNAASS---KCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILR  1309
             K+ K W  L +   S     L AA R  KL  KWM+YQGI++WEG+LDPLDD LR EILR
Sbjct  39    KHPKKWERLLDPVDSDPFSYLSAASRPVKLADKWMDYQGIQNWEGMLDPLDDNLRGEILR  98

Query  1308  YGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT  1129
             YG FV+AAY+SFDFD +S TYATCR+ ++ ++ R GL  +GY+ T+NL  T  V +PRW 
Sbjct  99    YGGFVDAAYKSFDFDPSSSTYATCRFPKNTLLDRSGLPETGYRPTKNLRATSGVQLPRWI  158

Query  1128  ----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD  961
                 + V+ +SSWIGYVAVC D++EI RLGRRDVVIAYRGTAT  EWLENLRATL  LPD
Sbjct  159   EKAPSWVATQSSWIGYVAVCQDKEEIARLGRRDVVIAYRGTATCLEWLENLRATLAHLPD  218

Query  960   ---DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHS  790
                D +     PMV+ GFLSLYTS     PSL++ +R+EI +++E+YGDEPLS+TITGHS
Sbjct  219   ADSDKSTARYAPMVESGFLSLYTSRPTVGPSLQEMVREEIHRLLESYGDEPLSLTITGHS  278

Query  789   LGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPIT  610
             LGAALA +TAYDI T F+ APLVTV+SFGGPRVGN++FR  LE  GTKVLRIVNSDD IT
Sbjct  279   LGAALAILTAYDIKTTFKRAPLVTVISFGGPRVGNRSFRQHLEKQGTKVLRIVNSDDLIT  338

Query  609   KVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVDS-QWVYAEVGKELRvsskds--syskdV  439
             KVPGFV+D ++         +G+ SWLQK V+  Q VYA+VG+ELR+SSKDS      +V
Sbjct  339   KVPGFVIDGENDQKMNV---AGLPSWLQKQVEQMQLVYADVGRELRLSSKDSPYMNGVNV  395

Query  438   ATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
             A CH+LKTYLH ++ + S  CP RATA+RV+
Sbjct  396   ARCHELKTYLHLVNGFVSSSCPFRATARRVL  426



>ref|XP_004240207.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
lycopersicum]
Length=344

 Score =   437 bits (1125),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 231/345 (67%), Positives = 274/345 (79%), Gaps = 17/345 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++WEGLLDPLDD LRKEILRYG+FVEAAYR FDFD +SPTYATC Y + +++T 
Sbjct  1     MEFQGIKNWEGLLDPLDDDLRKEILRYGEFVEAAYRCFDFDMSSPTYATCLYPKSSMLTD  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
              GL  +GYKV +NLY TC V +PRWT     NL SP+SSWIGYVAVCDDE EI RLGRRD
Sbjct  61    SGLDKTGYKVIKNLYATCVVQMPRWTKKTFPNLASPRSSWIGYVAVCDDEKEITRLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC---EPMVQRGFLSLYTSASDAHPSLK  871
             VVIAYRGTAT  EWLEN RATLTCLPDDM   +    +PMVQ G L+LYT+ +    SL+
Sbjct  121   VVIAYRGTATSSEWLENFRATLTCLPDDMTTFDENYDQPMVQSGLLNLYTTNTQCDQSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D+IR+EI+KI++ Y DEPLSITITGHSLGAALAT+TA DITT+F +AP+V+VVSFGGPRV
Sbjct  181   DTIREEISKILDKYNDEPLSITITGHSLGAALATLTACDITTKFSNAPIVSVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ--PSGMLSWLQKCV  517
             GNK+FR  LE +GT +LRIVNSDDPITKVPGFV+D DD+ D   +    +GM SWLQK +
Sbjct  241   GNKSFRCLLEKNGTNILRIVNSDDPITKVPGFVID-DDIDDMAESHVASTGMPSWLQKFM  299

Query  516   -DSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSS  385
              D+QWVYAEVGKELR      S   D+ATCHDLKTYL  ++N+ +
Sbjct  300   EDTQWVYAEVGKELR-----LSSKGDIATCHDLKTYLDLVNNYEN  339



>ref|XP_006367588.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
tuberosum]
Length=345

 Score =   437 bits (1124),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 232/342 (68%), Positives = 270/342 (79%), Gaps = 18/342 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++WEGLLDPLDD LRKEILRYG FVEAAYR FDFD +SP+YATC Y + +++T 
Sbjct  1     MEFQGIKNWEGLLDPLDDDLRKEILRYGKFVEAAYRCFDFDMSSPSYATCLYPKSSMLTN  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             CGL  +GYKV +NLY TC V +P+WT     NL SP+ SWIGYVA+CDD  EI RLGRRD
Sbjct  61    CGLDKTGYKVVKNLYATCVVQMPQWTKKTFPNLASPRCSWIGYVAICDDAKEITRLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC---EPMVQRGFLSLYTSASDAHPSLK  871
             VVIAYRGTAT  EWLENLRATLTCLPDDM   N    +PMVQ G LSLYT+ +    SL+
Sbjct  121   VVIAYRGTATSSEWLENLRATLTCLPDDMMTSNENYDQPMVQSGLLSLYTTNTQCDQSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D+IR EI KI++ Y DE LSITITGHSLGAALAT+TA DITT+F +AP+V+VVSFGGPRV
Sbjct  181   DTIRVEIGKILDKYSDEALSITITGHSLGAALATLTACDITTKFSNAPIVSVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVV--DSDDVSDCGTTQPSG--MLSWLQK  523
             GNK+FR QLE SGT VLRIVNSDDP+TKVPGFV+  D DDV++  TT  +   M SWLQK
Sbjct  241   GNKSFRCQLEKSGTNVLRIVNSDDPVTKVPGFVIHDDIDDVAERETTHVASTRMPSWLQK  300

Query  522   CV-DSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
             C+ D+QWVYAEVGKELR      +   D+ATCHDLKTYLH +
Sbjct  301   CMEDTQWVYAEVGKELR-----LNSKGDIATCHDLKTYLHLV  337



>ref|XP_004231145.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
lycopersicum]
Length=365

 Score =   438 bits (1126),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 236/353 (67%), Positives = 282/353 (80%), Gaps = 9/353 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI +W+GLLDPLDD LR EILRYG+FVEAAY  FDFDT+S TYATCRY + +++ +
Sbjct  1     MEFQGINNWDGLLDPLDDDLRGEILRYGEFVEAAYGCFDFDTSSATYATCRYPKRSMLMQ  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GLG SGYKV +NL+ TCAV +PRW     NL SP+SSWIGYVAVCDD DEI RLGRRD+
Sbjct  61    RGLGRSGYKVVKNLHATCAVQMPRWLEKFPNLKSPQSSWIGYVAVCDDMDEIARLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAP-RNCEPMVQRGFLSLYTSASDAH-PSLKDS  865
             VIAYRGT T  EWLENLR TLTCLPDDM+P  N +PMVQ G LS+YT+  + H PSL+++
Sbjct  121   VIAYRGTVTYSEWLENLRVTLTCLPDDMSPNENNKPMVQSGLLSMYTTKIEGHMPSLQET  180

Query  864   IRDEITKIIETYGDE-PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVG  688
             IR+EI  I+  Y DE  LSITITGHSLGAALAT+TAYD+TT+F + P+VTV+SFGGPRVG
Sbjct  181   IREEIISILNNYSDEYSLSITITGHSLGAALATLTAYDVTTKFNNLPMVTVLSFGGPRVG  240

Query  687   NKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-DS  511
             NK+FR QLE +GTKVLRIVNSDDPITKVPG V+D DDV+  G    + + SWL K + D+
Sbjct  241   NKSFRYQLEKNGTKVLRIVNSDDPITKVPGIVIDDDDVAHRGDAMVARLPSWLDKYMEDA  300

Query  510   QWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNW-SSCKCPLRATAK  355
              WVYAEVGKEL++SSKDS     VA CHDLKTYL+ ++N+ SS  CPLRAT +
Sbjct  301   PWVYAEVGKELKLSSKDSIRKGSVAKCHDLKTYLYLVNNFVSSSTCPLRATVR  353



>emb|CAN61096.1| hypothetical protein VITISV_007353 [Vitis vinifera]
Length=360

 Score =   437 bits (1124),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/364 (62%), Positives = 282/364 (77%), Gaps = 11/364 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGIR+W+GLLDPLDD LR EILRYGDFV+A Y++FDFD++SPTYATC + ++ ++  
Sbjct  1     MEYQGIRNWDGLLDPLDDKLRCEILRYGDFVDATYKAFDFDSSSPTYATCLFPKNFILDG  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRW----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  +GY+ TRNL  T  + +PRW    ++ V+ +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    AGLPNTGYRPTRNLRATSGIQLPRWIKKASSWVATESSWIGYVAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             VIAYRGTAT  EWLENLRATLT LP   A  +C  MV+RGFLSLYTS +   PSL+D +R
Sbjct  121   VIAYRGTATCLEWLENLRATLTPLPS--AHSDC--MVERGFLSLYTSRTATSPSLQDLVR  176

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
             +E+  ++++YGDEPLS+TITGHSLGAALA +TAYDI T F  APLVTVVSFGGPRVGN+N
Sbjct  177   EEVASLLQSYGDEPLSLTITGHSLGAALAILTAYDIKTTFSRAPLVTVVSFGGPRVGNRN  236

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK-CVDSQWV  502
             FR QLE  GTK+LRIVNSDD ITKVPGFV+D + V+     + SG+ SW+ K  VD+QW+
Sbjct  237   FRCQLERQGTKILRIVNSDDLITKVPGFVIDDNGVAGDHDVRVSGLPSWIPKRVVDTQWL  296

Query  501   YAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNHGK  328
             YA+VG+ELR+ S+DS    S +VATCHDL+TYLH +D + S KCP R   K+VI+    +
Sbjct  297   YADVGRELRLRSRDSPYLGSINVATCHDLRTYLHLVDGFVSSKCPFRPMIKKVIKSYGAQ  356

Query  327   RRRV  316
             + RV
Sbjct  357   KIRV  360



>emb|CBI16669.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   437 bits (1123),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 278/364 (76%), Gaps = 11/364 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGIR+W+GLLDPLDD LR EILRYGDFV+A Y++FDFD++SPTYATC + ++ ++  
Sbjct  1     MEYQGIRNWDGLLDPLDDKLRCEILRYGDFVDATYKAFDFDSSSPTYATCLFPKNFILDG  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRW----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  +GY+ TRNL  T  + +PRW    ++ V+ +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    AGLPNTGYRPTRNLRATSGIQLPRWIKKASSWVATESSWIGYVAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             VIAYRGTAT  EWLENLRATLT LP   A  +C  MV+RGFLSLYTS +   PSL+D +R
Sbjct  121   VIAYRGTATCLEWLENLRATLTPLPS--AHSDC--MVERGFLSLYTSRTATSPSLQDLVR  176

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
             +E+  ++++YGDEPLS+TITGHSLGAALA +TAYDI T F  APLVTVVSFGGPRVGN N
Sbjct  177   EEVASLLQSYGDEPLSLTITGHSLGAALAILTAYDIKTTFSRAPLVTVVSFGGPRVGNGN  236

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK-CVDSQWV  502
             FR QLE  GTKVLRIVNSDD ITKVPGFV+D + V+     + SG+ SW+ K  VD+QW+
Sbjct  237   FRFQLERQGTKVLRIVNSDDLITKVPGFVIDDNGVAGDHDVRVSGLPSWIPKRVVDTQWL  296

Query  501   YAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNHGK  328
             YA+VG+ELR+ S       S +VATCHDL+TYLH +D + S KCP R   K+VI+    +
Sbjct  297   YADVGRELRLRSRDSPYLGSINVATCHDLRTYLHLVDGFVSSKCPFRPMIKKVIKSYGAQ  356

Query  327   RRRV  316
             + RV
Sbjct  357   KIRV  360



>ref|XP_006397662.1| hypothetical protein EUTSA_v10001768mg [Eutrema salsugineum]
 gb|ESQ39115.1| hypothetical protein EUTSA_v10001768mg [Eutrema salsugineum]
Length=358

 Score =   434 bits (1117),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 223/362 (62%), Positives = 280/362 (77%), Gaps = 17/362 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+++WEGLLDPLD+ LR+EILRYG FVE+AY+SFDFD +SPTYATCR+    ++ R
Sbjct  1     MEYQGLQNWEGLLDPLDENLRREILRYGKFVESAYQSFDFDPSSPTYATCRFSRSTLLDR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  SGY++T+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    SGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEISRLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDD------MAPRNCEPMVQRGFLSLYTSASDAHPS  877
             VI++RGTAT  EWLENLRATLT LPDD      +   N  PMV+ GFLSLYTS   AH S
Sbjct  121   VISFRGTATCLEWLENLRATLTHLPDDGPTGPNLNGSNSGPMVESGFLSLYTSG--AH-S  177

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGP  697
             L+D +R+EI +++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+VTV+SFGGP
Sbjct  178   LRDMVREEIARLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGP  237

Query  696   RVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV  517
             RVGN++FR  LE  GTKVLRIVNSDD ITKVPG V+DS D  D      + M SW+Q+ V
Sbjct  238   RVGNRSFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDSRDQQD-NVKMTASMPSWIQRRV  296

Query  516   -DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              ++ WVYAEVGKELR+SS+DS    S +VATCH+LKTYLH +D + S  CP R TA+RV+
Sbjct  297   EETPWVYAEVGKELRLSSRDSPYVNSINVATCHELKTYLHLVDGFVSSTCPFRETARRVL  356

Query  345   EK  340
              +
Sbjct  357   HR  358



>ref|XP_004240206.2| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
lycopersicum]
Length=365

 Score =   434 bits (1117),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 229/347 (66%), Positives = 276/347 (80%), Gaps = 16/347 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME+QGI++WEGLLDPLDD LRKEILRYG+FVEAAYR FDFD +SPTYATC Y + ++++ 
Sbjct  1     MEFQGIKNWEGLLDPLDDDLRKEILRYGEFVEAAYRCFDFDMSSPTYATCLYPKSSMLSD  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             CGL  +GYKV +NL  TC V +PRWT     NL SP+SSW GYVA+CDDE EI RLGRRD
Sbjct  61    CGLDKTGYKVVKNLCATCVVQMPRWTKKMFPNLASPRSSWFGYVAICDDEKEIARLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC---EPMVQRGFLSLYTSASDAHPSLK  871
             +VIAYRGTAT  EWLENLRATLTCLPDDM   +    +PMVQ G L+LYT+ +    SL+
Sbjct  121   IVIAYRGTATSSEWLENLRATLTCLPDDMTTFDENYDQPMVQSGLLNLYTTNTQCDQSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D+IR+EI+KI++ Y DEPLSITITGHSLGAALAT+TA DITT+F +AP+V+VVSFGGPRV
Sbjct  181   DTIREEISKILDKYNDEPLSITITGHSLGAALATLTACDITTKFSNAPIVSVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ--PSGMLSWLQKCV  517
             GNK+FR  LE + T +LRIVNSDDPITKVPGFV+D DD+ D   +    +GM SWLQKC+
Sbjct  241   GNKSFRCLLEKNNTNILRIVNSDDPITKVPGFVID-DDIDDMAESHVASTGMPSWLQKCM  299

Query  516   -DSQWVYAEVGKELRvss----kdssyskdVATCHDLKTYLHCIDNW  391
              D+QWVYAEVGKELR+SS    +      +VA CHDLKTYL+ +DN+
Sbjct  300   EDTQWVYAEVGKELRLSSNDLCQQIINKGNVAMCHDLKTYLYLLDNF  346



>ref|XP_006464837.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Citrus 
sinensis]
Length=362

 Score =   433 bits (1113),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 273/359 (76%), Gaps = 13/359 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME QG  +WEGLLDPLD  LR E+LRYG FVEA YR FDFD +SPTYATC+Y  ++ +TR
Sbjct  1     MEIQGSNNWEGLLDPLDQNLRSELLRYGQFVEATYRCFDFDPSSPTYATCKYPRNSFLTR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G+  +GY++T++L  TC V++PRW +     +S +SSWIGYVAVC D+ EI RLGRRDV
Sbjct  61    SGIAETGYRMTKHLRATCGVHLPRWLDRAPSWMSTQSSWIGYVAVCQDKKEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCL--PDDMAP----RNCEPMVQRGFLSLYTSASDAHPS  877
             VIAYRGTAT  EWLENLRATLT    PDD+A     R   PMVQ GF SLYTS++D  PS
Sbjct  121   VIAYRGTATCLEWLENLRATLTACWPPDDVATSVHLRPSTPMVQTGFFSLYTSSTDTCPS  180

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGP  697
             L++ +R+EI ++++ YGDEPLSITITGHSLGAALAT+TAYDI + F +AP+VTV+SFGGP
Sbjct  181   LQEMVREEIKRVLDLYGDEPLSITITGHSLGAALATLTAYDINSTFNNAPMVTVISFGGP  240

Query  696   RVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV  517
             RVGN++FR QLE SGTK+LRIVNSDD ITKVPGFV+D  DV++      + + SWLQK V
Sbjct  241   RVGNRSFRCQLEKSGTKILRIVNSDDLITKVPGFVIDDYDVANKQAVNVAALPSWLQKRV  300

Query  516   -DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRV  349
              ++ WVYA+VGKELR+SS         +VATCHDL TYLH +  + S  CP +ATA+++
Sbjct  301   QNTHWVYADVGKELRLSSRDSPFLSKVNVATCHDLSTYLHLVKGFVSSTCPFKATARKL  359



>ref|XP_008232525.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Prunus 
mume]
Length=455

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/366 (60%), Positives = 279/366 (76%), Gaps = 15/366 (4%)
 Frame = -3

Query  1389  WMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMT  1210
             W EYQG+++WEGLLDPLDD LR EILRYG FV+AAY++FDFD  SP+YATC+Y + ++  
Sbjct  89    WEEYQGVKNWEGLLDPLDDNLRCEILRYGQFVDAAYKAFDFDPDSPSYATCKYPKSSLFE  148

Query  1209  RCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
              C L  +GY++T+NL  T  + +PRW     + V+ +SSWIGYVAVC D++EI RLGRRD
Sbjct  149   NCELPATGYRLTKNLRATSGIQLPRWIEKAPSWVATQSSWIGYVAVCQDKNEIARLGRRD  208

Query  1041  VVIAYRGTATPPEWLENLRATLTCLP----DDMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             VVI++RGTAT  EWLENLRATLT LP    ++     CEPMV+ GFLSLYTS +   PSL
Sbjct  209   VVISFRGTATCLEWLENLRATLTHLPSRTNNNSGLNECEPMVESGFLSLYTSGTHLMPSL  268

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +  +R+EI +++++YGDEPLS+TITGHSLGAALAT+ AYDI T F  +PLVTV+SFGGPR
Sbjct  269   QQMVREEIARLLQSYGDEPLSLTITGHSLGAALATLVAYDIKTTFNRSPLVTVMSFGGPR  328

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGTTQPSGMLSWLQ  526
             VGN++FR  LE  G KVLRIVNSDD ITKVPGFV+D ++      D G  +   + +WLQ
Sbjct  329   VGNRSFRRHLEKKGAKVLRIVNSDDVITKVPGFVIDENERRHVACDRGAHKRVEIQNWLQ  388

Query  525   KCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
             K V D+QWVYAEVGKELR+SSKDS      +V+TCH+L TYLH +DN+ S KCP +ATAK
Sbjct  389   KKVEDTQWVYAEVGKELRLSSKDSPYVNGTNVSTCHELSTYLHLVDNFVSRKCPFKATAK  448

Query  354   RVIEKN  337
             R++ ++
Sbjct  449   RLLGRH  454



>ref|XP_002880139.1| defective IN anther DEHISCENCE1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56398.1| defective IN anther DEHISCENCE1 [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 282/373 (76%), Gaps = 15/373 (4%)
 Frame = -3

Query  1422  AADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYA  1243
              ++   KL  +WMEYQG+++W+GLLDPLD+ LR+EILRYG FVE+AY++FDFD +SPTYA
Sbjct  79    GSNNPVKLGRRWMEYQGLQNWDGLLDPLDENLRREILRYGQFVESAYQAFDFDPSSPTYA  138

Query  1242  TCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDD  1075
             TCR+    ++ R GL  SGY++T+NL  T  +N+PRW     + ++ +SSWIGYVAVC D
Sbjct  139   TCRFPRSTLLDRSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQD  198

Query  1074  EDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLS  910
             ++EI RLGRRDVVI++RGTAT  EWLENLRATLT LP+     ++   N  PMV+ GFLS
Sbjct  199   KEEISRLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTGPNLNGSNSGPMVESGFLS  258

Query  909   LYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHA  730
             LYTS      SL+D +R+EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ A
Sbjct  259   LYTSGVH---SLRDMVREEISRLLQSYGDEPLSVTITGHSLGAAIATLAAYDIKTTFKRA  315

Query  729   PLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQP  550
             P+VTV+SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+++ +  +   +  
Sbjct  316   PMVTVISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQENVKMSTT  375

Query  549   SGMLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCK  379
             S M SW+Q+ V ++ WVYAEVGKELR+SS       S +VATCH+LKTYLH +D + S  
Sbjct  376   SIMPSWIQRRVEETPWVYAEVGKELRLSSRDSPHLNSINVATCHELKTYLHLVDGFVSST  435

Query  378   CPLRATAKRVIEK  340
             CP R TA+RV+ +
Sbjct  436   CPFRETARRVLHR  448



>emb|CDY48263.1| BnaC04g05220D [Brassica napus]
Length=446

 Score =   433 bits (1113),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 281/371 (76%), Gaps = 17/371 (5%)
 Frame = -3

Query  1416  DRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATC  1237
             ++  KL  +W EYQG+++WEGLLDPLDD LR EILRYG FVE+AY+SFDFD +SPTYATC
Sbjct  81    NKPVKLNRRWKEYQGLQNWEGLLDPLDDNLRGEILRYGQFVESAYQSFDFDPSSPTYATC  140

Query  1236  RYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDED  1069
             R+  + ++ + GL  SGY+VT+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++
Sbjct  141   RFPRNTLLDQSGLPNSGYRVTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKE  200

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLY  904
             EI RLGRRDVVI++RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLY
Sbjct  201   EISRLGRRDVVISFRGTATCLEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLY  260

Query  903   TSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
             TS   AH SL+D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+
Sbjct  261   TSG--AH-SLRDMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPM  317

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV+SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T  + 
Sbjct  318   VTVMSFGGPRVGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREKDNVKMT--AS  375

Query  543   MLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCP  373
             M SW+QK V ++ WVYAEVGKELR+SS         +VATCH+LKTYLH +D + S  CP
Sbjct  376   MPSWIQKRVEETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCP  435

Query  372   LRATAKRVIEK  340
              R TA+RV+ +
Sbjct  436   FRETARRVLHR  446



>ref|XP_007219371.1| hypothetical protein PRUPE_ppa020032mg [Prunus persica]
 gb|EMJ20570.1| hypothetical protein PRUPE_ppa020032mg [Prunus persica]
Length=352

 Score =   429 bits (1103),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 264/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +WE LLDPLD  LR EILRYG FVEAAYRSFDFD  SPTYATCR+  ++++TR
Sbjct  1     MEYQGSNNWECLLDPLDHTLRSEILRYGQFVEAAYRSFDFDPMSPTYATCRFPRNSLLTR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNLV----SPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G   +GY+VT+NL  TC V +PRW   V    S +SSWIGYVA+C D++EI RLGRRDV
Sbjct  61    SGFEQTGYRVTKNLRATCGVQMPRWIGGVPSWMSTQSSWIGYVAICQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             VIA+RGT T  EW+ENLRATLT +PD + P++  PMV+RGFLSLYTS +    SL+D IR
Sbjct  121   VIAFRGTITCLEWVENLRATLTEVPDYVGPKSGGPMVERGFLSLYTSRTATSSSLQDMIR  180

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
              EI+KIIE YGDEPLS+TITGHSLGAALA ++AYDIT  F  AP+VTVVSFGGPRVGN++
Sbjct  181   REISKIIELYGDEPLSLTITGHSLGAALAILSAYDITATFAKAPMVTVVSFGGPRVGNRS  240

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVV-DSDDVSDCGTTQPSGMLSWLQKCV-DSQW  505
                QL+ SGT++LRIVNSDDPI KVPGFV  D DDV        + +  W+ KCV D QW
Sbjct  241   LGCQLDKSGTRILRIVNSDDPIPKVPGFVFEDGDDVESTKNVHVANLPRWILKCVEDRQW  300

Query  504   VYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             VYA++G+ELR+SSK+S      ++ATCHDLKTYLH ++ + S KCP 
Sbjct  301   VYADMGQELRLSSKESPYLNKSNLATCHDLKTYLHLVNGFVSSKCPF  347



>ref|XP_003551712.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Glycine 
max]
Length=422

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 222/353 (63%), Positives = 269/353 (76%), Gaps = 7/353 (2%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             + KL  KW +YQGI  W+GLLDPLDD LR EILRYG FVE+ YR+FDFDT SPTYATCRY
Sbjct  56    SPKLGHKWTQYQGINQWDGLLDPLDDNLRMEILRYGQFVESTYRAFDFDTNSPTYATCRY  115

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP----KSSWIGYVAVCDDEDEI  1063
              + +++ R G   SGY+VT+NL+ TC V +P W + +S     +SSWIGYVAVC+D +EI
Sbjct  116   PKTSLLARTGPRKSGYRVTKNLHATCGVELPNWVSSLSQLPRVQSSWIGYVAVCEDREEI  175

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              RLGRRDVVIA RGTAT  EWLENLR TLT LP  M     + MV+ GFLSLY S + A 
Sbjct  176   ARLGRRDVVIALRGTATCLEWLENLRVTLTKLPSHMGCGYEDCMVENGFLSLYVSKTGAC  235

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL+D +R+E+ ++IE+YGDEPLSITITGHSLGAALA ++AYDIT   ++AP+VTVVSFG
Sbjct  236   PSLQDMVREEVARVIESYGDEPLSITITGHSLGAALAILSAYDITATLKNAPMVTVVSFG  295

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
              PRVGN+ FRSQLE SGT++LRIVNSDD ITKVPG VV  DDV+  G    +G+ SW +K
Sbjct  296   APRVGNEKFRSQLEKSGTRILRIVNSDDVITKVPGLVVRDDDVACSGGVHAAGLQSWFRK  355

Query  522   CVDS-QWVYAEVGKELRvsskdssyskd--VATCHDLKTYLHCIDNWSSCKCP  373
              VD  Q VYA+VG+ELRVSS++S Y K   VATCHDLKTYLH ++ + S  CP
Sbjct  356   VVDDMQLVYADVGQELRVSSRESQYLKKGDVATCHDLKTYLHLVNGFVSSSCP  408



>ref|XP_010508249.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Camelina 
sativa]
Length=454

 Score =   432 bits (1110),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 222/371 (60%), Positives = 284/371 (77%), Gaps = 18/371 (5%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
              KL  +WMEYQG+++W+GLLDPLDD LR+EILRYG FVE+AY++FDFD +SPTYATCR+ 
Sbjct  87    VKLGRRWMEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYATCRFP  146

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIR  1060
                ++ R GL  SGY++T+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++EI 
Sbjct  147   RSTLLDRSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEIS  206

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSA  895
             RLGRRDVVI++RGTAT  EWLENLRATLT LP+     ++   N  PMV+ GFLSLYTS 
Sbjct  207   RLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTGPNLNGSNSGPMVESGFLSLYTSG  266

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
               AH SL+D +R+EI++++++YGDEPLSITITGHSLGAA+AT+ AYDI T F+ AP+VTV
Sbjct  267   --AH-SLRDMVREEISRLLQSYGDEPLSITITGHSLGAAIATLAAYDIKTTFKRAPMVTV  323

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS---DDVSDCGTTQPSG  544
             +SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+   D+V    ++  S 
Sbjct  324   ISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLDNREQDNVKMSSSSAASA  383

Query  543   MLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCP  373
             M SW+Q+ V ++ WVYAEVGKELR+SS       S +VATCH+LKTYLH +D + S  CP
Sbjct  384   MPSWIQRRVEETPWVYAEVGKELRLSSRDSPYLSSINVATCHELKTYLHLVDGFVSSTCP  443

Query  372   LRATAKRVIEK  340
              R TA+RV+ +
Sbjct  444   FRETARRVLHR  454



>ref|XP_009143069.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Brassica rapa]
Length=446

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 280/371 (75%), Gaps = 17/371 (5%)
 Frame = -3

Query  1416  DRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATC  1237
             +   KL  +W EYQG+++WEGLLDPLDD LR EILRYG FVE+AY+SFDFD +SPTYATC
Sbjct  81    NNPVKLNRRWKEYQGLQNWEGLLDPLDDNLRGEILRYGQFVESAYQSFDFDPSSPTYATC  140

Query  1236  RYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDED  1069
             R+  + ++ + GL  SGY+VT+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++
Sbjct  141   RFPRNTLLDQSGLPNSGYRVTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKE  200

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLY  904
             EI RLGRRDVVI++RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLY
Sbjct  201   EISRLGRRDVVISFRGTATCLEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLY  260

Query  903   TSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
             TS   AH SL+D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+
Sbjct  261   TSG--AH-SLRDMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPM  317

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV+SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T  + 
Sbjct  318   VTVMSFGGPRVGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREQDNVKMT--AS  375

Query  543   MLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCP  373
             M SW+QK V ++ WVYAEVGKELR+SS         +VATCH+LKTYLH +D + S  CP
Sbjct  376   MPSWIQKRVEETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCP  435

Query  372   LRATAKRVIEK  340
              R TA+RV+ +
Sbjct  436   FRETARRVLHR  446



>gb|KHN40551.1| Phospholipase A(1) DAD1, chloroplastic [Glycine soja]
Length=422

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/353 (63%), Positives = 268/353 (76%), Gaps = 7/353 (2%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             + KL  KW +YQGI  W+GLLDPLDD LR EILRYG FVE+ YR+FDFDT SPTYATCRY
Sbjct  56    SPKLGHKWTQYQGINQWDGLLDPLDDNLRMEILRYGQFVESTYRAFDFDTNSPTYATCRY  115

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP----KSSWIGYVAVCDDEDEI  1063
              + +++ R G   SGY+VT+NL+ TC V +P W + +S     +SSWIGYVAVC+D +EI
Sbjct  116   PKTSLLARTGPRKSGYRVTKNLHATCGVELPNWVSSLSQLPRVQSSWIGYVAVCEDREEI  175

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              RLGRRDVVIA RGTAT  EWLENLR TLT LP  M     + MV+ GFLSLY S + A 
Sbjct  176   ARLGRRDVVIALRGTATCLEWLENLRVTLTKLPSHMGCGYEDCMVENGFLSLYVSKTGAC  235

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL+D +R+E+ ++IE+YGDEPLSITITGHSLGAALA ++AYDIT   ++AP+VTVVSFG
Sbjct  236   PSLQDMVREEVARVIESYGDEPLSITITGHSLGAALAILSAYDITATLKNAPMVTVVSFG  295

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
              PRVGN+ FRSQLE SGT++LRIVNSDD ITKVPG VV  DDV+  G    +G  SW +K
Sbjct  296   APRVGNEKFRSQLEKSGTRILRIVNSDDVITKVPGLVVRDDDVACSGGVHAAGFQSWFRK  355

Query  522   CVDS-QWVYAEVGKELRvsskdssyskd--VATCHDLKTYLHCIDNWSSCKCP  373
              VD  Q VYA+VG+ELRVSS++S Y K   VATCHDLKTYLH ++ + S  CP
Sbjct  356   VVDDMQLVYADVGQELRVSSRESQYLKKGDVATCHDLKTYLHLVNGFVSSSCP  408



>ref|XP_010058501.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Eucalyptus 
grandis]
Length=376

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 279/376 (74%), Gaps = 17/376 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+R+W+GLLDPLDD LR EILRYG FV+AAY++FDFD +SPTYAT R+ + ++  R
Sbjct  1     MEYQGVRNWDGLLDPLDDNLRCEILRYGGFVDAAYQAFDFDPSSPTYATRRFSKSSLFER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
             CGL G+GY++TRNL  +  + +PRW       +S +SSWIGYVAVC D+DEI RLGRRD+
Sbjct  61    CGLPGTGYRITRNLTASSGIQLPRWAERAPGWMSTRSSWIGYVAVCQDKDEIARLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP------DDMAPRNCEPMVQRGFLSLYTSASDAHPS  877
             +IAYRGTAT  EWLENLRATL+ +P      +   P    PMV+ GFLSLYTS +   PS
Sbjct  121   MIAYRGTATCLEWLENLRATLSHVPASGPADEGSCPPVDAPMVESGFLSLYTSRAATCPS  180

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF-RHAPLVTVVSFGG  700
             L++ + +EI +++ TYGDEPLS+TITGHSLGAALAT+TAYD+ T F + APLVTV+SFGG
Sbjct  181   LQEMVHEEIARLLRTYGDEPLSLTITGHSLGAALATLTAYDVKTAFGQAAPLVTVISFGG  240

Query  699   PRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVD---SDDVSDCGTTQPSGMLSWL  529
             PRVGN++FR  LE  GTKVLRIVNSDD ITKVPGFV+D    DDVS        G+ SW+
Sbjct  241   PRVGNQSFRCCLEEQGTKVLRIVNSDDLITKVPGFVIDGAAGDDVSSGQDVPVVGLPSWI  300

Query  528   QKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
             Q+ V D+QWVYAEVG+ELR+SS         +VATCHDLKTYLH ++ + S  CP RATA
Sbjct  301   QRRVADTQWVYAEVGRELRLSSRDSPYLSGINVATCHDLKTYLHLVNGFVSSNCPFRATA  360

Query  357   KRVIEKNHGKRRRVLA  310
             +RV+     +  +V A
Sbjct  361   ERVLGGRRSRAEKVGA  376



>gb|ABP35955.1| phospholipase A1 [Brassica rapa]
Length=446

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 280/371 (75%), Gaps = 17/371 (5%)
 Frame = -3

Query  1416  DRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATC  1237
             +   KL  +W EYQG+++WEGLLDPLDD LR EILRYG FVE+AY+SFDFD +SPTYATC
Sbjct  81    NNPVKLNRRWKEYQGLQNWEGLLDPLDDNLRGEILRYGQFVESAYQSFDFDPSSPTYATC  140

Query  1236  RYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDED  1069
             R+  + ++ + GL  SGY+VT+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++
Sbjct  141   RFPRNTLLDQSGLPNSGYRVTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKE  200

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLY  904
             EI RLGRRDVVI++RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLY
Sbjct  201   EISRLGRRDVVISFRGTATCLEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLY  260

Query  903   TSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
             TS   AH SL+D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+
Sbjct  261   TSG--AH-SLRDMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPM  317

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV+SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T  + 
Sbjct  318   VTVMSFGGPRVGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGAVLDNREQDNVKMT--AS  375

Query  543   MLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCP  373
             M SW+QK V ++ WVYAEVGKELR+SS         +VATCH+LKTYLH +D + S  CP
Sbjct  376   MPSWIQKRVEETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCP  435

Query  372   LRATAKRVIEK  340
              R TA+RV+ +
Sbjct  436   FRETARRVLHR  446



>dbj|BAC23081.1| DAD1 [Brassica rapa]
Length=446

 Score =   430 bits (1106),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 220/371 (59%), Positives = 280/371 (75%), Gaps = 17/371 (5%)
 Frame = -3

Query  1416  DRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATC  1237
             +   KL  +W EYQG+++WEGLLDPLDD LR EILRYG FVE+AY+SFDFD +SPTYATC
Sbjct  81    NNPVKLNRRWKEYQGLQNWEGLLDPLDDNLRGEILRYGQFVESAYQSFDFDPSSPTYATC  140

Query  1236  RYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDED  1069
             R+  + ++ + GL  SGY+VT+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++
Sbjct  141   RFPRNTLLDQSGLPNSGYRVTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKE  200

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLY  904
             EI RLGRRDVVI++RGTAT  EWLENLRATL  LPD     ++   N  PMV+ GFLSLY
Sbjct  201   EISRLGRRDVVISFRGTATCLEWLENLRATLAHLPDGPSGPNLNGSNSGPMVESGFLSLY  260

Query  903   TSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
             TS   AH SL+D +R+EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+
Sbjct  261   TSG--AH-SLRDMVREEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPM  317

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV+SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T  + 
Sbjct  318   VTVMSFGGPRVGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREQDNVKMT--AS  375

Query  543   MLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCP  373
             M SW+QK V ++ WVYAEVGKELR+SS         +VATCH+LKTYLH +D + S  CP
Sbjct  376   MPSWIQKRVEETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCP  435

Query  372   LRATAKRVIEK  340
              R TA+RV+ +
Sbjct  436   FRETARRVLHR  446



>ref|XP_008232524.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Prunus 
mume]
Length=352

 Score =   426 bits (1096),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 262/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +WE LLDPLD  LR EILRYG FVEAAYRSFD D  SPTYATCR+  ++++TR
Sbjct  1     MEYQGSNNWECLLDPLDHTLRSEILRYGQFVEAAYRSFDSDPMSPTYATCRFPRNSLLTR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNLV----SPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G G +GY+VT+NL  TC V +PRW   V    S +SSWIGYVA+C D+ EI RLGRRDV
Sbjct  61    SGFGQTGYRVTKNLRATCGVQMPRWIGGVPSWMSTQSSWIGYVAICQDKKEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             VIA+RGT T  EW+ENLRATL  +PD + P++  PMV+RGFLSLYTS +    SL+D IR
Sbjct  121   VIAFRGTITCLEWVENLRATLIEVPDYVGPKSGGPMVERGFLSLYTSRTATFSSLQDMIR  180

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
              EI+KIIE YGDEPLS+TITGHSLGAALA ++AYDIT  F +AP+VTVVSFGGPRVGN++
Sbjct  181   KEISKIIELYGDEPLSLTITGHSLGAALAILSAYDITATFANAPMVTVVSFGGPRVGNRS  240

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVV-DSDDVSDCGTTQPSGMLSWLQKCV-DSQW  505
              R QL+ SGT++LRIVNSDDPI KVPGFV  D DDV        + +  W+ K V D+QW
Sbjct  241   LRCQLDKSGTRILRIVNSDDPIPKVPGFVFEDGDDVESTKNVHVANLPRWILKYVEDTQW  300

Query  504   VYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             VYA++G+ELR+SSK+S       +ATCHDLKTYLH +  + S KCP 
Sbjct  301   VYADMGQELRLSSKESPYLNKSSLATCHDLKTYLHLVKGFVSSKCPF  347



>sp|Q948R1.1|PLA11_ARATH RecName: Full=Phospholipase A(1) DAD1, chloroplastic; AltName: 
Full=Phospholipase A1-Ibeta1; AltName: Full=Protein DEFECTIVE 
IN ANTHER DEHISCENCE 1; Short=AtDAD1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB69954.1| DEFECTIVE IN ANTHER DEHISCENCE1 [Arabidopsis thaliana]
Length=447

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/368 (58%), Positives = 278/368 (76%), Gaps = 16/368 (4%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
              KL  +WMEYQG+++W+GLLDPLDD LR+EILRYG FVE+AY++FDFD +SPTY TCR+ 
Sbjct  84    VKLGRRWMEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTCRFP  143

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIR  1060
                ++ R GL  SGY++T+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++EI 
Sbjct  144   RSTLLERSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEIS  203

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSA  895
             RLGRRDVVI++RGTAT  EWLENLRATLT LP+     ++   N  PMV+ GFLSLYTS 
Sbjct  204   RLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTGANLNGSNSGPMVESGFLSLYTSG  263

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
                  SL+D +R+EI +++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+VTV
Sbjct  264   VH---SLRDMVREEIARLLQSYGDEPLSVTITGHSLGAAIATLAAYDIKTTFKRAPMVTV  320

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLS  535
             +SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+++ +  +   T  S M S
Sbjct  321   ISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQDNVKMTA-SIMPS  379

Query  534   WLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
             W+Q+ V ++ WVYAE+GKELR+SS       S +VATCH+LKTYLH +D + S  CP R 
Sbjct  380   WIQRRVEETPWVYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRE  439

Query  363   TAKRVIEK  340
             TA+RV+ +
Sbjct  440   TARRVLHR  447



>ref|XP_006445433.1| hypothetical protein CICLE_v10020217mg [Citrus clementina]
 gb|ESR58673.1| hypothetical protein CICLE_v10020217mg [Citrus clementina]
Length=434

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/351 (63%), Positives = 271/351 (77%), Gaps = 13/351 (4%)
 Frame = -3

Query  1425  VAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTY  1246
             +A D AAKL + WME QG  +WEGLLDPLD  LR E+LRYG FVEA YR FDFD +SPTY
Sbjct  46    LAYDSAAKLGNNWMEIQGSNNWEGLLDPLDQNLRSELLRYGQFVEATYRCFDFDPSSPTY  105

Query  1245  ATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCD  1078
             ATC+Y  ++ +TR G+  +GY++T++L  TC V++PRW +     +S +SSWIGYVAVC 
Sbjct  106   ATCKYPRNSFLTRSGIAETGYRMTKHLRATCGVHLPRWLDRAPSWMSTQSSWIGYVAVCQ  165

Query  1077  DEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCL--PDDMAP----RNCEPMVQRGF  916
             D+ EI RLGRRDVVIAYRGTAT  EWLENLRATLT    PDD+A     R   PMVQ GF
Sbjct  166   DKKEIARLGRRDVVIAYRGTATCLEWLENLRATLTACWPPDDVATSVHLRPSTPMVQTGF  225

Query  915   LSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR  736
              SLYTS++D  PSL++ +R+EI ++++ YGDEPLSITITGHSLGAALAT+TAYDI + F 
Sbjct  226   FSLYTSSTDTCPSLQEMVREEIKRVLDLYGDEPLSITITGHSLGAALATLTAYDINSTFN  285

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
             +AP+VTV+SFGGPRVGN++FR QLE SGTK+LRIVNSDD ITKVPGFV+D  DV++    
Sbjct  286   NAPMVTVISFGGPRVGNRSFRCQLEKSGTKILRIVNSDDLITKVPGFVIDDYDVANKQAV  345

Query  555   QPSGMLSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTY  412
               + + SWLQK V ++ WVYA+VGKELR+SS+DS      +VATCHDL TY
Sbjct  346   NVAALPSWLQKRVQNTHWVYADVGKELRLSSRDSPFLSKVNVATCHDLNTY  396



>ref|XP_010518086.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Camelina sativa]
Length=450

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 281/370 (76%), Gaps = 17/370 (5%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
              KL  +WMEYQG+++W+GLLDPLDD LR+EILRYG FVE+AY++FDFD +SPTYATCR+ 
Sbjct  84    VKLGRRWMEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYATCRFP  143

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIR  1060
                ++ R GL  SGY++T+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++EI 
Sbjct  144   RSTLLDRSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEIS  203

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSA  895
             RLGRRDVVI++RGTAT  EWLENLRATLT LP+     ++   N  PMV+ GFLSLY+S 
Sbjct  204   RLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTGPNLNGSNSGPMVESGFLSLYSSG  263

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
               AH SL+D +R+EI++++++YGDEPLSITITGHSLGAA+AT+ AYDI T F+ AP+VTV
Sbjct  264   --AH-SLRDMVREEISRLLQSYGDEPLSITITGHSLGAAIATLAAYDIKTTFKRAPMVTV  320

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS--DDVSDCGTTQPSGM  541
             +SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+   D     ++  S M
Sbjct  321   ISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLDNREQDNVKMSSSAASAM  380

Query  540   LSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPL  370
              SW+Q+ V ++ WVYAEVGKELR+SS         +VATCH+LKTYLH +D + S  CP 
Sbjct  381   PSWIQRRVEETPWVYAEVGKELRLSSRDSPYLSRINVATCHELKTYLHLVDGFVSSTCPF  440

Query  369   RATAKRVIEK  340
             R TA+RV+ +
Sbjct  441   RETARRVLHR  450



>ref|XP_006293380.1| hypothetical protein CARUB_v10023210mg [Capsella rubella]
 gb|EOA26278.1| hypothetical protein CARUB_v10023210mg [Capsella rubella]
Length=448

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/369 (59%), Positives = 281/369 (76%), Gaps = 16/369 (4%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
              KL  +WMEYQG+++W+GLLDPLDD LR+EILRYG FVE+AY++FDFD +SPTYATCR+ 
Sbjct  83    VKLGRRWMEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYATCRFP  142

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIR  1060
                ++ R GL  SGY++T+NL  T  +N+P W     + V+ +SSWIGYVAVC D++EI 
Sbjct  143   RSTLLDRSGLPNSGYRLTKNLRATSGINLPGWIEKAPSWVATQSSWIGYVAVCQDKEEIS  202

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSA  895
             RLGRRDVVI++RGTAT  EWLENLRATLT LP+     ++   N  PMV+ GFLSLYTS 
Sbjct  203   RLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTGPNLNGSNSGPMVESGFLSLYTSG  262

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
               AH SL+D +R+EI++++++YGDEPLSITITGHSLGAA+AT+ AYDI T F+ AP+VTV
Sbjct  263   --AH-SLRDMVREEISRLLQSYGDEPLSITITGHSLGAAIATLAAYDIKTTFKRAPMVTV  319

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG-TTQPSGML  538
             +SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+++ +  +   ++  S M 
Sbjct  320   ISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQDNVKMSSTASAMP  379

Query  537   SWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLR  367
             SW+Q+ V ++ WVYAEVGKELR+SS       S +VA CH+LKTYLH +D + S  CP R
Sbjct  380   SWIQRRVEETPWVYAEVGKELRLSSRDSPYLSSINVAACHELKTYLHLVDGFVSSTCPFR  439

Query  366   ATAKRVIEK  340
              TA+RV+ +
Sbjct  440   ETARRVLHR  448



>ref|XP_002271065.2| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Vitis vinifera]
Length=418

 Score =   426 bits (1095),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 225/365 (62%), Positives = 283/365 (78%), Gaps = 13/365 (4%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             +AKL  KWMEYQG+ +W+GLLDPLDD LR EILRYG FVEAAYRSFDFD  SPTYATC++
Sbjct  53    SAKLGKKWMEYQGLNNWDGLLDPLDDTLRNEILRYGKFVEAAYRSFDFDPDSPTYATCKF  112

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEI  1063
               ++++ R  +G +GYK+T+NL+ TC V +PRW +     +S +S WIGYVAVC D++EI
Sbjct  113   SRNSLLKRSEIGYTGYKLTKNLHATCGVRLPRWVDRTPAWMSTQSCWIGYVAVCQDKEEI  172

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              RLGRRDVVIA+RGTAT  EW+ENLRATLT L    +  N  PMV+ GF SLYTS   + 
Sbjct  173   ARLGRRDVVIAFRGTATGMEWVENLRATLTSLVG--STNNGGPMVESGFWSLYTSKLSSC  230

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL++ +RDEI ++I +YGDE LSITITGHSLGAALAT+ AYDI T F HAP+VTVVSFG
Sbjct  231   PSLQEMVRDEIGRVIRSYGDEQLSITITGHSLGAALATLAAYDIATTFDHAPMVTVVSFG  290

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGN +FR Q+E SGTK+LRIVNSDD ITKVPGFV+D++DV+     Q +G+ SWL+K
Sbjct  291   GPRVGNTSFRCQMEKSGTKILRIVNSDDVITKVPGFVIDNNDVA----VQAAGLPSWLRK  346

Query  522   CVDS-QWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
              V++ Q  YA+VG+ELR+SS++S      +VA CHDLKTYLH ++ + S  CP RATA R
Sbjct  347   PVEAMQLGYADVGQELRLSSRESPYLNKNNVAACHDLKTYLHLVNGFVSSTCPFRATATR  406

Query  351   VIEKN  337
             ++E+ 
Sbjct  407   MLERQ  411



>gb|KCW73102.1| hypothetical protein EUGRSUZ_E01547, partial [Eucalyptus grandis]
Length=362

 Score =   424 bits (1089),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 220/362 (61%), Positives = 273/362 (75%), Gaps = 17/362 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+R+W+GLLDPLDD LR EILRYG FV+AAY++FDFD +SPTYAT R+ + ++  R
Sbjct  1     MEYQGVRNWDGLLDPLDDNLRCEILRYGGFVDAAYQAFDFDPSSPTYATRRFSKSSLFER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
             CGL G+GY++TRNL  +  + +PRW       +S +SSWIGYVAVC D+DEI RLGRRD+
Sbjct  61    CGLPGTGYRITRNLTASSGIQLPRWAERAPGWMSTRSSWIGYVAVCQDKDEIARLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP------DDMAPRNCEPMVQRGFLSLYTSASDAHPS  877
             +IAYRGTAT  EWLENLRATL+ +P      +   P    PMV+ GFLSLYTS +   PS
Sbjct  121   MIAYRGTATCLEWLENLRATLSHVPASGPADEGSCPPVDAPMVESGFLSLYTSRAATCPS  180

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF-RHAPLVTVVSFGG  700
             L++ + +EI +++ TYGDEPLS+TITGHSLGAALAT+TAYD+ T F + APLVTV+SFGG
Sbjct  181   LQEMVHEEIARLLRTYGDEPLSLTITGHSLGAALATLTAYDVKTAFGQAAPLVTVISFGG  240

Query  699   PRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVD---SDDVSDCGTTQPSGMLSWL  529
             PRVGN++FR  LE  GTKVLRIVNSDD ITKVPGFV+D    DDVS        G+ SW+
Sbjct  241   PRVGNQSFRCCLEEQGTKVLRIVNSDDLITKVPGFVIDGAAGDDVSSGQDVPVVGLPSWI  300

Query  528   QKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
             Q+ V D+QWVYAEVG+ELR+SS         +VATCHDLKTYLH ++ + S  CP RATA
Sbjct  301   QRRVADTQWVYAEVGRELRLSSRDSPYLSGINVATCHDLKTYLHLVNGFVSSNCPFRATA  360

Query  357   KR  352
             +R
Sbjct  361   ER  362



>ref|XP_011032133.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Populus 
euphratica]
Length=431

 Score =   425 bits (1092),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 235/399 (59%), Positives = 289/399 (72%), Gaps = 16/399 (4%)
 Frame = -3

Query  1494  EFSTLKNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEI  1315
             +F   +  K+W  L +  S+     A R  KL  KWMEYQGIR+WEGLLDPLDD LR EI
Sbjct  35    KFLQNQPLKNWEGLLDHESA----TASRPVKLRRKWMEYQGIRNWEGLLDPLDDNLRGEI  90

Query  1314  LRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPR  1135
             LRYG FV+AAY+SFDFD +SP YATCR+ +  +  RCG   +GY++T++L  T  + +PR
Sbjct  91    LRYGHFVDAAYKSFDFDPSSPAYATCRFPKSTLFERCGKPDTGYRLTKHLRATSGIQIPR  150

Query  1134  WT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCL  967
             W     + V  +SSWIGYVAV  ++ EI RLGRRDVVIA+RGTAT  EWLENLRATLT L
Sbjct  151   WIEKAPSWVFTQSSWIGYVAVSLNKAEIARLGRRDVVIAFRGTATCLEWLENLRATLTQL  210

Query  966   PDD----MAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITIT  799
             P+      +  +C PMV+ GFLSLYTS +   PSL++ +R EI +++ TYGDEPLS+TIT
Sbjct  211   PNSDCGKKSSDDCGPMVESGFLSLYTSGTPMGPSLQEMVRQEIKRLLHTYGDEPLSLTIT  270

Query  798   GHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDD  619
             GHSLGAALAT+ AYDI T F  APLVTV+SFGGPRVGN++FR  LE  GTKVLRIVNSDD
Sbjct  271   GHSLGAALATLAAYDIKTTFNCAPLVTVISFGGPRVGNRSFRRHLEKQGTKVLRIVNSDD  330

Query  618   PITKVPGFVVDSD-DVSDCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskds--sy  451
              ITKVPGFV+D + +V + G    + + SW+QK V D+QWVYAEVG+ELR+SSKDS    
Sbjct  331   VITKVPGFVIDGENNVPNKGDLNMASLPSWIQKKVEDTQWVYAEVGRELRLSSKDSPYLN  390

Query  450   skdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNH  334
             S +VA CHDLKTYLH ++ + S  CP RA AKR    NH
Sbjct  391   SINVAACHDLKTYLHLVNGFVSSSCPFRAKAKRFFHSNH  429



>ref|XP_010544567.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Tarenaya 
hassleriana]
Length=441

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 276/371 (74%), Gaps = 16/371 (4%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             R  KL  +WMEYQG+R+W GLLDPLDD LR+EILRYG FVEAAY+S+DFD +SPT+ATCR
Sbjct  74    RPVKLGRRWMEYQGLRNWTGLLDPLDDNLRREILRYGKFVEAAYKSYDFDPSSPTFATCR  133

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDE  1066
             +    ++ R G  G+GY++T+NL  T  + +PRW     + V+ +SSWIGYVAVC D++E
Sbjct  134   FPRSTLLERSGFPGTGYRLTKNLRTTSGIQLPRWIEKAPSWVATQSSWIGYVAVCQDKEE  193

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAP--RNCEPMVQRGFLSLYTSAS  892
             I RLGRRD+VI++RGTAT  EWLEN+RATLT LPD   P      PMV+ GFLS+YTS  
Sbjct  194   ISRLGRRDIVISFRGTATCLEWLENIRATLTHLPDGPGPDRSGSGPMVESGFLSMYTSG-  252

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
              AH SL+D +RDEI++++  YGDEPLS+TITGHSLGAALA +TAYD+ T F+  P+VTV+
Sbjct  253   -AH-SLRDMVRDEISRLLRAYGDEPLSLTITGHSLGAALAILTAYDVKTTFKQPPMVTVI  310

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGTTQPSG  544
             SFGGPRVGN++FR  LE  GTKVLRIVNSDD ITKVPG V++ +D      +        
Sbjct  311   SFGGPRVGNRSFRRLLEKQGTKVLRIVNSDDLITKVPGVVMNQEDEEPNSKNVEMATALT  370

Query  543   MLSWLQKCVD-SQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCP  373
             +  W+QK V+ + W YAEVG+ELR+SS+DS    S +VATCH+LKTYLH +D + S  CP
Sbjct  371   LPEWIQKRVEKTPWAYAEVGQELRLSSRDSPYVNSINVATCHELKTYLHLVDGFVSSTCP  430

Query  372   LRATAKRVIEK  340
              R TAKRV+ +
Sbjct  431   FRETAKRVLHR  441



>ref|NP_182008.1| phospholipase A(1) DAD1 [Arabidopsis thaliana]
 gb|AAC31843.1| putative triacylglycerol lipase [Arabidopsis thaliana]
 gb|AAL69449.1| At2g44810/T13E15.18 [Arabidopsis thaliana]
 gb|AAM14879.1| putative triacylglycerol lipase [Arabidopsis thaliana]
 gb|AEC10469.1| phospholipase A(1) DAD1 [Arabidopsis thaliana]
Length=357

 Score =   421 bits (1083),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 212/361 (59%), Positives = 274/361 (76%), Gaps = 16/361 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+++W+GLLDPLDD LR+EILRYG FVE+AY++FDFD +SPTY TCR+    ++ R
Sbjct  1     MEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTCRFPRSTLLER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  SGY++T+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    SGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEISRLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             VI++RGTAT  EWLENLRATLT LP+     ++   N  PMV+ GFLSLYTS      SL
Sbjct  121   VISFRGTATCLEWLENLRATLTHLPNGPTGANLNGSNSGPMVESGFLSLYTSGVH---SL  177

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +D +R+EI +++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+VTV+SFGGPR
Sbjct  178   RDMVREEIARLLQSYGDEPLSVTITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGPR  237

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-  517
             VGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+++ +  +   T  S M SW+Q+ V 
Sbjct  238   VGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQDNVKMTA-SIMPSWIQRRVE  296

Query  516   DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIE  343
             ++ WVYAE+GKELR+SS       S +VATCH+LKTYLH +D + S  CP R TA+RV+ 
Sbjct  297   ETPWVYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRETARRVLH  356

Query  342   K  340
             +
Sbjct  357   R  357



>gb|EYU31890.1| hypothetical protein MIMGU_mgv1a020241mg [Erythranthe guttata]
Length=440

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 227/368 (62%), Positives = 277/368 (75%), Gaps = 17/368 (5%)
 Frame = -3

Query  1374  GIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLG  1195
             GI+DW+GLLDPLDD LR EILRYG FVEAAY  FDFDT+S  YATCRY  +++++ C L 
Sbjct  64    GIKDWDGLLDPLDDRLRSEILRYGKFVEAAYCCFDFDTSSLGYATCRYPRESMLSECDLA  123

Query  1194  GSGYKVTRNLYGTC-AVNVPRWTNLVSPK-----SSWIGYVAVCDDEDEIRRLGRRDVVI  1033
              SGYKVTRNL+ TC A  +P WT    P+     S+W+GYVAVC D+ EI RLGRRDVV+
Sbjct  124   TSGYKVTRNLHATCGAARLPAWTEDRVPRWAATRSAWVGYVAVCTDKCEIARLGRRDVVV  183

Query  1032  AYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDE  853
             AYRGTAT  EWLEN+R  LT LPDDMA  + E MVQ GFLS+YT+      SL+DSIR+E
Sbjct  184   AYRGTATCAEWLENMRVALTRLPDDMAHGDRESMVQSGFLSMYTAREGTRRSLQDSIREE  243

Query  852   ITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFR  673
             I KI+E Y DEP+SIT+TGHSLGAALA +TAYDI  +F+HAPLVTV+SFGGPR+GNKNFR
Sbjct  244   IGKILEKYADEPISITVTGHSLGAALAALTAYDIAGEFKHAPLVTVLSFGGPRIGNKNFR  303

Query  672   SQLENSGTKVLRIVNSDDPITKVPGFVVDSDD--------VSDCGTTQPSGMLSWLQKCV  517
             SQLE  GTKVLRIVNSDDPITKVPGFV++ ++                  GM +W+QK V
Sbjct  304   SQLEKIGTKVLRIVNSDDPITKVPGFVINEEECRRSKGGEEKKAAAAAAEGMWNWVQKRV  363

Query  516   -DSQWVYAEVGKELRvsskd--ssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              ++QWVYAE+GKELR+SS+D     +  VATCHDLKTYL  +D++ S  CPLRATAK+V+
Sbjct  364   EETQWVYAEIGKELRLSSRDCPHLSNGGVATCHDLKTYLQLVDSFVSSNCPLRATAKKVL  423

Query  345   EKNHGKRR  322
              + H +++
Sbjct  424   SRAHHQQQ  431



>emb|CBI16668.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 220/357 (62%), Positives = 277/357 (78%), Gaps = 13/357 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+ +W+GLLDPLDD LR EILRYG FVEAAYRSFDFD  SPTYATC++  ++++ R
Sbjct  1     MEYQGLNNWDGLLDPLDDTLRNEILRYGKFVEAAYRSFDFDPDSPTYATCKFSRNSLLKR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
               +G +GYK+T+NL+ TC V +PRW +     +S +S WIGYVAVC D++EI RLGRRDV
Sbjct  61    SEIGYTGYKLTKNLHATCGVRLPRWVDRTPAWMSTQSCWIGYVAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             VIA+RGTAT  EW+ENLRATLT L    +  N  PMV+ GF SLYTS   + PSL++ +R
Sbjct  121   VIAFRGTATGMEWVENLRATLTSLVG--STNNGGPMVESGFWSLYTSKLSSCPSLQEMVR  178

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
             DEI ++I +YGDE LSITITGHSLGAALAT+ AYDI T F HAP+VTVVSFGGPRVGN +
Sbjct  179   DEIGRVIRSYGDEQLSITITGHSLGAALATLAAYDIATTFDHAPMVTVVSFGGPRVGNTS  238

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVDS-QWV  502
             FR Q+E SGTK+LRIVNSDD ITKVPGFV+D++DV+     Q +G+ SWL+K V++ Q  
Sbjct  239   FRCQMEKSGTKILRIVNSDDVITKVPGFVIDNNDVA----VQAAGLPSWLRKPVEAMQLG  294

Query  501   YAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKN  337
             YA+VG+ELR+SS++S      +VA CHDLKTYLH ++ + S  CP RATA R++E+ 
Sbjct  295   YADVGQELRLSSRESPYLNKNNVAACHDLKTYLHLVNGFVSSTCPFRATATRMLERQ  351



>ref|XP_010275454.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nelumbo 
nucifera]
Length=426

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 282/390 (72%), Gaps = 29/390 (7%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
             A L  +W EYQGI++WEGLLDPLDD LR EILRYG FVEAAY SF+FDT+SP+YA+CR+ 
Sbjct  35    AGLGKRWREYQGIKNWEGLLDPLDDNLRGEILRYGKFVEAAYSSFEFDTSSPSYASCRFS  94

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIR  1060
               +++ + G+  SGY+VT+NL  T  + +PRW     + V  +SSWIGYVAVC D+DEI 
Sbjct  95    RYSMLEKSGMPDSGYRVTKNLSATSGIQLPRWIENAPSWVWNQSSWIGYVAVCQDQDEIA  154

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPD---DMAPRNCEPMVQRGFLSLYTSASD  889
             RLGRRDVVIAYRGTAT  EWLENLRATLT LP+   ++ P    PMV+RGFLSLYTSA+ 
Sbjct  155   RLGRRDVVIAYRGTATCMEWLENLRATLTRLPNAPSNVGPDIGGPMVERGFLSLYTSATA  214

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
                 L+D +R+E+ +I++ YGDEPLS+TITGHSLGAALAT+TAYDITT F  APLVTV S
Sbjct  215   PCRCLRDQVREEVGRILQRYGDEPLSLTITGHSLGAALATLTAYDITTTFNQAPLVTVFS  274

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDV--------------S  571
             FG PRVGN++FR  +E  G+K+LRIVNS D ITKVPGFV+D                   
Sbjct  275   FGAPRVGNRSFRCHVEKCGSKILRIVNSHDLITKVPGFVIDDHHHHHHNHNNHGDTLKKK  334

Query  570   DCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskdssy----skdVATCHDLKTYLH  406
               G+   +G  SWLQK V ++QWVYA+VG+ELRVSS DSSY      +VAT HDL TYL 
Sbjct  335   KGGSRVAAGFPSWLQKRVEETQWVYADVGRELRVSSGDSSYLTWPITNVATYHDLDTYLQ  394

Query  405   CIDNWSSCKCPLRATAKRVIEKNHGKRRRV  316
              ++ + S  CPL+ +AKRV+   +G+ R++
Sbjct  395   LVNGYVSSNCPLKDSAKRVL---NGQNRKI  421



>ref|XP_010525260.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Tarenaya 
hassleriana]
Length=362

 Score =   412 bits (1059),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 217/367 (59%), Positives = 268/367 (73%), Gaps = 20/367 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             ME QG  +WEG+LDPLD+ LR+EILRYG FVEAAYR+FDFD +SPTYATC++   +++ R
Sbjct  1     MEIQGFNNWEGMLDPLDENLRQEILRYGKFVEAAYRAFDFDPSSPTYATCKFPRKSLLDR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPK-----SSWIGYVAVCDDEDEIRRLGRRD  1042
              G+G SGY++T+NL  TC +N+PRW    SP+     SSWIGYVAVC D+DEI RLGRRD
Sbjct  61    SGVGESGYRITKNLRATCGINLPRWLE-SSPRWANTLSSWIGYVAVCQDKDEIARLGRRD  119

Query  1041  VVIAYRGTATPPEWLENLRATLTCLP-DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             VVIA+RGT T  EW+ENLRATLT  P DD AP     MV+ GFLSLYTS +   PSL+D 
Sbjct  120   VVIAFRGTGTCMEWIENLRATLTDFPGDDEAPTG---MVESGFLSLYTSGTATCPSLRDM  176

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQ-FRHAPLVTVVSFGGPRVG  688
             +R+E+ K++ETYGDEPLS T+TGHSLGAALAT+TA DI         LVTVVSFGGPRVG
Sbjct  177   VREEVAKVVETYGDEPLSFTVTGHSLGAALATLTASDINAVCGGETALVTVVSFGGPRVG  236

Query  687   NKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVDSQ  508
             N  FR QLE SGT+VLRIVNSDD ITKVPGFV+D++DV+        G+ +WL+K    Q
Sbjct  237   NTRFRRQLEKSGTRVLRIVNSDDVITKVPGFVIDNNDVA----CHVGGLPTWLEKM---Q  289

Query  507   WVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNH  334
             W YA++G+ELR+SSK S       VATCH+L TYLH ++ + S  CP R TA+ ++   H
Sbjct  290   WDYADLGRELRLSSKQSPFLRKTGVATCHELGTYLHLVNGFVSSTCPFRTTAEMMLRDQH  349

Query  333   GKRRRVL  313
               + R L
Sbjct  350   MMKLRKL  356



>ref|XP_006464836.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Citrus 
sinensis]
Length=454

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 289/392 (74%), Gaps = 16/392 (4%)
 Frame = -3

Query  1449  NAASSKCLVAADRA-AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSF  1273
             N   S C   + R   KL  +WMEYQG+++WEGLLDPLDD LR EILRYGDFVEAAY+SF
Sbjct  58    NYNYSDCFRFSSRVPVKLGDRWMEYQGMQNWEGLLDPLDDNLRGEILRYGDFVEAAYKSF  117

Query  1272  DFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW-----TNLVSPKS  1108
             DFD +SP+YATCR+ ++ ++ R GL  +GY++T+NL  T   N+PRW      + V+ +S
Sbjct  118   DFDPSSPSYATCRFPKNTLLDRSGLPQTGYRLTKNLRATSGTNLPRWWIEKAPSWVATQS  177

Query  1107  SWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC-EPM  931
             SWIGYVAVC D++ I RLGRRDVVIA RGTAT  EWLENLRATLT LP      +   PM
Sbjct  178   SWIGYVAVCQDQEVISRLGRRDVVIALRGTATCLEWLENLRATLTRLPGPGTDGSVFGPM  237

Query  930   VQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI  751
             V+ GFLSLYTS + + PSL++ +R+EI ++++TYGDEPLS+TITGHSLGAALAT+ AYDI
Sbjct  238   VESGFLSLYTSKTASCPSLQEMLREEIKRLLQTYGDEPLSLTITGHSLGAALATLAAYDI  297

Query  750   TTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS-DDV  574
              T F  +P+ TV SFGGPRVGNK FR QLE  GTKVLRIVNSDD ITKVPGFV+D  +DV
Sbjct  298   KTHFNGSPMATVFSFGGPRVGNKCFRQQLEVQGTKVLRIVNSDDLITKVPGFVMDQGNDV  357

Query  573   SDCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHC  403
             +D        +  W+QKCV D+QW YAEVG+ELR+SSKDS    S +VATCHDLKTYLH 
Sbjct  358   ADAHLAA-HRLPGWIQKCVEDAQWAYAEVGRELRLSSKDSPHLSSTNVATCHDLKTYLHL  416

Query  402   IDNWSSCKCPLRATA----KRVIEKNHGKRRR  319
             ++ + S  CP +ATA    +RV++    +R R
Sbjct  417   VEGFVSSTCPFKATASARTRRVLKNETTQRER  448



>ref|XP_007220124.1| hypothetical protein PRUPE_ppa020861mg, partial [Prunus persica]
 gb|EMJ21323.1| hypothetical protein PRUPE_ppa020861mg, partial [Prunus persica]
Length=364

 Score =   412 bits (1058),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 217/364 (60%), Positives = 278/364 (76%), Gaps = 15/364 (4%)
 Frame = -3

Query  1380  YQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCG  1201
             YQG+++WEGLLDPLDD LR EILRYG FV+AAY++FDFD  SP+YATC+Y + ++   C 
Sbjct  1     YQGVKNWEGLLDPLDDNLRGEILRYGQFVDAAYKAFDFDPDSPSYATCKYPKSSLFENCE  60

Query  1200  LGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVI  1033
             L  +GY++T+NL  T  + +PRW     + V+ +SSWIGYVAVC D++EI RLGRRDVVI
Sbjct  61    LPATGYRLTKNLRATSGIQLPRWIEKAPSWVATQSSWIGYVAVCQDKNEITRLGRRDVVI  120

Query  1032  AYRGTATPPEWLENLRATLTCLP----DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             ++RGTAT  EWLENLRATLT LP    ++     CEPMV+ GFLSLYTS +   PSL+  
Sbjct  121   SFRGTATCLEWLENLRATLTHLPSRTNNNSCLNECEPMVESGFLSLYTSGTHLMPSLQQM  180

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +R+EI +++++YGDEPLS+TITGHSLGAALAT+ AYDI T F  +PLVTV+SFGGPRVGN
Sbjct  181   VREEIARLLQSYGDEPLSLTITGHSLGAALATLAAYDIKTTFNRSPLVTVMSFGGPRVGN  240

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGTTQPSGMLSWLQKCV  517
             ++FR  LE  G KVLRIVNSDD ITKVPGFV+D ++      D G  +   + +WLQK V
Sbjct  241   RSFRRHLEKKGAKVLRIVNSDDVITKVPGFVIDENERRHVACDRGAHKRVEIQNWLQKKV  300

Query  516   -DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              D+QWVYAEVGKELR+SSKDS      +V+TCH+L TYLH +DN+ S KCP +ATAKR++
Sbjct  301   EDTQWVYAEVGKELRLSSKDSPYVNGTNVSTCHELSTYLHLVDNFVSRKCPFKATAKRLL  360

Query  345   EKNH  334
              +++
Sbjct  361   GRHY  364



>ref|XP_010052797.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Eucalyptus 
grandis]
Length=352

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 272/353 (77%), Gaps = 11/353 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG RDWEGLLDPLDD LR+EILRYG+FVEAAYRSFDFD +SPTY TC+Y   +++ R
Sbjct  1     MEYQGCRDWEGLLDPLDDTLRREILRYGEFVEAAYRSFDFDPSSPTYGTCKYPRSSLLAR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G+  +GY++TRNL  TC+V +PRW  L    +S +SSWIGYVAVC D  EI+RLGRRDV
Sbjct  61    SGIRETGYRLTRNLRATCSVRLPRWARLAPGWMSTRSSWIGYVAVCQDRREIQRLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP--DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             VIA RGT T  EW+ENLRATLTCL   DD+   +  PMV+ GFL LYTS +   PSL++ 
Sbjct  121   VIALRGTGTCLEWIENLRATLTCLHGHDDVTDDDT-PMVESGFLRLYTSRTANFPSLREM  179

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             IR+EI +++ETYGDEPLS+TITGHSLGAALAT+ AYDI++    AP+VTVVSFGGPRVGN
Sbjct  180   IREEIARVVETYGDEPLSLTITGHSLGAALATLAAYDISSTLEGAPMVTVVSFGGPRVGN  239

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVV-DSDDVSDCGTTQPSGMLSWLQKCV-DS  511
             ++FR  LE SGTK+LRIVNSDD +TK+PGFVV D D  +D  + + +GM  W QK V D+
Sbjct  240   RSFRRHLEASGTKILRIVNSDDLVTKLPGFVVEDGDTSADGKSIRVAGMPQWFQKSVQDA  299

Query  510   QWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
             +WVYA+VG+ELR+SS++S      ++ATCH+LKTYLH ++ + S  CP +   
Sbjct  300   RWVYADVGRELRLSSRESPHLREGNMATCHELKTYLHLVNGFVSSTCPFQVNG  352



>ref|XP_007139643.1| hypothetical protein PHAVU_008G047000g [Phaseolus vulgaris]
 gb|ESW11637.1| hypothetical protein PHAVU_008G047000g [Phaseolus vulgaris]
Length=421

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 268/350 (77%), Gaps = 7/350 (2%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  KW +YQGI  WEGLLDPLDD LR EILRYG FVE+AYR+FDFDT S TYATCR+ E 
Sbjct  58    LGHKWTQYQGINHWEGLLDPLDDNLRAEILRYGHFVESAYRAFDFDTNSLTYATCRFPET  117

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP----KSSWIGYVAVCDDEDEIRRL  1054
             +++ + G+  SGY+VT+NL  TC V +P W + VS     +SSWIGYVAVC+DE EIRRL
Sbjct  118   SLLPQTGMRKSGYRVTKNLQATCGVQLPSWISSVSQLPRVQSSWIGYVAVCEDEKEIRRL  177

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             GRRDVVIA RGTAT  EWLENLR TLT LP+ M   + E MV+ GFLSLY S +D  PSL
Sbjct  178   GRRDVVIALRGTATCLEWLENLRVTLTKLPEHMGCGSEECMVENGFLSLYVSKTDTCPSL  237

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +D +R+E+ ++I+ YG EPLSI+ITGHSLGAALA + AYDITT F+++P+V+VVSFGGPR
Sbjct  238   QDMVREEVARVIQCYGHEPLSISITGHSLGAALALLCAYDITTTFKNSPMVSVVSFGGPR  297

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-  517
             VGN  FR+QLE SGT++LRIVNSDD ITKVPG VV  DDV+       +G+ +W +K V 
Sbjct  298   VGNDKFRAQLEKSGTRILRIVNSDDVITKVPGLVVPDDDVACNAGVHVAGLQTWFRKVVQ  357

Query  516   DSQWVYAEVGKELRvsskdssyskd--VATCHDLKTYLHCIDNWSSCKCP  373
             D Q VYA+VG+ELRVSS++S Y K   VATCHDLKTYLH ++ + S  CP
Sbjct  358   DMQLVYADVGQELRVSSRESPYLKKGDVATCHDLKTYLHLVNGFVSSSCP  407



>gb|EPS65776.1| hypothetical protein M569_09001, partial [Genlisea aurea]
Length=350

 Score =   409 bits (1050),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 265/362 (73%), Gaps = 27/362 (7%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             +W E+QGIR+WEG+LDPLDD LR EILRYG+FVEAAYR F+ D A P             
Sbjct  5     RWKEFQGIRNWEGMLDPLDDGLRDEILRYGEFVEAAYRCFESDAAPP-------------  51

Query  1212  TRCGLGG---SGYKVTRNLYGTCAVNVPRWTNLVSP-KSSWIGYVAVCDDEDEIRRLGRR  1045
               CG GG   +GYK+TR+++ TC + +P  T+ +    SSWIGYVAVCDD DEI RLGRR
Sbjct  52    --CGDGGLRMNGYKLTRSVHATCGIQLPNLTDRIPQWMSSWIGYVAVCDDADEIARLGRR  109

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             DVV+AYRGT+T  EWLENLRATLTCLP +M+  +    VQ GFLSLYTS++   PSL+ S
Sbjct  110   DVVVAYRGTSTCMEWLENLRATLTCLPSEMSSVSGS-KVQSGFLSLYTSSTPEKPSLQTS  168

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +++EI +I+  Y  EPLSITITGHSLGAALAT+TAYDI T   + PLVTVVSFGGPRVGN
Sbjct  169   VKEEINRILRKYAGEPLSITITGHSLGAALATLTAYDIATTVENPPLVTVVSFGGPRVGN  228

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGT----TQPSGMLSWL-QKC  520
             K FR QLE +  KVLRIVNSDDPITKVPGFV++    +   T    +Q + ML WL ++ 
Sbjct  229   KTFRRQLEKTAVKVLRIVNSDDPITKVPGFVLEDGGAAAEKTRTPRSQSTAMLKWLHRRA  288

Query  519   VDSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              ++Q VYAE+G+ELR+SS DS    +  VATCHDLKTYLH +DN+ S  CP+RATAK V+
Sbjct  289   EEAQLVYAEIGEELRLSSNDSPYLNNPSVATCHDLKTYLHLVDNFVSSNCPIRATAKMVL  348

Query  345   EK  340
             EK
Sbjct  349   EK  350



>emb|CDX74688.1| BnaA05g04340D [Brassica napus]
Length=425

 Score =   411 bits (1056),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 211/370 (57%), Positives = 268/370 (72%), Gaps = 36/370 (10%)
 Frame = -3

Query  1416  DRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATC  1237
             +   KL  +W EYQG+++WEGLLDPLDD LR EILRYG FVE+AY+SFDFD +SPTYATC
Sbjct  81    NNPVKLNRRWKEYQGLQNWEGLLDPLDDNLRGEILRYGQFVESAYQSFDFDPSSPTYATC  140

Query  1236  RYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDED  1069
             R+  + ++ + GL  SGY+VT+NL  T  +N+PRW     + ++ +SSWIGYVAVC D++
Sbjct  141   RFPRNTLLDQSGLPNSGYRVTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKE  200

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLY  904
             EI RLGRRDVVI++RGTAT  EWLENLRATL  LPD     ++   N  PMV+ GFLSLY
Sbjct  201   EISRLGRRDVVISFRGTATCLEWLENLRATLAHLPDGPSGPNLNGSNSGPMVESGFLSLY  260

Query  903   TSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
             TS   AH SL+D +R+EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+
Sbjct  261   TSG--AH-SLRDMVREEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPM  317

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV+SFGGPRVGN+ FR  LE  GTKVLRIVNSDD ITKVPG                  
Sbjct  318   VTVMSFGGPRVGNRCFRRLLEKQGTKVLRIVNSDDVITKVPG------------------  359

Query  543   MLSWLQKCVDSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPL  370
                 +++  ++ WVYAEVGKELR+SS         +VATCH+LKTYLH +D + S  CP 
Sbjct  360   ----VKRVEETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCPF  415

Query  369   RATAKRVIEK  340
             R TA+RV+ +
Sbjct  416   RETARRVLHR  425



>ref|XP_006445434.1| hypothetical protein CICLE_v10023837mg [Citrus clementina]
 gb|ESR58674.1| hypothetical protein CICLE_v10023837mg [Citrus clementina]
Length=375

 Score =   408 bits (1049),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 226/370 (61%), Positives = 280/370 (76%), Gaps = 15/370 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+++WEGLLDPLDD LR EILRYGDFVEAAY+SFDFD +SP+YATCR+ ++ ++ R
Sbjct  1     MEYQGMQNWEGLLDPLDDNLRGEILRYGDFVEAAYKSFDFDPSSPSYATCRFPKNTLLDR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRW-----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
              GL  +GY++T+NL  T   N+PRW      + V+ +SSWIGYVAVC D++ I RLGRRD
Sbjct  61    SGLPQTGYRLTKNLRATSGTNLPRWWIEKAPSWVATQSSWIGYVAVCQDQEVISRLGRRD  120

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC-EPMVQRGFLSLYTSASDAHPSLKDS  865
             VVIA RGTAT  EWLENLRATLT LP      +   PMV+ GFLSLYTS + + PSL++ 
Sbjct  121   VVIALRGTATCLEWLENLRATLTRLPGPGTDGSVFGPMVESGFLSLYTSKTASCPSLQEM  180

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +R+EI ++++TYGDEPLS+TITGHSLGAALAT+ AYDI T F  +P+ TV SFGGPRVGN
Sbjct  181   LREEIKRLLQTYGDEPLSLTITGHSLGAALATLAAYDIKTHFNGSPMATVFSFGGPRVGN  240

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS-DDVSDCGTTQPSGMLSWLQKCV-DS  511
             K FR QLE  GTKVLRIVNSDD ITKVPGFV+D  +DV+D        +  W+QKCV D+
Sbjct  241   KCFRQQLEVQGTKVLRIVNSDDLITKVPGFVMDQGNDVADAHLAAHR-LPGWIQKCVEDA  299

Query  510   QWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATA----KRV  349
             QW YAEVG+ELR+SSKDS    S +VATCHDLKTYLH ++ + S  CP +ATA    +RV
Sbjct  300   QWAYAEVGRELRLSSKDSPHLSSTNVATCHDLKTYLHLVEGFVSSTCPFKATASARTRRV  359

Query  348   IEKNHGKRRR  319
             ++    +R R
Sbjct  360   LKNETTQRER  369



>ref|XP_006375140.1| DEFECTIVE ANTHER DEHISCENCE family protein [Populus trichocarpa]
 gb|ERP52937.1| DEFECTIVE ANTHER DEHISCENCE family protein [Populus trichocarpa]
Length=365

 Score =   408 bits (1048),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 224/363 (62%), Positives = 273/363 (75%), Gaps = 12/363 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGIR+WEGLLDPLDD LR EILRYG FV+AAY+SFDFD +SPTYATCR+ +  +  R
Sbjct  1     MEYQGIRNWEGLLDPLDDNLRGEILRYGHFVDAAYKSFDFDPSSPTYATCRFPKSTLFER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G   +GY++T++L  T  + +PRW     + V  +SSWIGYVAV  ++ EI RLGRRDV
Sbjct  61    SGKPDTGYRLTKHLRATSGIQIPRWIEKAPSWVFTQSSWIGYVAVSLNKAEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD-DMAPRNCE---PMVQRGFLSLYTSASDAHPSLK  871
             VIA+RGTAT  EWLENLRATLT LP+ D   +  +   PMV+ GFLSLYTS +   PSL+
Sbjct  121   VIAFRGTATCLEWLENLRATLTQLPNSDCGKKGSDDSGPMVESGFLSLYTSGTPMGPSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             + +R EI +++ TYGDEPLS+TITGHSLGAALAT+ AYDI T F  APLVTV+SFGGPRV
Sbjct  181   EMVRQEIKRLLHTYGDEPLSLTITGHSLGAALATLAAYDIKTTFNCAPLVTVISFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD-DVSDCGTTQPSGMLSWLQKCV-  517
             GN++FR  LE  GTKVLRIVNSDD ITKVPGFV+D + +V + G    + + SW+QK V 
Sbjct  241   GNRSFRRHLEKQGTKVLRIVNSDDVITKVPGFVIDGENNVPNKGDLNMASLPSWIQKKVE  300

Query  516   DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIE  343
             D+QWVYAEVG+ELR+SSKDS    S +VA CHDLKTYLH ++ + S  CP RA AKR   
Sbjct  301   DTQWVYAEVGRELRLSSKDSPYLNSINVAACHDLKTYLHLVNGFVSSSCPFRAKAKRFFL  360

Query  342   KNH  334
              NH
Sbjct  361   SNH  363



>ref|XP_010259174.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nelumbo 
nucifera]
Length=391

 Score =   408 bits (1049),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 220/379 (58%), Positives = 276/379 (73%), Gaps = 25/379 (7%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGI++WEGLLDPLDD LR EI+RYG FVEAAY SF+FDT+SP+YATCR+   +++  
Sbjct  1     MEYQGIKNWEGLLDPLDDNLRGEIIRYGKFVEAAYSSFEFDTSSPSYATCRFSTHSLLKN  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G+  +GY+VT+NL  T  +  PRW     + V  +SSW+GYVA+CDD+DEI RLGRRDV
Sbjct  61    SGVSNTGYRVTKNLTATSGIKFPRWVEKAPSWVWNQSSWVGYVAICDDKDEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD---DMAPRNCEPMVQRGFLSLYTSASDAHPSLKD  868
             VIAYRGTAT  EWLENLRATLT LP+   ++ P    PMV++GFLSLYTS +    SL+D
Sbjct  121   VIAYRGTATCMEWLENLRATLTHLPNAPSNVGPDIGGPMVEKGFLSLYTSETATCRSLRD  180

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRH-APLVTVVSFGGPRV  691
              +++E+ +I++ YGDEPLS+TITGHSLGAALAT+TAYDITT F   APLVTV+SFG PRV
Sbjct  181   EVKEEVGRILQRYGDEPLSLTITGHSLGAALATLTAYDITTTFNSPAPLVTVISFGTPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD------DVSDCGTTQ------PS  547
             GN++F   +E  GTK+LRIVNS D ITKVPGFV+D        D  + G  +       +
Sbjct  241   GNRSFSCHVERCGTKILRIVNSHDLITKVPGFVIDGHDHHGELDSEEVGKRRKGAAGMAA  300

Query  546   GMLSWLQKCV-DSQWVYAEVGKELRvsskdssy----skdVATCHDLKTYLHCIDNWSSC  382
             G+ SWLQK V ++QWVYA+VG+ELRVSS DSSY      +V T HDL TYL  +  + S 
Sbjct  301   GLPSWLQKRVEETQWVYADVGRELRVSSGDSSYLTWPITNVVTHHDLDTYLQLVSGYVSS  360

Query  381   KCPLRATAKRVIEKNHGKR  325
             KCPLR TAKRV+     ++
Sbjct  361   KCPLRDTAKRVLSGRRAEK  379



>ref|XP_010559205.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Tarenaya 
hassleriana]
Length=363

 Score =   406 bits (1044),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 211/362 (58%), Positives = 266/362 (73%), Gaps = 20/362 (6%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+R+W GLLDPLD+ LR+EILRYG FVEAAY+SFDFD +SPTYATCR+    ++ R
Sbjct  1     MEYQGLRNWTGLLDPLDENLRREILRYGQFVEAAYQSFDFDPSSPTYATCRFPRSTLLER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G  G+GY++T+NL  T  + +P W     + V+ +SSWIGYVAVC D++EI RLGRRD+
Sbjct  61    SGFPGTGYRLTKNLRATSGIQLPSWIEKAPSWVTTQSSWIGYVAVCQDKEEISRLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE--PMVQRGFLSLYTSASDAHPSLKDS  865
             VI++RGTAT  EWLENL+ TLT LP+          PMV+ GFLSLYTS +    SL+D 
Sbjct  121   VISFRGTATCLEWLENLQVTLTHLPEGSGTHGSGSGPMVESGFLSLYTSGTH---SLRDM  177

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +R+EI++++++YGDEPLS+TITGHSLGAALA +TAYD+ T F  AP+VTV+SFGGPRVGN
Sbjct  178   VRNEISRLLQSYGDEPLSLTITGHSLGAALAILTAYDVKTTFNRAPMVTVISFGGPRVGN  237

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPG-FVVDSDDVSDC-------GTTQPSGMLSWL  529
             ++F   LE  GTKVLRIVNSDD ITK+PG  VVD D+   C        T   S +  W+
Sbjct  238   RSFGELLERQGTKVLRIVNSDDLITKLPGVVVVDKDEEDRCNSRNVETATALTSTLPGWI  297

Query  528   QKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
             QK V D+ W YAEVG+ELR+SS+ S    S +VATCH+LKTYLH +D + S  CP R TA
Sbjct  298   QKRVEDTPWAYAEVGQELRLSSRYSPYVNSINVATCHELKTYLHLVDGFVSSTCPFRETA  357

Query  357   KR  352
             KR
Sbjct  358   KR  359



>gb|KCW76875.1| hypothetical protein EUGRSUZ_D01226, partial [Eucalyptus grandis]
Length=341

 Score =   403 bits (1035),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 214/342 (63%), Positives = 268/342 (78%), Gaps = 11/342 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG RDWEGLLDPLDD LR+EILRYG+FVEAAYRSFDFD +SPTY TC+Y   +++ R
Sbjct  1     MEYQGCRDWEGLLDPLDDTLRREILRYGEFVEAAYRSFDFDPSSPTYGTCKYPRSSLLAR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G+  +GY++TRNL  TC+V +PRW  L    +S +SSWIGYVAVC D  EI+RLGRRDV
Sbjct  61    SGIRETGYRLTRNLRATCSVRLPRWARLAPGWMSTRSSWIGYVAVCQDRREIQRLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP--DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             VIA RGT T  EW+ENLRATLTCL   DD+   +  PMV+ GFL LYTS +   PSL++ 
Sbjct  121   VIALRGTGTCLEWIENLRATLTCLHGHDDVTDDDT-PMVESGFLRLYTSRTANFPSLREM  179

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             IR+EI +++ETYGDEPLS+TITGHSLGAALAT+ AYDI++    AP+VTVVSFGGPRVGN
Sbjct  180   IREEIARVVETYGDEPLSLTITGHSLGAALATLAAYDISSTLEGAPMVTVVSFGGPRVGN  239

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS-DCGTTQPSGMLSWLQKCV-DS  511
             ++FR  LE SGTK+LRIVNSDD +TK+PGFVV+  D S D  + + +GM  W QK V D+
Sbjct  240   RSFRRHLEASGTKILRIVNSDDLVTKLPGFVVEDGDTSADGKSIRVAGMPQWFQKSVQDA  299

Query  510   QWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNW  391
             +WVYA+VG+ELR+SS++S      ++ATCH+LKTYLH ++ +
Sbjct  300   RWVYADVGRELRLSSRESPHLREGNMATCHELKTYLHLVNGF  341



>ref|XP_004248588.2| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Solanum 
lycopersicum]
Length=443

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/365 (56%), Positives = 264/365 (72%), Gaps = 11/365 (3%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             K+   WMEYQGI++WEGLLDPLDD LR EI+RYG FVEAAYR+ +FD +SP+YA C+Y  
Sbjct  78    KIGKNWMEYQGIKNWEGLLDPLDDNLRGEIIRYGHFVEAAYRACNFDPSSPSYAMCKYSR  137

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCDDEDEIRR  1057
               +    G  G+GY++++ L  T  +N+P W +     +S +SSWIGYVA+C D+ EI R
Sbjct  138   KKLFHLSGFSGTGYRISKYLKATSGINLPNWVDKAPKWMSKQSSWIGYVAICHDQREIAR  197

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPS  877
             LGRRDVVIA RGTAT  EWLENLRATLT LP+ +    C PMV+ GFLSLYTS  DA  S
Sbjct  198   LGRRDVVIALRGTATCLEWLENLRATLTPLPN-IKHTICCPMVESGFLSLYTSKIDAQQS  256

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGP  697
             L+D +R+EI +I + Y  E LS TI GHSLGAALAT+TAYDI   FR  PLVTV+SFGGP
Sbjct  257   LQDMVREEIDRIKKLYDGETLSFTIAGHSLGAALATLTAYDIKQFFRDIPLVTVMSFGGP  316

Query  696   RVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV  517
             RVGN +FR  L+   TK+LRIVNSDD ITK+PGFV+D++D  D    +      W+++ V
Sbjct  317   RVGNHSFRYHLDKQDTKILRIVNSDDLITKIPGFVIDNNDDDDKYVEKSD---HWMKRLV  373

Query  516   -DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              DSQWVYA+VG ELR+SS  S      ++ATCH+L TYLH ++++ S  CP+RATAK+++
Sbjct  374   EDSQWVYADVGCELRLSSSGSPHFNGINIATCHELNTYLHLVNSFVSSSCPVRATAKKIM  433

Query  345   EKNHG  331
              K++ 
Sbjct  434   HKSNN  438



>ref|XP_004308496.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=366

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 212/367 (58%), Positives = 270/367 (74%), Gaps = 17/367 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+++WEGLLDPLD  LR+EI+RYG+FV+AAY++FDFD  SPTYATC+Y +  V   
Sbjct  1     MEYQGVKNWEGLLDPLDGNLRREIIRYGNFVDAAYKAFDFDPDSPTYATCKYPKSTVFDN  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL G+GY++T+NL  T  +N+PRW     + V  +SSWIGYVAVC D+DEI RLGRRD+
Sbjct  61    SGLPGTGYRITKNLRATSGINLPRWIERGPSWVGTQSSWIGYVAVCKDKDEIARLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP-----DDMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             VIA RGTAT  EWLENLR TLT LP             EPMV+ GFLSLYTS +D  PSL
Sbjct  121   VIALRGTATCLEWLENLRVTLTHLPCGAKMAHTGAEGSEPMVETGFLSLYTSGTDLVPSL  180

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +  IR+EI ++++TYGDEP+S+TITGHSLGAALAT+ AYDI + F  APL TVVSFGGPR
Sbjct  181   QQMIREEIRRLLQTYGDEPMSLTITGHSLGAALATLAAYDIKSTFNRAPLATVVSFGGPR  240

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLS----WLQ  526
             VGN++FR  LE  G KVLRIVN DD ITK+PGFVV+         +   GM +    W+Q
Sbjct  241   VGNRSFRHNLEKKGAKVLRIVNEDDLITKMPGFVVEDKKARHVAGSPLVGMAAGFQNWIQ  300

Query  525   KCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
             K V ++QWVY+EVGKEL++SSK+S      +++TCHDL TYLH ++N+ S  CP ++TAK
Sbjct  301   KRVEETQWVYSEVGKELKLSSKNSPDLSGTNMSTCHDLGTYLHLVENFVS-NCPCKSTAK  359

Query  354   RVIEKNH  334
             +++ + H
Sbjct  360   KLLSRVH  366



>ref|XP_009353725.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009353735.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=365

 Score =   399 bits (1025),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 214/365 (59%), Positives = 267/365 (73%), Gaps = 14/365 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +WEGLLDPLD  LR EI+RYG FV+ AY++FDFD  S +YATC+Y + ++   
Sbjct  1     MEYQGFTNWEGLLDPLDANLRGEIIRYGQFVDVAYKAFDFDPDSNSYATCKYSKASLFEN  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL G+GY++T+NL  T  + +P W     + V+ +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    SGLPGTGYRITKNLRATSGIQLPSWIEKAPSWVATQSSWIGYVAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP---DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKD  868
             VIAYRGTAT  EWLENLRATLT LP   ++    NCEPMV+ GFLSLYTS +D+ PSL+ 
Sbjct  121   VIAYRGTATCLEWLENLRATLTQLPSVLNNSGLDNCEPMVESGFLSLYTSGTDSIPSLQQ  180

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVG  688
              +R EI ++++ YGDEPLSIT TGHSLGAALAT+ A DI T F  +PLVTV+SF GPRVG
Sbjct  181   MVRQEIARLLQYYGDEPLSITFTGHSLGAALATLAACDIKTTFNPSPLVTVMSFAGPRVG  240

Query  687   NKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGTTQPSGMLSWLQKC  520
             N +FR  L+  G KVLRIVNSDD ITK+PGFV+D ++      D G  +     +W+QK 
Sbjct  241   NSSFRRNLDKKGAKVLRIVNSDDVITKIPGFVIDDNERLHKACDGGFRKAVEFQNWIQKK  300

Query  519   V-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRV  349
             V D+Q  YAEVGKELR+SSKDS      +V+TCH+L TYLH +DN+ S KCP +ATAKR+
Sbjct  301   VEDTQLSYAEVGKELRLSSKDSPYLMGTNVSTCHELSTYLHLVDNFQSSKCPFKATAKRL  360

Query  348   IEKNH  334
               K H
Sbjct  361   FSKKH  365



>ref|XP_011017357.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Populus euphratica]
Length=366

 Score =   398 bits (1023),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 220/370 (59%), Positives = 273/370 (74%), Gaps = 18/370 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGIR+WEGLLDPLDD LR EILRYGDFV+AAY+SFDF+ +SPTYA CR+ +  +  R
Sbjct  1     MEYQGIRNWEGLLDPLDDNLRGEILRYGDFVDAAYKSFDFNPSSPTYANCRFPKRTLFER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  +GY+VT++L  T  + +PRW     + +  +SSWIGY AV  ++ EI RLGRRDV
Sbjct  61    SGLRDTGYQVTKHLRATSGIQLPRWMEKAPSWMFTQSSWIGYAAVSQNKAEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE----PMVQRGFLSLYTSASDAHPSLK  871
             VIA+RGTAT  EWLENLRATLT LP+    +N      PMV+RGFLSLYTS +   PSL+
Sbjct  121   VIAFRGTATCLEWLENLRATLTQLPNTECDKNGSDESGPMVERGFLSLYTSGTPIRPSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAP-LVTVVSFGGPR  694
             + +R+E  ++++TYGDEPLS+TI GHSLGAALAT+ AYDI T F   P LVTV+SFGGPR
Sbjct  181   EMVREETKRLLQTYGDEPLSLTIAGHSLGAALATLAAYDIKTTFNRVPVLVTVISFGGPR  240

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD--DVSDCGTTQPSGMLSWLQKC  520
             VGN++FR  L+  GTKVLRIVNSDD ITK+PGFV+D D  DV+D G    +   SW+QK 
Sbjct  241   VGNRSFRQLLDKQGTKVLRIVNSDDVITKLPGFVIDGDQNDVADKGDLSMASFPSWIQKR  300

Query  519   VD-SQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRV  349
             ++ +QWVYAEVG+ELR+SSKDS    S +VATCHDLKTYLH ++ + S  CP    A R 
Sbjct  301   MENTQWVYAEVGRELRLSSKDSPYLNSINVATCHDLKTYLHLVNGFVSSSCPFVEKANRF  360

Query  348   IEKNHGKRRR  319
             +    G RRR
Sbjct  361   L----GNRRR  366



>ref|XP_002302495.1| hypothetical protein POPTR_0002s13890g [Populus trichocarpa]
 gb|EEE81768.1| hypothetical protein POPTR_0002s13890g [Populus trichocarpa]
Length=367

 Score =   396 bits (1017),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 274/371 (74%), Gaps = 19/371 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGIR+WEGLLDPLDD LR EILRYGDFV+AAY+SFDF+ +SPTYA CR+ +  +  R
Sbjct  1     MEYQGIRNWEGLLDPLDDNLRGEILRYGDFVDAAYKSFDFNPSSPTYANCRFPKRTLFER  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G   +GY+VT++L  T  + +PRW     + +  +SSWIGYVAV  ++ EI RLGRRDV
Sbjct  61    SGFRDTGYRVTKHLRATSVIQLPRWMEKAPSWMFTQSSWIGYVAVSQNKAEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE----PMVQRGFLSLYTSASDAHPSLK  871
             VIA+RGTAT  EWLENLRATLT LP+    +N      PMV+RGFLSLYTS +   PSL+
Sbjct  121   VIAFRGTATCLEWLENLRATLTQLPNTECDKNGSDESGPMVERGFLSLYTSGTPIRPSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAP-LVTVVSFGGPR  694
             + +R+E  ++++TYGDEPLS+TI GHSLGAALAT+ AYDI T F   P LVTV+SFGGPR
Sbjct  181   EMVREESKRLLQTYGDEPLSLTIAGHSLGAALATLAAYDIKTTFNRVPVLVTVISFGGPR  240

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD--DVSDCG-TTQPSGMLSWLQK  523
             VGN++FR  L+  GTKVLRIVNS+D ITK+PGFV+D D  DV+D G     +   SW+QK
Sbjct  241   VGNRSFRQLLDKQGTKVLRIVNSNDVITKLPGFVIDGDQNDVADKGDLISMASFPSWIQK  300

Query  522   CV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
              + D+QWVYAEVG+ELR+SSKDS    S +VATCHDLKTYLH ++ + S  CP    AKR
Sbjct  301   RMEDTQWVYAEVGRELRLSSKDSPYLNSINVATCHDLKTYLHLVNGFVSSSCPFVEKAKR  360

Query  351   VIEKNHGKRRR  319
              +    G RRR
Sbjct  361   FL----GNRRR  367



>ref|XP_003533563.2| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Glycine 
max]
Length=404

 Score =   397 bits (1020),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 265/375 (71%), Gaps = 19/375 (5%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             +++KL  +W EY G+ +WEGLLDPLDD LR EILRYG FVE AY+SF+FD +SP +A  R
Sbjct  32    QSSKLGKRWKEYHGMSNWEGLLDPLDDNLRAEILRYGHFVETAYKSFEFDPSSPNFANSR  91

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDE  1066
             + + A++ RCGL  + YKVT+ L  T  + +P W +     V+ ++S++GYVAVC D++E
Sbjct  92    FPKKALLERCGLPKTRYKVTKYLRATSGIQLPSWVDKVPRWVAKQTSYVGYVAVCHDKEE  151

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC----------EPMVQRGF  916
             I+RLGRRDVV+AYRGT T  EWLEN RA+LT LP   + +              MV+ GF
Sbjct  152   IKRLGRRDVVVAYRGTTTCLEWLENFRASLTNLPIPCSSKRAFEKNGVMDGSGAMVESGF  211

Query  915   LSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR  736
             LSLYTS+  A  SL++ +R EI++I++TY  E LS+T+TGHSLGAALAT+TAYD+ T F 
Sbjct  212   LSLYTSSLPAKVSLQEMVRREISRILDTYRGEQLSLTVTGHSLGAALATLTAYDVKTAFP  271

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
               P VTV+SFGGPRVG++ FR QLE  GTKVLRIVNSDD ITK+PGFV D DDV+  G  
Sbjct  272   ELP-VTVISFGGPRVGDRRFRRQLERQGTKVLRIVNSDDVITKLPGFVFD-DDVASAGGV  329

Query  555   QPSGMLSWLQKCV-DSQWVYAEVGKELR--vsskdssyskdVATCHDLKTYLHCIDNWSS  385
               +G  SW+QK V ++Q VYAEVGKELR          + +VATCH+L TYLH +D + S
Sbjct  330   HVAGFPSWIQKRVEEAQLVYAEVGKELRLCSRDSPYLGNTNVATCHELNTYLHLVDGFVS  389

Query  384   CKCPLRATAKRVIEK  340
               CP RA+AKR +++
Sbjct  390   STCPFRASAKRFLQR  404



>ref|XP_003624312.1| Lipase [Medicago truncatula]
 gb|AES80530.1| glycerolipase A1 [Medicago truncatula]
Length=450

 Score =   395 bits (1016),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 211/415 (51%), Positives = 277/415 (67%), Gaps = 37/415 (9%)
 Frame = -3

Query  1491  FSTLKNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEIL  1312
             + TLK T     L ++ S+   +      K+  +W EYQG+ +WEGLLDPLD+ LR EIL
Sbjct  40    YETLKTTHKIPNLSSSKSTFSPLPFP-TTKVNKRWKEYQGMTNWEGLLDPLDNNLRSEIL  98

Query  1311  RYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW  1132
             RYG FVEAAY+SF+FD +S  YAT ++ +  +  +CGL  +GYKVT++L+ T  + +P W
Sbjct  99    RYGHFVEAAYKSFEFDPSSSNYATNKFPKTTLFKKCGLPKTGYKVTKHLHATSGIQLPSW  158

Query  1131  TNL----VSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLP  964
              +     V+ KSS+IGYVAVCD+++EI+RLGRRDVVIA RGT T  EWLENLRATLT   
Sbjct  159   IDKAPSWVATKSSYIGYVAVCDNKEEIKRLGRRDVVIALRGTTTCLEWLENLRATLT---  215

Query  963   DDMAPRNC--------------EPMVQRGFLSLYTSAS-----DAHPSLKDSIRDEITKI  841
              ++ P  C              +PMV+ GFLSLYTS S     +A PSL++ +R EI +I
Sbjct  216   -NINPLECDNSSQHSINSDENDQPMVESGFLSLYTSKSNSTNNEAIPSLQEMVRSEIERI  274

Query  840   IETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLE  661
             ++TY  E LS TITGHSLGAALA +TA+DI T F   PLVTV+SFGGPRVGNK+FR +LE
Sbjct  275   LKTYKGENLSFTITGHSLGAALAILTAHDIKTYFDQKPLVTVISFGGPRVGNKSFRLKLE  334

Query  660   NSGTKVLRIVNSDDPITKVPGFVVDSD------DVSDCGTTQPSGMLSWLQKCV-DSQWV  502
               G KVLRIVNSDD ITK+PGFV+D        D+          +  W+QK V ++QWV
Sbjct  335   KEGIKVLRIVNSDDVITKMPGFVLDDKVEESVYDMEGNNDDMAWFLPRWIQKRVKETQWV  394

Query  501   YAEVGKELR--vsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIE  343
             Y+EVG+ELR    +       ++ATCHDLKTYLH +D + S +CP R+TA+R ++
Sbjct  395   YSEVGEELRVCSRNSPYLKGVNIATCHDLKTYLHLVDGFVSSECPFRSTARRFLQ  449



>ref|XP_004493049.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Cicer 
arietinum]
Length=413

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/348 (58%), Positives = 256/348 (74%), Gaps = 10/348 (3%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             M+YQGI +WEGLLDPLD  LR EILRYG FVEAAYRSFD+D  SPTY+TCRY + +++T 
Sbjct  1     MQYQGINNWEGLLDPLDHNLRNEILRYGQFVEAAYRSFDYDVNSPTYSTCRYSKTSLLTN  60

Query  1206  CGLG--GSGYKVTRNLYGTCAVNVPRW----TNLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              G+      Y++T+NL  TC   +P W    + L   +SSWIGYVAVC D++EI RLGRR
Sbjct  61    SGMKFHADNYRITKNLRATCGFRLPNWFHDISQLTRVRSSWIGYVAVCTDKNEIARLGRR  120

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRNCEPMVQRGFLSLYTSASDAHPSLKD  868
             DVVI+ RGTAT  EWLEN RATLT LP+++    N E MV++GFLS+Y S +D  PSL+D
Sbjct  121   DVVISLRGTATLLEWLENFRATLTTLPNNIGCGNNNECMVEKGFLSIYVSKTDTCPSLQD  180

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVG  688
              +++E+  +I++YGDEPLS+TITGHSLGAALA ++AYDI T FR  PLVTV+SFGGPRV 
Sbjct  181   MVKEEVRTLIKSYGDEPLSLTITGHSLGAALAILSAYDIATSFRIPPLVTVISFGGPRVV  240

Query  687   NKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVD-S  511
             N  FRSQLE SG ++LRIVNSDD ITK PGFV  SDDV          +  WL++ V+  
Sbjct  241   NDKFRSQLEQSGVRILRIVNSDDVITKFPGFVEKSDDVEINKGAHVDLLQRWLRQRVEYM  300

Query  510   QWVYAEVGKELRvsskdssyskd--VATCHDLKTYLHCIDNWSSCKCP  373
             + VYA+VG+ELR+SS++S Y K   +ATCHDLKTYLH ++ + S   P
Sbjct  301   KLVYADVGQELRLSSRESPYVKSGDIATCHDLKTYLHLVECFVSSSSP  348



>ref|XP_010104276.1| Phospholipase A(1) DAD1 [Morus notabilis]
 gb|EXB99561.1| Phospholipase A(1) DAD1 [Morus notabilis]
Length=456

 Score =   395 bits (1015),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 215/369 (58%), Positives = 280/369 (76%), Gaps = 21/369 (6%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             +W EYQGIR+W+GLLDPLD+ LR+EILRYG FV+AAY+SFDFD +S +YATC++ + +++
Sbjct  88    RWKEYQGIRNWDGLLDPLDENLRREILRYGKFVDAAYKSFDFDPSSSSYATCKFPKSSLL  147

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              R GL  +GY++TRNL  T  + +PRW +     V+ +SSWIGYVAVC D++EI RLGRR
Sbjct  148   DRSGLPDTGYRLTRNLRATSGIQLPRWVDRAPSWVATQSSWIGYVAVCQDKEEIARLGRR  207

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             D VI++RGTATP EWLENLRATLT    D++P N   MV+ GFLSLYTS ++   SL+  
Sbjct  208   DAVISFRGTATPLEWLENLRATLT----DVSPVNDGSMVESGFLSLYTSGAE---SLQQM  260

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +R EI +++++YGDEPLS+TITGHSLGAALAT+ AYDI T F+  PLVTV+SFGGPRVGN
Sbjct  261   VRAEIARLLQSYGDEPLSLTITGHSLGAALATLAAYDIKTHFKRTPLVTVISFGGPRVGN  320

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGT-----TQPSGMLSWLQKC  520
             +NFRSQLE  GTK+LRIVNSDD ITKVPGFV+D +D  D         + + + SW+QK 
Sbjct  321   RNFRSQLEKQGTKILRIVNSDDLITKVPGFVLDENDGGDSHVESNKDVRVASLPSWIQKR  380

Query  519   V-DSQWVYAEVGKELRvssk----dssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
             V D+ WVYAEVGKELR+SS+          +VATCH+L TYLH ++N+ S  CP RATA+
Sbjct  381   VEDTPWVYAEVGKELRLSSRDSPYLLGSGFNVATCHELGTYLHLVENFVSSTCPFRATAR  440

Query  354   RVIEKNHGK  328
             +++ K + +
Sbjct  441   KMLGKRNTR  449



>ref|XP_009779306.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nicotiana 
sylvestris]
Length=467

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 263/377 (70%), Gaps = 24/377 (6%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             +L + WM+YQGI++WEGLLDPLDD LR EI+RYG FVEAAYR+ +FD +SP+YA C+Y +
Sbjct  86    ELGNNWMDYQGIKNWEGLLDPLDDSLRGEIIRYGHFVEAAYRACNFDPSSPSYAMCKYSK  145

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRR  1057
               ++   G  G+GY+V++ L  T  + +P W     N ++ +SSWIGYVA+C D+ EI R
Sbjct  146   KKLLQFSGFSGTGYRVSKYLKATSGIQLPSWVDKAPNWMAKQSSWIGYVAICHDQREITR  205

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLP---------------DDMAPRNCEPMVQR  922
             LGRRDVVIA RGTAT  EWLENLRA LT LP                 + P NC PMV+ 
Sbjct  206   LGRRDVVIALRGTATCLEWLENLRAILTPLPNNNNNNNNNNNNECCSSIYPDNCCPMVES  265

Query  921   GFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQ  742
             GFLSLYTS     PSL++ +++EI +II+ Y  E LS TI GHSLGAALAT+ AYDI   
Sbjct  266   GFLSLYTSKMGTRPSLQNMVKEEIARIIKAYPGETLSFTIAGHSLGAALATLMAYDIKQA  325

Query  741   FRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
                 PLVTV+SFGGPRVGN +FR  L+  GTK+LRIVNSDD ITKVPGFV+D+ + +D  
Sbjct  326   LEEIPLVTVISFGGPRVGNHSFRHHLDKQGTKILRIVNSDDLITKVPGFVIDNHNNNDNF  385

Query  561   TTQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNW  391
             T    G   W+QK V D+QWVYA+VG ELR+SS DS      ++A CH+LKTYL  ++ +
Sbjct  386   TNNKGG--HWIQKLVEDTQWVYADVGCELRLSSSDSPYLNGINIAACHELKTYLQLVNGF  443

Query  390   SSCKCPLRATAKRVIEK  340
              S  CP+RATAK++++K
Sbjct  444   VSSNCPVRATAKKMMQK  460



>ref|XP_003520425.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Glycine 
max]
 gb|KHN00200.1| Phospholipase A(1) DAD1, chloroplastic [Glycine soja]
Length=429

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 270/380 (71%), Gaps = 15/380 (4%)
 Frame = -3

Query  1479  KNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGD  1300
             K+  SW  L    S+KC        KL  KW +YQGI  WEGLLDPLDD LR EILRYG 
Sbjct  38    KSLLSWNRL-KPPSTKC-----NFPKLRHKWKQYQGINHWEGLLDPLDDDLRWEILRYGH  91

Query  1299  FVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLV  1120
             FV+A Y SFDFD +S TYATC Y + +++ +CGLG  GY++T+ L+ TC +++P W N  
Sbjct  92    FVDATYSSFDFDPSSLTYATCLYSKKSLLNKCGLGNYGYRLTKYLHVTCGIHMPTWINKF  151

Query  1119  SP----KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA  952
                   +S+WIGYVA+CD++ EI RLGRRD+VIA+RGT T  EWLENLRATLT LPD + 
Sbjct  152   FKQACIRSNWIGYVAICDNKKEITRLGRRDIVIAFRGTVTCLEWLENLRATLTHLPDHVV  211

Query  951   PRN--CEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAA  778
               N    PMVQ+GFLSLYTS S    SL++ +R+EI ++I+ Y +EPLS+T+TGHSLGAA
Sbjct  212   GENDGVGPMVQKGFLSLYTSKSTTRASLQEMVREEIGRVIQRYTNEPLSLTLTGHSLGAA  271

Query  777   LATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG  598
             LA ++AYDITT F++AP+VTV+SFGGPRVGN++FR QLE +G K+LRIVNSDD +TKVPG
Sbjct  272   LAILSAYDITTTFKNAPMVTVISFGGPRVGNESFRKQLEQNGIKILRIVNSDDVVTKVPG  331

Query  597   FVVDSDDVSDCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskdssyskd--VATCH  427
              VV+ DDV+            WL K + D Q VYA++G+ELR+SSK+        VA CH
Sbjct  332   LVVNLDDVASNEDVHMGIWSRWLHKYIEDMQLVYADIGQELRLSSKEFPNLNKGDVAMCH  391

Query  426   DLKTYLHCIDNWSSCKCPLR  367
             DLKTYLH + N+ S  CP +
Sbjct  392   DLKTYLHLVKNFVSSSCPCK  411



>ref|XP_008344420.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Malus 
domestica]
Length=365

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/365 (57%), Positives = 263/365 (72%), Gaps = 14/365 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +WE LLDPLD  LR EI+RYG FV+AAY++FDFD  S +YATC+Y + ++   
Sbjct  1     MEYQGFNNWEXLLDPLDANLRGEIIRYGQFVDAAYKAFDFDPDSNSYATCKYSKASLFEN  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL G+GY++T+NL  T  + +P W     + V+ +SSWIGY+AVC D++EI RLGRRDV
Sbjct  61    SGLPGTGYRITKNLRATSGIKLPSWIEKAPSWVATQSSWIGYMAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLP---DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKD  868
             VIA+RGTAT  EWLENLR   T LP   ++    NCEPMV+ GFLSLYTS +D  PSL+ 
Sbjct  121   VIAFRGTATCLEWLENLRXXXTQLPSVLNNSGLDNCEPMVESGFLSLYTSGTDLIPSLQQ  180

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVG  688
              +R EI +++++YGDEPLSIT TGHSLGAALAT+ A DI T F  +PLVTV+SF GPRVG
Sbjct  181   MVRQEIARLLQSYGDEPLSITFTGHSLGAALATLAACDIKTTFNPSPLVTVMSFAGPRVG  240

Query  687   NKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGTTQPSGMLSWLQKC  520
             N +FR  L+  G KVLRIVNSDD ITK+PGFV+D ++      D G  +     +W+QK 
Sbjct  241   NSSFRRNLDKKGAKVLRIVNSDDVITKIPGFVIDDNERRHKACDGGFRKAVEFQNWIQKK  300

Query  519   V-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRV  349
             V D+Q  YAEVGKELR+SSKDS      +V TCH+L TYLH +DN+ S KCP +ATAKR+
Sbjct  301   VEDTQLSYAEVGKELRLSSKDSPYLMGTNVCTCHELSTYLHLVDNFQSSKCPFKATAKRL  360

Query  348   IEKNH  334
               K H
Sbjct  361   FSKKH  365



>ref|XP_010934644.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Elaeis 
guineensis]
Length=354

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/360 (57%), Positives = 253/360 (70%), Gaps = 23/360 (6%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +W GLLDPLDD LR EI+RYG+FV+AAY SFDFD  SP+YATCR+ +D+++ R
Sbjct  1     MEYQGANNWHGLLDPLDDALRSEIVRYGEFVQAAYTSFDFDPTSPSYATCRFPKDSLLHR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  SGY+VTRNL+ T A  +PRW       +S +SSWIGYVAVC DEDEI RLGRRDV
Sbjct  61    SGLPSSGYRVTRNLHATSATRLPRWARSAPASLSRRSSWIGYVAVCQDEDEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE--PMVQRGFLSLYTSASDAHPSLKDS  865
             VIA+RGTAT  EWLENLRA+LT LP    P   +  PMVQRGF SL+TS      SL+D 
Sbjct  121   VIAFRGTATCLEWLENLRASLTHLPSPFPPSASQPDPMVQRGFWSLFTSPGSVRWSLRDE  180

Query  864   IRDEITKIIETYGDE--PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             +RDEI ++++ YG +  PLS+T+TGHSLGAALA +TAYDITT F+ AP+VTVVSFGGPRV
Sbjct  181   VRDEIARLLDAYGGKGHPLSLTVTGHSLGAALAVLTAYDITTTFQDAPMVTVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC-----GTTQPSGMLSWLQ  526
             GN +FR +LE  G+KVLRIVN+ D ITKVPGFV+D            GTT    ++SWL 
Sbjct  241   GNASFRRRLEEQGSKVLRIVNAQDIITKVPGFVIDDGGNGKKKDGKEGTT----LISWL-  295

Query  525   KCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
                 + WVYA++G+ELR        + +V  CHDL  YL+ + N  S   P R+ A + +
Sbjct  296   -LSKTGWVYADIGRELR---LPGQRTANVVACHDLSVYLNLV-NQLSANYPFRSLATQAV  350



>gb|KHN11563.1| Phospholipase A(1) DAD1, chloroplastic [Glycine soja]
Length=370

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/375 (54%), Positives = 263/375 (70%), Gaps = 23/375 (6%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             +++KL  +W EY G+ +WEGLLDPLDD LR EILRYG FVE AY+SF+FD +SP +A  R
Sbjct  2     QSSKLGKRWKEYHGMSNWEGLLDPLDDNLRAEILRYGHFVETAYKSFEFDPSSPNFANSR  61

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDE  1066
             + + A++ RCGL  + YKVT+ L  T  + +P W +     V+ ++S++GYVAVC D++E
Sbjct  62    FPKKALLERCGLPKTRYKVTKYLRATSGIQLPSWVDKVPRWVAKQTSYVGYVAVCHDKEE  121

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC----------EPMVQRGF  916
             I+RLGRRDVV+AYRGT T  EWLEN RA+LT LP   + +              MV+ GF
Sbjct  122   IKRLGRRDVVVAYRGTTTCLEWLENFRASLTNLPIPCSSKRAFEKNGVMDGSGAMVESGF  181

Query  915   LSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR  736
             LSLYTS+  A  SL++ +R EI++I++TY  E LS+T+TGHSLGAALAT+TAYD    F 
Sbjct  182   LSLYTSSLPAKVSLQEMVRREISRILDTYRGEQLSLTVTGHSLGAALATLTAYD----FP  237

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
               P VTV+SFGGPRVG++ FR QLE  GTKVLRIVNSDD ITK+PGFV D DDV+  G  
Sbjct  238   ELP-VTVISFGGPRVGDRRFRRQLERQGTKVLRIVNSDDVITKLPGFVFD-DDVASAGGV  295

Query  555   QPSGMLSWLQKCV-DSQWVYAEVGKELR--vsskdssyskdVATCHDLKTYLHCIDNWSS  385
               +G  SW+QK V ++Q VYAEVGKELR          + +VATCH+L TYLH +D + S
Sbjct  296   HVAGFPSWIQKRVEEAQLVYAEVGKELRLCSRDSPYLGNTNVATCHELNTYLHLVDGFVS  355

Query  384   CKCPLRATAKRVIEK  340
               CP RA+AKR +++
Sbjct  356   STCPFRASAKRFLQR  370



>ref|XP_007139644.1| hypothetical protein PHAVU_008G047100g [Phaseolus vulgaris]
 gb|ESW11638.1| hypothetical protein PHAVU_008G047100g [Phaseolus vulgaris]
Length=436

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/376 (55%), Positives = 265/376 (70%), Gaps = 20/376 (5%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             +++KL  +W EY G+ +W+GLLDPLDD LR EILRYG FVE AY+SF+FD +SP YA  R
Sbjct  63    QSSKLAERWKEYHGMSNWDGLLDPLDDNLRAEILRYGHFVETAYKSFEFDPSSPNYANSR  122

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDE  1066
             + +  +  RCGL  SGYKVT+ L  T  + +P W +     V  +SS++GYVAVC D + 
Sbjct  123   FHKKTLFERCGLPNSGYKVTKYLRATSGIQLPSWVDKAPTWVGKQSSYVGYVAVCHDREV  182

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCL----PDDMAPRNCE------PMVQRGF  916
             I+RLGRRD+V+AYRGT T  EWLEN RA LT L        A  N E       MV+ GF
Sbjct  183   IKRLGRRDIVVAYRGTTTCLEWLENFRAALTNLHISCKTKRAFENSEVMEGSGAMVESGF  242

Query  915   LSLYTSASDAH-PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF  739
             LSLYTS+  A+  SL++ ++ EI++I+  YG E LS+T+TGHSLGAAL+T+TAYD+ T F
Sbjct  243   LSLYTSSCSANTSSLQEMVKREISRIVRIYGGEQLSLTVTGHSLGAALSTLTAYDMKTVF  302

Query  738   RHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGT  559
                P VTV+SFGGPRVG++ FR QLE  GTKVLRIVNSDD ITKVPGFV D D+V+  G 
Sbjct  303   PRLP-VTVISFGGPRVGDRRFRRQLERQGTKVLRIVNSDDVITKVPGFVFD-DEVASGGR  360

Query  558   TQPSGMLSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWS  388
                +G   W+QK V ++QWVYAEVGKELR+SS+DS    + +VATCH+L TYLH +D + 
Sbjct  361   VGVAGFPRWVQKRVEEAQWVYAEVGKELRLSSRDSPYLGNTNVATCHELNTYLHLVDGFV  420

Query  387   SCKCPLRATAKRVIEK  340
             S  CP RA+AKR + +
Sbjct  421   SSTCPFRASAKRFLRR  436



>ref|XP_008805240.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Phoenix 
dactylifera]
Length=345

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 199/352 (57%), Positives = 250/352 (71%), Gaps = 17/352 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +W GLLDPLDD LR EI+RYG+FV+AAY SFDFD  SP+YA CR+ +D+   R
Sbjct  1     MEYQGANNWHGLLDPLDDALRSEIVRYGEFVQAAYTSFDFDPTSPSYAACRFPKDSFFRR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  +GY+VTRNL+ +    +P W +     +S +S WIGYVAVC D+DEI RLGRRDV
Sbjct  61    SGLPSTGYRVTRNLHASSTTRLPLWASSAPAWLSRRSGWIGYVAVCQDKDEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPR--NCEPMVQRGFLSLYTSASDAHPSLKDS  865
             VIA+RGTAT  EWLENLRA+LT LP    P     EPMV+RGF SL+TS      SL+D 
Sbjct  121   VIAFRGTATCLEWLENLRASLTHLPCPFPPSASQPEPMVERGFWSLFTSPGSVRQSLRDE  180

Query  864   IRDEITKIIETYGDE--PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             +RDEI ++++ YG +  PLS+T+TGHSLGAALA +TAYDIT  FRHAP+VTVVSFGGPRV
Sbjct  181   VRDEIARLLDAYGGKGHPLSLTVTGHSLGAALAVLTAYDITATFRHAPMVTVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM-LSWLQKCVD  514
             GN +FR +LE  G+KVLRIVN+ D ITKVPGFV+D  +  +    +  GM LSWL     
Sbjct  241   GNASFRRRLEEQGSKVLRIVNAQDIITKVPGFVIDDGNGKNQDAKE--GMTLSWLLS--K  296

Query  513   SQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
             + WVYA++G+ELR        + +V  CHDL  YL+ ++  S+ KCP R+ A
Sbjct  297   TGWVYADIGRELR---LTGRRTANVVACHDLSVYLNLVNQLST-KCPFRSLA  344



>ref|XP_007139645.1| hypothetical protein PHAVU_008G047200g [Phaseolus vulgaris]
 gb|ESW11639.1| hypothetical protein PHAVU_008G047200g [Phaseolus vulgaris]
Length=428

 Score =   388 bits (997),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 258/380 (68%), Gaps = 26/380 (7%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             K+  KW EYQG+ +W GLLDPLD+ LR EILRYG FVEAAY+SF+FD +SP YATC++ +
Sbjct  48    KVGKKWKEYQGVNNWNGLLDPLDENLRAEILRYGQFVEAAYKSFEFDPSSPNYATCKFPK  107

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEIRR  1057
                + RCGL  +GYKVT++L  T  + +P W +     V+ +SS+IGYVAVC +++EI+R
Sbjct  108   STHLERCGLHNTGYKVTKHLRATSGIKLPSWVDKAPSWVATQSSYIGYVAVCQNKEEIKR  167

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLT-CLPDD-MAPRNCEP--------MVQRGFLSL  907
             LGRRD+VIA+RGT T  EWLENLRATLT  +P +    R  EP        MV+ GFLSL
Sbjct  168   LGRRDIVIAFRGTTTCLEWLENLRATLTNVIPSNSTGIREAEPCSIEENGAMVESGFLSL  227

Query  906   YTSASDAHPS---LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR  736
             YTS    +PS   L+D +R EI ++++TY  E LS+TITGHSLGAALAT+TAYDI   F 
Sbjct  228   YTSKVSNNPSFMSLQDMVRTEIARLLKTYEGENLSLTITGHSLGAALATLTAYDIKNSFP  287

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVD-----SDDVS  571
               P VT +SFGGPRVGN++FR +LE  G+KVLRIVNSDD ITK+PGFV D       DV 
Sbjct  288   RPPHVTAISFGGPRVGNRSFRRRLEEQGSKVLRIVNSDDVITKIPGFVFDDVEKKDGDVG  347

Query  570   DCGTTQPSGMLSWLQKCVDS-QW-VYAEVGKELR--vsskdssyskdVATCHDLKTYLHC  403
               G    +    W++K V+  QW +Y+E+G+ELR            ++ATCHDL  YLH 
Sbjct  348   GMGGAHVASFQKWMRKRVEEVQWLLYSEIGEELRLCSRDSPYLRGINIATCHDLNIYLHL  407

Query  402   IDNWSSCKCPLRATAKRVIE  343
             +D + S  CP RATAKR + 
Sbjct  408   VDGFVSSTCPFRATAKRFLH  427



>ref|XP_006338919.1| PREDICTED: uncharacterized protein LOC102583663 [Solanum tuberosum]
Length=782

 Score =   399 bits (1026),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 208/360 (58%), Positives = 261/360 (73%), Gaps = 14/360 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQGI++WEGLLDPLDD LR EI+RYG FVEAAYR+ +FD +SP+YA C+Y    +   
Sbjct  1     MEYQGIKNWEGLLDPLDDNLRGEIIRYGHFVEAAYRACNFDPSSPSYAMCKYSRKKLFHL  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G  G+GY+V++ L  T  + +P W +     +S +SSWIGYVA+C D+ EI RLGRRDV
Sbjct  61    SGFSGTGYRVSKYLKATSGIKLPNWVDKAPKWMSKQSSWIGYVAICHDQREIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD--DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             VIA RGTAT  EWLENL ATLT LP+        C PMV+ GFLSLYTS  DA  SL+D 
Sbjct  121   VIALRGTATCLEWLENLGATLTPLPNIKHTCSTICCPMVESGFLSLYTSKIDAQQSLQDM  180

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +R+EI +I + Y  E LS TI GHSLGAALAT+TAYDI   FR  PLVTV+SFGGPRVGN
Sbjct  181   VREEIARIKKIYDGETLSFTIAGHSLGAALATLTAYDIKQFFRDIPLVTVMSFGGPRVGN  240

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-DSQ  508
              +FR  L+  GTK+LRIVNSDD ITK+PGFV+D++D       + SG   W+QK V DSQ
Sbjct  241   HSFRYHLDKQGTKILRIVNSDDLITKIPGFVIDNNDNK---FAEKSG--HWIQKLVEDSQ  295

Query  507   WVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEKNH  334
             WVYA+VG ELR+SS DS      ++ATCH+L TYLH ++++ S  CP+RATAK+++ K++
Sbjct  296   WVYADVGCELRLSSSDSPYFNGINIATCHELNTYLHLVNSFVSSNCPVRATAKKIMHKSN  355



>emb|CAN79244.1| hypothetical protein VITISV_022384 [Vitis vinifera]
Length=373

 Score =   385 bits (990),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 247/314 (79%), Gaps = 11/314 (4%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             +AKL  KWMEYQG+ +W+GLLDPLDD LR EILRYG FVEAAYRSFDFD  SPTYATC++
Sbjct  53    SAKLGKKWMEYQGLNNWDGLLDPLDDTLRNEILRYGKFVEAAYRSFDFDPDSPTYATCKF  112

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEI  1063
               ++++ R  +G +GYK+T+NL+ TC V +PRW +     +S +S WIGYVAVC D++EI
Sbjct  113   SRNSLLKRSEIGYTGYKLTKNLHATCGVRLPRWVDRTPAWMSTQSCWIGYVAVCQDKEEI  172

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              RLGRRDVVIA+RGTAT  EW+ENLRATLT L    +  N  PMV+ GF SLYTS     
Sbjct  173   ARLGRRDVVIAFRGTATGMEWVENLRATLTSLVG--STNNGGPMVESGFWSLYTSKLSTC  230

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL++ +RDEI ++I +YGDEPLSITITGHSLGAALAT+ AYDI T F HAP+VTVVSFG
Sbjct  231   PSLQEMVRDEIGRVIRSYGDEPLSITITGHSLGAALATLAAYDIATTFDHAPMVTVVSFG  290

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGN +FR Q+E SGTK+LRIVNSDD ITKVPGFV+D++DV+     Q +G+ SWL+K
Sbjct  291   GPRVGNTSFRCQMEKSGTKILRIVNSDDVITKVPGFVIDNNDVA----VQAAGLPSWLRK  346

Query  522   CVDS-QWVYAEVGK  484
              V++ Q  YA+VG+
Sbjct  347   PVEAMQLGYADVGQ  360



>ref|XP_003551710.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Glycine max]
Length=430

 Score =   386 bits (992),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 266/383 (69%), Gaps = 27/383 (7%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             + K+  +W EYQG+ +W+GLLDPLD+ LR EILRYG FVEAAY+SF+FD +SP YATC++
Sbjct  47    SKKVGKRWKEYQGMNNWDGLLDPLDENLRAEILRYGHFVEAAYKSFEFDPSSPNYATCKF  106

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEI  1063
              ++ +  + GL  +GYKVT++L  T  + +P W +     V+ +SS++GYVAVC+D++EI
Sbjct  107   PKNTLFEKSGLHNTGYKVTKHLRATSGIKLPSWVDKAPSWVAAQSSYVGYVAVCNDKEEI  166

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLT--CLPDDMAPRNCEP--------MVQRGFL  913
             +RLGRRD+V+AYRGT T  EWLENLRATLT   +P        EP        MV+ GFL
Sbjct  167   KRLGRRDIVVAYRGTTTCLEWLENLRATLTHVSVPSITTETTTEPCSMEENGAMVESGFL  226

Query  912   SLYTSA---SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQ  742
             SLYTS    + +  SL+D +R EI +I +TY  E LS+TITGHSLGAALAT+TAYDI   
Sbjct  227   SLYTSTVSNNKSFMSLQDMVRKEIGRIRKTYQGENLSLTITGHSLGAALATLTAYDIKNS  286

Query  741   F-RHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVD----SDD  577
             F +  PLVTV+SFGGPRVGN++FR +LE  GTKVLRIVNSDD ITKVPGFV D    ++D
Sbjct  287   FLQPPPLVTVISFGGPRVGNRSFRRRLEEQGTKVLRIVNSDDVITKVPGFVFDDVDKTED  346

Query  576   VSDC-GTTQPSGMLSWLQKCVDS-QW-VYAEVGKELR--vsskdssyskdVATCHDLKTY  412
             V+ C G  Q +    W++K  +  QW +Y+EVGKELR            ++AT HDL TY
Sbjct  347   VAACNGGVQVAKFQRWIRKRAEEVQWLLYSEVGKELRLCSRDSPYLRGVNIATSHDLNTY  406

Query  411   LHCIDNWSSCKCPLRATAKRVIE  343
             LH +D + S  CP RATAKR ++
Sbjct  407   LHLVDGFVSSTCPFRATAKRFLQ  429



>ref|XP_010058502.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Eucalyptus 
grandis]
Length=419

 Score =   386 bits (991),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 264/386 (68%), Gaps = 20/386 (5%)
 Frame = -3

Query  1455  LGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRS  1276
             L +  + +  +AA  A     KW EYQGI +WEGLLDPLDD LR+EILRYG+FVEA YRS
Sbjct  39    LKHHETGRTTIAAKCAVVCKKKWTEYQGIDNWEGLLDPLDDNLRREILRYGEFVEATYRS  98

Query  1275  FDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLV----SPKS  1108
             FDF+ +SPTY T ++ + +++ R G+ G+GY+VTR L+ TC V +P W + V      +S
Sbjct  99    FDFNPSSPTYGTSKHPKSSLLARAGIRGTGYRVTRYLHATCGVQMPHWASNVPSWMGTRS  158

Query  1107  SWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMV  928
             SWIG+VAVC D  EI RLGRRDVVIA RGT T  EW+ENLRA LTC+  D       PMV
Sbjct  159   SWIGFVAVCKDGREISRLGRRDVVIALRGTGTCLEWIENLRANLTCVGGDGDGGAEGPMV  218

Query  927   QRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT  748
               G+LSLYTS +  + SL+D IR+E+ +II  Y D PLS+TITGHSLGAALA ++AYDI+
Sbjct  219   GSGYLSLYTSKTATNMSLQDIIREEVARIINKYSDRPLSLTITGHSLGAALAILSAYDIS  278

Query  747   TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD  568
             + F +AP+VTV+SFGGPRVGN+ FR  LE S   VLRIVNSDD +TKVPG     DDV+ 
Sbjct  279   SNFSNAPMVTVISFGGPRVGNRAFRHLLEKSKANVLRIVNSDDLVTKVPGL---KDDVAR  335

Query  567   CGTTQPSGMLSWL--QKCVDSQWVYAEVGKELRvsskd--ssyskdVATCHDLKTYLHCI  400
                      L WL  +    +   Y +VG+ELR+SS++     S ++ATCH+LKTYL  I
Sbjct  336   ---------LPWLFRESREHAPSAYTDVGRELRLSSRECPYLSSVNLATCHELKTYLQLI  386

Query  399   DNWSSCKCPLRATAKRVIEKNHGKRR  322
               + S KCP RATAK+V+  N+ + R
Sbjct  387   SGFVSSKCPFRATAKKVLNVNNSRSR  412



>ref|XP_004492931.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Cicer 
arietinum]
Length=448

 Score =   386 bits (992),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 204/382 (53%), Positives = 266/382 (70%), Gaps = 25/382 (7%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             + K+  +W EYQG+R+WEGLLDPLD+ LR EILRYG FVEAAY+SF+F+ +SP Y+  ++
Sbjct  67    STKVSKRWKEYQGMRNWEGLLDPLDNNLRSEILRYGHFVEAAYKSFEFEPSSPNYSKNKF  126

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDEI  1063
              +  ++ +CGL  +GYK+T++L+ T  + +P W +     V+ K+S+IGYVAVCD+++EI
Sbjct  127   PKTTLLKKCGLPKTGYKLTKHLHATSGIQLPSWFDKAPTWVATKTSYIGYVAVCDNKEEI  186

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLT-------CLPDDMAPRNCEPMVQRGFLSLY  904
             +RLGRRDVVIA+RGT T  EWL+NLRATLT       C  ++    N EPMV+ GFLSLY
Sbjct  187   KRLGRRDVVIAFRGTTTCLEWLDNLRATLTNIDINIPCNNNNNKNNNNEPMVESGFLSLY  246

Query  903   TSASD------AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQ  742
             TS  D      A PSL++ +R EI +I++TY  E LS TITGHSLGAALA +TAYDI T 
Sbjct  247   TSKQDSSSSINAIPSLQEMVRKEIGRILKTYEGENLSFTITGHSLGAALAILTAYDIKTS  306

Query  741   FRH-APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
             F +  PLVTV+SFGGPRVGN+ FR ++E  G KVLRIVNSDD ITK+PGFV D DDV   
Sbjct  307   FNNRKPLVTVMSFGGPRVGNRRFRLEVEKEGIKVLRIVNSDDVITKMPGFVFDEDDVEGN  366

Query  564   GTTQPSG----MLSWLQKCV-DSQWVYAEVGKELR--vsskdssyskdVATCHDLKTYLH  406
             G          +  W+QK V ++Q VY+EVG+ELR            +VATCHDLKTYLH
Sbjct  367   GDEVEGDVAWVLPRWIQKRVEETQLVYSEVGEELRLCSKDSPYLRGFNVATCHDLKTYLH  426

Query  405   CIDNWSSCKCPLRATAKRVIEK  340
              +D + S  CP R+TA R + +
Sbjct  427   LVDGFVSSSCPFRSTANRFLHR  448



>ref|XP_009373233.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Pyrus x bretschneideri]
Length=366

 Score =   383 bits (984),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 208/366 (57%), Positives = 265/366 (72%), Gaps = 15/366 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             M+YQG  +WE LLDPLDD LR EI+RYG FV+AAY++F+FD  S  YATC+Y + ++  +
Sbjct  1     MDYQGFNNWENLLDPLDDNLRGEIIRYGQFVDAAYKAFEFDPDSNFYATCKYSKASLFEK  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL G+GY++T+NL  T  + +P W     + V+ +SSWIGYVAVC D++EI RLGRRDV
Sbjct  61    SGLPGTGYRITKNLRATSGIQLPSWIEKAPSWVATQSSWIGYVAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEW-LENLRATLTCLP---DDMAPRNCEPMVQRGFLSLYTSASDAHPSLK  871
             VIA+RGTAT  EW L++L ATLT LP   ++    NCEPMV+ GFLSLYTS +D  PSL+
Sbjct  121   VIAFRGTATCLEWGLKSLGATLTQLPSSPNNSGLDNCEPMVESGFLSLYTSGTDLIPSLQ  180

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
               +R EI +++++YG+EPLSIT+TGHSLGAALAT+ AYDI T F  +PLVTV SF GPRV
Sbjct  181   QMLRQEIARLLQSYGNEPLSITLTGHSLGAALATLAAYDIKTTFNRSPLVTVFSFAGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC----GTTQPSGMLSWL-Q  526
             GN +FR  L+  G KVLRIVNSDD ITKVPGFVVD ++        G  +     +W+ Q
Sbjct  241   GNSSFRRNLDKKGPKVLRIVNSDDVITKVPGFVVDDNERRHLACYRGFRKAVEFQNWIHQ  300

Query  525   KCVDSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
             K  D+Q  YAEVGKELR+SSKDS      +V+TCH+L TYLH +DN+ S KCP +A AKR
Sbjct  301   KVEDTQLSYAEVGKELRLSSKDSPYLMGTNVSTCHELSTYLHLVDNFQSSKCPFKAMAKR  360

Query  351   VIEKNH  334
             +  K H
Sbjct  361   LFSKKH  366



>ref|XP_008801803.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Phoenix 
dactylifera]
Length=352

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 256/358 (72%), Gaps = 21/358 (6%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +W+GLLDPLDD LR EI+RYG+FV+AAY  FDFD +SP+YATCR+   + + R
Sbjct  1     MEYQGANNWDGLLDPLDDTLRSEIVRYGEFVQAAYTCFDFDPSSPSYATCRFPRHSFLRR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRW----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  +GY+VTRNL+ T  + +PRW    +  +S +SSWIGYVAVC DEDEI RLGRRD+
Sbjct  61    SGLPCTGYRVTRNLHATSGIRLPRWARAASTWLSRRSSWIGYVAVCQDEDEIARLGRRDI  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPR--NCEPMVQRGFLSLYTSASDAHPSLKDS  865
             V+A+RGTAT  EWLENLRATLT LP    P     EPMVQRGF SL+TS       L+D 
Sbjct  121   VVAFRGTATCLEWLENLRATLTHLPCPFPPSASQPEPMVQRGFWSLFTSPGSIRRCLRDE  180

Query  864   IRDEITKIIETYGD--EPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             +RDEI ++++ YG   +PLS+T+TGHSLGAALA +TAYDITT F+ AP+VTVVSFGGPRV
Sbjct  181   VRDEIARLLDAYGGKGQPLSLTVTGHSLGAALAVLTAYDITTTFQDAPMVTVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ---PSGMLSWLQKC  520
             GN +F  +LE  G KVLRIVN+ D ITKVPGFV+D ++V +  +++   PS +LS     
Sbjct  241   GNASFCRRLEERGGKVLRIVNTQDIITKVPGFVIDDNNVKEEDSSEGVIPSWLLS-----  295

Query  519   VDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
               + WVYA++G+ELR    D   + +V  CHDL  YL+ + N  S KCP R+ A + +
Sbjct  296   -KTGWVYADIGRELR---VDGRRTANVVACHDLSVYLNLV-NQLSAKCPFRSLATQAM  348



>ref|XP_008437770.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Cucumis melo]
Length=417

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/361 (57%), Positives = 268/361 (74%), Gaps = 11/361 (3%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
              K+  +W EY G+ +WEGLLDPLDD LR EILRYG FV+AAY+SFDFD +SPTYATC + 
Sbjct  60    VKVGKRWKEYAGLGNWEGLLDPLDDNLRNEILRYGQFVDAAYKSFDFDPSSPTYATCLHS  119

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW---TNLVSPKSSWIGYVAVCDDEDEIRR  1057
             + +++   GL  +GY+V+++L  T  + +PRW   T   S  SSWIGYVAV  D+ EI R
Sbjct  120   KASLLESSGLPSTGYRVSKHLRATSGICLPRWLPNTPSFSTNSSWIGYVAVSQDKHEISR  179

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPS  877
             LGRRDVVIA RGTAT  EWLENLRATLT LP +        MV+ GFLSLY+S +++ PS
Sbjct  180   LGRRDVVIALRGTATCLEWLENLRATLTMLPGEEG----GAMVESGFLSLYSSGTESCPS  235

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR-HAPLVTVVSFGG  700
             LK+ +R+EI +I+++YG+EPLS+TITGHSLGAALAT+ AYDI   F+  AP+VTV+SFGG
Sbjct  236   LKEMVREEIGRILQSYGEEPLSLTITGHSLGAALATLAAYDIKEYFKTSAPMVTVMSFGG  295

Query  699   PRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKC  520
             PRVGN+ FR +LE  GTKVLRIVNS+D ITK+PGFVV++++ ++    +  G L W+QKC
Sbjct  296   PRVGNRKFRQRLEEQGTKVLRIVNSEDVITKLPGFVVNNNNNNNNNVEEGGGRLRWIQKC  355

Query  519   V-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRV  349
             V +++W Y+EVG+ELR+SS         +VATCH L TYLH +D + S  CP RATA+R+
Sbjct  356   VEETEWAYSEVGRELRLSSRDSPHLNRINVATCHHLNTYLHLVDGFVSSTCPFRATARRM  415

Query  348   I  346
              
Sbjct  416   F  416



>ref|XP_003533565.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Glycine 
max]
Length=423

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 262/374 (70%), Gaps = 23/374 (6%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             K+  +W EYQG+ +W+GLLDPLD+ LR EILRYG FVEAAY+SF+FD +SP YATC++ +
Sbjct  52    KVGKRWKEYQGMNNWDGLLDPLDENLRAEILRYGHFVEAAYKSFEFDPSSPNYATCKFQK  111

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
             + +  +CGL  +GYKVT++L  T  + +P W   V+ +SS++GYVAVC+D++EI+RLGRR
Sbjct  112   NTLFEQCGLRNTGYKVTKHLRATSGIKLPSW---VATQSSYVGYVAVCNDKEEIKRLGRR  168

Query  1044  DVVIAYRGTATPPEWLENLRATLT--CLPDDMAPRNCEP--------MVQRGFLSLYTSA  895
             D+V+A+RGTAT  EWLENLRATLT   +P        EP        MV+ GFLSLYTSA
Sbjct  169   DIVVAFRGTATCLEWLENLRATLTHVSVPSVATGITAEPCSMDGNGAMVESGFLSLYTSA  228

Query  894   S---DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
                  +  SL+D +R EI +I++TY  E LS+TITGHSLGAALAT+TAYDI   F   P 
Sbjct  229   GSSKQSFTSLQDMVRKEIGRILKTYEGENLSLTITGHSLGAALATLTAYDIKNSFIRQPP  288

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV+SFGGPRVGN++FR QLE +G K+LRIVNSDD ITKVPGFV D  D +D       G
Sbjct  289   VTVISFGGPRVGNRSFRRQLEETGIKLLRIVNSDDVITKVPGFVFDDVDKTDDDVACNGG  348

Query  543   ---MLSWLQKCVDS-QW-VYAEVGKELR--vsskdssyskdVATCHDLKTYLHCIDNWSS  385
                +  W++K  +  QW +Y+EVGKELR            ++ATCHDL TYLH +D + S
Sbjct  349   AHVVQRWIRKRAEEVQWLLYSEVGKELRLCSRDSPYLRGVNIATCHDLNTYLHLVDGFVS  408

Query  384   CKCPLRATAKRVIE  343
               CP RATAKR ++
Sbjct  409   STCPFRATAKRFLQ  422



>ref|XP_008375812.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A(1) DAD1, chloroplastic 
[Malus domestica]
Length=361

 Score =   381 bits (978),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 206/363 (57%), Positives = 261/363 (72%), Gaps = 14/363 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             M+YQG  +WE LLDPLDD LR EI+RYG FV+AAY++F+FD  S  YATC+Y + ++  +
Sbjct  1     MDYQGFNNWENLLDPLDDNLRGEIIRYGQFVDAAYKAFEFDPDSNFYATCKYSKASLFEK  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
               L G+GY++T+NL  T  + +P W     + V+ +SSWIGY AVC D++EI RLGRRDV
Sbjct  61    SALPGTGYRITKNLRATSGIQLPSWIEKAPSWVATQSSWIGYXAVCQDKEEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPR-NCEPMVQRGFLSLYTSASDAHPSLKDSI  862
             VIA+RGTAT     E LRATLT LP   +P+ NCEPMV+ GFLSLYTS +D  PSL+  +
Sbjct  121   VIAFRGTATCLXXXEXLRATLTQLPS--SPKDNCEPMVESGFLSLYTSGTDLIPSLQQIL  178

Query  861   RDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNK  682
             R EI +++++YG+EPLSIT TGHSLGAALAT+ AYDI T F  +PLVTV SF GPRVGN 
Sbjct  179   RQEIARLLQSYGNEPLSITFTGHSLGAALATLAAYDIKTTFNRSPLVTVFSFAGPRVGNS  238

Query  681   NFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGTTQPSGMLSWL-QKCV  517
             +FR  L+  G KVLRIVNSDD ITKVPGFVV+ ++      D G  +     +W+ QK  
Sbjct  239   SFRRNLDKKGPKVLRIVNSDDVITKVPGFVVNDNERRHLACDSGFRKAVEFQNWIHQKVE  298

Query  516   DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIE  343
             D+Q  YAEVGKELR+SSKDS      +V+TCH+L TYLH +DN+ S KCP +ATAKR+  
Sbjct  299   DTQLSYAEVGKELRLSSKDSPYLMGTNVSTCHELSTYLHLVDNFQSSKCPFKATAKRIFS  358

Query  342   KNH  334
             K  
Sbjct  359   KKQ  361



>ref|XP_011094371.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Sesamum 
indicum]
Length=370

 Score =   381 bits (978),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 267/369 (72%), Gaps = 20/369 (5%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             M+YQG+++WEGLLDPLDD LR EI+RYG FVEAAYRS +FD +SP+Y  CRY +  ++  
Sbjct  1     MDYQGLKNWEGLLDPLDDNLRCEIIRYGRFVEAAYRSCNFDPSSPSYGMCRYSKRKLLEE  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWTN----LVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G   +GY+VT+NL  T  + +P W       ++ +SSWIGYVAVC D  EI RLGRRDV
Sbjct  61    SGFPETGYRVTKNLMATSGIQLPGWAERGPTWMAMQSSWIGYVAVCQDRKEISRLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDD------MAPRNCEPMVQRGFLSLYTSASDAHPS  877
             VIA+RGTAT  EWLENLRATLT LP+        +  +CEPMV+ GFLSLYTS     PS
Sbjct  121   VIAFRGTATGLEWLENLRATLTPLPNGDCNWNCYSDSDCEPMVESGFLSLYTSNDGNRPS  180

Query  876   LKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGP  697
             L+  +R+EI +I+E +GDE LS TITGHSLGAALAT+ AYDI   F+++PLVTV+SF GP
Sbjct  181   LQTLVREEIARILEKHGDEALSFTITGHSLGAALATLAAYDIKQTFKNSPLVTVISFAGP  240

Query  696   RVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD----VSDCGT---TQPSGML  538
             RVGN +FR QLE  GTKVLRIVNSDD ITK+PGFV+D+++    +   G+      + + 
Sbjct  241   RVGNWSFRCQLEEQGTKVLRIVNSDDLITKIPGFVIDNNENHQFLKHSGSYTEAASANLA  300

Query  537   SWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
              W+QK V D+QWVYA+VG ELR+SS+DS    S ++A CH+LKTYLH ++ +    CP R
Sbjct  301   GWVQKLVEDTQWVYADVGCELRLSSRDSPDLNSINIAACHELKTYLHLVNEFVGSNCPFR  360

Query  366   ATAKRVIEK  340
             ATA++++ K
Sbjct  361   ATARKMMNK  369



>gb|KDO85501.1| hypothetical protein CISIN_1g037922mg [Citrus sinensis]
Length=358

 Score =   380 bits (976),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 268/370 (72%), Gaps = 32/370 (9%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG+++WEGLLDPLDD LR EILRYGDFVEAAY+SFDFD +SP+YATCR+ ++ ++ R
Sbjct  1     MEYQGMQNWEGLLDPLDDNLRGEILRYGDFVEAAYKSFDFDPSSPSYATCRFPKNTLLDR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRW-----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
              G                  N+PRW      + V+ +SSWIGYVAVC D++ I RLGRRD
Sbjct  61    SG-----------------TNLPRWWIEKAPSWVATQSSWIGYVAVCQDQEVISRLGRRD  103

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC-EPMVQRGFLSLYTSASDAHPSLKDS  865
             VVIA RGTAT  EWLENLRATLT LP      +   PMV+ GFLSLYTS + + PSL++ 
Sbjct  104   VVIALRGTATCLEWLENLRATLTRLPGPGTDGSVFGPMVESGFLSLYTSKTASCPSLQEM  163

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             +R+EI ++++TYGDEPLS+TITGHSLGAALAT+ AYDI T F  +P+ TV SFGGPRVGN
Sbjct  164   LREEIKRLLQTYGDEPLSLTITGHSLGAALATLAAYDIKTHFNGSPMATVFSFGGPRVGN  223

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS-DDVSDCGTTQPSGMLSWLQKCV-DS  511
             K FR QLE  GTKVLRIVNSDD ITKVPGFV+D  +DV+D        +  W+QKCV D+
Sbjct  224   KCFRQQLEVQGTKVLRIVNSDDLITKVPGFVMDQGNDVADAHLAAHR-LPGWIQKCVEDA  282

Query  510   QWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATA----KRV  349
             QW YAEVG+ELR+SSKDS    S +VA CHDLKTYLH ++ + S  CP +ATA    +RV
Sbjct  283   QWAYAEVGRELRLSSKDSPHLSSINVAICHDLKTYLHLVEGFVSSTCPFKATASARTRRV  342

Query  348   IEKNHGKRRR  319
             ++    +R R
Sbjct  343   LKNETTQRER  352



>gb|KCW73103.1| hypothetical protein EUGRSUZ_E01548, partial [Eucalyptus grandis]
Length=357

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 252/358 (70%), Gaps = 20/358 (6%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             KW EYQGI +WEGLLDPLDD LR+EILRYG+FVEA YRSFDF+ +SPTY T ++ + +++
Sbjct  12    KWTEYQGIDNWEGLLDPLDDNLRREILRYGEFVEATYRSFDFNPSSPTYGTSKHPKSSLL  71

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWTNLV----SPKSSWIGYVAVCDDEDEIRRLGRR  1045
              R G+ G+GY+VTR L+ TC V +P W + V      +SSWIG+VAVC D  EI RLGRR
Sbjct  72    ARAGIRGTGYRVTRYLHATCGVQMPHWASNVPSWMGTRSSWIGFVAVCKDGREISRLGRR  131

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDS  865
             DVVIA RGT T  EW+ENLRA LTC+  D       PMV  G+LSLYTS +  + SL+D 
Sbjct  132   DVVIALRGTGTCLEWIENLRANLTCVGGDGDGGAEGPMVGSGYLSLYTSKTATNMSLQDI  191

Query  864   IRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGN  685
             IR+E+ +II  Y D PLS+TITGHSLGAALA ++AYDI++ F +AP+VTV+SFGGPRVGN
Sbjct  192   IREEVARIINKYSDRPLSLTITGHSLGAALAILSAYDISSNFSNAPMVTVISFGGPRVGN  251

Query  684   KNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL--QKCVDS  511
             + FR  LE S   VLRIVNSDD +TKVPG     DDV+          L WL  +    +
Sbjct  252   RAFRHLLEKSKANVLRIVNSDDLVTKVPGL---KDDVAR---------LPWLFRESREHA  299

Query  510   QWVYAEVGKELRvsskd--ssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIE  343
                Y +VG+ELR+SS++     S ++ATCH+LKTYL  I  + S KCP RATAK+V+ 
Sbjct  300   PSAYTDVGRELRLSSRECPYLSSVNLATCHELKTYLQLISGFVSSKCPFRATAKKVLN  357



>ref|XP_003551711.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Glycine 
max]
Length=376

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 258/380 (68%), Gaps = 27/380 (7%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             +++KL  +W EY G+ +W+GLLDPLDD LR EILRYG FVE  Y+SF+FD +SP YA  R
Sbjct  2     QSSKLGKRWKEYHGMSNWDGLLDPLDDNLRAEILRYGHFVETVYKSFEFDPSSPNYANSR  61

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDE  1066
             +    ++ RCGL  +GYKVT+ L  T  + +P W +     V+ ++S++GYVAVC D++E
Sbjct  62    FPRKDLLERCGLHNTGYKVTKYLRATSGIQLPSWVDKAPTWVAKQTSYVGYVAVCHDKEE  121

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE-------------PMVQ  925
             I+RLGRRDVV+AYRGT T  EWLEN RA+LT LP    P N +              MV+
Sbjct  122   IKRLGRRDVVVAYRGTTTCLEWLENFRASLTNLP---IPCNTKRAFEKNGVMDRSGAMVE  178

Query  924   RGFLSLYTSA--SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI  751
              GFLSLYTS+       SL++ +R EI++I+ETY  E LS+T+TGHSLGAALAT+TAYD+
Sbjct  179   SGFLSLYTSSLPRKTFRSLQEMVRREISRILETYRGEQLSLTVTGHSLGAALATLTAYDV  238

Query  750   TTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS  571
              T F   P VTV+SFGGPRVG+  FR  LE  GTKVLRIVNSDD ITKVPGFV D    S
Sbjct  239   KTAFPGLP-VTVISFGGPRVGDPRFRRMLERQGTKVLRIVNSDDVITKVPGFVFDDGLAS  297

Query  570   DCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELR--vsskdssyskdVATCHDLKTYLHCI  400
             D G   P G   W+QK V ++Q VYAEVG+ELR          + +VATCH+L TYLH +
Sbjct  298   DGGVHVP-GFPRWIQKRVEEAQLVYAEVGRELRLCSKDSPYLGNTNVATCHELNTYLHLV  356

Query  399   DNWSSCKCPLRATAKRVIEK  340
             D + S  CP RA+AKR +++
Sbjct  357   DGFVSSTCPFRASAKRFLQR  376



>gb|KHN40550.1| Phospholipase A(1) DAD1, chloroplastic [Glycine soja]
Length=376

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 258/380 (68%), Gaps = 27/380 (7%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             +++KL  +W EY G+ +W+GLLDPLDD LR EILRYG FVE  Y+SF+FD +SP YA  R
Sbjct  2     QSSKLGKRWKEYHGMSNWDGLLDPLDDNLRAEILRYGHFVETVYKSFEFDPSSPNYANSR  61

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL----VSPKSSWIGYVAVCDDEDE  1066
             +    ++ RCGL  +GYKVT+ L  T  + +P W +     V+ ++S++GYVAVC D++E
Sbjct  62    FPRKDLLERCGLHNTGYKVTKYLRATSGIQLPSWVDKAPTWVAKQTSYVGYVAVCHDKEE  121

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE-------------PMVQ  925
             I+RLGRRDVV+AYRGT T  EWLEN RA+LT LP    P N +              MV+
Sbjct  122   IKRLGRRDVVVAYRGTTTCLEWLENFRASLTNLP---IPCNTKRAFEKNGVMDRSGAMVE  178

Query  924   RGFLSLYTSA--SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI  751
              GFLSLYTS+       SL++ +R EI++I+ETY  E LS+T+TGHSLGAALAT+TAYD+
Sbjct  179   SGFLSLYTSSLPRKTFRSLQEMVRREISRILETYRGEQLSLTVTGHSLGAALATLTAYDV  238

Query  750   TTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS  571
              T F   P VTV+SFGGPRVG+  FR  LE  GTKVLRIVNSDD ITKVPGFV D    S
Sbjct  239   KTAFPGLP-VTVISFGGPRVGDPRFRRMLERQGTKVLRIVNSDDVITKVPGFVFDDGLAS  297

Query  570   DCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELR--vsskdssyskdVATCHDLKTYLHCI  400
             D G   P G   W+QK V ++Q VYAEVG+ELR          + +VATCH+L TYLH +
Sbjct  298   DGGVHVP-GFPRWIQKRVEEAQLVYAEVGRELRLCSKDSPYLGNTNVATCHELTTYLHLV  356

Query  399   DNWSSCKCPLRATAKRVIEK  340
             D + S  CP RA+AKR +++
Sbjct  357   DGFVSSTCPFRASAKRFLQR  376



>ref|XP_010941431.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Elaeis 
guineensis]
Length=351

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 253/357 (71%), Gaps = 20/357 (6%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             MEYQG  +W+GLLDPLDD LR EI+RYG+FV+AAY  FDFD +SP+YATCR+ +++++ R
Sbjct  1     MEYQGANNWDGLLDPLDDTLRSEIVRYGEFVQAAYNCFDFDPSSPSYATCRFPKNSLLRR  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRW----TNLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              GL  +GY+VTRNLY T  + +PRW    +  +S +SSWIGYVAVC DEDEI RLGRRDV
Sbjct  61    SGLSCTGYRVTRNLYATSGIVLPRWARTASTWLSRRSSWIGYVAVCQDEDEIARLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNC--EPMVQRGFLSLYTSASDAHPSLKDS  865
             V+++RGTAT  EWLENLRATLT LP    P +   EPMV+RGF SL+TS       L+D 
Sbjct  121   VVSFRGTATGLEWLENLRATLTHLPCPFPPSSSQPEPMVERGFWSLFTSPGSVRRCLRDE  180

Query  864   IRDEITKIIETYG--DEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             +RDEI ++++ YG   +PLS+T+TGHSLGAALA +TAYDITT F   P+VTVVSFGGPRV
Sbjct  181   VRDEIARLLDAYGGQGQPLSLTVTGHSLGAALAVLTAYDITTTFPDPPMVTVVSFGGPRV  240

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ--PSGMLSWLQKCV  517
             GN +F  +LE  G KVLRIVN+ D ITKVPGFV+D  +V + G     PS +LS      
Sbjct  241   GNASFCRRLEERGGKVLRIVNTQDIITKVPGFVIDDRNVDEDGNEGVIPSWLLS------  294

Query  516   DSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              + WVYA++G+ELR        + +V  CHDL  YL+ + N  S KCP +  A + +
Sbjct  295   KTGWVYADIGRELR---VSGRRTANVVACHDLSVYLNLL-NQLSAKCPFQYLATQAM  347



>ref|XP_009621711.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   382 bits (981),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 208/408 (51%), Positives = 271/408 (66%), Gaps = 30/408 (7%)
 Frame = -3

Query  1452  GNAASSKCLVAADRAAKLCSK-----WMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEA  1288
             GN AS+   ++    +  C K     WM+YQGI++WEGLLDPL+D LR EI+RYG FVEA
Sbjct  64    GNLASTSSALSMPSFSGQCPKELGKNWMDYQGIKNWEGLLDPLNDNLRGEIIRYGHFVEA  123

Query  1287  AYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLV  1120
             AYR+ +FD +SP+YA C+Y +  ++   G  G+GY+V++ L  T  + +P W     N +
Sbjct  124   AYRACNFDPSSPSYAMCKYSKKKLLQFSGFSGTGYRVSKYLKATSGIQLPSWVDKAPNWM  183

Query  1119  SPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLP--------  964
             + +SSWIGYVA+C D+ EI RLGRRDVVIA RGTAT  EWLENLRATLT L         
Sbjct  184   AKQSSWIGYVAICHDQREITRLGRRDVVIALRGTATCLEWLENLRATLTPLSNNNNNNNN  243

Query  963   -------DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSIT  805
                      +   NC PMV+ GFLSLYTS      SL+D +++EI +II+ Y  E LS T
Sbjct  244   NNSNKCCSSIYSVNCCPMVESGFLSLYTSKMGTRHSLQDMVKEEIARIIKAYPGETLSFT  303

Query  804   ITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNS  625
             I GHSLGAALAT+ AYDI       PLVTV+SFGGPRVGN +FR  L+  GTK+LRIVNS
Sbjct  304   IAGHSLGAALATLMAYDIKQALEEIPLVTVISFGGPRVGNHSFRHHLDKQGTKILRIVNS  363

Query  624   DDPITKVPGFVVDSDDVSDCGTTQPSGMLS--WLQKCV-DSQWVYAEVGKELRvsskds-  457
             DD ITKVPGFV+D++  ++      +      W+QK V D+QWVYA+VG ELR+SS DS 
Sbjct  364   DDLITKVPGFVIDNNTNNNNNNDNFTNKKGGHWIQKLVEDTQWVYADVGCELRLSSSDSP  423

Query  456   -syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEK-NHGKRRR  319
                  ++A CH+LKTYL  ++ + S  CP+RATAK++++K N+ K  R
Sbjct  424   YLNGINIAACHELKTYLQLVNGFVSSNCPVRATAKKMMQKANYVKSNR  471



>ref|XP_004134279.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A(1) DAD1, chloroplastic-like 
[Cucumis sativus]
Length=406

 Score =   379 bits (973),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 206/380 (54%), Positives = 268/380 (71%), Gaps = 21/380 (6%)
 Frame = -3

Query  1443  ASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD  1264
              +S+CL    R  K+  +W EY G+ +WEGLLDPLDD LR EILRYG FV+AAY+SFDFD
Sbjct  33    GASECL---KRRVKVGKRWKEYAGLGNWEGLLDPLDDNLRNEILRYGQFVDAAYKSFDFD  89

Query  1263  TASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN---LVSPKSSWIGY  1093
              +SPTYATC + + +++   GL  +GY+V+++L  T  + +PRW      +S  SSWIGY
Sbjct  90    PSSPTYATCLHSKASLLESSGLPSTGYRVSKHLRATSGICLPRWLRNAPSISTNSSWIGY  149

Query  1092  VAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFL  913
             VAV  D+ EI RLGRRDVVI+ RGTAT  EWLENLRATLT LP +        MV+ GFL
Sbjct  150   VAVSQDKHEISRLGRRDVVISLRGTATCLEWLENLRATLTTLPGEEGG----AMVESGFL  205

Query  912   SLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR-  736
             SLY+S ++++PSLK+ +R+EI +++++YG+E LS+TITGHSLGAALAT+ AYDI   F+ 
Sbjct  206   SLYSSRTESYPSLKEMVREEIGRLLQSYGEEALSLTITGHSLGAALATLAAYDIKEYFKT  265

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVV-------DSDD  577
              AP+VTV+SFGGPRVGN+ FR +LE  GTKVLRIVNS+D ITK+PGFVV        +  
Sbjct  266   SAPMVTVMSFGGPRVGNRKFRQRLEKQGTKVLRIVNSEDVITKLPGFVVNNSSSSSSNKQ  325

Query  576   VSDCGTTQPSGMLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLH  406
                    +  G L W+QK V ++QW Y+EVG+ELR+SS         +VATCH L TYLH
Sbjct  326   QQQXNVEEGGGRLRWIQKYVEETQWAYSEVGRELRLSSRDSPHLNRINVATCHHLNTYLH  385

Query  405   CIDNWSSCKCPLRATAKRVI  346
              +D + S  CP RATA+R+ 
Sbjct  386   LVDGFVSSTCPFRATARRMF  405



>emb|CDP09430.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 206/371 (56%), Positives = 266/371 (72%), Gaps = 21/371 (6%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR  1207
             M+ QG+++WEGLLDPLD+ LR EI+RYG FVEAAYRS +F+ +SP+Y+ CR+ +  ++ +
Sbjct  1     MDIQGMKNWEGLLDPLDNNLRGEIIRYGHFVEAAYRSCEFEPSSPSYSKCRFSKRKLLVQ  60

Query  1206  CGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRRDV  1039
              G   +GY++T NL+ T  + +P W     + +S +SSWIGYVAVC D+  I +LGRRDV
Sbjct  61    SGFSETGYRITENLHATSGIQLPGWIERAPSWISMRSSWIGYVAVCQDKRVISKLGRRDV  120

Query  1038  VIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE-------PMVQRGFLSLYTSASDAHP  880
             VIA RGT T  EWLENLRATLT L +D A            PMV+ GFLSLYTS     P
Sbjct  121   VIALRGTVTCLEWLENLRATLTPLSNDNAASEVGANDYSSCPMVESGFLSLYTSRVGTSP  180

Query  879   SLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGG  700
             SL+D +R E  +I+ETYGDEPLS TITGHSLGAALAT+ AYDI   F+  PLVTV+SFGG
Sbjct  181   SLQDLVRQESGRILETYGDEPLSFTITGHSLGAALATLAAYDIKETFKCEPLVTVISFGG  240

Query  699   PRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD---VSDCGTTQPSG----M  541
             PRVGN++FR  LE  GTKVLRIVNSDD ITK+PGFV+D+++           P+G    +
Sbjct  241   PRVGNQSFRCHLEEQGTKVLRIVNSDDLITKMPGFVIDNNEDNLTKHNNEPAPAGQMVKL  300

Query  540   LSWLQKCV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             LSW+QK   DSQWVYA+VG ELR+SS+DS      D A+CH+LKTYLH ++ + S  CP+
Sbjct  301   LSWIQKIAEDSQWVYADVGCELRLSSRDSPYVNGFDFASCHELKTYLHLVNGFVSSNCPI  360

Query  369   RATAKRVIEKN  337
             RATA++++ K+
Sbjct  361   RATARKLMNKS  371



>gb|KGN56339.1| hypothetical protein Csa_3G116760 [Cucumis sativus]
Length=419

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 207/375 (55%), Positives = 270/375 (72%), Gaps = 16/375 (4%)
 Frame = -3

Query  1443  ASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD  1264
              +S+CL    R  K+  +W EY G+ +WEGLLDPLDD LR EILRYG FV+AAY+SFDFD
Sbjct  51    GASECL---KRRVKVGKRWKEYAGLGNWEGLLDPLDDNLRNEILRYGQFVDAAYKSFDFD  107

Query  1263  TASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN---LVSPKSSWIGY  1093
              +SPTYATC + + +++   GL  +GY+V+++L  T  + +PRW      +S  SSWIGY
Sbjct  108   PSSPTYATCLHSKASLLESSGLPSTGYRVSKHLRATSGICLPRWLRNAPSISTNSSWIGY  167

Query  1092  VAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFL  913
             VAV  D+ EI RLGRRDVVI+ RGTAT  EWLENLRATLT LP +        MV+ GFL
Sbjct  168   VAVSQDKHEISRLGRRDVVISLRGTATCLEWLENLRATLTTLPGEEG----GAMVESGFL  223

Query  912   SLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFR-  736
             SLY+S ++++PSLK+ +R+EI +++++YG+E LS+TITGHSLGAALAT+ AYDI   F+ 
Sbjct  224   SLYSSRTESYPSLKEMVREEIGRLLQSYGEEALSLTITGHSLGAALATLAAYDIKEYFKT  283

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
              AP+VTV+SFGGPRVGN+ FR +LE  GTKVLRIVNS+D ITK+PGFVV++   S     
Sbjct  284   SAPMVTVMSFGGPRVGNRKFRQRLEKQGTKVLRIVNSEDVITKLPGFVVNNSSSSSSNNN  343

Query  555   --QPSGMLSWLQKCV-DSQWVYAEVGKELRvss--kdssyskdVATCHDLKTYLHCIDNW  391
               +  G L W+QK V ++QW Y+EVG+ELR+SS         +VATCH L TYLH +D +
Sbjct  344   VEEGGGRLRWIQKYVEETQWAYSEVGRELRLSSRDSPHLNRINVATCHHLNTYLHLVDGF  403

Query  390   SSCKCPLRATAKRVI  346
              S  CP RATA+R+ 
Sbjct  404   VSSTCPFRATARRMF  418



>ref|XP_007134467.1| hypothetical protein PHAVU_010G049800g [Phaseolus vulgaris]
 gb|ESW06461.1| hypothetical protein PHAVU_010G049800g [Phaseolus vulgaris]
Length=418

 Score =   372 bits (956),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 202/391 (52%), Positives = 264/391 (68%), Gaps = 22/391 (6%)
 Frame = -3

Query  1479  KNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGD  1300
             K+ + W  L    S+KC         L +KW +YQGI  WEGLLDPLDD LR EILRYG 
Sbjct  37    KSLRPWNQL-KLHSAKC-----NFPNLRNKWKQYQGINHWEGLLDPLDDNLRWEILRYGH  90

Query  1299  FVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLV  1120
             FV+A Y SFDFD +S TYA   Y + +++ +CGLG  GY++++ LY TC +++P+  N +
Sbjct  91    FVDATYTSFDFDPSSLTYAKSLYSKKSLLKKCGLGKYGYRISKYLYVTCGIHMPKCINKI  150

Query  1119  SPK----SSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA  952
               K    SS IGYVA+C +E EI RLGRRD+V++ RGT T  EWLENLR  LT LP  + 
Sbjct  151   FKKLFTRSSLIGYVAICVNEKEITRLGRRDIVVSLRGTITCLEWLENLRVFLTHLPGVVK  210

Query  951   PRN-CEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAAL  775
               +   PMVQ+GFLSLYTS    H SL++ IR EI ++I+ Y +EPLS+T+TGHSLGAAL
Sbjct  211   GEDDVGPMVQKGFLSLYTSKITPHGSLQEMIRKEIGRLIQRYTNEPLSLTLTGHSLGAAL  270

Query  774   ATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGF  595
             A ++AYDITT F +AP+VTV+SFGGPRVGN +FR+QLE  G K+LRIVNSDD +TKVPG 
Sbjct  271   AILSAYDITTTFNNAPMVTVISFGGPRVGNGSFRNQLEQKGIKILRIVNSDDVVTKVPGL  330

Query  594   VVDSDDV---SDCGTTQPSGMLS-WLQKCVDS-QWVYAEVGKELRvsskds--syskdVA  436
              V+ D+V    D G     G+ S W  K + + + VY ++G+ELR+SS++       DVA
Sbjct  331   FVNFDEVVSDEDVGV----GIWSKWFYKYIQNMKLVYVDIGQELRLSSREFPCLNKTDVA  386

Query  435   TCHDLKTYLHCIDNWSSCKCPLRATAKRVIE  343
              CHDLKTYLH + N+ S  C  + T    I+
Sbjct  387   MCHDLKTYLHLVKNFVSSSCACKHTKIHSIQ  417



>ref|XP_006837391.1| hypothetical protein AMTR_s00111p00133140 [Amborella trichopoda]
 gb|ERN00245.1| hypothetical protein AMTR_s00111p00133140 [Amborella trichopoda]
Length=439

 Score =   365 bits (938),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 195/364 (54%), Positives = 252/364 (69%), Gaps = 22/364 (6%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             R  KL  +W EYQG ++WEGLLDPL++ +R EILRYG FV+AAY SF+FD +SP+YA+C+
Sbjct  55    RKGKLGERWKEYQGSKNWEGLLDPLEENMRNEILRYGAFVQAAYTSFNFDPSSPSYASCK  114

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRL  1054
             + E +++  CGL  +GY+VTRNL+ T  +  P   + ++ +SS+IGYVAVC DE+EI RL
Sbjct  115   FSESSMLQLCGLPETGYRVTRNLHATSGIRPP---HFLTKRSSYIGYVAVCQDEEEITRL  171

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSASD  889
             GRRDVVIAYRGTAT  EWL+NLR+ LT +P+     DM     +P V+ GF SLYTS  D
Sbjct  172   GRRDVVIAYRGTATCLEWLDNLRSMLTQIPNSTLECDMP----QPKVESGFYSLYTSQDD  227

Query  888   AHPSLKDSIRDEITKIIETY-GDEPLSITITGHSLGAALATITAYDITTQFRHAPL-VTV  715
               PSL + + DE+ KI+ T    +PLSITITGHSLGAALA +TA DI   F  +P+ +TV
Sbjct  228   TCPSLSEEVIDEVGKILRTSDSTKPLSITITGHSLGAALAVLTACDIRAAFPSSPISITV  287

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLS  535
             +SFGGPRVG++ F   LEN G K+LRIVN+ D +T+VPG V+D     D G    + +  
Sbjct  288   ISFGGPRVGDRLFSQHLENQGIKILRIVNTHDVVTRVPGIVID-----DTGVKGHAKLPK  342

Query  534   WLQKCVDSQ-WVYAEVGKELRvsskdssyskdV--ATCHDLKTYLHCIDNWSSCKCPLRA  364
             WL   +    WVYAEVG+ELRVSS+DS Y      A CHDL+ YLH +D + S  CP RA
Sbjct  343   WLMTGLQGMPWVYAEVGQELRVSSEDSPYLNPNDFAMCHDLEAYLHLVDGFLSSACPFRA  402

Query  363   TAKR  352
             T KR
Sbjct  403   TVKR  406



>gb|EYU40369.1| hypothetical protein MIMGU_mgv1a018694mg [Erythranthe guttata]
Length=354

 Score =   359 bits (922),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 246/362 (68%), Gaps = 27/362 (7%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             K    W +YQG ++WEGLLDPLD+ LR EI+RYG FVEAAYRS DFD +SP+YATCRY +
Sbjct  2     KFGENWTDYQGGKNWEGLLDPLDENLRSEIIRYGHFVEAAYRSCDFDQSSPSYATCRYTK  61

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP----KSSWIGYVAVCDDEDEIRR  1057
               ++   G   +GY+VT+ L  T  + +P W     P    +SSWIGYVAVC D +EI R
Sbjct  62    RKLLKETGFSDTGYRVTKYLTATSGIQLPGWAERGPPWMAVQSSWIGYVAVCQDREEISR  121

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTSASDAH  883
             LGRRDVVIA RGTAT  EWLENLRATLT L    +      EPMV+ GFLSLYTS+    
Sbjct  122   LGRRDVVIALRGTATGLEWLENLRATLTPLSGSDSGSGSDTEPMVESGFLSLYTSSVGNR  181

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
              SL+  +R+EI ++++ YGDEPLS T TGHSLGAALAT+ AYDI   F ++PLVTV+SF 
Sbjct  182   RSLQSMVREEIGRVLDKYGDEPLSFTFTGHSLGAALATLAAYDIKRSFVNSPLVTVISFA  241

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPR GN  FR  LE  GTKVLRIVNSDD ITKVPGF                    W+QK
Sbjct  242   GPRAGNWRFRCGLEEQGTKVLRIVNSDDVITKVPGFA------------------GWVQK  283

Query  522   CV-DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
              V D+QWVYA+VG ELR+SS+DS       +ATCH+LKTYLH ++ +    CP +ATA++
Sbjct  284   LVEDTQWVYADVGCELRLSSRDSPDLNGISIATCHELKTYLHLVNGFVGSNCPFKATARK  343

Query  351   VI  346
             +I
Sbjct  344   MI  345



>ref|XP_009407578.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=476

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 198/373 (53%), Positives = 250/373 (67%), Gaps = 26/373 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W EYQG  +W+GLLDPLDD LR EILRYG+F  AAY  FDFD +SPTY TCR+ + 
Sbjct  110   IGKRWREYQGANNWDGLLDPLDDALRSEILRYGEFARAAYTCFDFDPSSPTYGTCRFPKR  169

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPK-----SSWIGYVAVCDDEDEIRR  1057
             +++ R G+  +GY ++RNL  T    +P W    +P      +SWIGYVAVC DEDEI R
Sbjct  170   SLLRRSGIPDTGYCISRNLTATSGARLPGWAEPGAPAWLSRGTSWIGYVAVCQDEDEIER  229

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN-----CEPMVQRGFLSLYTSAS  892
             LGRRD+VI++RGTAT  EW+ENLRATLT LP  + P        EPMV+RGF SL+TS+S
Sbjct  230   LGRRDIVISFRGTATLLEWMENLRATLTHLPSVVVPAALGSDAAEPMVERGFWSLFTSSS  289

Query  891   DAHPSLKDSIRDEITKIIETYG--DEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                 SL+D +R EI ++I  Y    +PLS+T+TGHSLGAALA +TA+DITT F+  P+VT
Sbjct  290   STRRSLRDQVRQEIRRLINKYDARGKPLSLTVTGHSLGAALAVLTAHDITTAFQDVPMVT  349

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD---VSDCGTTQPS  547
             VVSFGGPRVGN +FR +LE  GTKVLRIVN+ D ITKVPGFVV+ D      D     PS
Sbjct  350   VVSFGGPRVGNASFRRRLEERGTKVLRIVNTQDIITKVPGFVVEEDRRVAADDDNGWLPS  409

Query  546   GMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLR  367
              +LS       S WVYA++G+ELR    +   + +V  CHDL  YL+ + N  S  CPLR
Sbjct  410   WLLS------KSGWVYADIGRELR---LNGRRTANVVACHDLGVYLNLV-NQLSANCPLR  459

Query  366   ATAKR-VIEKNHG  331
             + A R    +N G
Sbjct  460   SLAMRAATSQNQG  472



>ref|XP_004168164.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Cucumis 
sativus]
Length=374

 Score =   357 bits (917),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 246/346 (71%), Gaps = 22/346 (6%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             KW EYQGI++W+GLLDPLD +LR EILRYG FVEAAY SF ++  SP YA+CR+ + +++
Sbjct  35    KWTEYQGIQNWDGLLDPLDHHLRTEILRYGRFVEAAYDSFQYNPTSPFYASCRHSKSSLL  94

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              R GL  +GY+VT+ L  T ++ +P W     N  + +SSWIGYVAVC+D+ EI RLGRR
Sbjct  95    NRTGLSKTGYRVTKYLRATSSLELPYWVEKAANSTATRSSWIGYVAVCEDKKEIARLGRR  154

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAP-RNCEPMVQRGFLSLYTSASDAHPSLKD  868
             D+V AYRGTAT  EWLENLR  LT L D  +     +PMV+ GFLSLY S      SLK 
Sbjct  155   DIVFAYRGTATCLEWLENLRFALTELSDSCSSWVGSKPMVETGFLSLYRSKMVGWLSLKQ  214

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF-RHAPLVTVVSFGGPRV  691
             +IR+E+++++ +Y  EPLS+TITGHSLGAALA +TAYDI   F + AP VTVVSFGGPRV
Sbjct  215   TIREEVSRLLHSYTGEPLSLTITGHSLGAALAILTAYDIKMTFEQRAPPVTVVSFGGPRV  274

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVD-  514
             GNK+F+  L+  GTKVLRIVNSDD +TKVPG VVD D++          +  W+++CV+ 
Sbjct  275   GNKDFQRSLDEQGTKVLRIVNSDDIVTKVPGIVVDDDNL--------EALPWWIRQCVEN  326

Query  513   --SQWVYAEVGKELRvsskdss-----yskdVATCHDLKTYLHCID  397
               SQ +Y+EVGKEL+V++K +S        ++   HDLKTYLH ++
Sbjct  327   VQSQRLYSEVGKELKVNNKSTSWYVNGGIMNMGMHHDLKTYLHLVE  372



>ref|XP_009414077.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 243/359 (68%), Gaps = 20/359 (6%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             +W EYQG  +W+GLLDPLDD LR EILRYG+F   AY  FDFD +SPTY  CR+ + +++
Sbjct  43    RWREYQGANNWDGLLDPLDDALRSEILRYGEFARVAYTCFDFDHSSPTYGACRFPKRSLL  102

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPK-----SSWIGYVAVCDDEDEIRRLGR  1048
                G+  +GY VTRNL  T    +PRW    +P      +SWIGYVA C DEDEI RLGR
Sbjct  103   RHAGIPDTGYCVTRNLTATSGARLPRWAEPGAPAWFSRCTSWIGYVAECQDEDEIERLGR  162

Query  1047  RDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN-----CEPMVQRGFLSLYTSASDAH  883
             RD+VI++RGTAT  EWLENLRATLT LP    P        EPMV+RGF SL+TS+S   
Sbjct  163   RDIVISFRGTATCLEWLENLRATLTHLPSVAVPAALGSDAAEPMVERGFWSLFTSSSSTS  222

Query  882   PSLKDSIRDEITKIIETYGDE--PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
              SL+D IR EI ++I  YG    PLSIT+TGHSLGAALA +TA+DITT F+ AP+VTVVS
Sbjct  223   CSLRDQIRQEIRRLIVKYGGRGNPLSITVTGHSLGAALAVLTAHDITTAFQDAPMVTVVS  282

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGN +FR +LE SG KVLRIVN+ D ITKVPGFVV+   V++    +   + SWL
Sbjct  283   FGGPRVGNASFRRRLEESGIKVLRIVNTQDVITKVPGFVVEDQSVAE--DKENGSIPSWL  340

Query  528   QKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                  + WVYA++G+ELR        + +V  CHDL  YL+ + N  S  CPLR+ A R
Sbjct  341   LS--KTGWVYADIGRELR---LPGQPTANVVACHDLSVYLNLV-NQLSANCPLRSLAMR  393



>ref|XP_004140625.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A(1) DAD1, chloroplastic-like 
[Cucumis sativus]
Length=374

 Score =   355 bits (910),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 245/346 (71%), Gaps = 22/346 (6%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             KW EYQGI++W+GLLDPLD +LR EILRYG FVEAAY SF ++  SP YA+CR+ + +++
Sbjct  35    KWTEYQGIQNWDGLLDPLDHHLRTEILRYGRFVEAAYDSFQYNPTSPFYASCRHSKSSLL  94

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              R GL  +GY+VT+ L  T ++ +P W     N  + +SSWIGYVAVC+D+ EI RLGRR
Sbjct  95    NRTGLSKTGYRVTKYLRATSSLELPYWVEKAANSTATRSSWIGYVAVCEDKKEIARLGRR  154

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAP-RNCEPMVQRGFLSLYTSASDAHPSLKD  868
             D+V AYRGTAT  EWLENLR  LT L D  +     +PMV+ GF SLY S      SLK 
Sbjct  155   DIVFAYRGTATCLEWLENLRFALTELSDSCSSWVGSKPMVETGFXSLYRSKMVGWLSLKQ  214

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF-RHAPLVTVVSFGGPRV  691
             +IR+E+++++ +Y  EPLS+TITGHSLGAALA +TAYDI   F + AP VTVVSFGGPRV
Sbjct  215   TIREEVSRLLHSYTGEPLSLTITGHSLGAALAILTAYDIKMTFEQRAPPVTVVSFGGPRV  274

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVD-  514
             GNK+F+  L+  GTKVLRIVNSDD +TKVPG VVD D++          +  W+++CV+ 
Sbjct  275   GNKDFQRSLDEQGTKVLRIVNSDDIVTKVPGIVVDDDNL--------EALPWWIRQCVEN  326

Query  513   --SQWVYAEVGKELRvsskdss-----yskdVATCHDLKTYLHCID  397
               SQ +Y+EVGKEL+V++K +S        ++   HDLKTYLH ++
Sbjct  327   VQSQRLYSEVGKELKVNNKSTSWYVNGGIMNMGMHHDLKTYLHLVE  372



>gb|KEH23433.1| glycerolipase A1 [Medicago truncatula]
Length=423

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 246/371 (66%), Gaps = 35/371 (9%)
 Frame = -3

Query  1413  RAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCR  1234
             +   L  +W EYQG+R+W+GLLDPLDD LR EILRYG FVEA Y+SF+FD +S  YA CR
Sbjct  71    KTKTLGKRWKEYQGMRNWDGLLDPLDDILRCEILRYGHFVEATYKSFEFDPSSSKYANCR  130

Query  1233  YDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDE  1066
             + +  ++  CGL  +GYKVT+ L+ T  + +P W     N V+ +SS+IGYVAVCD+++E
Sbjct  131   FPKSTLLECCGLPNTGYKVTKYLHATSGIQLPSWMDKAPNWVATQSSYIGYVAVCDNKEE  190

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLT--CLPDDM----APRNCEPMVQRGFLSLY  904
             I+RLGRRDVVIA RGT T  EWLEN RATLT   +P +       +    MV+ GFL+LY
Sbjct  191   IKRLGRRDVVIAIRGTCTCLEWLENFRATLTNFSIPCNHNINDERKGVGTMVESGFLNLY  250

Query  903   TSASDAHPSL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRH  733
             TS++ A  SL   +  ++ EI +I + Y  E LS+TITGHSLGAALAT+ AYD+      
Sbjct  251   TSSNYAKSSLESMQKMVKQEILRINQIYRQEELSLTITGHSLGAALATLIAYDVKISVPK  310

Query  732   APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ  553
               +VTV+SFGGPRVGN+NFR  LE  GTKVLRIVNSDD ITK+PGFV   DDV       
Sbjct  311   L-MVTVISFGGPRVGNRNFRQHLEKQGTKVLRIVNSDDVITKLPGFVF-FDDVD------  362

Query  552   PSGMLSWLQKCVDSQWVYAEVGKELR--vsskdssyskdVATCHDLKTYLHCIDNWSSCK  379
                          + W+YAEVGKELR          S +VATCH+L+TYLH +D + S +
Sbjct  363   ------------KTPWMYAEVGKELRLCSRDSPYLGSTNVATCHELQTYLHLVDGFISSR  410

Query  378   CPLRATAKRVI  346
             CP RA+AKR +
Sbjct  411   CPFRASAKRFL  421



>ref|XP_010692044.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   356 bits (914),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 191/385 (50%), Positives = 272/385 (71%), Gaps = 30/385 (8%)
 Frame = -3

Query  1419  ADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYAT  1240
             A    ++  +W EY G++DW G+LDPLD++LR +ILRYG+F+EA YR+FDF+ +S +Y +
Sbjct  69    ASPNGRVADRWEEYMGVKDWAGMLDPLDEHLRDQILRYGNFIEATYRAFDFEPSSTSYGS  128

Query  1239  CRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW--TNLVSPKSSWIGYVAVCDDEDE  1066
             C+Y++ +++  CGL   GYKVTR+L  T  + VP W  ++  + +SSWIG+VAVC+D+  
Sbjct  129   CKYNKKSLLDSCGLPCHGYKVTRHLRATSGIQVPEWARSSWAAAQSSWIGFVAVCNDKAV  188

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLP-------DDMAPRNCE----PMVQRG  919
             I RLGRR+VVI+ RGTAT  EW+ENLRATL  +P       D++ P + +    PMV+ G
Sbjct  189   INRLGRREVVISLRGTATCLEWVENLRATLAPVPGPTTLNNDNVGPWDRDGSQAPMVESG  248

Query  918   FLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF  739
             FLSLYTS ++  PSL+D+IR E+ ++++ Y +EPLSITITGHSLGAALAT+ AYDI T F
Sbjct  249   FLSLYTSGTNMGPSLQDAIRMEVRQLLKLYKNEPLSITITGHSLGAALATLAAYDIKTTF  308

Query  738   RHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGT  559
               APLVTV+SFGGPRVGN+ FRS ++  GTK+LR+VN  D ITKVPGFV+D+++      
Sbjct  309   EGAPLVTVISFGGPRVGNQCFRSLVDKQGTKILRVVNPSDLITKVPGFVIDNNEEYVNNI  368

Query  558   TQP---SGMLSWLQ--KCVDSQ-WVYAEVGKELRvsskdssy------skdVATCHDLKT  415
              +P    G+ SW+Q  +  D+  WVYAEVG+ELR+  +++        + +VA CHDLKT
Sbjct  369   KRPCKKHGIPSWIQEFRVEDTHWWVYAEVGRELRLKCEETEQLPYYLSNMNVAKCHDLKT  428

Query  414   YLHCIDNWSSCKCPLRATAKRVIEK  340
             YL+ ++      CP++A  +R ++K
Sbjct  429   YLNLVE-----VCPIKAFVRRSLQK  448



>gb|EPS63624.1| hypothetical protein M569_11160, partial [Genlisea aurea]
Length=358

 Score =   350 bits (899),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 190/359 (53%), Positives = 245/359 (68%), Gaps = 14/359 (4%)
 Frame = -3

Query  1386  MEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTAS-PTYA-TCRYDEDAVM  1213
             M+YQG+R+WEGLLDPLD+ LR+EI+RYG FVEAAYR+ +F  AS P Y   CR     ++
Sbjct  1     MDYQGMRNWEGLLDPLDENLRREIIRYGHFVEAAYRASEFRAASAPAYGGACRVSRRRLL  60

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRW-TNLVSPKSSWIGYVAVCDDEDEIRRLGRRDVV  1036
                G  G+GYKVT+NL  +  +++P W T+ V+  SSWIGYVAVC +  EI R+GRRDVV
Sbjct  61    EGSGFEGTGYKVTKNLIASSGISLPPWITDRVAASSSWIGYVAVCQNRREISRIGRRDVV  120

Query  1035  IAYRGTATPPEWLENLRATLTCLPDDMAPR-NCEPMVQRGFLSLYTSASDAHPSLKDSIR  859
             IA+RGT T  EW+ENLRATL   P ++ PR    PMV+ GFLSLYTS++   PSL+  +R
Sbjct  121   IAFRGTGTAMEWVENLRATLA--PVEVEPRAGGGPMVESGFLSLYTSSAGGGPSLQKLVR  178

Query  858   DEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKN  679
              EI +I+  YG EPLS T TGHSLGAALAT+ AYD+   F  +PLVTV+SF GPRVG+  
Sbjct  179   QEIGRILRKYGGEPLSFTFTGHSLGAALATLAAYDVRKTFPDSPLVTVISFAGPRVGDWR  238

Query  678   FRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS-----DCGTTQPSGMLSWLQKCV-  517
             FR  +E  GTK+LRIVN DDP+TKVPGFVV SDD +     +           W++K V 
Sbjct  239   FRRHVERQGTKILRIVNPDDPVTKVPGFVVGSDDETSGLRCEAAAAAAENFSDWIRKLVE  298

Query  516   DSQWVYAEVGKE--LRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
             D+QWVYA++G E  LR          D+A CHDLKTYL  ++ +    CP R+TA++++
Sbjct  299   DTQWVYADIGCELKLRNRDSVKLNGFDLAACHDLKTYLQLVNGFDGSHCPFRSTARKLM  357



>gb|EAY79924.1| hypothetical protein OsI_35090 [Oryza sativa Indica Group]
Length=405

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 239/365 (65%), Gaps = 44/365 (12%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPT-YATCRYD  1228
             ++  +W E QG RDWEGLL+PLD  LR E++RYG+FV AAY SFDFD  +P+ Y +CR+ 
Sbjct  50    RIGRQWTELQGARDWEGLLNPLDGALRGELVRYGEFVRAAYASFDFDGGAPSSYGSCRFP  109

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGR  1048
               +++ R GL  +GY+VT  L+   + + P W   +S +SS+IGYVAVCDDEDEI RLGR
Sbjct  110   TSSLLRRSGLPETGYRVTGILH-AASTSAPGW---LSCRSSYIGYVAVCDDEDEIERLGR  165

Query  1047  RDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE-----PMVQRGFLSLYTSASDAH  883
             RDVVIA+RGTAT  EW++N ++TLT LP    PR+ +     PMV+ GF  L+T+  +AH
Sbjct  166   RDVVIAFRGTATCGEWVDNFKSTLTHLP----PRSGDGEAAPPMVESGFWRLFTTPGEAH  221

Query  882   PSLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITTQF---RH----  733
              SL+  +R E+ +I+  YG E   PLSIT+TGHSLGAALA +TAYDITT     RH    
Sbjct  222   GSLQQQVRGEVQRIVSEYGGEGMPPLSITVTGHSLGAALAVLTAYDITTNSPMQRHGGGD  281

Query  732   -----APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD  568
                  AP+VT VSFGGPRVGN  FR +LE SG KVLR+VNS+D +TKVPGF VD D   D
Sbjct  282   DDDGEAPMVTAVSFGGPRVGNAAFRRRLEESGGKVLRVVNSNDVVTKVPGFPVDGD---D  338

Query  567   CGTTQPSG---------MLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKT  415
             CG     G         +  WL   +   W Y++VG+ELR+ S+  +    VA+ HDL  
Sbjct  339   CGGGAREGDAPARRKPRLPRWLVSKMG--WEYSDVGRELRLCSQGDTARNVVAS-HDLDL  395

Query  414   YLHCI  400
             YL  +
Sbjct  396   YLKLV  400



>gb|ABA91465.1| Lipase family protein [Oryza sativa Japonica Group]
 gb|EAZ17428.1| hypothetical protein OsJ_32952 [Oryza sativa Japonica Group]
 emb|CBX25492.1| hypothetical_protein [Oryza glaberrima]
Length=405

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 242/379 (64%), Gaps = 44/379 (12%)
 Frame = -3

Query  1446  AASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDF  1267
             A SS          ++  +W E QG RDW+GLL+PLD  LR E++RYG+FV AAY SFDF
Sbjct  36    ATSSPATCKPSGMMRIGRQWTELQGARDWDGLLNPLDGALRGELVRYGEFVRAAYASFDF  95

Query  1266  DTASPT-YATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYV  1090
             D  +P+ Y +CR+   +++ R GL  +GY+VT  L+   + + P W   +S +SS+IGYV
Sbjct  96    DGGAPSSYGSCRFPTSSLLRRSGLPETGYRVTGILH-AASTSAPGW---LSCRSSYIGYV  151

Query  1089  AVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE-----PMVQ  925
             AVCDDEDEI RLGRRDVVIA+RGTAT  EW++N ++TLT LP    PR+ +     PMV+
Sbjct  152   AVCDDEDEIERLGRRDVVIAFRGTATCGEWVDNFKSTLTHLP----PRSGDGEAAPPMVE  207

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYD  754
              GF  L+T+  +AH SL+  +R E+ +I+  YG E   PLSIT+TGHSLGAALA +TAYD
Sbjct  208   SGFWRLFTTPGEAHGSLQQQVRGEVQRIVSEYGGEGMPPLSITVTGHSLGAALAVLTAYD  267

Query  753   ITTQF---RH---------APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPIT  610
             ITT     RH         AP+VT VSFGGPRVGN  FR +LE SG KVLR+VNS+D +T
Sbjct  268   ITTNSPMQRHGGGDDDDGEAPMVTAVSFGGPRVGNAAFRRRLEESGGKVLRVVNSNDVVT  327

Query  609   KVPGFVVDSDDVSDCGTTQPSG---------MLSWLQKCVDSQWVYAEVGKELRvsskds  457
             KVPGF VD D   DCG     G         +  WL   +   W Y++VG+ELR+ S+  
Sbjct  328   KVPGFPVDGD---DCGGGAREGDAPARRKPRLPRWLVSKMG--WEYSDVGRELRLCSQGD  382

Query  456   syskdVATCHDLKTYLHCI  400
             +    VA+ HDL  YL  +
Sbjct  383   TARNVVAS-HDLDLYLKLV  400



>ref|XP_008680711.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Zea mays]
 gb|AFW64783.1| hypothetical protein ZEAMMB73_486323 [Zea mays]
Length=402

 Score =   320 bits (820),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 226/355 (64%), Gaps = 24/355 (7%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             A ++ SKW E QG RDW+GLL PLD  LR E++RYG+FV AAY SFDFD  +P+Y +CR+
Sbjct  49    AQRIGSKWAELQGARDWDGLLSPLDGALRGELVRYGEFVRAAYASFDFDGGAPSYGSCRF  108

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-KSSWIGYVAVCDDEDEIRRL  1054
                +++ R G+ G+GY+VTR L+   + + P W     P  SS+IG+VAVCDDE EI RL
Sbjct  109   PSRSLLRRAGMPGTGYRVTRLLH-AASTSAPGWLPSSPPCGSSYIGFVAVCDDESEIERL  167

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDDM--APRNCEPMVQRGFLSLYTSASDAHP  880
             GRRDVV+A+RGTAT  EW++N ++ LT LP          EPMV+ GF  L+T+  +AH 
Sbjct  168   GRRDVVVAFRGTATCGEWVDNFKSGLTRLPTTGTDEEEEEEPMVESGFWRLFTAPGEAHS  227

Query  879   SLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITTQFRHAP------  727
             SL+  +RDE  +I   YG     PLSIT+TGHSLGAALA +TA++ITTQ R         
Sbjct  228   SLQQQVRDEARRIANEYGGSGMPPLSITVTGHSLGAALAVLTAHEITTQQRQEHGSGEPM  287

Query  726   LVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGF-VVDSDDVSDCGTTQP  550
             +VT VSFGGPRVGN  FR +LE SG KVLR+VNSDD +TKVPGF VV   D  D G    
Sbjct  288   MVTAVSFGGPRVGNVAFRRRLEESGGKVLRVVNSDDIVTKVPGFPVVHEHDDDDSGAQPA  347

Query  549   SGMLS-----WLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
              GM+      WL   +   W Y +VG+ELR     S    +V   HDL  YL  +
Sbjct  348   KGMMKARLPRWLVSKMG--WGYTDVGRELR---LSSHSQANVVASHDLDLYLKLV  397



>ref|XP_004978370.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Setaria 
italica]
Length=400

 Score =   320 bits (819),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 239/355 (67%), Gaps = 25/355 (7%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             ++  KW E QG RDW+GLL PLD  LR E++RYG+FV AAY SFDFD  +P+Y +CR+  
Sbjct  46    RIGRKWPELQGARDWDGLLSPLDGALRGELVRYGEFVRAAYASFDFDGGAPSYGSCRFPS  105

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              +++ R GL  +GY+VTR L+   + + P W +  S  SS+IGYVAVCDDEDEI RLGRR
Sbjct  106   RSLLRRAGLPETGYQVTRLLH-AASTSAPGWLSPCS--SSYIGYVAVCDDEDEIERLGRR  162

Query  1044  DVVIAYRGTATPPEWLENLRATLTCL----------PDDMAPRNCEPMVQRGFLSLYTSA  895
             DVVIAYRGTAT  EWL+N +++LT L           D       EPMV+ GF  L+T+ 
Sbjct  163   DVVIAYRGTATCSEWLDNFKSSLTRLPSSSTAAPSSSDAGEEEEEEPMVESGFWRLFTTP  222

Query  894   SDAHPSLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITTQFRH---  733
              +AH SL+  +RDE+ +I+  YG +   PLSITITGHSLGAALA ++AY+ITT       
Sbjct  223   GEAHSSLQQQVRDEVQRIVHEYGGKGMPPLSITITGHSLGAALAVLSAYEITTAAAQQGV  282

Query  732   --APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGT  559
               AP+VT VSFGGPRVGN  FR +LE SG KVLR+VNS+D +TKVPGF V  D+    G 
Sbjct  283   DAAPMVTAVSFGGPRVGNAAFRRRLEESGGKVLRVVNSNDIVTKVPGFPVGGDERCSQG-  341

Query  558   TQPSGMLSWLQKCVDSQ--WVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
              +P+   + + + + S+  W Y++VG+ELR+SS+DS+ +  VA+ H L  YL  +
Sbjct  342   GEPAKRKARVPRWLVSKMGWAYSDVGRELRLSSRDSAPNNVVAS-HGLDLYLQLV  395



>gb|KGN46517.1| hypothetical protein Csa_6G106200 [Cucumis sativus]
Length=345

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 226/346 (65%), Gaps = 51/346 (15%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             KW EYQGI++W+GLLDPLD +LR EILRYG FVEAAY SF ++  SP YA+CR+ + +++
Sbjct  35    KWTEYQGIQNWDGLLDPLDHHLRTEILRYGRFVEAAYDSFQYNPTSPFYASCRHSKSSLL  94

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWT----NLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              R GL  +GY+VT+ L  T ++ +P W     N  + +SSWIGYVAVC+D+ EI RLGRR
Sbjct  95    NRTGLSKTGYRVTKYLRATSSLELPYWVEKAANSTATRSSWIGYVAVCEDKKEIARLGRR  154

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAP-RNCEPMVQRGFLSLYTSASDAHPSLKD  868
             D+V AYRGTAT  EWLENLR  LT L D  +     +PMV+ G                 
Sbjct  155   DIVFAYRGTATCLEWLENLRFALTELSDSCSSWVGSKPMVETG-----------------  197

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF-RHAPLVTVVSFGGPRV  691
                         Y  EPLS+TITGHSLGAALA +TAYDI   F + AP VTVVSFGGPRV
Sbjct  198   ------------YTGEPLSLTITGHSLGAALAILTAYDIKMTFEQRAPPVTVVSFGGPRV  245

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVD-  514
             GNK+F+  L+  GTKVLRIVNSDD +TKVPG VVD D++          +  W+++CV+ 
Sbjct  246   GNKDFQRSLDEQGTKVLRIVNSDDIVTKVPGIVVDDDNL--------EALPWWIRQCVEN  297

Query  513   --SQWVYAEVGKELRvsskdss-----yskdVATCHDLKTYLHCID  397
               SQ +Y+EVGKEL+V++K +S        ++   HDLKTYLH ++
Sbjct  298   VQSQRLYSEVGKELKVNNKSTSWYVNGGIMNMGMHHDLKTYLHLVE  343



>emb|CBX25385.1| hypothetical_protein [Oryza brachyantha]
Length=389

 Score =   317 bits (812),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 236/350 (67%), Gaps = 22/350 (6%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             ++  +W E QG RDW+GLL+PLD  LR E++RYG+FV AAY SF+FD  +P+Y +CR+  
Sbjct  42    RIGRQWAELQGARDWDGLLNPLDGALRGELVRYGEFVRAAYASFNFDGGAPSYGSCRFPS  101

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
             ++++ R GL  +GY+V R L+   + + P W   +S +SS+IGYVAVCD+E+EI RLGRR
Sbjct  102   NSLLRRSGLPETGYRVARLLH-AASTSAPCW---LSCRSSYIGYVAVCDEEEEIERLGRR  157

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE----PMVQRGFLSLYTSASDAHPS  877
             DVVIA+RGTAT  EW++N ++TLT LP   +PR+ +    PMV+ GF  L+T+   AH S
Sbjct  158   DVVIAFRGTATCSEWVDNFKSTLTRLPLTTSPRSADGEAAPMVESGFWRLFTTPGKAHSS  217

Query  876   LKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITT------QFRHAPL  724
             L+  +R E+ +II  YG +   PLSIT+TGHSLGAALA +TAY+ITT          AP+
Sbjct  218   LQHQVRGEVQRIISEYGGKGMPPLSITVTGHSLGAALAVLTAYEITTTSAMQGHGGAAPM  277

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VT VSFGGPRVGN  FR +LE SG KVLR+VNSDD +T+VPGF  D+DD        P+ 
Sbjct  278   VTAVSFGGPRVGNAAFRRRLEESGGKVLRVVNSDDIVTRVPGF-PDADDCGGARDDAPAK  336

Query  543   MLSWLQKCVDSQ--WVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
                   + + S+  W Y++VG+ELR+  +D+  +   +  HDL  YL  +
Sbjct  337   RKPRFPRWLVSKMGWEYSDVGRELRLCGQDTWSNVVAS--HDLDLYLKLV  384



>ref|XP_004978369.1| PREDICTED: phospholipase A(1) DAD1, chloroplastic-like [Setaria 
italica]
Length=382

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 231/349 (66%), Gaps = 19/349 (5%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             ++  KW E QG RDWEGLL PLD  LR E+LRYG+FV AAY SFDFD  +P+Y +CR+  
Sbjct  34    QIGRKWPELQGARDWEGLLSPLDGTLRGELLRYGEFVRAAYASFDFDGGAPSYGSCRFPS  93

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              +++ R GL  +GY+VTR L+   +   P W +  S  SS+IGY+AVCDDE EI RLGRR
Sbjct  94    RSLLLRAGLPETGYQVTRLLH-AASTPAPAWLSPCS--SSYIGYIAVCDDEGEIERLGRR  150

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMA------PRNCEPMVQRGFLSLYTSASDAH  883
             DVVIAYRG  T  EW+++ ++ LT LP  +A          EPMV+RGF SL+T+  +AH
Sbjct  151   DVVIAYRGITTFSEWVDSFKSNLTRLPTAVARWSNAGEEEEEPMVERGFWSLFTAPGEAH  210

Query  882   PSLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITTQF---RHAPLV  721
              SL+  + DE+ +II  YG E   P SITI GHSLGAALA ++ Y+IT Q       P+V
Sbjct  211   SSLQQQVLDEVRRIIHEYGGESMPPRSITIAGHSLGAALAVLSVYEITCQQWSDDAPPMV  270

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM  541
             T VSFGGPRVGN  FR +LE SG KVLR+VNS+D +TKVPGF V+ DD    G       
Sbjct  271   TAVSFGGPRVGNAVFRRRLEESGGKVLRVVNSNDIVTKVPGFPVNDDDCCIPGGEPAKRN  330

Query  540   LSWLQKCVDSQ--WVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
             ++ + + + S+  W Y++VG+ELR+SS+DS+ +   A  HDL  YL  +
Sbjct  331   VARVPRWLVSKMGWGYSDVGRELRLSSQDSAPNVVAA--HDLDCYLKLV  377



>ref|XP_010440096.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Camelina sativa]
Length=512

 Score =   311 bits (796),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 239/369 (65%), Gaps = 30/369 (8%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
             +KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SPT+     
Sbjct  124   SKLGSKWKELHGLNNWAGLLDPLDEDLRRELVRYGEFVQAAYHAFHSDPEGSPTH-----  178

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                       L    +KVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  179   --------VALQDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  230

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDM--APRNCEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+    +     P V+ GF SLYT+
Sbjct  231   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDSSNPTRPKVECGFNSLYTT  290

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
             +S   PSL +S+  EI++++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V 
Sbjct  291   SSQHGPSLAESLIGEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVA  350

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG    SD+ ++ G ++P G++
Sbjct  351   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGLF--SDNENNNGRSRPGGIM  408

Query  537   SWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
               +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP R
Sbjct  409   EMVER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFR  466

Query  366   ATAKRVIEK  340
             A AKR + K
Sbjct  467   ANAKRSLRK  475



>ref|XP_010434764.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Camelina 
sativa]
Length=512

 Score =   311 bits (796),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 239/369 (65%), Gaps = 30/369 (8%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
             +KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SPT+     
Sbjct  124   SKLGSKWRELHGLNNWAGLLDPLDEDLRRELVRYGEFVQAAYHAFHSDPEGSPTH-----  178

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                       L    +KVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  179   --------VALQDVSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  230

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+     +    P V+ GF SLYT+
Sbjct  231   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDSSDPTRPKVECGFNSLYTT  290

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
             +S   PSL +S+ +EI++++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V 
Sbjct  291   SSQHGPSLAESLIEEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVA  350

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D   + G ++P G++
Sbjct  351   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFSDND--KNNGRSRPGGIM  408

Query  537   SWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
               +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP R
Sbjct  409   EMVER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFR  466

Query  366   ATAKRVIEK  340
             A AKR + K
Sbjct  467   ANAKRSLRK  475



>gb|KDO37674.1| hypothetical protein CISIN_1g039426mg, partial [Citrus sinensis]
Length=531

 Score =   311 bits (797),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 232/364 (64%), Gaps = 26/364 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G +DW GLLDPLD+ LR+E++RYG+FV+AAY SF  + A         DE 
Sbjct  143   LGSRWREYHGCKDWAGLLDPLDENLRREVVRYGEFVQAAYHSFHSNPAMSA------DEA  196

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    YKVT++LY T +V +P+W + V+P       +SSWIGYVAVCDD  EI
Sbjct  197   PQPRYVALSDRSYKVTKSLYATSSVGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDRREI  256

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGTAT  EW EN RA L  +P D   +     V+ GFLSLY +     
Sbjct  257   QRMGRRDIVIALRGTATCLEWAENFRAQLADMPHDKQSK-----VESGFLSLYNTRGAQV  311

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAAL+ + A DI+T     P V V SFG
Sbjct  312   PSLSESVLEEVRRLMELYKGETLSITVTGHSLGAALSLLVADDISTCAPSVPPVAVFSFG  371

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGN+ F ++++ +  KVLRIVN+ D IT+VPG  +  +DV++    +   ML+ +  
Sbjct  372   GPRVGNRGFANRVKANNVKVLRIVNNQDLITRVPGNFI-GEDVANENIKK---MLNVINN  427

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
               +S+W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  428   -EESEWAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASDCPFRANAKR  486

Query  351   VIEK  340
              + K
Sbjct  487   SLVK  490



>ref|XP_006477114.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Citrus 
sinensis]
Length=533

 Score =   311 bits (797),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 234/365 (64%), Gaps = 28/365 (8%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G +DW GLLDPLD+ LR+E++RYG+FV+AAY SF  + A          E+
Sbjct  145   LGSRWREYHGCKDWAGLLDPLDENLRREVVRYGEFVQAAYHSFHSNPAMSA-------EE  197

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             A   R   L    YKVT++LY T +V +P+W + V+P       +SSWIGYVAVCDD  E
Sbjct  198   APQPRYVALSDRSYKVTKSLYATSSVGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDRRE  257

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA  886
             I+R+GRRD+VIA RGTAT  EW EN RA L  +P D   +     V+ GFLSLY +    
Sbjct  258   IQRMGRRDIVIALRGTATCLEWAENFRAQLADMPHDKQSK-----VESGFLSLYNTRGAQ  312

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAAL+ + A DI+T     P V V SF
Sbjct  313   VPSLSESVLEEVRRLMELYKGETLSITVTGHSLGAALSLLVADDISTCAPSVPPVAVFSF  372

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQ  526
             GGPRVGN+ F ++++ +  KVLRIVN+ D IT+VPG  +  +DV++    +   ML+ + 
Sbjct  373   GGPRVGNRGFANRVKANNVKVLRIVNNQDLITRVPGNFI-GEDVANENIKK---MLNVIN  428

Query  525   KCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
                +S+W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AK
Sbjct  429   N-EESEWAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASDCPFRANAK  487

Query  354   RVIEK  340
             R + K
Sbjct  488   RSLVK  492



>ref|XP_006440208.1| hypothetical protein CICLE_v10019666mg [Citrus clementina]
 gb|ESR53448.1| hypothetical protein CICLE_v10019666mg [Citrus clementina]
Length=533

 Score =   311 bits (797),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 232/364 (64%), Gaps = 26/364 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G +DW GLLDPLD+ LR+E++RYG+FV+AAY SF  + A         DE 
Sbjct  145   LGSRWREYHGCKDWAGLLDPLDENLRREVVRYGEFVQAAYHSFHSNPAMSA------DEA  198

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    YKVT++LY T +V +P+W + V+P       +SSWIGYVAVCDD  EI
Sbjct  199   PQPRYVALSDRSYKVTKSLYATSSVGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDRREI  258

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGTAT  EW EN RA L  +P D   +     V+ GFLSLY +     
Sbjct  259   QRMGRRDIVIALRGTATCLEWAENFRAQLADMPHDKQSK-----VESGFLSLYNTRGAQV  313

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAAL+ + A DI+T     P V V SFG
Sbjct  314   PSLSESVLEEVRRLMELYKGETLSITVTGHSLGAALSLLVADDISTCAPSVPPVAVFSFG  373

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGN+ F ++++ +  KVLRIVN+ D IT+VPG  +  +DV++    +   ML+ +  
Sbjct  374   GPRVGNRGFANRVKANNVKVLRIVNNQDLITRVPGNFI-GEDVANENIKK---MLNVINN  429

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
               +S+W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  430   -EESEWAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASDCPFRANAKR  488

Query  351   VIEK  340
              + K
Sbjct  489   SLVK  492



>ref|XP_010449712.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Camelina 
sativa]
Length=512

 Score =   308 bits (789),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 240/369 (65%), Gaps = 30/369 (8%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
             +KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SPT+     
Sbjct  124   SKLGSKWKELHGLNNWAGLLDPLDEDLRRELVRYGEFVQAAYHAFHSDPQGSPTH-----  178

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                      GL    +KVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  179   --------VGLQDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  230

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+     +    P V+ GF SLYT+
Sbjct  231   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDSSDPTRPKVECGFNSLYTT  290

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
             +S   PSL +S+ +EI++++E Y  E LSI++TGHSLGAA+A + A DI  +   AP V 
Sbjct  291   SSQHGPSLAESLIEEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPLAPPVA  350

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D+  + G ++P  ++
Sbjct  351   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFSDNDN--NNGRSRPGSIM  408

Query  537   SWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
               +++  ++ W Y+ VG ELRV+ K S     + DVA CHDL+ YLH +D + +  CP R
Sbjct  409   EMVER--NNPWAYSHVGAELRVNMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFR  466

Query  366   ATAKRVIEK  340
             A AKR + K
Sbjct  467   ANAKRSLRK  475



>ref|XP_006282944.1| hypothetical protein CARUB_v10007507mg [Capsella rubella]
 gb|EOA15842.1| hypothetical protein CARUB_v10007507mg [Capsella rubella]
Length=518

 Score =   308 bits (788),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 237/373 (64%), Gaps = 32/373 (9%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
              KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SP +     
Sbjct  124   GKLGSKWRELHGLNNWAGLLDPLDEDLRRELVRYGEFVQAAYHAFHSDPEGSPKH-----  178

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                       L    +KVT+NLY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  179   --------VALQDGSFKVTKNLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  230

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+     +    P V+ GF SLYT+
Sbjct  231   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDSSDPTRPKVECGFNSLYTT  290

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
             +S   PSL +S+  EI++++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V 
Sbjct  291   SSQHGPSLAESLIGEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVA  350

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD----DVSDCGTTQP  550
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D    + S+ G ++ 
Sbjct  351   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFSDNDKQGQNRSNNGKSRQ  410

Query  549   SGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCK  379
              G++  +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  
Sbjct  411   GGIMEMVER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFIATN  468

Query  378   CPLRATAKRVIEK  340
             CP RA AKR + K
Sbjct  469   CPFRANAKRSLRK  481



>ref|XP_010104824.1| Phospholipase A1-Ibeta2 [Morus notabilis]
 gb|EXC02060.1| Phospholipase A1-Ibeta2 [Morus notabilis]
Length=529

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 230/369 (62%), Gaps = 27/369 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W +Y G  DW GLLDPLD+ LR+E++RYG+FV+AAYR F  + A+P       DE 
Sbjct  130   LGRRWRDYHGCSDWIGLLDPLDENLRREVVRYGEFVQAAYRCFHSNPATPA------DEP  183

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    YKVT++LY T +V +P+W + V+P       +SSWIGYVAVCDD+ EI
Sbjct  184   PFPRHVALPERSYKVTKSLYVTSSVGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDKREI  243

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLP-------DDMAPRNCEPMVQRGFLSLY  904
             +R+GRRD+VIA RGTAT  EW EN+RA L  +P       D++A  + +P V+ GFLSLY
Sbjct  244   QRMGRRDIVIALRGTATCLEWAENMRAQLIEMPGQDQDPADNLA--HGQPKVECGFLSLY  301

Query  903   TSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
              +     PSL +S+ +E+ +++E Y DE LSIT+TGHSLGAALA +   +++T     P 
Sbjct  302   KTRGAHVPSLAESVVEEVKRLMELYKDETLSITVTGHSLGAALALLVGDELSTCAEDVPP  361

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             V V SFGGPRVGN+ F  ++     KVLRIVNS D IT+VPG  +          T+  G
Sbjct  362   VAVFSFGGPRVGNRGFADRINAKNVKVLRIVNSQDVITRVPGTFLSEGLEEKLRNTKVGG  421

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
             ML  L++  +    Y+ VG ELRV +K S     + D+A CHDL+ YLH +D + S  CP
Sbjct  422   MLEMLEE--NMPLAYSHVGAELRVDTKMSPYLKPNADMACCHDLEAYLHLVDGFLSSNCP  479

Query  372   LRATAKRVI  346
              RA AKR +
Sbjct  480   FRANAKRSL  488



>ref|XP_002448976.1| hypothetical protein SORBIDRAFT_05g002750 [Sorghum bicolor]
 gb|EES07964.1| hypothetical protein SORBIDRAFT_05g002750 [Sorghum bicolor]
Length=412

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 227/369 (62%), Gaps = 44/369 (12%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             ++ SKW E QG RDW+GLL PLD  LR E++RYG+FV AAY SFDF+  +P+Y +CR+  
Sbjct  49    RIGSKWTELQGARDWDGLLSPLDGALRGELVRYGEFVRAAYASFDFEGGAPSYGSCRFPS  108

Query  1224  DAVMTRCGLGGSGYKVTRNLYG--TCAVNVPRW---TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +++ R G+ G+GY+VTR L+   +C  ++  W   ++     SS+IG+VAVCDDE EI 
Sbjct  109   RSLLRRAGMPGTGYRVTRLLHAASSCTASLRWWLPSSSPPPCGSSYIGFVAVCDDEREIE  168

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLP-----------DDMAPRNCEPMVQRGFL  913
             RLGRRDVV+A+RGTAT  EW++N ++ LT LP           DD      E MV+RGF 
Sbjct  169   RLGRRDVVVAFRGTATCGEWVDNFKSGLTRLPTIPTTMTGGGEDD----GEEAMVERGFW  224

Query  912   SLYTSASDAHPSLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITTQ  742
              L+T+  +AH SL+  +RDE  +I   YG     PLSIT+TGHSLGAALA +TA++I T 
Sbjct  225   RLFTAPGEAHSSLQQQVRDEARRIAHEYGGSGMPPLSITVTGHSLGAALAVLTAHEIATT  284

Query  741   FRH----------APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFV  592
              +           A +VT VSFGGPRVGN  FR ++E SG KVLR+VNSDD +TKVPGF 
Sbjct  285   QQQQQRQEDGEPAAMMVTAVSFGGPRVGNAAFRRRMEESGGKVLRVVNSDDIVTKVPGFP  344

Query  591   VDSDDVSDCGTTQPSGMLS-----WLQKCVDSQWVYAEVGKELRvsskdssyskdVATCH  427
             V   +  D G     GM+      WL       W YA+VG+ELR     +    +V   H
Sbjct  345   V--HEQGDGGDQPAKGMMKARLPRWL--VAKMGWAYADVGRELR--LSQAGSPPNVVASH  398

Query  426   DLKTYLHCI  400
             DL  YL  +
Sbjct  399   DLDLYLKLV  407



>gb|KDP39930.1| hypothetical protein JCGZ_03461 [Jatropha curcas]
Length=510

 Score =   305 bits (782),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 224/365 (61%), Gaps = 36/365 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW GLLDPLD+ LR+E++RYG+FV+AAY +F  + A  T       E 
Sbjct  131   LGSRWREYHGSNDWVGLLDPLDENLRREVVRYGEFVQAAYHAFHSNPAMST-------EA  183

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             A + R   L    YKVT++LY T +V +P+W + V+P       +SSW+GYVAVCDD+ E
Sbjct  184   APLPRHVALPDRSYKVTKSLYATSSVGLPKWVDEVAPDLGWMTQRSSWVGYVAVCDDKRE  243

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA  886
             I+R+GRRD+VIA RGTAT  EW EN+RA L  +P      + +P V+ GFLSLY ++ D 
Sbjct  244   IQRMGRRDIVIALRGTATCLEWAENMRAHLVDMPGSHESTHGQPKVECGFLSLYKTSGDH  303

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+  EI ++ E Y +E LSIT+TGHSLGAALA +   D+++     P V V SF
Sbjct  304   VPSLAESVVAEIKRLKEAYKEETLSITVTGHSLGAALALLVGDDLSSCASEMPPVAVFSF  363

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQ  526
             GGPRVGN+ F +Q+ +   KVLRIVNS D IT+VPG  V    V +     P        
Sbjct  364   GGPRVGNRGFANQINSKNVKVLRIVNSQDVITRVPGLPV----VEELNDNMP--------  411

Query  525   KCVDSQWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDNWSSCKCPLRATAK  355
                     Y+ VG ELRV +K S Y K  A    CHDL+ YLH +D + +  CP RA AK
Sbjct  412   ------LAYSHVGAELRVDTKMSPYLKPNADVSCCHDLEAYLHLVDGFRASNCPFRANAK  465

Query  354   RVIEK  340
             R + K
Sbjct  466   RSLVK  470



>ref|NP_567515.1| phospholipase A1-Ibeta2 [Arabidopsis thaliana]
 sp|O23522.2|PLA14_ARATH RecName: Full=Phospholipase A1-Ibeta2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE83808.1| phospholipase A1-Ibeta2 [Arabidopsis thaliana]
Length=517

 Score =   303 bits (777),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 170/371 (46%), Positives = 233/371 (63%), Gaps = 30/371 (8%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
             +KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SP +     
Sbjct  125   SKLGSKWRELHGLNNWAGLLDPLDENLRRELVRYGEFVQAAYHAFHSDPEGSPRH-----  179

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                       L    +KVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  180   --------VALPDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  231

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+    ++    P V+ GF SLYT+
Sbjct  232   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDQSDPTRPKVECGFNSLYTT  291

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                  PSL +S+  EI++++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V 
Sbjct  292   GDQHAPSLAESLVGEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVA  351

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD--VSDCGTTQPSG  544
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D    S      P G
Sbjct  352   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFADNDKQGQSRNNGRSPGG  411

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
             ++  +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP
Sbjct  412   IMEMVER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCP  469

Query  372   LRATAKRVIEK  340
              RA AKR + K
Sbjct  470   FRANAKRSLRK  480



>ref|XP_011047585.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Populus 
euphratica]
Length=514

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 166/364 (46%), Positives = 222/364 (61%), Gaps = 34/364 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW+GLLDPLD+ LR+E++RYG+FV+AAY +F  + A          + 
Sbjct  136   LGSRWREYHGSNDWDGLLDPLDENLRREVVRYGEFVQAAYHAFHSNPA------MSAGKP  189

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                 +  L    Y+VT++LYGT +V +P+W + V+P       +SSWIGYVAVC+D  EI
Sbjct  190   PSPQQVSLPDRSYRVTKSLYGTSSVGLPKWVDDVAPDLGWMTQQSSWIGYVAVCEDRREI  249

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGT+T  EW EN+RA L  +P D  P   +P V+ GFLSLY +     
Sbjct  250   QRMGRRDIVIALRGTSTCLEWAENMRAQLVEMPGDHDPTEIQPKVECGFLSLYKTCGANV  309

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA +   +++T     P + V SFG
Sbjct  310   PSLAESVVEEVKRLIEVYKGEDLSITVTGHSLGAALALLVGDELSTCAPQVPPIAVFSFG  369

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F +Q+     KVLRIVN+ D IT+VPG  +    V +     P         
Sbjct  370   GPRVGNKGFANQINAKKVKVLRIVNNQDLITRVPGIPM----VEELNDNMP---------  416

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                    YA VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  417   -----LAYAHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASNCPFRANAKR  471

Query  351   VIEK  340
              + K
Sbjct  472   SLVK  475



>ref|XP_006368966.1| hypothetical protein POPTR_0001s15300g [Populus trichocarpa]
 gb|ERP65535.1| hypothetical protein POPTR_0001s15300g [Populus trichocarpa]
Length=514

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 166/364 (46%), Positives = 224/364 (62%), Gaps = 34/364 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW+GLLDPLD+ LR+E++RYG+FV+AAY +F    ++P  +  +    
Sbjct  136   LGSRWREYHGSNDWDGLLDPLDENLRREVVRYGEFVQAAYHAFH---SNPAMSAGKPPSP  192

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                 +  L    Y+VT++LYGT +V +P+W + V+P       +SSWIGYVAVC+D  EI
Sbjct  193   ---QQVSLPDRSYRVTKSLYGTSSVGLPKWVDDVAPDLGWMTQQSSWIGYVAVCEDRREI  249

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGT+T  EW EN+RA L  +P D  P   +P V+ GFLSLY +     
Sbjct  250   QRMGRRDIVIALRGTSTCLEWAENMRAQLVEMPGDHDPTEIQPKVECGFLSLYKTCGANV  309

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA +   +++T     P + V SFG
Sbjct  310   PSLAESVVEEVKRLIELYKGEDLSITVTGHSLGAALALLVGDELSTCAPQVPPIAVFSFG  369

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F +Q+     KVLRIVN+ D IT+VPG  +    V +     P         
Sbjct  370   GPRVGNKGFANQINAKKVKVLRIVNNQDLITRVPGIPM----VEELNDNMP---------  416

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                    YA VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  417   -----LAYAHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASNCPFRANAKR  471

Query  351   VIEK  340
              + K
Sbjct  472   SLVK  475



>ref|XP_007039723.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY24224.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=527

 Score =   303 bits (776),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 229/373 (61%), Gaps = 22/373 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW GLLDPLD+ LR+E++RYG+FV+AAY  F  + A  T      DE 
Sbjct  135   LGSRWREYHGCNDWSGLLDPLDENLRREVVRYGEFVQAAYHGFHSNPAMST------DEA  188

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    YKVT++LY T +V +P+W + ++P       +SSWIG+VAVCDD+ EI
Sbjct  189   PLPRHVALPDRSYKVTKSLYATSSVGLPKWVDDMAPNLGWMTQRSSWIGFVAVCDDKREI  248

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGTAT  EW EN RA L  +P+   P      V+ GFLSL+ ++    
Sbjct  249   QRMGRRDIVIALRGTATCLEWAENFRAQLVQIPESRDPTQ---KVECGFLSLHKTSGAHV  305

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ ++IE Y  E LSITITGHSLGAAL+ + A ++++     P + V SFG
Sbjct  306   PSLAESVVEEVRRLIEMYQGETLSITITGHSLGAALSLLVADELSSCAPQVPPIAVFSFG  365

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F  +L +   KVLRIVN+ D IT+VPG  +             S + + L  
Sbjct  366   GPRVGNKGFVDRLNDKNVKVLRIVNNQDVITRVPGVFIGEGSQQQQRNESFSRVFNMLDN  425

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
               ++ W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + S  CP RA AKR
Sbjct  426   --NNPWAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFLSSNCPFRANAKR  483

Query  351   VIEK-NHGKRRRV  316
              + +  H +R  V
Sbjct  484   SLARLVHDQRSNV  496



>ref|XP_002870131.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46390.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 170/371 (46%), Positives = 232/371 (63%), Gaps = 30/371 (8%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
             +KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SP +     
Sbjct  124   SKLGSKWRELHGLNNWAGLLDPLDENLRRELVRYGEFVQAAYHAFHSDPEGSPRH-----  178

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                       L    +KVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  179   --------VALPDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  230

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+    ++    P V+ GF SLYT+
Sbjct  231   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDQSDPTRPKVECGFNSLYTT  290

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                  PSL +S+  EIT+++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V 
Sbjct  291   GGQHAPSLAESLVGEITRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVA  350

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT--QPSG  544
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D           P G
Sbjct  351   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFSDNDKHGQNRNNGRSPGG  410

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
             ++  +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP
Sbjct  411   IMEMVER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCP  468

Query  372   LRATAKRVIEK  340
              RA AKR + K
Sbjct  469   FRANAKRSLRK  479



>ref|XP_006414297.1| hypothetical protein EUTSA_v10027304mg [Eutrema salsugineum]
 gb|ESQ55750.1| hypothetical protein EUTSA_v10027304mg [Eutrema salsugineum]
Length=523

 Score =   301 bits (771),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 235/371 (63%), Gaps = 31/371 (8%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRYD  1228
             KL SKW E  G  +W GLLDPLD+ LR+E++RYG+FV+AAY++F  D   SP +      
Sbjct  130   KLGSKWRELHGSNNWAGLLDPLDENLRRELVRYGEFVQAAYQAFHSDPEGSPRH------  183

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDED  1069
                      L    YKVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD  
Sbjct  184   -------VALPDGSYKVTKSLYATSSVRLPKWIDEVAPDLRWMTKQTSWVGYVAVCDDPS  236

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSA  895
             EIRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+ 
Sbjct  237   EIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTG  296

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
             S   PSL +S+  EI+++++ Y  E LSI++TGHSLGAA+A + A DI  +  HAP V+V
Sbjct  297   SHQAPSLAESLIGEISRLVDLYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVSV  356

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS---DCGTTQPSG  544
              SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D      + G +Q   
Sbjct  357   FSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFSDNDKQGQNRNNGRSQGGI  416

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
             ++  ++K  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP
Sbjct  417   IMEMVEK--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCP  474

Query  372   LRATAKRVIEK  340
              RA AKR + K
Sbjct  475   FRANAKRSLRK  485



>ref|XP_003611369.1| Lipase [Medicago truncatula]
 gb|AES94327.1| glycerolipase A1 [Medicago truncatula]
Length=548

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 230/367 (63%), Gaps = 24/367 (7%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVM  1213
             KW EY G  DW+G+LDPLDD LR+E++RYGD V+AAY++F  D A  T     + + ++ 
Sbjct  138   KWREYHGSNDWKGMLDPLDDNLRREVVRYGDLVQAAYQAFHADPAMSTTEAPHHQQVSLP  197

Query  1212  TRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEIRRL  1054
              R       YKVT++LY T ++ +P+W + V+P       +SSW+GYVAVCDD+ EI R+
Sbjct  198   ER------SYKVTKSLYATSSIGLPKWVDEVAPDLGWMTQRSSWVGYVAVCDDKREIARM  251

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDD-----MAPRNCEPMVQRGFLSLYTSASD  889
             GRRD+VI+ RGT+T  EW EN+RA L  LP+D           +P V+ GF+SLY +   
Sbjct  252   GRRDIVISLRGTSTCLEWAENMRAQLVDLPEDAQTQTQTQTQSKPKVECGFMSLYKTKGA  311

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
                SL +S+ +E+ ++IE Y  E LSIT+TGHSLGA LA + A +I+T   + P V V S
Sbjct  312   HVQSLSESVVEEVRRLIELYKGEELSITVTGHSLGATLALLVAEEISTCAPNVPPVAVFS  371

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ-PSGMLSW  532
             FGGPRVGN+ F   LE    KVLRIVN+ D IT+VPG  +  +       ++  SG++  
Sbjct  372   FGGPRVGNRAFGEHLEKKNVKVLRIVNTQDVITRVPGIFLSEELEEKIKNSKVVSGVVDM  431

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
             L++  ++   Y+ VG ELRV++K S       D+A CHDL+ YLH +D + +  CP RA 
Sbjct  432   LEE--NTPLGYSHVGTELRVNTKMSPYLKPDADIACCHDLEAYLHLVDGYMASNCPFRAN  489

Query  360   AKRVIEK  340
             AKR + +
Sbjct  490   AKRSLAR  496



>ref|XP_010647255.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Vitis vinifera]
Length=528

 Score =   301 bits (770),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 226/366 (62%), Gaps = 21/366 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G +DW G+LDPLD+ LR+E++RYG+FV+AAY SF  + A         +E 
Sbjct  133   LGGRWREYHGSKDWSGMLDPLDENLRREVVRYGEFVQAAYHSFHSNPA------MSAEEP  186

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    Y+VT++LY T +V +P W + V+P       +SSW+GYVAVC+D  EI
Sbjct  187   PLPRHVTLPDRAYRVTKSLYATSSVGLPDWVDDVAPDLGWMTQRSSWMGYVAVCEDRREI  246

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLP--DDMAPRNCEPMVQRGFLSLYTSASD  889
              R+GRRD+VIA RGTAT  EW EN+R  L  +P  DD      +P V+ GFLSLY +   
Sbjct  247   ARMGRRDIVIALRGTATCLEWAENMRDLLVQIPGEDDSVQGQGQPKVECGFLSLYKTRGA  306

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
               PSL +S+  EI +++E Y  E LSIT+TGHSLGAALA + A +++T     P + V S
Sbjct  307   HVPSLAESVVQEIQRLMEVYKGETLSITVTGHSLGAALAVLVADELSTCDFEVPPLAVFS  366

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGN+ F ++++ +  KVLRIVNS D IT+VPG  V  +       T+  G+L+ L
Sbjct  367   FGGPRVGNRGFANRIKQNNVKVLRIVNSQDVITRVPGMFVSEELDQKLRNTKMGGVLNVL  426

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
              K     W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +   P RA A
Sbjct  427   DKM---PWAYSHVGTELRVDTKQSPYLKPNADVACCHDLEAYLHLVDGFLASNSPFRANA  483

Query  357   KRVIEK  340
             KR + K
Sbjct  484   KRSLLK  489



>emb|CAB10455.1| triacylglycerol lipase like protein [Arabidopsis thaliana]
 emb|CAB80953.1| triacylglycerol lipase like protein [Arabidopsis thaliana]
Length=601

 Score =   303 bits (775),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 244/400 (61%), Gaps = 35/400 (9%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRY  1231
             +KL SKW E  G+ +W GLLDPLD+ LR+E++RYG+FV+AAY +F  D   SP +     
Sbjct  125   SKLGSKWRELHGLNNWAGLLDPLDENLRRELVRYGEFVQAAYHAFHSDPEGSPRH-----  179

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDE  1072
                       L    +KVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD 
Sbjct  180   --------VALPDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDP  231

Query  1071  DEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTS  898
              EIRR+GRR++VIA RGTAT  EW EN R  L  +P+    ++    P V+ GF SLYT+
Sbjct  232   REIRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDQSDPTRPKVECGFNSLYTT  291

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                  PSL +S+  EI++++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V 
Sbjct  292   GDQHAPSLAESLVGEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVA  351

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD--VSDCGTTQPSG  544
             V SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D    S      P G
Sbjct  352   VFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFADNDKQGQSRNNGRSPGG  411

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
             ++  +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP
Sbjct  412   IMEMVER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCP  469

Query  372   LRATAKRVIEKNHGKRRRVLA*PQIKLLRIGARGSDEQTF  253
              RA AKR + K   ++R       +K+L  G      +TF
Sbjct  470   FRANAKRSLRKLLDEQRS-----NVKVLYTGKSLRLNRTF  504



>emb|CAN77244.1| hypothetical protein VITISV_035465 [Vitis vinifera]
Length=579

 Score =   301 bits (770),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 226/366 (62%), Gaps = 21/366 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G +DW G+LDPLD+ LR+E++RYG+FV+AAY SF  + A         +E 
Sbjct  184   LGGRWREYHGSKDWSGMLDPLDENLRREVVRYGEFVQAAYHSFHSNPA------MSAEEP  237

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    Y+VT++LY T +V +P W + V+P       +SSW+GYVAVC+D  EI
Sbjct  238   PLPRHVTLPDRAYRVTKSLYATSSVGLPDWVDDVAPDLGWMTQRSSWMGYVAVCEDRREI  297

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLP--DDMAPRNCEPMVQRGFLSLYTSASD  889
              R+GRRD+VIA RGTAT  EW EN+R  L  +P  DD      +P V+ GFLSLY +   
Sbjct  298   ARMGRRDIVIALRGTATCLEWAENMRDLLVQIPGEDDSVQGQGQPKVECGFLSLYKTRGA  357

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
               PSL +S+  EI +++E Y  E LSIT+TGHSLGAALA + A +++T     P + V S
Sbjct  358   HVPSLAESVVQEIQRLMEVYKGETLSITVTGHSLGAALAVLVADELSTCDFEVPPLAVFS  417

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGN+ F ++++ +  KVLRIVNS D IT+VPG  V  +       T+  G+L+ L
Sbjct  418   FGGPRVGNRGFANRIKQNNVKVLRIVNSQDVITRVPGMFVSEELDQKLRNTKMGGVLNVL  477

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
              K     W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +   P RA A
Sbjct  478   DKM---PWAYSHVGTELRVDTKQSPYLKPNADVACCHDLEAYLHLVDGFLASNSPFRANA  534

Query  357   KRVIEK  340
             KR + K
Sbjct  535   KRSLLK  540



>ref|XP_004245812.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Solanum 
lycopersicum]
Length=552

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 235/378 (62%), Gaps = 20/378 (5%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   L S+W EY G +DW GLLDPLD+ LR+E++RYG+F++AAY  F  D 
Sbjct  136   SSKSMEYSPRN-NLGSRWKEYHGCKDWLGLLDPLDENLRRELVRYGEFIQAAYHCFHSDP  194

Query  1260  ASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSS  1105
             A+        +E+A + R   L    YKVT++LY T ++ +P+W + V+P       +SS
Sbjct  195   ATSA------NENAHVARDVSLPDRSYKVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSS  248

Query  1104  WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQ  925
             WIGYVAVCDD+ EI+R+GRRD+VIA RGTAT  EW ENLR  L  +P +    + +P V+
Sbjct  249   WIGYVAVCDDKTEIQRMGRRDIVIALRGTATCLEWGENLRDVLVQMPGENELVDAQPKVE  308

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +     PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA + A DI+T
Sbjct  309   CGFLSLYKTGGAKIPSLAESVINEVKRLIEMYKGESLSITVTGHSLGAALALLVADDIST  368

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                 AP V V SFGGPRVGNK F ++LE+   KVLRIVN  D ITKVPG  V        
Sbjct  369   CSPDAPPVAVFSFGGPRVGNKGFANRLESKNVKVLRIVNKQDVITKVPGMFVSEAIDKKL  428

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDN  394
               T  SG+L+ L   +   W Y+ VG ELRV +  S       DVA CHDL+ YLH +D 
Sbjct  429   RDTGASGVLNLLDNSM--PWAYSHVGTELRVDTTKSPFLKPDADVACCHDLEAYLHLVDG  486

Query  393   WSSCKCPLRATAKRVIEK  340
             +       R  AKR +EK
Sbjct  487   YLGSNESFRPNAKRSLEK  504



>ref|XP_004241988.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Solanum 
lycopersicum]
Length=518

 Score =   298 bits (764),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 235/383 (61%), Gaps = 19/383 (5%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   L ++W EY G  +W GLLDPLD+ LR+E++RYG+F+++AY  F  D 
Sbjct  110   SSKSMEYSPRN-NLANRWREYHGSNNWLGLLDPLDENLRRELVRYGEFIQSAYHCFHTDP  168

Query  1260  ASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSW  1102
             A+        DE        L    YKVT++LY T ++ +P+W + V+P       +SSW
Sbjct  169   ATSA------DEVLPERHVALPDRSYKVTKSLYATSSIGLPKWVDDVAPDLRWMTQRSSW  222

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQR  922
             IGYVAVCDD  EI+R+GRRD+VIA RGTAT  EW EN R  L    D+      +  V+ 
Sbjct  223   IGYVAVCDDRSEIQRMGRRDIVIALRGTATCLEWAENFRDLLVEQNDNNDEGVVQSKVEC  282

Query  921   GFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQ  742
             GFLSLY ++    PSL +S+ +E+ ++IE Y  EPLSIT+TGHSLGAAL+ + A D++T 
Sbjct  283   GFLSLYKTSDHRVPSLAESVVNEVQRLIEKYKGEPLSITVTGHSLGAALSLLVADDLSTC  342

Query  741   FRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
               +AP V V SFGGPRVGN+ F  +L ++  KVLRIVN+ D IT+VPG  V S+ +    
Sbjct  343   VPNAPPVAVFSFGGPRVGNRGFADRLNDNNVKVLRIVNNQDVITRVPGMFV-SESLDKKL  401

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNW  391
                 +G +  +  C    W Y+ VG E RV +K S     + DVA CHDL+ YLH +D +
Sbjct  402   RESGAGRVLEMLDC-RMPWAYSHVGTEFRVDTKMSPFLKPNADVACCHDLEAYLHLVDGF  460

Query  390   SSCKCPLRATAKRVIEKNHGKRR  322
             ++  CP R  AKR + +   ++R
Sbjct  461   TASNCPFRPNAKRSLVRLLNEQR  483



>ref|XP_009136810.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Brassica rapa]
Length=510

 Score =   298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 227/367 (62%), Gaps = 26/367 (7%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL SKW E  G  +W GLLDPLD+ LR+E++RYG+FV+AAY+ F              D 
Sbjct  121   KLGSKWRELHGSNNWAGLLDPLDEDLRRELVRYGEFVQAAYQGF------------HSDP  168

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    YKVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD  E
Sbjct  169   EGSPRDVALPDGSYKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDPKE  228

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+ S
Sbjct  229   IRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTGS  288

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL DS+  EI+++++ Y  E LSI++TGHSLGAA+A + A DI  +  HAP V+V 
Sbjct  289   QHAPSLADSLVAEISRLVDLYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPVSVF  348

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D           G+   
Sbjct  349   SFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFADNDKNKQGQNRNNGGIREM  408

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
             +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP R  
Sbjct  409   VER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRTN  466

Query  360   AKRVIEK  340
             AKR + K
Sbjct  467   AKRSLRK  473



>ref|XP_011031953.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Populus euphratica]
Length=519

 Score =   296 bits (759),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/362 (45%), Positives = 219/362 (60%), Gaps = 34/362 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G  DW+GLLDPLD+ LR+E++RYG+FV+A+Y +F    ++P  +  +    
Sbjct  141   LGPRWREYHGSNDWKGLLDPLDENLRREVVRYGEFVQASYHAFH---SNPAMSAAK---P  194

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +  +  L    Y+VTR+LY T +V +P+W + V+P       +SSWIGYVAVC+D  EI
Sbjct  195   PLPQQVALPDRSYRVTRSLYATSSVGLPKWVDDVAPDLGWMTQRSSWIGYVAVCEDRREI  254

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +RLGRRD+VIA RGT+T  EW EN+RA L   P +  P   +P V+ GFLSLY +     
Sbjct  255   QRLGRRDIVIALRGTSTCLEWAENMRAQLVETPGEHDPTEIQPKVECGFLSLYKTGGANV  314

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL  S+  E+ +++E Y  E LSIT+TGHSLGAALA +   +++T     P + V SFG
Sbjct  315   PSLSQSVVQEVRRLMELYRGETLSITVTGHSLGAALALLVGDELSTCAPQVPPIAVFSFG  374

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F +Q+     KVLRIVNS D IT+VPG  +    V +     P         
Sbjct  375   GPRVGNKGFANQINAKNVKVLRIVNSQDVITRVPGIPM----VEELNDNMP---------  421

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                    YA VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  422   -----LAYAHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFIASNCPFRANAKR  476

Query  351   VI  346
              +
Sbjct  477   SL  478



>ref|XP_006359231.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Solanum 
tuberosum]
Length=550

 Score =   297 bits (761),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 178/377 (47%), Positives = 231/377 (61%), Gaps = 18/377 (5%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   L S+W EY G +DW GLLDPLD+ LR+E++RYG+F++AAY  F  D 
Sbjct  136   SSKSMEYSPRN-NLGSRWKEYHGCKDWLGLLDPLDENLRRELVRYGEFIQAAYHCFHSDP  194

Query  1260  ASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSW  1102
             A     T   D   V     L    YKVT++LY T ++ +P+W + V+P       +SSW
Sbjct  195   A-----TSANDNAHVARDVSLPDRSYKVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSW  249

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQR  922
             IGYVAVCDD+ EI+R+GRRD+VIA RGTAT  EW ENLR  L  +P +    + +P V+ 
Sbjct  250   IGYVAVCDDKAEIQRMGRRDIVIALRGTATCLEWGENLRDVLVQMPGENELVDTQPKVEC  309

Query  921   GFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQ  742
             GFLSLY +     PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A DI+T 
Sbjct  310   GFLSLYKTGGAKIPSLAESVVNEVKRLVEMYKGESLSITVTGHSLGAALALLVADDISTC  369

Query  741   FRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
               +AP V V SFGGPRVGNK F ++LE+   KVLRIVN  D ITKVPG  V         
Sbjct  370   SPNAPPVAVFSFGGPRVGNKGFVNRLESKNVKVLRIVNKQDVITKVPGMFVSEAIDKKLR  429

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNW  391
              T  SG+L+ L   +   W Y+ VG ELRV +  S       DVA CHDL+ YLH +D +
Sbjct  430   DTGASGVLNLLDNSM--PWAYSHVGTELRVDTTKSPFLKPDADVACCHDLEAYLHLVDGY  487

Query  390   SSCKCPLRATAKRVIEK  340
                    R  AKR + K
Sbjct  488   LGSNESFRPNAKRSLAK  504



>ref|XP_002532349.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF30022.1| triacylglycerol lipase, putative [Ricinus communis]
Length=526

 Score =   296 bits (757),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 167/364 (46%), Positives = 218/364 (60%), Gaps = 34/364 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  +WEGLLDPLD+ LR+E++RYG++V+AAY SF  + A  T       E 
Sbjct  147   LGSRWREYHGSNNWEGLLDPLDENLRREVVRYGEYVQAAYHSFHSNPAMST------QEP  200

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVS-------PKSSWIGYVAVCDDEDEI  1063
              +     L    YKVT++LY T +V +P+W + V+        +SSW+GYVAVCDD+ EI
Sbjct  201   PLPRHVALPDRSYKVTKSLYATTSVGLPKWVDDVASDLGWMTQRSSWVGYVAVCDDKREI  260

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGTAT  EW EN+RA L  +P D      +P V+ GFLSLY +     
Sbjct  261   QRMGRRDIVIALRGTATCLEWAENMRAHLVGMPGDHEQTQGQPKVECGFLSLYKTRGAHV  320

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
              SL +S  +EI +++E Y  E LSITITGHSLGAALA +   D++T     P + V SFG
Sbjct  321   ASLAESAVEEIKRLMEVYKGEALSITITGHSLGAALALLVGDDLSTIASEMPPIAVFSFG  380

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GP+VGN+ F +Q+     KVLRIVNS D IT+VP   V    V D     P         
Sbjct  381   GPKVGNRGFANQINAKNVKVLRIVNSQDVITRVPCLPV----VEDLHEDMP---------  427

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                    Y+ VG ELR+ SK S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  428   -----LAYSHVGVELRIDSKMSPYLKPNADVACCHDLEAYLHLVDGFMASNCPFRANAKR  482

Query  351   VIEK  340
              + K
Sbjct  483   SLVK  486



>ref|XP_004511725.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Cicer 
arietinum]
Length=551

 Score =   296 bits (758),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 230/377 (61%), Gaps = 31/377 (8%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW+G+LDPLDD LR+E++RYGD V+AAY++F  D A  +    ++   
Sbjct  141   LGSRWKEYHGSNDWKGMLDPLDDNLRREVVRYGDLVQAAYQAFHADPAMSSTEPPQHHHV  200

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
             A+  R       YKVT++LY T ++ +P+W + V+P        SSW+GYVAVCDD  EI
Sbjct  201   ALPER------SYKVTKSLYATSSIGLPKWIDDVAPDLGWMTQHSSWVGYVAVCDDRREI  254

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDM------------APRNCEPMVQRG  919
              R+GRRD+VI+ RGT+T  EW EN+RA L  LP D             A    +P V+ G
Sbjct  255   ARMGRRDIVISLRGTSTCLEWAENMRAQLIDLPVDNNNNNNNENSEARAQTQGKPKVECG  314

Query  918   FLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF  739
             F+SLY +     PSL +S+ +E+ +++E Y  E LSITITGHSLGA LA + A +I+T  
Sbjct  315   FMSLYKTRGAHVPSLSESVVEEVKRLMELYKGEELSITITGHSLGATLALLVAEEISTCG  374

Query  738   RHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGT  559
              + P V V SFGGPRVGNK F   L     KVLRIVN+ D IT+VPG  +  +       
Sbjct  375   PNVPPVAVFSFGGPRVGNKAFGEHLTQKKVKVLRIVNTQDVITRVPGIFLSEELEEKIKN  434

Query  558   TQ-PSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNW  391
             ++  SG++  L++  ++   Y+ VG ELRV++K S       D+A CHDL+ YLH +D +
Sbjct  435   SKVVSGVVDMLEE--NTPLGYSHVGTELRVNTKMSPYLKPDADIACCHDLEAYLHLVDGF  492

Query  390   SSCKCPLRATAKRVIEK  340
              +  CP RA AKR + +
Sbjct  493   IASNCPFRANAKRSLAR  509



>ref|XP_002303372.1| hypothetical protein POPTR_0003s07940g [Populus trichocarpa]
 gb|EEE78351.1| hypothetical protein POPTR_0003s07940g [Populus trichocarpa]
Length=519

 Score =   295 bits (755),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/362 (45%), Positives = 220/362 (61%), Gaps = 34/362 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G  DW+GLLDPLD+ LR+E++RYG+FV+A+Y +F    ++P  +  +    
Sbjct  141   LGPRWREYHGSNDWKGLLDPLDENLRREVVRYGEFVQASYHAFH---SNPAMSAAK---P  194

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +  +  L    Y+VT++LY T +V +P+W + ++P       +SSWIGYVAVC+D  EI
Sbjct  195   PLPQQVTLPDRSYRVTKSLYATSSVGLPKWVDDLAPDLGWMTQRSSWIGYVAVCEDRREI  254

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +RLGRRD+VIA RGT+T  EW EN+RA L   P +  P   +P V+ GFLSLY +A    
Sbjct  255   QRLGRRDIVIALRGTSTCLEWAENMRAQLVETPGEHDPTEIQPKVECGFLSLYKTAGANV  314

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL  S+  E+ +++E Y  E LSIT+TGHSLGAALA +   +++T     P V V SFG
Sbjct  315   PSLSQSVVQEVRRLMELYRGETLSITVTGHSLGAALALLVGDELSTCAPQVPPVAVFSFG  374

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F +Q+     KVLRIVNS D IT+VPG  +    V +     P         
Sbjct  375   GPRVGNKGFANQINAKNVKVLRIVNSQDVITRVPGIPM----VEELNDNMP---------  421

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                    YA VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  422   -----LAYAHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFIASNCPFRANAKR  476

Query  351   VI  346
              +
Sbjct  477   SL  478



>emb|CDP08362.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   295 bits (754),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/365 (47%), Positives = 230/365 (63%), Gaps = 19/365 (5%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW GLLDPLD+ LR+E++RYG+FV+AAY  F  + A         DE 
Sbjct  137   LGSRWREYHGCNDWAGLLDPLDENLRREVVRYGEFVQAAYHCFHSNPA------MSADEA  190

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    Y+VT++LY T ++ +P+W + V+P       +SSWIGYVAVCDD  EI
Sbjct  191   PSQRNVALPDRSYRVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDRREI  250

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRD+VIA RGTAT  EW EN+R  L  +P +   ++ +P V+ GF SLY +     
Sbjct  251   QRMGRRDIVIALRGTATCLEWAENMRDVLVQMPGENGSKDGQPKVECGFSSLYQTRGAHV  310

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL  S+ +EI ++IE Y  E LSIT+TGHSLGAALA + A +++T   + P V VVSFG
Sbjct  311   PSLAQSVVEEIQRLIEQYRGETLSITVTGHSLGAALALLVANELSTCAPNVPPVAVVSFG  370

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG-FVVDSDDVSDCGTTQPSGMLSWLQ  526
             GPRVGN+ F  Q+  +  KVLR+VN+ D ITKVPG FV ++ D     +   +G+L+ L 
Sbjct  371   GPRVGNRGFADQITENNVKVLRVVNNQDVITKVPGMFVSETLDKKLRESGAAAGVLNALD  430

Query  525   KCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
               +   W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP R+ AK
Sbjct  431   SSMP--WAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRSNAK  488

Query  354   RVIEK  340
             R + K
Sbjct  489   RSLVK  493



>gb|KFK22257.1| phospholipase a1- chloroplastic-like [Arabis alpina]
Length=507

 Score =   294 bits (752),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/387 (44%), Positives = 238/387 (61%), Gaps = 33/387 (9%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL SKW E  G  +W GLLDPLD+ LR+E++RYG+FV+AAY +F              D 
Sbjct  119   KLGSKWRELHGSNNWVGLLDPLDENLRRELVRYGEFVQAAYHAF------------HSDP  166

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    YKVT++LY T +V +P+W + ++P       ++SW+GYVAVCDD  E
Sbjct  167   EGSPRDVALPDGSYKVTKSLYATSSVRLPKWIDDMAPDLKWMTKQTSWVGYVAVCDDATE  226

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN--CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L C+P+    ++    P V+ GF SLYT+ S
Sbjct  227   IRRMGRREIVIALRGTATLLEWSENFRPNLVCMPEPKPEKSDPTRPKVECGFNSLYTTCS  286

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                 SL  S+ +EI ++++ Y  E LSI++TGHSLGAA+A + A DI T+  +AP V+V 
Sbjct  287   QHGTSLAGSLIEEIKRLVDLYAGEELSISVTGHSLGAAIALLAADDIATRVNYAPPVSVF  346

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L++   KVLR+VNS D +TKVPG    SD+ ++ G     G++  
Sbjct  347   SFGGPRVGNREFADRLDSKEVKVLRVVNSQDVVTKVPGIF--SDNKNNQGQKSQGGIMEM  404

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
             +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP R  
Sbjct  405   VER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRTN  462

Query  360   AKRVIEKNHGKRRRVLA*PQIKLLRIG  280
             AKR + K   ++R     P +K L  G
Sbjct  463   AKRSLRKLLDEQR-----PNVKALYTG  484



>ref|XP_007208875.1| hypothetical protein PRUPE_ppa026090mg [Prunus persica]
 gb|EMJ10074.1| hypothetical protein PRUPE_ppa026090mg [Prunus persica]
Length=549

 Score =   294 bits (753),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/364 (44%), Positives = 223/364 (61%), Gaps = 21/364 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L ++W EY G  +W GLLDPLD  LR+E++RYG+F++AAY SF  + A          E+
Sbjct  152   LGTRWREYHGSNNWAGLLDPLDQNLRREVVRYGEFIQAAYHSFHSNPAMSA-------EE  204

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             A + R   L    YKVT++LY T ++ +P W + V+P       +SSWIGYVAVCDD+ E
Sbjct  205   AQLPRHVALPDRSYKVTKSLYATSSIGLPDWVDDVAPDLGWMTQRSSWIGYVAVCDDKRE  264

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA  886
             I R+GRRD+VIA RGT+T  EW ENLRA L  +P        +  V+ GFLSLY +  + 
Sbjct  265   ISRMGRRDIVIALRGTSTCLEWAENLRAQLIQMPSTEGGEQAQAKVECGFLSLYKTGGEH  324

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAA+A +   ++ T     P V V SF
Sbjct  325   VPSLSESVVEEVKRLMEQYKGETLSITVTGHSLGAAIALLVGDELKTCAEEMPSVAVFSF  384

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWL  529
             GGPRVGN+ F  ++++   KVLRIVNS D IT+VPG  +    + +   + +  G +  +
Sbjct  385   GGPRVGNRGFTKRMDDKNVKVLRIVNSQDVITRVPGIFIGEGVLEEKLKSAKVGGFVDMI  444

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
              +  +    Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP R  A
Sbjct  445   DR--NMPLAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRENA  502

Query  357   KRVI  346
             KR +
Sbjct  503   KRSL  506



>ref|XP_006367468.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Solanum 
tuberosum]
Length=521

 Score =   293 bits (750),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 235/386 (61%), Gaps = 22/386 (6%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   L ++W EY G  +W GLLDPLD+ LR+E++RYG+F+++AY  F  D 
Sbjct  110   SSKSIEYSPRN-NLANRWREYHGSNNWLGLLDPLDENLRRELVRYGEFIQSAYHCFHSDP  168

Query  1260  ASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSW  1102
             A+        DE        L    YKVT++LY T ++ +P+W + V+P       +SSW
Sbjct  169   ATSA------DEVPSERHVALPDRSYKVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSW  222

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRN---CEPM  931
             IGYVAVCDD  EI+R+GRRD+VIA RGTAT  EW EN R  L    D+    +    +  
Sbjct  223   IGYVAVCDDRSEIQRMGRRDIVIALRGTATCLEWAENFRDLLVEQNDNDDDNDEGVVQSK  282

Query  930   VQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI  751
             V+ GFLSLY +     PSL +S+ +E+ ++IE Y  EPLSIT+TGHSLGAAL+ + A D+
Sbjct  283   VECGFLSLYKTGDHRVPSLAESVVNEVQRLIEKYKGEPLSITVTGHSLGAALSLLVADDL  342

Query  750   TTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS  571
             +T   +AP V V SFGGPRVGN+ F  +L ++  KVLRIVN+ D IT+VPG  V S+ + 
Sbjct  343   STCVPNAPPVAVFSFGGPRVGNRGFADRLNDNNVKVLRIVNNQDVITRVPGMFV-SESLD  401

Query  570   DCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCI  400
                    +G L  +  C    W Y+ VG E RV +K S     + DVA CHDL+ YLH +
Sbjct  402   KKLRESGAGRLLEMLDC-RMPWAYSHVGTEFRVDTKMSPFLKPNADVACCHDLEAYLHLV  460

Query  399   DNWSSCKCPLRATAKRVIEKNHGKRR  322
             D +++  CP R  AKR + +   ++R
Sbjct  461   DGFTASNCPFRPNAKRSLVRLLNEQR  486



>ref|XP_008238400.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Prunus mume]
Length=548

 Score =   293 bits (751),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 223/364 (61%), Gaps = 21/364 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L ++W EY G  +W GLLDPLD  LR+E++RYG+F++AAY SF  + A          E+
Sbjct  152   LGTRWREYHGSNNWAGLLDPLDQNLRREVVRYGEFIQAAYHSFHSNPAMSA-------EE  204

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             A + R   L    YKVT++LY T ++ +P W + V+P       +SSWIGYVAVCDD+ E
Sbjct  205   AQLPRHVALPDRSYKVTKSLYATSSIGLPDWVDDVAPDLGWMTQRSSWIGYVAVCDDKRE  264

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA  886
             I R+GRRD+VIA RGT+T  EW EN+RA L  +P        +  V+ GFLSLY +  + 
Sbjct  265   ISRMGRRDIVIALRGTSTCLEWAENMRAQLIQMPSTEGGEQAQAKVECGFLSLYKTGGEH  324

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAA+A +   ++ T     P V V SF
Sbjct  325   VPSLSESVVEEVKRLMEQYKGETLSITVTGHSLGAAIALLVGDELKTCAEEMPSVAVFSF  384

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWL  529
             GGPRVGN+ F  ++++   KVLRIVNS D IT+VPG  +    + +   + +  G +  +
Sbjct  385   GGPRVGNRGFTKRMDDKNVKVLRIVNSQDVITRVPGIFIGEGVLEEKLKSAKVGGFVDMI  444

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
              +  +    Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP R  A
Sbjct  445   DR--NMPLAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRENA  502

Query  357   KRVI  346
             KR +
Sbjct  503   KRSL  506



>ref|XP_009145395.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Brassica rapa]
Length=512

 Score =   292 bits (747),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 230/367 (63%), Gaps = 28/367 (8%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL S W E  G  +W GLLDPLD+ LR+EI+RYG+FV+A+Y +F              D 
Sbjct  125   KLGSNWRELHGSNNWAGLLDPLDENLRREIVRYGEFVQASYHAF------------HSDP  172

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    +KVT++LY T +V +P+W + V+P        +SW+GYVAVCDD  E
Sbjct  173   EGSPRDIALPDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKPTSWVGYVAVCDDPRE  232

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+AS
Sbjct  233   IRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTAS  292

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL +S+  EI+++++ Y  E LSI++TGHSLGAA+A + A DI  +  +AP V+V 
Sbjct  293   QQAPSLAESLVGEISRLVDLYAGEELSISVTGHSLGAAIALLAAGDIAERVPNAPPVSVF  352

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L + G KVLR+VNS D +TKVPG   D D+ S  G  Q + ++  
Sbjct  353   SFGGPRVGNREFADRLVSKGVKVLRVVNSQDVVTKVPGIFSDKDNNSKKG--QQNRIMEM  410

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
             +++  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP RA 
Sbjct  411   VER--NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRAN  468

Query  360   AKRVIEK  340
             AKR + K
Sbjct  469   AKRSLRK  475



>ref|XP_009343932.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=547

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 231/403 (57%), Gaps = 32/403 (8%)
 Frame = -3

Query  1482  LKNTKSWTTLGNAASSKCLVAADRAAKLCSK-------------WMEYQGIRDWEGLLDP  1342
             L  ++ WT +  AA        +R  +L SK             W EY G  +W GLLDP
Sbjct  103   LNLSRLWTQVKGAAEDMSPRHLNRLQRLLSKTGEYSPRNNLSTRWREYHGSNNWAGLLDP  162

Query  1341  LDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLY  1162
             LD+ LR+E++RYG+F++AAY SF  + A         +E  V  +  L    YKVT++LY
Sbjct  163   LDENLRREVVRYGEFIQAAYHSFHSNPAMSA------EEAQVPRQVALPDRSYKVTKSLY  216

Query  1161  GTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPE  1003
              T ++ +P W +   P       +SSW+GYVAVCDD+ EI R+GRRD+VIA RGT+T  E
Sbjct  217   ATSSIGLPDWVDEARPDLGWMTQRSSWVGYVAVCDDKREIARMGRRDIVIALRGTSTCLE  276

Query  1002  WLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGD  823
             W ENLRA L  +P        +  V+ GFLSLY +     PSL +S+ +E+ +++E Y  
Sbjct  277   WAENLRAQLIQMPSTEEGEQRQARVECGFLSLYKTRGAHVPSLAESVVEEVRRLMEQYKG  336

Query  822   EPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKV  643
             E LSIT+TGHSLGAALA +   ++ T   + P V V SFGGPRVGN+ F  ++++   KV
Sbjct  337   ETLSITVTGHSLGAALALLVGDELKTCAENMPSVAVFSFGGPRVGNRGFTKRMDDKNVKV  396

Query  642   LRIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvss  466
             LRIVNS D IT+VPG  V    + +     +  G +  + +  +    Y+ VG ELRV +
Sbjct  397   LRIVNSQDVITRVPGIFVGEGVLEEKLKNAKAGGFIDMIDR--NMPLAYSHVGTELRVDT  454

Query  465   kds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
             K S     + DVA CHDL+ YLH +D + +  CP R  AKR +
Sbjct  455   KMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRENAKRSL  497



>ref|XP_003517405.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Glycine 
max]
Length=524

 Score =   290 bits (742),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 158/366 (43%), Positives = 225/366 (61%), Gaps = 24/366 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G  DW+G+LDPLD+ LR+E++RYG+FV+AAY++F  D A  T      +E 
Sbjct  131   LGGRWREYHGSNDWKGMLDPLDENLRREVVRYGEFVQAAYQAFHSDPAMST------EEP  184

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    Y++T++LY T ++ +P+W + V+P       +SSW+GYVAVC+D  EI
Sbjct  185   PHTQHVALPDRSYRMTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSWVGYVAVCEDRREI  244

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE--PMVQRGFLSLYTSASD  889
              R+GRRD+VI+ RGT+T  EW ENLRA +  +PD+ +    +  P V+ GF+SLY +   
Sbjct  245   TRMGRRDIVISLRGTSTCLEWAENLRAHMIDMPDNDSSEEAQGKPKVECGFMSLYKTKGA  304

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
               PSL +S+ +E+ ++I+ Y  E LSI++ GHSLGA LA + A +I+T     P V V S
Sbjct  305   QVPSLAESVVEEVRRLIDLYKGEELSISVIGHSLGATLALLVAEEISTCCPQVPPVAVFS  364

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGNK F  +L     KVLRIVNS D IT+VPG  V S+++         G+L   
Sbjct  365   FGGPRVGNKAFGDRLAAKNVKVLRIVNSQDVITRVPGIFV-SEELEQKIRNVGGGVLEE-  422

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
                 ++   Y+ VG ELRV +K S       D+A CHDL+ YLH +D + +  CP R+ A
Sbjct  423   ----NTPLAYSHVGTELRVHTKMSPYLKPDADMACCHDLEAYLHLVDGFLASNCPFRSNA  478

Query  357   KRVIEK  340
             KR + +
Sbjct  479   KRSLAR  484



>ref|XP_007156578.1| hypothetical protein PHAVU_002G000600g [Phaseolus vulgaris]
 gb|ESW28572.1| hypothetical protein PHAVU_002G000600g [Phaseolus vulgaris]
Length=522

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/364 (45%), Positives = 222/364 (61%), Gaps = 26/364 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G  DW+G+LDPLD+ LR+E++RYG+FV+AAY++F  D A  T      +E 
Sbjct  135   LGGRWREYHGSNDWKGMLDPLDENLRREVVRYGEFVQAAYQAFHSDPAMST------EEP  188

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    Y+VT++LY T ++ +P+W + V+P       +SSW+GYVAVC+D  EI
Sbjct  189   PHPRHVALPDRSYRVTKSLYATSSIGLPKWVDDVAPDLGWMSQRSSWVGYVAVCEDRREI  248

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              R+GRRD+VI+ RGT+T  EW ENLRA L  LP        +P V+ GF+SLY +     
Sbjct  249   ARMGRRDIVISLRGTSTCMEWAENLRAQLVDLPGGQG----KPKVECGFMSLYKTKGAHV  304

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
              SL +S+ +E+ +++  Y DE LSIT+TGHSLGA LA + A +I+T     P V V SFG
Sbjct  305   ASLSESVVEEVKRLVNLYRDEELSITVTGHSLGATLALLVADEISTCCAGVPPVAVFSFG  364

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F  +L     KVLRIVNS D IT+VPG  V S+++         G+L     
Sbjct  365   GPRVGNKAFGERLTAKNVKVLRIVNSQDVITRVPGIFV-SEELEQKIRNVGGGVLEE---  420

Query  522   CVDSQWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                +   Y+ VG ELRV +K S Y K    +A CHDL+ YLH +D + +  CP RA AKR
Sbjct  421   --KTPLAYSHVGTELRVHTKMSPYLKPDADMACCHDLEAYLHLVDGFLASNCPFRANAKR  478

Query  351   VIEK  340
              + +
Sbjct  479   SLAR  482



>gb|EYU19471.1| hypothetical protein MIMGU_mgv1a004169mg [Erythranthe guttata]
Length=541

 Score =   289 bits (739),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 166/385 (43%), Positives = 232/385 (60%), Gaps = 34/385 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW GLLDPLD+ LR+E++R+G+F++AAY  F  + A+ T       E+
Sbjct  133   LGSRWREYHGSDDWAGLLDPLDENLRREVVRFGEFIQAAYHCFHSNPATST-------EE  185

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             A   R   L    Y+VT++LY T ++ +P+W + V+P       +SSW+GYVAVCDD  E
Sbjct  186   AQWPRHVALPDRSYRVTKSLYATASIGLPKWVDDVAPDLGWMTQRSSWVGYVAVCDDSTE  245

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC--------------EPMV  928
             I+R+GRRD+VIA RGTAT  EW EN+R  L  + D+    N               +P V
Sbjct  246   IQRMGRRDIVIALRGTATCLEWAENVRDVLVPISDEYNNNNNNPKKNGGIESTDGQQPKV  305

Query  927   QRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT  748
             + GFLSL+ +  +  PSL +S+ +EI +++E Y  E LSITITGHSLGAALA +   +++
Sbjct  306   ECGFLSLFKTRGEHVPSLAESVVEEIQRLMEKYKGEALSITITGHSLGAALALLIGDELS  365

Query  747   TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD  568
             T     P V V SFGGPRVGN+ F ++++++  KVLRIVNS D +T+VPG  V  +    
Sbjct  366   TCAPDVPPVAVFSFGGPRVGNRGFANRIQSNKVKVLRIVNSQDLVTRVPGMFVSEELDKK  425

Query  567   CGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHCID  397
                     +L+ L    +  W YA VG ELRV +K S + K    VA CHDL+ YLH +D
Sbjct  426   LRENGARKLLNALDN--NMPWAYAHVGTELRVDTKMSPFLKPDADVACCHDLEAYLHLVD  483

Query  396   NWSSCKCPLRATAKRVIEKNHGKRR  322
              + +  CP R  AKR + K   ++R
Sbjct  484   GFLASNCPFRPNAKRSLWKLLNEQR  508



>ref|XP_009606132.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=547

 Score =   289 bits (739),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 229/382 (60%), Gaps = 18/382 (5%)
 Frame = -3

Query  1455  LGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRS  1276
             L    SSK +  + R   L S+W EY G +DW GL+DPLD+ LR+E++RYG+F++AAY  
Sbjct  126   LHRMLSSKSMEYSPRN-NLGSRWREYHGCKDWLGLVDPLDENLRRELVRYGEFIQAAYHC  184

Query  1275  FDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP------  1114
             F  D A     T   +   V     L    YKVT++LY T +V +P+W + V+P      
Sbjct  185   FHSDPA-----TSEKENPDVARNVSLPDRSYKVTKSLYATSSVGLPKWVDDVAPDLGWMT  239

Query  1113  -KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE  937
              +SSWIGYVAVCDD+ EI+R+GRRD+VIA RGTAT  EW EN R  L  +P +      +
Sbjct  240   QRSSWIGYVAVCDDKAEIQRMGRRDIVIALRGTATCLEWGENFRDVLVQMPGENDSVEGQ  299

Query  936   PMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAY  757
             P V+ GFLSLY +  +  PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA + A 
Sbjct  300   PKVECGFLSLYQTGGNKIPSLAESVVNEVKRLIEMYKGETLSITVTGHSLGAALALLVAD  359

Query  756   DITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD  577
             DI+T    +P V V +FGGPRVGNK F ++LE+   KVLRIVN  D ITKVPG  V    
Sbjct  360   DISTCTPDSPPVAVFTFGGPRVGNKGFANRLESKNVKVLRIVNKQDVITKVPGMFVSEAL  419

Query  576   VSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLH  406
                      +G+L+ L   +   W Y+ VG ELRV +  S       DVA CHDL+ YLH
Sbjct  420   DKKLREKGAAGVLNLLDNSM--PWAYSHVGTELRVDTTKSPFLKPDADVACCHDLEAYLH  477

Query  405   CIDNWSSCKCPLRATAKRVIEK  340
              +D +       R  AKR + K
Sbjct  478   LVDGYLGSNESFRPNAKRSLVK  499



>ref|XP_008369207.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Malus 
domestica]
Length=543

 Score =   289 bits (739),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 231/402 (57%), Gaps = 35/402 (9%)
 Frame = -3

Query  1473  TKSWTTLGNAASSKCLVAADRAAKLCSK-------------WMEYQGIRDWEGLLDPLDD  1333
             ++ WT +  AA         R  +L SK             W EY G  +W GLLDPLD+
Sbjct  110   SRLWTQVKGAAEDMSPRHLKRLQRLLSKTGEYSPRNNFGTRWXEYHGSNNWAGLLDPLDE  169

Query  1332  YLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGT  1156
              LR+E++RYG+F++AAY SF  + A          E+A + R   L    YKVT++LY T
Sbjct  170   NLRREVVRYGEFIQAAYZSFHSNPAMSA-------EEAXLPRNVALPDRSYKVTKSLYAT  222

Query  1155  CAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWL  997
              ++ +P W + V P       +SSW+GYVAVCDD+ EI R+GRRD+VIA RGT+T  EW 
Sbjct  223   SSIGLPDWVDEVRPDLSWMTQRSSWVGYVAVCDDKREIARMGRRDIVIALRGTSTCLEWA  282

Query  996   ENLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDE  820
             ENLRA L  +P  +   +  +  V+ GFLSLY +     PSL +S+ +E+ +++E Y  E
Sbjct  283   ENLRAQLIQMPSTEQGQQEGQAKVECGFLSLYKTRGAHVPSLAESVVEEVKRLMEQYKGE  342

Query  819   PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVL  640
              LSIT+TGHSLGAALA +   ++ T   + P V V SFGGPRVGN+ F  ++++   KVL
Sbjct  343   TLSITVTGHSLGAALALLVGDELKTCAXNMPSVAVFSFGGPRVGNRGFTKRMDDKDVKVL  402

Query  639   RIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvssk  463
             RIVNS D IT+VPG  V    + +     +  G +  + +  +    Y  VG ELRV +K
Sbjct  403   RIVNSQDVITRVPGIFVGEGVLEEKLKNAKAGGFIDMIDR--NMPLAYTHVGTELRVDTK  460

Query  462   ds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              S       DVA CHDL+ YLH +D + +  CP R  AKR +
Sbjct  461   MSPYLKPDADVACCHDLEAYLHLVDGFLASNCPFRENAKRSL  502



>ref|XP_008369208.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Malus 
domestica]
Length=542

 Score =   288 bits (738),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 231/402 (57%), Gaps = 35/402 (9%)
 Frame = -3

Query  1473  TKSWTTLGNAASSKCLVAADRAAKLCSK-------------WMEYQGIRDWEGLLDPLDD  1333
             ++ WT +  AA         R  +L SK             W EY G  +W GLLDPLD+
Sbjct  109   SRLWTQVKGAAEDMSPRHLKRLQRLLSKTGEYSPRNNFGTRWXEYHGSNNWAGLLDPLDE  168

Query  1332  YLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGT  1156
              LR+E++RYG+F++AAY SF  + A          E+A + R   L    YKVT++LY T
Sbjct  169   NLRREVVRYGEFIQAAYZSFHSNPAMSA-------EEAXLPRNVALPDRSYKVTKSLYAT  221

Query  1155  CAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWL  997
              ++ +P W + V P       +SSW+GYVAVCDD+ EI R+GRRD+VIA RGT+T  EW 
Sbjct  222   SSIGLPDWVDEVRPDLSWMTQRSSWVGYVAVCDDKREIARMGRRDIVIALRGTSTCLEWA  281

Query  996   ENLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDE  820
             ENLRA L  +P  +   +  +  V+ GFLSLY +     PSL +S+ +E+ +++E Y  E
Sbjct  282   ENLRAQLIQMPSTEQGQQEGQAKVECGFLSLYKTRGAHVPSLAESVVEEVKRLMEQYKGE  341

Query  819   PLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVL  640
              LSIT+TGHSLGAALA +   ++ T   + P V V SFGGPRVGN+ F  ++++   KVL
Sbjct  342   TLSITVTGHSLGAALALLVGDELKTCAENMPSVAVFSFGGPRVGNRGFTKRMDDKDVKVL  401

Query  639   RIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvssk  463
             RIVNS D IT+VPG  V    + +     +  G +  + +  +    Y  VG ELRV +K
Sbjct  402   RIVNSQDVITRVPGIFVGEGVLEEKLKNAKAGGFIDMIDR--NMPLAYTHVGTELRVDTK  459

Query  462   ds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
              S       DVA CHDL+ YLH +D + +  CP R  AKR +
Sbjct  460   MSPYLKPDADVACCHDLEAYLHLVDGFLASNCPFRENAKRSL  501



>ref|XP_011081332.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Sesamum indicum]
Length=533

 Score =   288 bits (736),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 160/368 (43%), Positives = 225/368 (61%), Gaps = 24/368 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  +W GLLDPLD+ LR+E++R+G+F++AAY  F  + A+        +E 
Sbjct  133   LGSRWREYHGSNEWVGLLDPLDENLRREVVRFGEFIQAAYHCFHSNPAT------SMEET  186

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    Y+VT++LY T ++ +P+W + V+P       +SSWIGYVAVCDD  EI
Sbjct  187   QWPRHVALPDRSYRVTKSLYATASIGLPKWVDEVAPDLGWMTQRSSWIGYVAVCDDRREI  246

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDD------MAPRNCEPMVQRGFLSLYT  901
             +R+GRRD+VIA RGTAT  EW EN+R  L  L D+      +  +  +P V+ GFLSL+ 
Sbjct  247   QRMGRRDIVIALRGTATCLEWAENVRDLLVPLSDENEKSKEIDGQVLQPKVECGFLSLFK  306

Query  900   SASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLV  721
             +     PSL +S+ +E+ +++E Y  E LSITITGHSLGAALA +   +++T     P +
Sbjct  307   TRGTHVPSLAESVVEEVKRLMEKYKGETLSITITGHSLGAALALLVGDELSTCAPDVPPL  366

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM  541
              V SFGGPRVGN++F ++L ++  KVLRIVNS D IT+VPG  V  +       T    +
Sbjct  367   AVFSFGGPRVGNRSFANRLNSNNVKVLRIVNSQDVITRVPGMFVSEELDKKLRETGAGKL  426

Query  540   LSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             L+ L    +  W YA VG ELR+ +K S     + DVA CHDL+ YLH +D + +   P 
Sbjct  427   LNTLDN--NMPWAYAHVGTELRIDTKMSPFLKPNADVACCHDLEAYLHLVDGFLASNSPF  484

Query  369   RATAKRVI  346
             R  AKR +
Sbjct  485   RPNAKRSL  492



>ref|XP_004148351.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004166200.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60475.1| hypothetical protein Csa_3G914060 [Cucumis sativus]
Length=501

 Score =   286 bits (733),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 224/374 (60%), Gaps = 48/374 (13%)
 Frame = -3

Query  1437  SKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-T  1261
             SK +  + R A L  +W EY G  DW GLLDPLD+ LR+E++RYG+FV+AAY +F  + T
Sbjct  124   SKTVEYSPRNA-LGQRWREYHGCNDWSGLLDPLDENLRREVVRYGEFVQAAYHAFHSNPT  182

Query  1260  ASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSW  1102
              SP       +E  +     L    YKVT++LY T +V +P W + V+P       +SSW
Sbjct  183   TSP-------NEPPLPRHVALPDRSYKVTKSLYATSSVGLPGWIDEVAPDLGWMTQRSSW  235

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC-EPMVQ  925
             +GYVAVCDD  EI R+GRRD+VIA RGTAT  EW EN+RA LT +P D+  ++  +P V+
Sbjct  236   VGYVAVCDDRREIARMGRRDIVIALRGTATCLEWAENVRAQLTNVPADVDTKDGGDPKVE  295

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +A     SL +S+ +EI ++ E Y  E LSIT+TGHSLGAALA + A +I+ 
Sbjct  296   CGFLSLYKTAGAHVKSLSESVVEEIRRLTELYKGETLSITVTGHSLGAALAILVADEISV  355

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                  P V V SFGGPRVGNK F  ++++   KVLRIVNS D IT+VP            
Sbjct  356   CSAEVPPVAVFSFGGPRVGNKIFADRIKSRNVKVLRIVNSQDLITQVP------------  403

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDN  394
                 P+ M             Y+ VG ELRV +K S + K  A    CHDL+ YLH +D 
Sbjct  404   ----PNPM------------TYSHVGTELRVETKMSPFLKPNADIACCHDLEAYLHLVDG  447

Query  393   WSSCKCPLRATAKR  352
             + S KCP R  AKR
Sbjct  448   FMSSKCPFRPNAKR  461



>ref|XP_009772200.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   286 bits (733),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 172/376 (46%), Positives = 231/376 (61%), Gaps = 22/376 (6%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   +CS+W EY G  +W GLLDPLD+ LR+E++RYG+F++AAY  F  + 
Sbjct  96    SSKSMQYSPRN-NICSRWKEYHGSNNWLGLLDPLDENLRRELVRYGEFIQAAYHCFHSNP  154

Query  1260  ASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSS  1105
             A+        +E  +  R   L    YKVT+NLY T ++ +P W + V+P       +SS
Sbjct  155   ATSA------EEGPLSARHVALPDRSYKVTKNLYATSSIGLPTWVDDVAPDLGWMTQRSS  208

Query  1104  WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQ  925
             WIGYVAVC+D +EI+R+GRRD+VIA RGTAT  EW EN RA L    DD+A    +  V+
Sbjct  209   WIGYVAVCEDRNEIQRMGRRDIVIALRGTATCLEWAENFRALLVEQNDDLAKEQSK--VE  266

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +  +  PSL +S+ +E+ ++IE Y  EPLSIT+TGHSLGAALA + A D++T
Sbjct  267   CGFLSLYKTGGEHVPSLAESVVNEVQRLIEQYKGEPLSITVTGHSLGAALALLVADDVST  326

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                +AP V V SFGGPRVGN+ F  +L  +  KVLRIVN+ D IT+VPG  V  +     
Sbjct  327   CAPNAPPVAVFSFGGPRVGNRVFADRLNANNVKVLRIVNNQDVITRVPGMFVSEELDKKL  386

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDN  394
               +    ML  L       W Y+ VG E RV ++ S       DVA CHDL+ YLH +D 
Sbjct  387   RKSGAGRMLEMLD--CRMPWAYSHVGTEFRVDTRMSPFLKPDADVACCHDLEAYLHLVDG  444

Query  393   WSSCKCPLRATAKRVI  346
             + +  CP R  AKR +
Sbjct  445   FLASDCPFRPNAKRSL  460



>ref|XP_009368157.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Ibeta2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=543

 Score =   288 bits (736),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 221/364 (61%), Gaps = 20/364 (5%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W E+ G  +W GLLDPLD+ LR+E++RYG+F++AAY+SF  + A         +E 
Sbjct  147   LGSRWREFHGSNNWAGLLDPLDENLRREVVRYGEFIQAAYQSFHXNPA------MSAEEV  200

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    YKVT++LY T ++ +P W + V P       +SSW+GYVAVCDD+ EI
Sbjct  201   QLPRNVALPDRSYKVTKSLYATSSIGLPDWVDEVRPDLSWMTQRSSWVGYVAVCDDKGEI  260

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDA  886
              R+GRRD+VIA RGT+T  EW ENLRA L  +P  +   +  +  V+ GFLSLY +    
Sbjct  261   ARMGRRDIVIALRGTSTCLEWAENLRAQLIQMPSTEQGQQERQAKVECGFLSLYKTRGAD  320

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA +   ++ T   + P V V SF
Sbjct  321   VPSLAESVVEEVKRLMEQYKGETLSITVTGHSLGAALALLVGDELKTCAENMPSVAVFSF  380

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWL  529
             GGPRVGN+ F  ++++   KVLRIVNS D IT+VPG  V    + +     +  G +  +
Sbjct  381   GGPRVGNRGFTKRMDDKDVKVLRIVNSQDVITRVPGIFVGEGALEEKLKNAKAGGFIDMI  440

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
              +  +    Y  VG ELRV +K S       DVA CHDL+ YLH +D + +  CP R  A
Sbjct  441   DR--NMPLAYTHVGTELRVDTKMSPYLKPDADVACCHDLEAYLHLVDGFLASNCPFRENA  498

Query  357   KRVI  346
             KR +
Sbjct  499   KRSL  502



>ref|XP_008465868.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Cucumis melo]
Length=541

 Score =   288 bits (736),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 224/374 (60%), Gaps = 48/374 (13%)
 Frame = -3

Query  1437  SKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-T  1261
             SK +  + R A L  +W EY G  DW GLLDPLD+ LR+E++RYG+FV+AAY +F  + T
Sbjct  164   SKTVEYSPRNA-LGQRWREYHGCNDWSGLLDPLDENLRREVVRYGEFVQAAYHAFHSNPT  222

Query  1260  ASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSW  1102
              SP       +E  +     L    YKVT++LY T +V +P W + V+P       +SSW
Sbjct  223   TSP-------NEPPLPRHVTLPDRSYKVTKSLYATSSVGLPGWIDEVAPDLGWMTQRSSW  275

Query  1101  IGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC-EPMVQ  925
             +GYVAVCDD  EI R+GRRD+VIA RGTAT  EW EN+RA L  +P D+  ++C +P V+
Sbjct  276   VGYVAVCDDRREIARMGRRDIVIALRGTATCLEWAENVRAQLIDIPADVDTKDCGDPKVE  335

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +A     SL +S+ +EI ++ E Y  E LSIT+TGHSLGAALA + A +I+ 
Sbjct  336   CGFLSLYKTAGAHVRSLSESVVEEIRRLTEMYKGETLSITVTGHSLGAALAILVADEISV  395

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                  P V V SFGGPRVGNK F  ++++   KVLRIVNS D IT+VP            
Sbjct  396   CSAEVPPVAVFSFGGPRVGNKMFADRIKSRNVKVLRIVNSQDVITQVP------------  443

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDN  394
                 P+ M             Y+ VG ELRV +K S + K  A    CHDL+ YLH +D 
Sbjct  444   ----PNPM------------TYSHVGTELRVETKMSPFLKPNADIACCHDLEAYLHLVDG  487

Query  393   WSSCKCPLRATAKR  352
             + S KCP R  AKR
Sbjct  488   FMSSKCPFRPNAKR  501



>ref|XP_009772191.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic isoform X1 
[Nicotiana sylvestris]
Length=533

 Score =   287 bits (734),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/376 (46%), Positives = 231/376 (61%), Gaps = 22/376 (6%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   +CS+W EY G  +W GLLDPLD+ LR+E++RYG+F++AAY  F  + 
Sbjct  126   SSKSMQYSPRN-NICSRWKEYHGSNNWLGLLDPLDENLRRELVRYGEFIQAAYHCFHSNP  184

Query  1260  ASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSS  1105
             A+        +E  +  R   L    YKVT+NLY T ++ +P W + V+P       +SS
Sbjct  185   ATSA------EEGPLSARHVALPDRSYKVTKNLYATSSIGLPTWVDDVAPDLGWMTQRSS  238

Query  1104  WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQ  925
             WIGYVAVC+D +EI+R+GRRD+VIA RGTAT  EW EN RA L    DD+A    +  V+
Sbjct  239   WIGYVAVCEDRNEIQRMGRRDIVIALRGTATCLEWAENFRALLVEQNDDLAKEQSK--VE  296

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +  +  PSL +S+ +E+ ++IE Y  EPLSIT+TGHSLGAALA + A D++T
Sbjct  297   CGFLSLYKTGGEHVPSLAESVVNEVQRLIEQYKGEPLSITVTGHSLGAALALLVADDVST  356

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                +AP V V SFGGPRVGN+ F  +L  +  KVLRIVN+ D IT+VPG  V  +     
Sbjct  357   CAPNAPPVAVFSFGGPRVGNRVFADRLNANNVKVLRIVNNQDVITRVPGMFVSEELDKKL  416

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDN  394
               +    ML  L       W Y+ VG E RV ++ S       DVA CHDL+ YLH +D 
Sbjct  417   RKSGAGRMLEMLD--CRMPWAYSHVGTEFRVDTRMSPFLKPDADVACCHDLEAYLHLVDG  474

Query  393   WSSCKCPLRATAKRVI  346
             + +  CP R  AKR +
Sbjct  475   FLASDCPFRPNAKRSL  490



>emb|CBI29538.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   286 bits (732),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 161/366 (44%), Positives = 217/366 (59%), Gaps = 44/366 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G +DW G+LDPLD+ LR+E++RYG+FV+AAY SF  + A         +E 
Sbjct  133   LGGRWREYHGSKDWSGMLDPLDENLRREVVRYGEFVQAAYHSFHSNPA------MSAEEP  186

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    Y+VT++LY T +V +P W + V+P       +SSW+GYVAVC+D  EI
Sbjct  187   PLPRHVTLPDRAYRVTKSLYATSSVGLPDWVDDVAPDLGWMTQRSSWMGYVAVCEDRREI  246

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLP--DDMAPRNCEPMVQRGFLSLYTSASD  889
              R+GRRD+VIA RGTAT  EW EN+R  L  +P  DD      +P V+ GFLSLY +   
Sbjct  247   ARMGRRDIVIALRGTATCLEWAENMRDLLVQIPGEDDSVQGQGQPKVECGFLSLYKTRGA  306

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
               PSL +S+  EI +++E Y  E LSIT+TGHSLGAALA + A +++T     P + V S
Sbjct  307   HVPSLAESVVQEIQRLMEVYKGETLSITVTGHSLGAALAVLVADELSTCDFEVPPLAVFS  366

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGN+ F ++++ +  KVLRIVNS D IT+VPG  +                    
Sbjct  367   FGGPRVGNRGFANRIKQNNVKVLRIVNSQDVITRVPGMFMP-------------------  407

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
                    W Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +   P RA A
Sbjct  408   -------WAYSHVGTELRVDTKQSPYLKPNADVACCHDLEAYLHLVDGFLASNSPFRANA  460

Query  357   KRVIEK  340
             KR + K
Sbjct  461   KRSLLK  466



>ref|XP_008373668.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Malus 
domestica]
 ref|XP_008385154.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Malus 
domestica]
Length=552

 Score =   286 bits (732),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 163/401 (41%), Positives = 232/401 (58%), Gaps = 33/401 (8%)
 Frame = -3

Query  1473  TKSWTTLGNAASSKCLVAADRAAKLCSK-------------WMEYQGIRDWEGLLDPLDD  1333
             ++ WT +  AA        +R  +L SK             W EY G  +W GLLDPLD+
Sbjct  110   SRLWTQVKGAAEDMSPRHLNRLQRLLSKTGEYSPRNNLSTRWREYHGSNNWAGLLDPLDE  169

Query  1332  YLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTC  1153
              LR+E++RYG+F++AAY SF  + A         +E  +  +  L    YKVT++LY T 
Sbjct  170   NLRREVVRYGEFIQAAYHSFHSNPAMSA------EEAQLPRQVALPDRSYKVTKSLYATS  223

Query  1152  AVNVPRWTNL-------VSPKSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLE  994
             ++ +P W +        ++ +SSW+GYVAVCDD+ EI R+GRRD+VIA RGT+T  EW E
Sbjct  224   SIGLPDWVDEARXDLSWMTQRSSWVGYVAVCDDKREIARMGRRDIVIALRGTSTCLEWAE  283

Query  993   NLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEP  817
             NLRA L  +P  +   +     V+ GFLSLY +     PSL +S+ +E+ +++E Y  E 
Sbjct  284   NLRAQLIQMPSTEEGHQQSGARVECGFLSLYKTRGAHVPSLAESVVEEVNRLMEQYKGET  343

Query  816   LSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLR  637
             LSIT+TGHSLGAALA +   ++ T   + P V V SFGGPRVGN+ F  ++++   KVLR
Sbjct  344   LSITVTGHSLGAALALLVGDELKTCAENMPSVAVFSFGGPRVGNRGFTKRMDDKNVKVLR  403

Query  636   IVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskd  460
             IVNS D IT+VPG  V    + +     +  G +  + +  +    Y+ VG ELRV +K 
Sbjct  404   IVNSQDVITRVPGIFVGEGVLEEKLKNAKAGGFIDMIDR--NMPLAYSHVGTELRVDTKM  461

Query  459   s---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVI  346
             S     + DVA CHDL+ YLH +D + +  CP R  AKR +
Sbjct  462   SPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRENAKRSL  502



>ref|XP_004300344.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=541

 Score =   286 bits (731),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 162/363 (45%), Positives = 218/363 (60%), Gaps = 21/363 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  +W GLLDPLD+ LR+E++RYG+F++AAY+SF  + A         +E 
Sbjct  148   LVSRWREYHGSNNWAGLLDPLDENLRREVVRYGEFIQAAYQSFHNNPA------MSLEET  201

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    YKVT++LY T A+ +P W + V+P       +SSWIGYVAVCDD  EI
Sbjct  202   QMPRNVALPDRSYKVTKSLYATSAIGLPDWVDDVAPDLGWMTQRSSWIGYVAVCDDRREI  261

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDA  886
              R+GRRD+VIA RGT+T  EW EN+RA L  +P  +      +  V+ GF SLY +    
Sbjct  262   ARMGRRDIVIALRGTSTCLEWAENMRAQLIQIPPTEEGGEEAQAKVECGFQSLYKTPGVH  321

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL  S+ +EI ++ E Y  E LSIT+TGHSLGAA+A +   ++ T     P V V SF
Sbjct  322   VPSLSQSVVEEIKRLKELYKGEELSITVTGHSLGAAIALLVGDELKTCAEDMPPVAVFSF  381

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQ  526
             GGPRVGN+ F +++E    KVLRIVNS D IT+VPG  V    + +    + S +   L 
Sbjct  382   GGPRVGNRGFANRMEAKNVKVLRIVNSQDLITRVPGIFVGEGVLEE--KLKNSKIADLLD  439

Query  525   KCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
             K +     Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP R  AK
Sbjct  440   KKMP--LAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASNCPFRKNAK  497

Query  354   RVI  346
             R +
Sbjct  498   RSL  500



>ref|XP_004253384.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Solanum 
lycopersicum]
Length=537

 Score =   285 bits (729),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 235/375 (63%), Gaps = 25/375 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G +DW GL+DPL++ LR+E++RYG+F++AAY  F  + A     TC    +
Sbjct  138   LGSRWKEYHGCKDWLGLIDPLNENLRRELIRYGEFIQAAYHCFHSNPA-----TC---NE  189

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                 +  L    YKVT++LY T ++ +P+W + V+P       +SSWIGYVAVCDD  EI
Sbjct  190   CDTRKVALPDKSYKVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDRSEI  249

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC----EPMVQRGFLSLYTSA  895
             +R+GRRD+VIA RGTAT  EW EN R  L  +P  +   +     +  V+ GFLSL+ +A
Sbjct  250   KRMGRRDIVIALRGTATCLEWGENFRDLLVQIPTKIESESESSEGQAKVECGFLSLFQTA  309

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
                 PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA + A +++T    +P V V
Sbjct  310   GVNVPSLAESVVNEVQRLIEQYKGESLSITVTGHSLGAALALLVADEVSTCTPDSPPVAV  369

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG-FVVDSDDVSDCGTTQPSGML  538
              SFGGPRVGN++F  +L +   KVLRIVN+ D IT+VPG FV +  D     +   SGML
Sbjct  370   FSFGGPRVGNRSFADRLNSRNVKVLRIVNNQDVITRVPGMFVSEELDKKLRESGFVSGML  429

Query  537   SWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
             + L K +   W YA VG ELRV ++ S       DVA CHDL+ YLH +D + +  CP R
Sbjct  430   NVLDKSMP--WAYAHVGTELRVDTRMSPFLKPDADVACCHDLEAYLHLVDGYIASNCPFR  487

Query  366   ATAKRVIEKNHGKRR  322
             A AKR + K   ++R
Sbjct  488   ANAKRSLAKLLSEQR  502



>ref|XP_009773480.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Nicotiana 
sylvestris]
Length=545

 Score =   285 bits (730),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 172/382 (45%), Positives = 228/382 (60%), Gaps = 18/382 (5%)
 Frame = -3

Query  1455  LGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRS  1276
             L    SSK +  + R   L S+W EY G +DW  L+DPLD+ LR+E++RYG+F++AAY  
Sbjct  124   LHRMLSSKSMEYSPRN-NLGSRWREYHGCKDWLELIDPLDENLRRELVRYGEFIQAAYHC  182

Query  1275  FDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP------  1114
             F  D A     T   +   V     L    YKVT++LY T +V +P+W + V+P      
Sbjct  183   FHSDPA-----TSDKENPDVARNVSLPDRSYKVTKSLYATSSVGLPKWVDDVAPDLGWMT  237

Query  1113  -KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE  937
              +SSWIGYVAVCDD+ EI+R+GRRD+VIA RGTAT  EW EN R  L  +P +      +
Sbjct  238   QRSSWIGYVAVCDDKAEIQRMGRRDIVIALRGTATCLEWGENFRDVLVQMPGENDSVEGQ  297

Query  936   PMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAY  757
             P V+ GFLSLY +  +  PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A 
Sbjct  298   PKVECGFLSLYQTGGNKIPSLAESVVNEVKRLVEMYKGESLSITVTGHSLGAALALLVAD  357

Query  756   DITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD  577
             DI+T    +P V V +FGGPRVGNK F ++LE+   KVLRIVN  D ITKVPG  V    
Sbjct  358   DISTCTPDSPPVAVFTFGGPRVGNKGFANRLESKNVKVLRIVNKQDVITKVPGMFVSEAL  417

Query  576   VSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLH  406
                      +G+L+ L   +   W Y+ VG ELRV +  S       DVA CHDL+ YLH
Sbjct  418   DKKLREKGAAGVLNLLDNSM--PWAYSHVGTELRVDTTKSPFLKPDADVACCHDLEAYLH  475

Query  405   CIDNWSSCKCPLRATAKRVIEK  340
              +D +       R  AKR + K
Sbjct  476   LVDGYLGSNESFRPNAKRSLVK  497



>ref|XP_009368221.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=543

 Score =   285 bits (729),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 220/364 (60%), Gaps = 20/364 (5%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W E+ G  +W GLLDPLD+ LR+E++RYG+ ++AAY+SF  + A         +E 
Sbjct  147   LGSRWREFHGSNNWAGLLDPLDENLRREVVRYGEVIQAAYQSFHSNPA------MSAEEV  200

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    YKVT++LY T ++ +P W + V P       +SSW+GYVAVCDD+ EI
Sbjct  201   QLPRNVALPDRSYKVTKSLYATSSIGLPDWVDEVRPDLSWMTQRSSWVGYVAVCDDKGEI  260

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDA  886
              R+GRRD+VIA RGT+T  EW ENLRA L  +P  +   +  +  V+ GFLSLY +    
Sbjct  261   ARMGRRDIVIALRGTSTCLEWAENLRAQLIQMPSTEQGQQERQAKVECGFLSLYKTRGAD  320

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA +   ++ T   + P V V SF
Sbjct  321   VPSLAESVVEEVKRLMEQYKGETLSITVTGHSLGAALALLVGDELKTCAENMPSVAVFSF  380

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD-CGTTQPSGMLSWL  529
             GGPRVGN+ F  ++++   KVLRIVNS D IT+VPG  V    + +     +  G +  +
Sbjct  381   GGPRVGNRGFTKRMDDKDVKVLRIVNSQDVITRVPGIFVGEGALEEKLKNAKAGGFIDMI  440

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
              +  +    Y  VG ELRV +K S       DVA CHDL+ YLH +D + +  CP R  A
Sbjct  441   DR--NMPLAYTHVGTELRVDTKMSPYLKPDADVACCHDLEAYLHLVDGFLASNCPFRENA  498

Query  357   KRVI  346
             KR +
Sbjct  499   KRSL  502



>ref|XP_006362471.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Solanum 
tuberosum]
Length=541

 Score =   285 bits (729),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 179/409 (44%), Positives = 245/409 (60%), Gaps = 35/409 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G +DW GL+DPL++ LR+E++RYG+F++AAY  F  + A+      R    
Sbjct  137   LGSRWKEYHGCKDWLGLIDPLNENLRRELIRYGEFIQAAYHCFHSNPATCNEGDSR----  192

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                 +  L    YKVT++LY T ++ +P+W + V+P       +SSWIGYVAVCDD  EI
Sbjct  193   ----KVALPDKSYKVTKSLYATSSIGLPKWVDDVTPDLGWMTQRSSWIGYVAVCDDRSEI  248

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC---------EPMVQRGFLS  910
             +R+GRRD+VIA RGTAT  EW EN R  L  +P +               +  V+ GFLS
Sbjct  249   KRMGRRDIVIALRGTATCLEWGENFRDLLVQIPTETTEIESESESESSEGQAKVECGFLS  308

Query  909   LYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHA  730
             L+ +A    PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA + A +++T    A
Sbjct  309   LFQTAGVNVPSLAESVVNEVQRLIEQYKGESLSITVTGHSLGAALALLVADEVSTCAPDA  368

Query  729   PLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG-FVVDSDDVSDCGTTQ  553
             P V V SFGGPRVGN++F  +L +   KVLRIVN+ D IT+VPG FV +  D     +  
Sbjct  369   PPVAVFSFGGPRVGNRSFADRLNSKNVKVLRIVNNQDVITRVPGMFVSEELDKKLRESGF  428

Query  552   PSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSC  382
              SGML+ L K +   W YA VG ELRV S+ S     + DVA CHDL+ YLH +D + + 
Sbjct  429   VSGMLNVLDKSM--PWAYAHVGTELRVDSRMSPFLKPNADVACCHDLEAYLHLVDGYLAS  486

Query  381   KCPLRATAKRVIEKNHGKRR---RVLA*PQIKLLRIGARGSDEQTFKKH  244
              CP RA AKR + K   ++R   + L   + K L +   G  E +F  H
Sbjct  487   NCPFRANAKRSLTKLLSEQRSNIKRLYTNKAKGLNLNLEG--EHSFSTH  533



>ref|XP_009607511.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic isoform X2 
[Nicotiana tomentosiformis]
Length=504

 Score =   283 bits (725),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 230/376 (61%), Gaps = 22/376 (6%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   +CS+W EY G  +W GLLDPLD+ LR+E++RYG+F++AAY  F  + 
Sbjct  97    SSKSMEYSPRN-NICSRWKEYHGSNNWLGLLDPLDENLRRELVRYGEFIQAAYHCFHSNP  155

Query  1260  ASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSS  1105
             A         +E  +  R   L    YKVT+NLY T ++ +P W + V+P       +SS
Sbjct  156   AMSA------EEGPLSARHVALPDRSYKVTKNLYATSSIGLPTWVDDVAPDLGWMTQRSS  209

Query  1104  WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQ  925
             WIGYVAVCDD  EI+R+GRRD+VIA RGTAT  EW EN RA L    DD A    +  V+
Sbjct  210   WIGYVAVCDDRKEIQRMGRRDIVIALRGTATCLEWAENFRALLVEQNDDSAEEQSK--VE  267

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +  +  PSL +S+ +E+ ++IE Y  EPLSIT+TGHSLGAALA + A D +T
Sbjct  268   CGFLSLYKTGGEHVPSLAESVVNEVQRLIEQYKGEPLSITVTGHSLGAALALLVADDAST  327

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                +AP V V SFGGPRVGN+ F  +L  +  KVLRIVN+ D IT+VPG  V S+ +   
Sbjct  328   CAPNAPPVAVFSFGGPRVGNRVFADRLNANNVKVLRIVNNQDVITRVPGMFV-SEALDKK  386

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDN  394
                  +G +  +  C    W Y+ VG E RV ++ S       DVA CHDL+ YLH +D 
Sbjct  387   LRESGAGRVLEMLDC-RMPWAYSHVGTEFRVDTRMSPFLKPDADVACCHDLEAYLHLVDG  445

Query  393   WSSCKCPLRATAKRVI  346
             + +  CP R  AKR +
Sbjct  446   FLASDCPFRPNAKRSL  461



>ref|XP_009607510.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic isoform X1 
[Nicotiana tomentosiformis]
Length=534

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 230/376 (61%), Gaps = 22/376 (6%)
 Frame = -3

Query  1440  SSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDT  1261
             SSK +  + R   +CS+W EY G  +W GLLDPLD+ LR+E++RYG+F++AAY  F  + 
Sbjct  127   SSKSMEYSPRN-NICSRWKEYHGSNNWLGLLDPLDENLRRELVRYGEFIQAAYHCFHSNP  185

Query  1260  ASPTYATCRYDEDAVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSS  1105
             A         +E  +  R   L    YKVT+NLY T ++ +P W + V+P       +SS
Sbjct  186   AMSA------EEGPLSARHVALPDRSYKVTKNLYATSSIGLPTWVDDVAPDLGWMTQRSS  239

Query  1104  WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQ  925
             WIGYVAVCDD  EI+R+GRRD+VIA RGTAT  EW EN RA L    DD A    +  V+
Sbjct  240   WIGYVAVCDDRKEIQRMGRRDIVIALRGTATCLEWAENFRALLVEQNDDSAEEQSK--VE  297

Query  924   RGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT  745
              GFLSLY +  +  PSL +S+ +E+ ++IE Y  EPLSIT+TGHSLGAALA + A D +T
Sbjct  298   CGFLSLYKTGGEHVPSLAESVVNEVQRLIEQYKGEPLSITVTGHSLGAALALLVADDAST  357

Query  744   QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC  565
                +AP V V SFGGPRVGN+ F  +L  +  KVLRIVN+ D IT+VPG  V S+ +   
Sbjct  358   CAPNAPPVAVFSFGGPRVGNRVFADRLNANNVKVLRIVNNQDVITRVPGMFV-SEALDKK  416

Query  564   GTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDN  394
                  +G +  +  C    W Y+ VG E RV ++ S       DVA CHDL+ YLH +D 
Sbjct  417   LRESGAGRVLEMLDC-RMPWAYSHVGTEFRVDTRMSPFLKPDADVACCHDLEAYLHLVDG  475

Query  393   WSSCKCPLRATAKRVI  346
             + +  CP R  AKR +
Sbjct  476   FLASDCPFRPNAKRSL  491



>ref|XP_010934704.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Ibeta2, chloroplastic-like 
[Elaeis guineensis]
Length=535

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 219/369 (59%), Gaps = 36/369 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + S+W  Y G  DW GLLDPLD+ LR+E++RYGD V+AAY +F        Y+      D
Sbjct  138   IASRWRHYHGAADWAGLLDPLDENLRRELVRYGDLVQAAYHAF--------YSQPATKPD  189

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN-LVSP----KSSWIGYVAVCDDEDEIRR  1057
             A      L    Y+VTR+L+ T +V +P W + LV P    +SSWIGYVAVCD + EI R
Sbjct  190   APRP-VSLPDRSYRVTRSLFATASVELPPWVDRLVDPSMTQRSSWIGYVAVCDHDHEIHR  248

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPD----DMAPRNC---EPMVQRGFLSLYTS  898
             +GRRD+VIA RGTAT  EW EN RA L  + D    D    N     P V+ GF SLY +
Sbjct  249   MGRRDIVIALRGTATCLEWAENFRAGLVPIDDGNDNDEKNENSASKSPKVECGFWSLYKT  308

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
             A D  PSL  ++ +E+ +++  Y  E LSIT+TGHSLGAALA + A +++     AP + 
Sbjct  309   AGDRVPSLSAAVVEEVRRLLNQYKGEELSITVTGHSLGAALAVLVADELSATIPDAPPIA  368

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V SFGGPRVGN+ F  Q+E  G KVLR+VN+ D +T+VP  VV            P+G  
Sbjct  369   VFSFGGPRVGNRAFVDQVEGRGVKVLRVVNAHDVVTRVPFGVV------------PAGFK  416

Query  537   SWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
              W  K ++    YA+VG+EL+V S+ S       D A CHDL+ YLH +D + +  CP R
Sbjct  417   WWPAKVLEGIDGYADVGRELKVDSQASPYLRPDADPACCHDLEAYLHLVDGFMATNCPFR  476

Query  366   ATAKRVIEK  340
             + AKR + +
Sbjct  477   SNAKRSLAR  485



>ref|XP_008801786.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Phoenix 
dactylifera]
Length=432

 Score =   280 bits (715),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 218/374 (58%), Gaps = 36/374 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + S+W  Y G  DW GLLDPLD+ LR+E++RYGD V+A Y +F     +P  A    D  
Sbjct  25    IASRWRHYHGAADWAGLLDPLDENLRRELVRYGDLVQATYHAFHSRPDAPADAPRSVD--  82

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN-LVSP----KSSWIGYVAVCDDEDEIRR  1057
                    L    Y+VTR+L+ T +V +PRW +  V+P    +SSWIGYVAVCD + EI R
Sbjct  83    -------LPDRSYRVTRSLFATASVELPRWLDRFVAPWMTQRSSWIGYVAVCDSDREIHR  135

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE------------PMVQRGFL  913
             +GRRD+VI+ RGTAT  EW EN+RA L  +P D    N E            P V+ GF 
Sbjct  136   MGRRDIVISLRGTATCLEWFENIRAGL--VPVDDGKDNDEKNDNSTSRLPHAPKVESGFW  193

Query  912   SLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRH  733
             SLY +A D  PSL  ++ +E+ +++  Y  E LSIT+TGHSLGAALA + A +++     
Sbjct  194   SLYKTAGDRLPSLSAAVVEEVRRLVNQYKGEELSITVTGHSLGAALAVLVADELSASIPD  253

Query  732   APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ  553
             AP + V SFGGPRVGN+ F  ++E  G KVLRIVN+ D +T+VP  V   +        +
Sbjct  254   APPIAVFSFGGPRVGNRAFADRVEGRGVKVLRIVNAHDVVTRVPLGVAPPE-----AAER  308

Query  552   PSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSC  382
               G   W  K ++    Y +VG+ELRV S+ S       D A CHDL+ YLH +D +   
Sbjct  309   HLGGNWWPAKVLEGMDGYTDVGRELRVDSRASPYLRPDADPACCHDLEAYLHLVDGFMGT  368

Query  381   KCPLRATAKRVIEK  340
              CP R+ AKR + +
Sbjct  369   NCPFRSNAKRSLAR  382



>ref|XP_010053518.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW77829.1| hypothetical protein EUGRSUZ_D02117 [Eucalyptus grandis]
Length=533

 Score =   283 bits (723),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 228/370 (62%), Gaps = 23/370 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W +Y G  DW GLLDPLD+ LR+E++RYG+ V+AAY++F+ + A PT      +E 
Sbjct  141   LGSRWRQYHGCDDWGGLLDPLDENLRREMIRYGELVQAAYQAFNSNPAMPT------EEA  194

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    YKVT++LY T AV +P+W + V+P       +SSW+GYVAVCDD  EI
Sbjct  195   PMPHHVALPDKSYKVTKSLYATSAVGLPKWVDDVAPDLGWLTQRSSWVGYVAVCDDRREI  254

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
             +R+GRRDVVIA RGTAT  EW EN R  L  +     P++    V  GFLSL+ +     
Sbjct  255   QRMGRRDVVIALRGTATCLEWAENFRTKLAPISSTEDPKS---KVGSGFLSLFKTPGAHV  311

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ +++E Y  E LSITITGHSLGAALA + A ++TT+    P + V SFG
Sbjct  312   PSLAESVVEEVQRLMELYKGETLSITITGHSLGAALALLVADELTTRVAELPSLAVFSFG  371

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGN  F  ++ +   KVLRIVN  D IT+VPG  + SDD+         GML   Q 
Sbjct  372   GPRVGNSAFADRIRSKNVKVLRIVNDQDVITRVPGMFL-SDDLERKLKETVDGMLENGQM  430

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
               DS   Y+  G ELR+ ++ S     + DVA CHDL+ YLH +D + +  CP RA AKR
Sbjct  431   PWDS---YSHAGTELRLDTRKSPYLKPNADVACCHDLEAYLHLVDGFMASNCPFRANAKR  487

Query  351   VIEKNHGKRR  322
              + K   ++R
Sbjct  488   SLVKLLNEQR  497



>ref|XP_010677111.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   282 bits (722),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 231/366 (63%), Gaps = 21/366 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G RDWEGLLDPLD+ LR+E++RYG+F++AAY +F  D A+       + + 
Sbjct  143   LGKRWREYHGSRDWEGLLDPLDENLRREVIRYGEFIQAAYHAFHADPATTEAGINTWRD-  201

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                   GL  + Y+VT++LY T ++ +P+W + V+P       +SSW+GYVAVC+DE EI
Sbjct  202   -----VGLPDNSYQVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSWVGYVAVCEDEREI  256

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              R+GRRD+VI+ RGTAT  EW EN RA L  + +     + +  V+ GFLSL+ +  +  
Sbjct  257   ARMGRRDIVISLRGTATCLEWAENFRALLVPMQEGSDSED-QAKVECGFLSLFQTQGEHT  315

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +++  E+ +++E Y  E LSITITGHSLGAALA + A +I+T     P V V SFG
Sbjct  316   PSLAETVVQEVRRLLEMYKGETLSITITGHSLGAALALLVADEISTCAAEVPPVAVFSFG  375

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDC--GTTQPSGMLSWL  529
             GPRVGN+ F ++++ +  KVLRIVN+ D IT+VPG  +  +   +     +Q SG+L +L
Sbjct  376   GPRVGNRAFANKIKANNVKVLRIVNNQDVITRVPGIFMSEEVEQNLRDNASQVSGVLEFL  435

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
                +     Y+ VG EL+V +K S       DVA CHDL+ YLH +D + +  CP RA A
Sbjct  436   DNNLP--LAYSHVGTELKVDTKMSPYLKPDADVACCHDLEAYLHLVDGFMASNCPFRANA  493

Query  357   KRVIEK  340
             KR + K
Sbjct  494   KRSLFK  499



>ref|XP_009789580.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Nicotiana 
sylvestris]
Length=530

 Score =   282 bits (721),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 235/368 (64%), Gaps = 22/368 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W E+ G  DW GL+DPL++ LR+E++RYG+FV+AAY  F    ++P+ ++    E 
Sbjct  130   LGSRWKEFHGSNDWLGLIDPLNENLRRELIRYGEFVQAAYHCFH---SNPSTSS---GEG  183

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
              +  R   L    YKVT++LY T +V +P+W + V+P       +SSWIGYVAVCDD  E
Sbjct  184   LLRPRHVALPDKSYKVTKSLYATSSVGLPKWVDDVAPDLGWMTQRSSWIGYVAVCDDRSE  243

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA--PRNCEPMVQRGFLSLYTSAS  892
             I+R+GRRD+VIA RGTAT  EW EN R  L  +P +      + +  V+ GFLSL+ ++ 
Sbjct  244   IQRMGRRDIVIALRGTATCLEWGENFRDLLVQIPAETETDSTDGQAKVECGFLSLFQTSG  303

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA + A +I+T    AP V V 
Sbjct  304   VNVPSLAESVVNEVQRLIEQYKGENLSITVTGHSLGAALALLVADEISTCAPDAPPVAVF  363

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG-FVVDSDDVSDCGTTQPSGMLS  535
             SFGGPRVGN++F  +L +   KVLRIVN+ D IT+VPG FV +S D     +   SG+L+
Sbjct  364   SFGGPRVGNRSFADRLNSKNVKVLRIVNNQDVITRVPGMFVSESLDKKLRESGIASGVLN  423

Query  534   WLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
              L K +   W Y+ VG ELRV ++ S       D+A CHDL+ YLH +D + +  CP RA
Sbjct  424   VLDKSMP--WAYSHVGTELRVDTRMSPFLKPDADIACCHDLEAYLHLVDGYLASNCPFRA  481

Query  363   TAKRVIEK  340
              AKR + K
Sbjct  482   NAKRSLAK  489



>emb|CDX90495.1| BnaA03g42860D [Brassica napus]
Length=492

 Score =   280 bits (715),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/367 (45%), Positives = 218/367 (59%), Gaps = 44/367 (12%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL SKW E  G  +W GLLDPLD+ LR+E++RYG+FV+AAY+ F              D 
Sbjct  121   KLGSKWRELHGSNNWAGLLDPLDEDLRRELVRYGEFVQAAYQGF------------HSDP  168

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    YKVT++LY T +V +P+W + V+P       ++SW+GYVAVC+D  E
Sbjct  169   EGSPRDVALPDGSYKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCEDPKE  228

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+ S
Sbjct  229   IRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTGS  288

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL DS+  EI+++++ Y  E LSI++TGHSLGAA+A + A DI  +  HAP V+V 
Sbjct  289   QHAPSLADSLVAEISRLVDLYAGEELSISVTGHSLGAAIALLAADDIAERVTHAPPVSVF  348

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L++ G KVLR+VNS D +TKVPG   D+D                
Sbjct  349   SFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFADNDK---------------  393

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
                  + Q      G ELRV  K S     + DVA CHDL+ YLH +D + +  CP R  
Sbjct  394   -----NKQGQNRNNGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRTN  448

Query  360   AKRVIEK  340
             AKR + K
Sbjct  449   AKRSLRK  455



>ref|XP_010275455.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Nelumbo 
nucifera]
Length=543

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 227/366 (62%), Gaps = 21/366 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L ++W EY G ++W GLLDPLD+ LR+E++RYG+FV+A+Y  F  + A+        DE 
Sbjct  147   LGTRWREYHGSKNWAGLLDPLDENLRREVVRYGEFVQASYHGFHSNPATSE------DEF  200

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
             +      L    Y+VT++LY T +V +P W + V+P       ++SWIGYVAVCDD+ EI
Sbjct  201   SKPRHVALPDRSYRVTKSLYATSSVGLPEWVDTVAPDMGWMTQRTSWIGYVAVCDDKREI  260

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE--PMVQRGFLSLYTSASD  889
              R+GRRD+VIA RGTAT  EW+EN+R  L  LP +    + +  P V++GF SLY++   
Sbjct  261   SRMGRRDIVIALRGTATCLEWVENVRGLLIQLPGEEEESSSQRPPKVEQGFWSLYSTQGP  320

Query  888   AHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVS  709
                SL DSI++EI +++E Y  E LSIT+TGHSLGAALA + A +++T     P + V S
Sbjct  321   HASSLADSIKEEIRRLMELYKGETLSITVTGHSLGAALALLAADELSTCAPDMPPIAVFS  380

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGN++F +++   G KVLR+VNS D ITKVPG  V          T    M+  L
Sbjct  381   FGGPRVGNRSFGNRMSKRGVKVLRVVNSQDVITKVPGMPVGEGLDQKLKGTNMERMVDVL  440

Query  528   QKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
                  S   Y+ VG ELRV SK S     + DVA CHDL+ YLH +D + +  CP RA A
Sbjct  441   DNMPLS---YSHVGTELRVDSKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRANA  497

Query  357   KRVIEK  340
             KR + +
Sbjct  498   KRSLAR  503



>ref|XP_009599019.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 233/368 (63%), Gaps = 22/368 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W E+ G  DW GL+DPL++ LR+E++RYG+F++AAY  F    ++P+ +     E 
Sbjct  130   LGSRWKEFHGSNDWLGLIDPLNENLRRELIRYGEFIQAAYHCFH---SNPSTSQ---GEG  183

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
              +  R   L    YKVT++LY T +V +P+W + ++P       +SSWIGYVAVCDD  E
Sbjct  184   LLGPRHVALPDKSYKVTKSLYATSSVGLPQWVDDIAPDLGWMTQRSSWIGYVAVCDDRSE  243

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC--EPMVQRGFLSLYTSAS  892
             I+R+GRRD+VIA RGTAT  EW EN R  L  +P +    +   +  V+ GFLSL+ +  
Sbjct  244   IQRMGRRDIVIALRGTATCLEWGENFRDLLVQIPAETETDSADGQAKVECGFLSLFQTTG  303

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL +S+ +E+ ++IE Y  E LSIT+TGHSLGAALA + A +I+T    AP V V 
Sbjct  304   VNVPSLAESVVNEVQRLIEHYKGENLSITVTGHSLGAALALLVADEISTCAPDAPPVAVF  363

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG-FVVDSDDVSDCGTTQPSGMLS  535
             SFGGPRVGN++F  +L +   KVLRIVN+ D IT+VPG FV +S D     +   SG+L+
Sbjct  364   SFGGPRVGNRSFADRLTSKNVKVLRIVNNQDLITRVPGMFVSESLDKKLRESGIASGVLN  423

Query  534   WLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
              L K +   W Y+ VG ELRV ++ S       DVA CHDL+ YLH +D + +  CP RA
Sbjct  424   VLDKSMP--WAYSHVGTELRVDTRMSPFLKPDADVACCHDLEAYLHLVDGYLASNCPFRA  481

Query  363   TAKRVIEK  340
              AKR + K
Sbjct  482   NAKRSLAK  489



>ref|XP_003539047.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Glycine 
max]
Length=523

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/364 (42%), Positives = 220/364 (60%), Gaps = 26/364 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G  DW+G+LDPLD+ LR+E++RYG+FV+AAY++F  D A  T      +E 
Sbjct  136   LGGRWREYHGSNDWKGMLDPLDENLRREVVRYGEFVQAAYQAFHSDPAMST------EEP  189

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    Y++T++LY T ++ +P+W + V+P       +SSW+GYVAVC+D  EI
Sbjct  190   PHPQHVALPDRSYRMTKSLYATSSIGLPKWVDEVAPDLGWMTQRSSWVGYVAVCEDRREI  249

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              R+GRRD++I+ RGT+T  EW ENLRA +     +M     +  V+ GF+SLY +     
Sbjct  250   ARMGRRDIIISLRGTSTCMEWAENLRAHMV----EMGDEEGKAKVECGFMSLYKTKGAQV  305

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
              SL +S+ +E+ ++I+ Y  E LSI++ GHSLGA LA + A +I+T     P V V SFG
Sbjct  306   ASLAESVVEEVRRLIDLYRGEELSISVIGHSLGATLALLVADEISTCCPKVPPVAVFSFG  365

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GPRVGNK F  +L     KVLRIVNS D IT+VPG  V S+++         G+L     
Sbjct  366   GPRVGNKAFGDRLTAKNVKVLRIVNSQDVITRVPGIFV-SEELEQKIRNVGGGVLEE---  421

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
               ++   Y+ VG ELRV +K S       D+A CHDL+ YLH +D + +  CP R+ AKR
Sbjct  422   --NTPLAYSHVGTELRVQTKMSPYLKPDADMACCHDLEAYLHLVDGFLASNCPFRSNAKR  479

Query  351   VIEK  340
              + +
Sbjct  480   SLAR  483



>ref|XP_010538355.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Tarenaya hassleriana]
Length=519

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 224/372 (60%), Gaps = 32/372 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W E  G  +W GLLDPLD+ LR+E++ YG+FV+AAY +F  D            E 
Sbjct  122   LGSRWRELHGSNNWVGLLDPLDENLRRELVSYGEFVQAAYHAFHSDP-----------EG  170

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSW-------IGYVAVCDDEDEI  1063
             A      L    YKVT++LY T +V +P+W + ++P   W       +GYVAVCDD  EI
Sbjct  171   ASPGHVALPDGSYKVTKSLYATSSVRLPKWIDDMAPDLRWMTQQTSCVGYVAVCDDPREI  230

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-DMAPR-----NCEPMVQRGFLSLYT  901
             RR+GRRD+VIA RGTAT  EW E+ R  L  +P  +  PR        P V+ GFLSLY 
Sbjct  231   RRMGRRDIVIALRGTATLLEWAEDFRPNLVPVPHPEPQPRPEIFDQNPPKVECGFLSLYR  290

Query  900   SASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLV  721
             +     PSL +++  E+ +++E Y  E LSI+ITGHSLGAAL+ + A DI     HAP V
Sbjct  291   TRGSHVPSLAEALVGEVNRLVELYRGEELSISITGHSLGAALSLLAAEDIAASVTHAPPV  350

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFV--VDSDDVSDCGTTQPS  547
              V SFGGPRVGN+ F  Q+E+ G KVLR+VN+ D +TKVPG    V   D ++ G  Q  
Sbjct  351   AVFSFGGPRVGNQEFARQMESRGVKVLRVVNNQDVVTKVPGIFPEVHGQDGNNNGRIQ-G  409

Query  546   GMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKC  376
              ++  +++  ++ W Y+ VG ELRV ++ S     + DVA CHDL+ YLH +D + +  C
Sbjct  410   ALMEMVKR--NNPWDYSHVGAELRVDTRMSPYLKPNADVACCHDLEAYLHLVDGFLASNC  467

Query  375   PLRATAKRVIEK  340
             P RA AKR + K
Sbjct  468   PFRANAKRSLRK  479



>gb|ACZ57767.1| glycerolipase A1 [Nicotiana attenuata]
Length=547

 Score =   278 bits (711),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 226/382 (59%), Gaps = 18/382 (5%)
 Frame = -3

Query  1455  LGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRS  1276
             L    SSK +  + R   L ++W EY G +DW GL+DPLD+ LR+E++RYG+F++AAY  
Sbjct  126   LHRMLSSKSMEYSPRN-NLGTRWREYHGCKDWLGLIDPLDENLRRELVRYGEFIQAAYHC  184

Query  1275  FDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP------  1114
                + A     T   +   V     L    YKVT++LY T +V +P+W + V+P      
Sbjct  185   LHSNPA-----TSEKENADVARNVSLPDRSYKVTKSLYATSSVGLPKWVDDVAPDLGWMT  239

Query  1113  -KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE  937
              +SSWIGYVAVCDD+ EI+R+GRRD+VIA RGTAT  EW EN R  L  +P        +
Sbjct  240   QRSSWIGYVAVCDDKTEIQRMGRRDIVIALRGTATCLEWGENFRDVLVQMPGKNDSVEGQ  299

Query  936   PMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAY  757
             P V+ GFLSLY +  +  PSL + + +E+ ++IE Y  E LSIT+TGHSLGAALA + A 
Sbjct  300   PKVECGFLSLYQTGGNKIPSLAEXVVNEVKRLIEMYKGESLSITVTGHSLGAALALLVAD  359

Query  756   DITTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDD  577
             D++T    +P V V +FGGPRVGNK F ++LE+   KVLRIVN  D ITKVPG  V    
Sbjct  360   DVSTCTPDSPPVAVFTFGGPRVGNKGFANRLESKNVKVLRIVNKQDVITKVPGMFVSEAL  419

Query  576   VSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLH  406
                      +G+L+ L   +   W Y+ VG ELRV +  S       DVA CHDL+ YLH
Sbjct  420   DKKLREKGAAGVLNLLDNSMP--WAYSHVGTELRVDTTKSPFLKPDADVACCHDLEAYLH  477

Query  405   CIDNWSSCKCPLRATAKRVIEK  340
              +D +       R  AKR + K
Sbjct  478   LVDGYLGSNESFRPNAKRSLVK  499



>emb|CDY09664.1| BnaC07g33970D [Brassica napus]
Length=483

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 216/367 (59%), Gaps = 53/367 (14%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL SKW E  G  +W GLLDPLD+ LR+E++RYG+FV+A+Y +F              D 
Sbjct  121   KLGSKWRELHGSNNWAGLLDPLDEDLRRELVRYGEFVQASYHAF------------HSDP  168

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    YKVT++LY T +V +P+W + V+P       ++SW+GYVAVCDD  E
Sbjct  169   EGSPRDVALPDGSYKVTKSLYATSSVRLPKWIDDVAPDLRWMTKQTSWVGYVAVCDDPKE  228

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+ S
Sbjct  229   IRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTGS  288

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL DS+  EI++++E Y  E LSI++TGHSLGAA+A + A DI  +  HAP V+V 
Sbjct  289   QHAPSLADSLVAEISRLVELYAGEELSISVTGHSLGAAIALLAADDIADRVPHAPPVSVF  348

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L++ G KVLR+VNS D +TK                         
Sbjct  349   SFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKR------------------------  384

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
                  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP R  
Sbjct  385   -----NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRTN  439

Query  360   AKRVIEK  340
             AKR + K
Sbjct  440   AKRSLRK  446



>gb|KEH31635.1| glycerolipase A1 [Medicago truncatula]
Length=521

 Score =   273 bits (699),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 222/364 (61%), Gaps = 21/364 (6%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S W EY G  DW+G+LDPLD+ LR+E++RYG+FV+ AY SF  + A          +D
Sbjct  129   LGSHWREYHGCNDWKGMLDPLDENLRREVVRYGEFVQDAYHSFHSNPA------MSGQDD  182

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                    L    YKVT++LY T ++ +P+W + V+P       +SSWIGYVAVC+D+ EI
Sbjct  183   PQTRHVSLTDKSYKVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSWIGYVAVCNDKREI  242

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              RLGRRD+VI+ RGTAT  EW EN+RA L    +    +     V+ GFLSLY +     
Sbjct  243   SRLGRRDIVISLRGTATCLEWAENMRAQLIETEEQHGKK---AKVECGFLSLYKTKGTHV  299

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A DI+T   + P V V SFG
Sbjct  300   PSLGESVIEEVKRLMEVYEGETLSITVTGHSLGAALALLVADDISTCNPNVPPVAVFSFG  359

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQK  523
             GP+VGNK + +++ +   KVLRIVNS D IT+VPG ++  +      +    G++  L +
Sbjct  360   GPKVGNKAYGNKITSQNVKVLRIVNSQDVITRVPGMLLSEEFEQKLRSFNFGGVVDMLDE  419

Query  522   CVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAKR  352
                +   Y  VG ELRV +K S       D+A CHDL+ YLH +D + +  CP RA AKR
Sbjct  420   --KTPLAYTHVGSELRVDTKMSPFLKPDADMACCHDLEAYLHLVDGFLASNCPFRANAKR  477

Query  351   VIEK  340
              + +
Sbjct  478   SLAR  481



>emb|CBX25299.1| hypothetical_protein [Oryza brachyantha]
Length=452

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 220/355 (62%), Gaps = 42/355 (12%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             ++  +W E QG +DW+GLL+PLD  L    +RYG+FV AAY SF+FD+ +P+Y  CR+  
Sbjct  115   RIGRQWTELQGAQDWDGLLNPLDGAL----VRYGEFVRAAYASFNFDSGAPSYGCCRFPS  170

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRR  1045
              +++ R  L  +GY+V + L+   + + PRW   +S +SS+IGYVAVCDDE+EI RLGRR
Sbjct  171   SSLLRRSRLPETGYRVAQLLHAA-STSAPRW---LSCRSSYIGYVAVCDDEEEIERLGRR  226

Query  1044  DVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCE-------PMVQRGFLSLYTSASDA  886
             DVVIA+RGTAT  EW++N ++TL  LP   + R+ +       PMV+ GF  L+T++  A
Sbjct  227   DVVIAFRGTATCSEWVDNFKSTLAHLPPTTSRRSADAGDGEAAPMVESGFWRLFTTSGKA  286

Query  885   HPSLKDSIRDEITKIIETYGDE---PLSITITGHSLGAALATITAYDITTQFRH------  733
             H SL+  +R      +  YG +   PLSIT+TGHSL AALA +TAY+ITT          
Sbjct  287   HSSLQHQVRG-----VSEYGGKGMPPLSITVTGHSLSAALAVLTAYEITTTSAMQGHGDH  341

Query  732   ---APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
                AP+VT VSFGGPRVGN  FR +LE SG KVLR+VNSDD +TKVPGF        D  
Sbjct  342   DGAAPMVTAVSFGGPRVGNAAFRRRLEESGGKVLRVVNSDDIVTKVPGF-------PDVP  394

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRv-sskdssyskdVATCHDLKTYLHCI  400
               +      WL   +   W Y++VG+ELR+        S++V   HDL  YL  +
Sbjct  395   AKRKPRFPRWLVSKMG--WEYSDVGRELRLCGPCGQDTSRNVVASHDLDLYLKLV  447



>ref|XP_004508952.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Cicer 
arietinum]
Length=506

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/366 (44%), Positives = 233/366 (64%), Gaps = 26/366 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  +W G+LDPLD+ LR+E++RYG+FV+AAY  F    ++P+ +     +D
Sbjct  115   LGSRWREYHGCNNWNGMLDPLDENLRREVVRYGEFVQAAYHCFH---SNPSMSP----QD  167

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
               + R   L    Y+VT++LY T ++ +P+W + ++P       +SSWIGY+AVCDD+ E
Sbjct  168   PPLPRHVSLPDKSYRVTKSLYATSSIGLPKWVDEIAPDLGWMTQRSSWIGYIAVCDDKRE  227

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA  886
             I RLGRRD+VI+ RGT+T  EW EN+RA L     ++  +  +P V+ GFLSLY +    
Sbjct  228   ISRLGRRDIVISLRGTSTCLEWAENMRAQLI----EIEAQQGKPKVECGFLSLYKTKGTQ  283

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A D++T   + P V V SF
Sbjct  284   VPSLAESVIEEVKRLMEVYEGETLSITVTGHSLGAALALLVADDVSTCSPNVPPVAVFSF  343

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQ  526
             GGP+VGNK + +++ +   KVLRIVNS D IT+VPG  V  +      ++   G++  L 
Sbjct  344   GGPKVGNKAYGNKMTSQNVKVLRIVNSQDVITRVPGMFVSEEFEQKLRSSNVGGVVDIL-  402

Query  525   KCVD-SQWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHCIDNWSSCKCPLRATA  358
               VD +   Y+ VG ELRV +K S + K    +A CHDL+ YLH +D + +  CP RA A
Sbjct  403   --VDKTPLAYSHVGVELRVDTKMSPFLKPDADMACCHDLEAYLHLVDGFLASNCPFRANA  460

Query  357   KRVIEK  340
             KR + +
Sbjct  461   KRSLAR  466



>ref|XP_010055434.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW71912.1| hypothetical protein EUGRSUZ_E00372 [Eucalyptus grandis]
Length=553

 Score =   273 bits (699),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 224/371 (60%), Gaps = 30/371 (8%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L ++W EY G  DWEG+LDPLD+ LR+E++RYG+FV+AAY++F  D A+           
Sbjct  149   LAARWREYHGCNDWEGMLDPLDENLRREVVRYGEFVQAAYQAFHTDPATSAQVAPPPRHV  208

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
             A+  R       YKVT++LY T ++ +P+W + V+P       +SSWIGYVAVC+D  EI
Sbjct  209   ALPDR------SYKVTKSLYATSSIALPKWVDDVAPDLDWMTQRSSWIGYVAVCEDRREI  262

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAP---RNCEPMVQRGFLSLYTSAS  892
             +R+GRRD+VIA RGTAT  EW EN+RA L  +P    P      +  V+ GF SLY +  
Sbjct  263   QRMGRRDIVIALRGTATCLEWAENMRANLVDMPHVGGPLPGAQGQSKVECGFQSLYRTGG  322

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT------QFRHA  730
                PSL +S+ +E+ ++ + Y  E LSIT+TGHSLGAALA + A +++T           
Sbjct  323   AHVPSLAESVVEEVKRLQKLYEGETLSITVTGHSLGAALALLVADELSTCTAESSSSSSP  382

Query  729   PLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQP  550
             P V V SFGGPRVGNK F +++     KVLRIVN+ D IT+VPG  +  D       T+ 
Sbjct  383   PHVAVFSFGGPRVGNKAFANRMNAKNVKVLRIVNNQDIITRVPGTFLSEDLEQKLRDTKL  442

Query  549   SGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCK  379
              G+L       +  W Y+ VG ELRV ++ S       DVA CHDL+ YLH +D +SS  
Sbjct  443   QGVLD-----DNMPWDYSHVGTELRVDTRMSPFLKPDADVACCHDLEAYLHLVDGFSSSS  497

Query  378   CPLRATAKRVI  346
             CP RA AKR +
Sbjct  498   CPFRANAKRSL  508



>ref|XP_003549939.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Glycine 
max]
Length=528

 Score =   272 bits (696),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 163/365 (45%), Positives = 225/365 (62%), Gaps = 25/365 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S W EY G  DW+G+LDPLD+ LR+E++RYG+FV+AAY SF  + A         +E 
Sbjct  138   LGSLWREYHGSHDWKGMLDPLDENLRREVVRYGEFVQAAYHSFHSNPA------MSAEEP  191

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     L    Y++T++LY T ++ +P+W + V+P       +SSW+GYVAVCDD  EI
Sbjct  192   PLPRHMVLPDRSYRITKSLYATSSIGLPKWVDDVAPDLGWMSQRSSWVGYVAVCDDRREI  251

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAH  883
              RLGRRD+VI+ RGTAT  EW+EN+RA L  + D  +    +P V+ GFLSLY +     
Sbjct  252   VRLGRRDIVISLRGTATCLEWVENMRAQLINI-DSSSSSRGKPKVECGFLSLYKTRGSHV  310

Query  882   PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFG  703
             PSLK+S+ +E+ ++++ Y  E LSITITGHSLGAALA + A D++      P V V SFG
Sbjct  311   PSLKESVIEEVKRLMKLYQGETLSITITGHSLGAALALLVADDVSMCSTDVPPVAVFSFG  370

Query  702   GPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ-PSGMLSWLQ  526
             GPRVGN+ F  +L     KVLRIVNS D ITKVPG +V  +       ++  +G+L    
Sbjct  371   GPRVGNRAFGDKLAAQNVKVLRIVNSQDVITKVPGMLVSEEVEKKLRNSKLGAGVLDIFD  430

Query  525   KCVDSQWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHCIDNWSSCKCPLRATAK  355
             +       Y+  G ELRV +K S + K    +A CHDL+ YLH +D + +  CP RA AK
Sbjct  431   E-------YSHTGTELRVDTKMSPFLKPDADMACCHDLEAYLHLVDGFLASNCPFRANAK  483

Query  354   RVIEK  340
             R + +
Sbjct  484   RSLAR  488



>ref|XP_010941432.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-Ibeta2, chloroplastic-like 
[Elaeis guineensis]
Length=545

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 165/392 (42%), Positives = 226/392 (58%), Gaps = 35/392 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + S+W  Y G  DW GLLDPLD+ LR+E++ YGD V+AAY +F       ++     D  
Sbjct  136   IASRWRHYHGAADWAGLLDPLDENLRRELVHYGDLVQAAYHAFH------SHPEASLD--  187

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN-LVSP----KSSWIGYVAVCDDEDEIRR  1057
                    L    Y+VTR+L+ T +V +PR  +   +P    +SSWIGYVAVCD + EIRR
Sbjct  188   -APRHVALPDRSYRVTRSLFATASVELPRCLDRFAAPWMTQRSSWIGYVAVCDSDHEIRR  246

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC------EPMVQRGFLSLYTSA  895
             +GRRD+VIA RGTAT  EW EN RA L  +P D    N        P V+ GF SLY +A
Sbjct  247   MGRRDIVIALRGTATCLEWAENFRAGL--VPVDDGSDNSTLRSPHAPKVECGFWSLYKTA  304

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
              D  PSL  S+ +E+ +++  Y  E LSIT+TGHSLGAALA + A ++++    AP + V
Sbjct  305   GDRVPSLSASVVEEVRRLVNQYKGEELSITVTGHSLGAALAVLVADELSSSIPDAPPIAV  364

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS-DCGTTQPSGML  538
              SFGGPRVGN+ F  ++E  G KVLR+VN+ D +T+VP  V   +    D G+       
Sbjct  365   FSFGGPRVGNRGFADRVEGGGVKVLRVVNAHDMVTRVPLGVAPPEAAERDLGSKW-----  419

Query  537   SWLQKCVDSQWVYAEVGKELRvsskdssys---kdVATCHDLKTYLHCIDNWSSCKCPLR  367
              W  + ++    YA+VG+ELRV S+ S Y     D A CHDL+ YLH +D +     P R
Sbjct  420   -WPARVLERMDGYADVGRELRVDSRASPYLRPDADPACCHDLEAYLHLVDGFMGTDYPFR  478

Query  366   ATAKRVIEK---NHGKRRRVLA*PQIKLLRIG  280
             + AKR + +     G   + L   + + LRIG
Sbjct  479   SNAKRSLARLLSQQGGNVKKLYMSKARELRIG  510



>ref|XP_003524096.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Glycine 
max]
Length=540

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 226/366 (62%), Gaps = 27/366 (7%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW+G+LDPLD+ LR+E++RYG+FV+AAY SF  + A         +E 
Sbjct  150   LGSRWREYHGSHDWKGMLDPLDENLRREVVRYGEFVQAAYHSFHSNPA------MSAEEP  203

Query  1221  AVMTR-CGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
               + R   L    Y+VT++LY T ++ +P+  + V+P       +SSWIGYVAVCDD  E
Sbjct  204   PPLPRHMVLPDRSYRVTKSLYATSSIGLPKLVDDVAPDLGWMTQRSSWIGYVAVCDDRRE  263

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA  886
             I RLGRRD+VI+ RGTAT  EW EN+RA L  +  D +    +P V+ GFLSLY +    
Sbjct  264   IARLGRRDIVISLRGTATCLEWAENMRAQLRNI--DNSTTQEKPKVECGFLSLYKTRGTH  321

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSLK+S+ +E+ +++E Y  E LSITITGHSLGAALA + A D++    H P V V SF
Sbjct  322   VPSLKESVIEEVKRLMELYKGETLSITITGHSLGAALALLVADDVSMCSVHVPSVAVFSF  381

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQ-PSGMLSWL  529
             GGPRVGN+ F  +L     KVLRIVNS D IT+VPG  V  +      T++  +G+L  L
Sbjct  382   GGPRVGNRAFGDKLAAQNVKVLRIVNSQDVITRVPGMFVSEELEKKLRTSKVGAGVLDML  441

Query  528   QKCVDSQWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHCIDNWSSCKCPLRATA  358
              +       Y+  G ELRV +K S + K    +A CHDL+ YLH +D + +   P RA A
Sbjct  442   DE-------YSHTGTELRVDTKMSPFLKPDADMACCHDLEAYLHLVDGFLASNSPFRANA  494

Query  357   KRVIEK  340
             KR + +
Sbjct  495   KRSLAR  500



>emb|CDY42944.1| BnaA01g18100D [Brassica napus]
Length=487

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/367 (44%), Positives = 215/367 (59%), Gaps = 53/367 (14%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL S W E  G  +W GLLDPLD+ LR+EI+RYG+FV+A+Y +F              D 
Sbjct  125   KLGSNWRELHGSNNWAGLLDPLDENLRREIVRYGEFVQASYHAF------------HSDP  172

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    +KVT++LY T +V +P+W + V+P        +SW+GYVAVCDD  E
Sbjct  173   EGSPRDIALPDGSFKVTKSLYATSSVRLPKWIDDVAPDLRWMTKPTSWVGYVAVCDDPRE  232

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+AS
Sbjct  233   IRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTAS  292

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL +S+  EI+++++ Y  E LSI++TGHSLGAA+A + A DI  +  +AP V+V 
Sbjct  293   QQAPSLAESLVGEISRLVDLYAGEELSISVTGHSLGAAIALLAAGDIAERVPNAPPVSVF  352

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L + G KVLR+VNS D +TK                         
Sbjct  353   SFGGPRVGNREFADRLVSKGVKVLRVVNSQDVVTKR------------------------  388

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
                  ++ W Y+ VG ELRV  K S     + DVA CHDL+ YLH +D + +  CP RA 
Sbjct  389   -----NNPWAYSHVGAELRVDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRAN  443

Query  360   AKRVIEK  340
             AKR + K
Sbjct  444   AKRSLRK  450



>ref|XP_007155702.1| hypothetical protein PHAVU_003G224000g [Phaseolus vulgaris]
 gb|ESW27696.1| hypothetical protein PHAVU_003G224000g [Phaseolus vulgaris]
Length=549

 Score =   268 bits (684),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 161/366 (44%), Positives = 224/366 (61%), Gaps = 29/366 (8%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  DW+G+LDPLD+ LR+E++RYG+FV++AY SF  + A         +E 
Sbjct  150   LGSRWREYHGSHDWKGMLDPLDENLRREVVRYGEFVQSAYHSFHSNPA------MSAEEP  203

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
              +     +    Y+VT++LY T ++ +P+W + V+P       +SSW+G+VAVCDD  EI
Sbjct  204   PLPRHMVVPDRSYRVTKSLYATSSIGLPKWVDDVAPDLGWMTQRSSWVGFVAVCDDRREI  263

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM----VQRGFLSLYTSA  895
              RLGRRD+VI+ RGTAT  EW EN+RA L  + +D A  + EP     V+ GFLSLY + 
Sbjct  264   ARLGRRDIVISLRGTATCLEWAENMRAQLINISEDTA--HGEPKAKAKVECGFLSLYRTR  321

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
                  SL +S+ +E+ +++E Y DE LSITITGHSLGAALA + A D++        V V
Sbjct  322   GTHVGSLAESVIEEVKRLMEVYKDETLSITITGHSLGAALALLVADDVSACSGDVAPVAV  381

Query  714   VSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLS  535
              SFGGPRVGN+ F  +L     KVLRIVNS D IT+VPG +V  +       ++  G+L+
Sbjct  382   FSFGGPRVGNRAFGEKLTAQNVKVLRIVNSQDVITRVPGMLVSEEVEKKLRRSKVGGVLN  441

Query  534   WLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
              + +       Y+ +G ELRV +K S       D+A CHDL+ YLH +D +    CP RA
Sbjct  442   MVDE-------YSHMGTELRVETKMSPYLKPDADMACCHDLEAYLHLVDGFLGSNCPFRA  494

Query  363   TAKRVI  346
              AKR +
Sbjct  495   NAKRSL  500



>ref|XP_006837394.1| hypothetical protein AMTR_s00111p00135120 [Amborella trichopoda]
 gb|ERN00248.1| hypothetical protein AMTR_s00111p00135120 [Amborella trichopoda]
Length=575

 Score =   267 bits (683),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 170/397 (43%), Positives = 228/397 (57%), Gaps = 42/397 (11%)
 Frame = -3

Query  1464  WTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAA  1285
             W  L N A+S          KL  KW+EY G  +W GLLDPLD+ LR+EI+RYGDFV+AA
Sbjct  164   WGKLLNPANSP-------RNKLGEKWLEYHGKNNWAGLLDPLDENLRREIVRYGDFVQAA  216

Query  1284  YRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP---  1114
             Y  F  D+      T R  E    +   +    Y+VT++LY T ++ VP W N V P   
Sbjct  217   YEHFYSDSM-----TSR--EPTTPSHVAVPDRSYRVTKSLYATSSLGVPDWFNNVVPDWM  269

Query  1113  --KSSWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLP--------  964
               +SSWIGY+AVCDDE EI RLGRRD+V+A RGTAT  EW EN R  L  LP        
Sbjct  270   TRRSSWIGYIAVCDDEREIARLGRRDIVVALRGTATCMEWAENFRDILVNLPTGDGEDGN  329

Query  963   ---DDMAPRNCEPMVQRGFLSLYTSASDAHPSLKDSIRDEITKIIETY-GDEPLSITITG  796
                ++    N    V+ GF SLY +     PSL + +  E+++++  Y G  PLSITITG
Sbjct  330   NNNNNNNNSNNAAKVECGFWSLYKTHGKHIPSLSEEVVAEVSRLVREYKGQGPLSITITG  389

Query  795   HSLGAALATITAYDITTQF--RHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSD  622
             HSLG ALA + A +I  +   + AP + V SFGGPRVGN  F ++LE +G KVLR+VNS 
Sbjct  390   HSLGGALALLAADEIGARLGPQEAPPIAVFSFGGPRVGNNAFGAKLEGNGIKVLRVVNSR  449

Query  621   DPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---sy  451
             D + ++PG +++    +      P      +      +W Y+ VG ELR+ S+ S     
Sbjct  450   DVVPQMPGVLMNEGLRASVHAALP------IADGPLQEWTYSHVGCELRLDSRQSPYLRP  503

Query  450   skdVATCHDLKTYLHCIDNWSSCKCPLRATAKRVIEK  340
               DVA CHDL+ YLH +D + +  CP RA+AKR ++K
Sbjct  504   DADVAACHDLEAYLHLVDGFLASNCPFRASAKRWVQK  540



>ref|XP_008776009.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Phoenix 
dactylifera]
Length=433

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 216/369 (59%), Gaps = 28/369 (8%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + ++W  Y G  DW GLLDPLD+ LR+E++R GD V+AAY +F       ++ T + D  
Sbjct  22    IAARWRHYHGAGDWSGLLDPLDENLRRELVRCGDLVQAAYHAFH------SHPTTKPDAP  75

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN-LVSP----KSSWIGYVAVCDDEDEIRR  1057
               +    L    Y+V+R+L+ T ++  P W + LV+P    +SSWIGYVA CD + EI R
Sbjct  76    RPVA---LPDRSYRVSRSLFATASIEFPPWVDRLVAPWITQRSSWIGYVAFCDHDHEIHR  132

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPD----DMAPRNC---EPMVQRGFLSLYTS  898
             +GRRD+VIA RGTAT  EW EN RA L  + D    D    N     P V+ GF SLY +
Sbjct  133   MGRRDIVIALRGTATCLEWAENFRAGLVPIEDGNDNDEKNENSASKSPKVECGFWSLYKT  192

Query  897   ASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
             A D  PSL  ++ +E+ +++  Y  E LSIT+TGHSLGAALA + A +++++   AP + 
Sbjct  193   AGDRVPSLSAAVVEEVCRLVNQYKGEQLSITVTGHSLGAALAVLVADELSSRVPDAPPIA  252

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V SFGGPRVGN  F  Q+E  G KVLR+VN+ D +T+VP         +     + +   
Sbjct  253   VFSFGGPRVGNLAFADQVEGRGVKVLRVVNAHDVVTRVP----LGAGPAPAPPERQTDFK  308

Query  537   SWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLR  367
              W  K ++    YA+VG+EL+V S+ S       D A CHDL+ YLH +D +     P R
Sbjct  309   WWPAKVLEGIDGYADVGRELKVDSRASPYLRPDADPACCHDLEAYLHLVDGFMGTNSPFR  368

Query  366   ATAKRVIEK  340
             + AKR + +
Sbjct  369   SNAKRSLAR  377



>emb|CDY35617.1| BnaC01g21390D [Brassica napus]
Length=487

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/367 (43%), Positives = 213/367 (58%), Gaps = 53/367 (14%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL S W E  G  +W GLLDPLD+ LR+E++RYG+FV+A+Y +F              D 
Sbjct  125   KLGSNWRELHGSNNWAGLLDPLDENLRRELVRYGEFVQASYHAF------------HSDP  172

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDE  1066
             +       L    +K T++LY T +V +P+W + V+P        +SW+GYVAVCDD  E
Sbjct  173   EGSPRDIALPDGSFKATKSLYATSSVRLPKWIDDVAPDLRWMTKPTSWVGYVAVCDDPRE  232

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-PRN-CEPMVQRGFLSLYTSAS  892
             IRR+GRR++VIA RGTAT  EW EN R  L  +P+    P +   P V+ GF SLYT+AS
Sbjct  233   IRRMGRREIVIALRGTATLLEWSENFRPNLVSMPEPKPDPSDPTRPKVECGFNSLYTTAS  292

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
                PSL +S+  EI ++++ Y  E LSI++TGHSLGAA+A + A DI  +  +AP V+V 
Sbjct  293   QHAPSLAESLVGEICRLVDLYAGEELSISVTGHSLGAAIALLAADDIAERVPNAPPVSVF  352

Query  711   SFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSW  532
             SFGGPRVGN+ F  +L + G KVLR+VNS D +TK                         
Sbjct  353   SFGGPRVGNREFADRLVSKGVKVLRVVNSQDVVTKR------------------------  388

Query  531   LQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
                  ++ W Y+ VG ELR+  K S     + DVA CHDL+ YLH +D + +  CP RA 
Sbjct  389   -----NNPWAYSHVGAELRLDMKMSPYLKPNADVACCHDLEAYLHLVDGFLASNCPFRAN  443

Query  360   AKRVIEK  340
             AKR + K
Sbjct  444   AKRSLRK  450



>ref|XP_009631504.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/361 (42%), Positives = 205/361 (57%), Gaps = 35/361 (10%)
 Frame = -3

Query  1425  VAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTY  1246
             ++ +   +L S W E QG ++WE L++PLD+ L+ EI+RYG+FV A Y +FD D  S  Y
Sbjct  32    ISRNTTNRLASMWREIQGSKNWENLVNPLDNLLQNEIIRYGEFVAACYNAFDLDPNSKRY  91

Query  1245  ATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDE  1066
               C+Y +++++   GLG SGY VT+ +Y T  +NV       S    WIGYVAV ++  E
Sbjct  92    LNCKYGKNSMLNEVGLGNSGYNVTKYIYATTNINVLSIGQNCSSSGKWIGYVAVSNNV-E  150

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSAS  892
               RLGRRDV+I +RGT T PEW+ NL +TLT  P  + P N  P   V+ GFLSLYTS  
Sbjct  151   STRLGRRDVLITFRGTVTNPEWIANLMSTLT--PAHLDPNNLRPDVKVEAGFLSLYTSNE  208

Query  891   DAHPSL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT---------  748
             D    L   ++ +  EI ++I  Y  E +SITI GHS+G+ALA + AYDI          
Sbjct  209   DEKFGLGSCREQLLSEIGRVINMYKGEEMSITIAGHSMGSALALLLAYDIAELGLNTTIV  268

Query  747   ----TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD  580
                  +  ++  VTV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG  ++ +
Sbjct  269   PESQVKINNSIPVTVFSFGGPRVGNLGFKERCEELGIKVLRIVNVNDPITKLPGVFLNEN  328

Query  579   DVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATC-HDLKTYLHC  403
                  G       + W   C      YA VG E+        ++    TC HDL TYL+ 
Sbjct  329   FRVLLGGKYE---VPWSCSC------YAHVGVEI----LLDFFNMQNPTCVHDLATYLNL  375

Query  402   I  400
             +
Sbjct  376   L  376



>gb|ABR13259.1| defective in anther dehiscence 1 [Brassica rapa var. parachinensis]
Length=226

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 175/231 (76%), Gaps = 13/231 (6%)
 Frame = -3

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             VI++RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLYTS   AH SL
Sbjct  1     VISFRGTATCLEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLYTSG--AH-SL  57

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+VTV+SFGGPR
Sbjct  58    RDMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPMVTVMSFGGPR  117

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-  517
             VGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T  + M SW+QK V 
Sbjct  118   VGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREQDNVKMT--ASMPSWIQKRVE  175

Query  516   DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             ++ WVYAEVGKELR+SS+DS      +VATCH+LKTYLH +D + S  CP 
Sbjct  176   ETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCPF  226



>ref|XP_008798807.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Phoenix dactylifera]
Length=528

 Score =   264 bits (675),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 220/376 (59%), Gaps = 44/376 (12%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
             + + S+W  Y G  DW GLLDPLD+ LR+E+LRYGDFV+AAY +F     + + A  R+ 
Sbjct  149   SSIASRWRLYHGAEDWSGLLDPLDENLRRELLRYGDFVQAAYHAFHSRPEASSPARHRH-  207

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-----KSSWIGYVAVCDDEDEI  1063
                      L    Y+ T++L+ T ++++  W N  +P      SSWIGYVAVCD + EI
Sbjct  208   -------LILPDRSYRPTKSLFATSSLSIHPWVNSSAPARMTQSSSWIGYVAVCDSDREI  260

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCL--PDDMAPRNCE--PMVQRGFLSLYTSA  895
             RR+GRRD+VI  RGTAT  EW ENLRA+L  +  PD  +    +  P V RGF SLY +A
Sbjct  261   RRMGRRDIVIVLRGTATCLEWAENLRASLVPMDSPDASSSEVGQHVPKVARGFWSLYKTA  320

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
              +   SL  S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A +++T     P + V
Sbjct  321   GEQVSSLSASVVEEVRRLMEVYKGEELSITVTGHSLGAALAFLVADELSTCAPSVPPIAV  380

Query  714   VSFGGPRVGNKNFRSQLE-NSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             VSFGGPRVGN+ F  ++E + G K LRIVN+ D ITKVPG                   L
Sbjct  381   VSFGGPRVGNQAFADRIEKHHGVKALRIVNAHDVITKVPGLP-----------------L  423

Query  537   SWLQKCVDSQWVYAEVGKELRvsskdss---yskdVATCHDLKTYLHCIDNWSSCKCPLR  367
               L++       Y  VG ELR++S+DS         A  HDL+ YLH +D ++    P R
Sbjct  424   PHLREK------YEHVGSELRINSRDSPYLRPDAGPACTHDLEAYLHLVDGFTGTGSPFR  477

Query  366   ATAKRVIEKNHGKRRR  319
             ++AKR + +   ++RR
Sbjct  478   SSAKRSLVRLLDQQRR  493



>ref|XP_010919735.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Elaeis guineensis]
Length=528

 Score =   263 bits (673),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 161/377 (43%), Positives = 223/377 (59%), Gaps = 45/377 (12%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
             + + SKW  Y G  DW GLLDPLD+ LR+E+LRYGDFV+AAY +F    A+ + A   + 
Sbjct  149   SSIASKWRLYHGAEDWSGLLDPLDENLRRELLRYGDFVQAAYHAFHSRPAASSPARHHH-  207

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT-----NLVSPKSSWIGYVAVCDDEDEI  1063
                      L    Y+ T++L+ T ++++P WT     N  +  SSWIGYVAV D + EI
Sbjct  208   -------LLLPDRSYRPTKSLFATSSLSIPPWTHSSASNWRTQSSSWIGYVAVSDSDREI  260

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCL--PDDMAP--RNCEPMVQRGFLSLYTSA  895
             RR+GRR++V+  RGTAT  EW ENLRA+L  +  PDD +   R   P V RGF SLY +A
Sbjct  261   RRMGRREIVVVLRGTATCLEWAENLRASLVPMDSPDDSSGEVRQHVPKVARGFWSLYKTA  320

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTV  715
              +   SL  S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A +++T   + P + V
Sbjct  321   GEQVSSLSASVVEEVRRLMELYKGEELSITVTGHSLGAALAILVADELSTCAPNVPPIAV  380

Query  714   VSFGGPRVGNKNFRSQLENS-GTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM-  541
             VSFGGPRVGN+ F  ++E   G KVLRIVN+ D ITKVP                 +GM 
Sbjct  381   VSFGGPRVGNRAFADRVEKEHGVKVLRIVNAHDVITKVP-----------------AGMP  423

Query  540   LSWLQKCVDSQWVYAEVGKELRvsskdss---yskdVATCHDLKTYLHCIDNWSSCKCPL  370
             L  +++       Y  VG ELR++S+DS         A  HDL+ YLH +D ++    P 
Sbjct  424   LPHVREG------YEHVGSELRINSRDSPYLRPDAGPACSHDLEAYLHLVDGFTGTGSPF  477

Query  369   RATAKRVIEKNHGKRRR  319
             R+ AKR + +   ++RR
Sbjct  478   RSNAKRSLVRLLDQQRR  494



>ref|XP_006349966.1| PREDICTED: phospholipase A1-Ialpha2, chloroplastic-like [Solanum 
tuberosum]
Length=395

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 150/366 (41%), Positives = 211/366 (58%), Gaps = 29/366 (8%)
 Frame = -3

Query  1458  TLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYR  1279
             T  ++  S  ++      KL + W E QG R+WE L++PLD  L++EI+RYG+FV A Y 
Sbjct  3     TFSHSNISSNMINTTTNNKLATMWREIQGSRNWENLVNPLDTLLQEEIIRYGEFVVACYN  62

Query  1278  SFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPR--WTNLVSPKSS  1105
             +FD D  S  Y  C+Y +++++   GLG SGY++T+ +Y T  +NV      +  S    
Sbjct  63    AFDLDPNSKRYLNCKYGKNSMLIEVGLGKSGYQITKYIYATTNINVLSIGQNSSSSSSGR  122

Query  1104  WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--M  931
             WIGYVA+  DE E +RLGRRDV+I +RGT T PEW+ NL +TL+  P  + P N  P   
Sbjct  123   WIGYVAISSDE-ETKRLGRRDVLITFRGTVTNPEWIANLMSTLS--PARLDPSNLRPEVK  179

Query  930   VQRGFLSLYTSASDAHPSL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITA  760
             V+ GFLSLYTS       L   ++ +  EI ++I  Y +E +SITI GHS+G+ALA + A
Sbjct  180   VEAGFLSLYTSNEGERFGLRSCREQLLSEIGRLINMYKNEEMSITIGGHSMGSALALLLA  239

Query  759   YDIT------TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG  598
             YDI           +   VTV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG
Sbjct  240   YDIAELGLNKNSESNNISVTVFSFGGPRVGNSGFKERCEELGVKVLRIVNVNDPITKLPG  299

Query  597   FVVDSDDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLK  418
              +++ +     G  +    + W   C      YA VG E+     D    ++ +  HDL 
Sbjct  300   VLLNENFRVFGGRYE----VPWSCSC------YAHVGVEI---LLDFFNMQNPSCVHDLG  346

Query  417   TYLHCI  400
             TYL+ +
Sbjct  347   TYLNLL  352



>gb|ABR13260.1| defective in anther dehiscence 1 [Brassica oleracea var. botrytis]
Length=226

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 173/231 (75%), Gaps = 13/231 (6%)
 Frame = -3

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             VI+ RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLYTS   AH SL
Sbjct  1     VISLRGTATCLEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLYTSG--AH-SL  57

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+VTV+SFGGPR
Sbjct  58    RDMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPMVTVMSFGGPR  117

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-  517
             VGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T    M SW+QK V 
Sbjct  118   VGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREKDNVKMT--VSMPSWIQKRVE  175

Query  516   DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             ++ WVYAEVGKELR+SS+DS      +VATCH+LKTYLH +D + S  CP 
Sbjct  176   ETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCPF  226



>gb|ABR13261.1| defective in anther dehiscence 1 [Brassica oleracea var. italica]
Length=226

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 173/230 (75%), Gaps = 13/230 (6%)
 Frame = -3

Query  1035  IAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSASDAHPSLK  871
             I++RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLYTS   AH SL+
Sbjct  2     ISFRGTATCLEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLYTSG--AH-SLR  58

Query  870   DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPRV  691
             D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ AP+VTV+SFGGPRV
Sbjct  59    DMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRAPMVTVMSFGGPRV  118

Query  690   GNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-D  514
             GN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T    M SW+QK V +
Sbjct  119   GNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREKDNVKMT--VSMPSWIQKRVEE  176

Query  513   SQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             + WVYAEVGKELR+SS+DS      +VATCH+LKTYLH +D + S  CP 
Sbjct  177   TPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCPF  226



>ref|XP_010314737.1| PREDICTED: phospholipase A1-Ialpha2, chloroplastic-like [Solanum 
lycopersicum]
Length=463

 Score =   258 bits (658),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 210/372 (56%), Gaps = 53/372 (14%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             KL + W E QG R+WE L++PLD  L++EI+RYG+FV A Y +FD D  S  Y  C+Y +
Sbjct  63    KLATMWREIQGSRNWENLVNPLDSLLQEEIIRYGEFVVACYNAFDLDPNSKRYLNCKYGK  122

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSS--WIGYVAVCDDEDEIRRLG  1051
             ++++++ GLG SGY++T+ +Y T  +NV       SP SS  WIGYVAV +DE E +RLG
Sbjct  123   NSMLSKVGLGKSGYEITKYIYATTNINVLSIGQNSSPSSSGRWIGYVAVSNDE-ETKRLG  181

Query  1050  RRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSASDAHPS  877
             RRDV+I +RGT T PEW+ NL +TL+  P  + P N  P   V+ GFLSLYTS       
Sbjct  182   RRDVLITFRGTVTSPEWVANLMSTLS--PARLDPSNLRPEVKVEAGFLSLYTSKEGERFG  239

Query  876   L---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI--------TTQFRHA  730
             L   ++ +  EI ++   Y +E +SITI GHS+G+ALA + AYDI         T  R  
Sbjct  240   LRSCREQLLSEIGRVTNMYKNEEMSITIGGHSMGSALALLLAYDIAELGLNKHATTTRRD  299

Query  729   PL----------------------VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDP  616
              L                      VTV SFGGPRVGN  F+ + E  G KVLRIVN +DP
Sbjct  300   QLYKSSVSEPVSERVSEPESSNISVTVFSFGGPRVGNSGFKERCEELGVKVLRIVNVNDP  359

Query  615   ITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVA  436
             ITK+PG +++ +     G  +    + W   C      Y  +G E+     D    ++ +
Sbjct  360   ITKLPGVLLNENFRVFGGRYE----VPWSYSC------YTHIGVEI---LLDFFNMQNPS  406

Query  435   TCHDLKTYLHCI  400
               HDL TYL+ I
Sbjct  407   CVHDLGTYLNLI  418



>ref|XP_003532708.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=497

 Score =   258 bits (658),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/368 (39%), Positives = 208/368 (57%), Gaps = 37/368 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  KW E QG  +WE +LDPL  +LR+EI++YG+F +A Y +FD+D+ S    +CRY+++
Sbjct  89    ISQKWREIQGYHNWEDILDPLQPWLRREIVKYGEFAQATYDAFDYDSFSEYCGSCRYNQN  148

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +  + GL  + Y VTR +Y    + +PRW       +  S  S+WIG+VAV DD DE R
Sbjct  149   KLFEKLGLTRNSYTVTRYIYAMSHIELPRWLERSHVADTWSKDSNWIGFVAVSDD-DETR  207

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA--  886
             R+GRRD+V+A+RGT  P EW E+ +  L  +       + +  V+ GFLS+Y S S+   
Sbjct  208   RIGRRDIVVAWRGTVAPCEWYEDFQRKLDPIG------HGDAKVEHGFLSIYKSKSETTR  261

Query  885   --HPSLKDSIRDEITKIIETY---GDEPLSITITGHSLGAALATITAYDITTQFRHAPLV  721
                 S  D +  E+TK++  Y     E +S+TITGHSLG ALA I AY++ T F   P V
Sbjct  262   YNKSSASDQVMKEVTKLVNFYKGKKGEEVSLTITGHSLGGALALINAYEVATTFLDLP-V  320

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM  541
             +V+SFG PRVGN  F+ +L   G K+LR+V   D + K+PG + +               
Sbjct  321   SVISFGAPRVGNIAFKDELHQMGVKLLRVVVKQDWVPKMPGLLFNEK-------------  367

Query  540   LSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             L    +    +WVY  VG EL +    S       +++  H L+TYLH ID + S + P 
Sbjct  368   LKMFDEITGLEWVYTHVGAELALDVHSSPYLKGGMNLSGFHSLETYLHLIDGYLSHETPF  427

Query  369   RATAKRVI  346
             R+ A+R I
Sbjct  428   RSEARRDI  435



>gb|ACN30274.1| defective in anther dehiscence 1 [Brassica oleracea var. alboglabra]
Length=226

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 173/231 (75%), Gaps = 13/231 (6%)
 Frame = -3

Query  1038  VIAYRGTATPPEWLENLRATLTCLPD-----DMAPRNCEPMVQRGFLSLYTSASDAHPSL  874
             VI+ RGTAT  EWLENLRATLT LPD     ++   N  PMV+ GFLSLYTS   AH SL
Sbjct  1     VISSRGTATCFEWLENLRATLTHLPDGPSGPNLNGSNSGPMVESGFLSLYTSG--AH-SL  57

Query  873   KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSFGGPR  694
             +D +R EI++++++YGDEPLS+TITGHSLGAA+AT+ AYDI T F+ A +VTV+SFGGPR
Sbjct  58    RDMVRQEISRLLQSYGDEPLSLTITGHSLGAAIATLAAYDIKTTFKRALMVTVMSFGGPR  117

Query  693   VGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCV-  517
             VGN+ FR  LE  GTKVLRIVNSDD ITKVPG V+D+ +  +   T  + M SW+QK V 
Sbjct  118   VGNRCFRRLLEKQGTKVLRIVNSDDVITKVPGVVLDNREKDNVKMT--ASMPSWIQKRVE  175

Query  516   DSQWVYAEVGKELRvsskds--syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             ++ WVYAEVGKELR+SS+DS      +VATCH+LKTYLH +D + S  CP 
Sbjct  176   ETPWVYAEVGKELRLSSRDSPYLNGINVATCHELKTYLHLVDGFVSSTCPF  226



>ref|XP_004298041.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=477

 Score =   255 bits (652),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 206/358 (58%), Gaps = 34/358 (9%)
 Frame = -3

Query  1389  WMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMT  1210
             W E QG  +WE L+DPL   LR+EI+RYGDFV+  Y +FD D  S  Y  C+Y +  ++ 
Sbjct  84    WREIQGSDNWENLVDPLHPLLRQEIIRYGDFVKGCYCAFDLDPNSKRYLNCKYGKKNMLR  143

Query  1209  RCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRRDVVIA  1030
               G+  SGY+VT+ +Y T  +N+P           WIGYVAV  DE  ++RLGRRD++I 
Sbjct  144   EVGMESSGYEVTKYIYATPDINIPIQNG--ESCGRWIGYVAVATDE-AVKRLGRRDIIIT  200

Query  1029  YRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTS-ASDAHPSL---KD  868
             +RGT T PEW+ NL ++LT  P  + P N  P   V+ GFLSLYTS  SD+   L   ++
Sbjct  201   FRGTVTNPEWVANLMSSLT--PARLDPHNERPDVKVESGFLSLYTSDESDSKFGLGSCRE  258

Query  867   SIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT-------TQFRHAPLVTVVS  709
              +  E+++++  Y  E LSIT+ GHS+G++LA + AYDIT             P VTV S
Sbjct  259   QLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLAYDITELGLNRVNSSTKTP-VTVFS  317

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG V + ++    G+ + S    W 
Sbjct  318   FGGPRVGNSGFKRRCEELGVKVLRIVNVNDPITKMPGMVFNHENFRVLGSERLSFEFPWS  377

Query  528   QKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
               C      YA VG EL     D    ++ +  HDL TY+      S  KCP R + +
Sbjct  378   CSC------YAHVGVEL---VLDFFNMQNPSCVHDLGTYI------SLLKCPKRPSME  420



>ref|XP_008791829.1| PREDICTED: galactolipase DONGLE, chloroplastic [Phoenix dactylifera]
Length=384

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 150/379 (40%), Positives = 217/379 (57%), Gaps = 38/379 (10%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
             A L S W E QG  DWE L++PL   LR+EI+RYG+ V A Y++FD D +S  Y  C+Y 
Sbjct  6     APLASVWREVQGADDWEDLVEPLHPLLREEIVRYGELVAACYKAFDLDPSSKRYLNCKYG  65

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGR  1048
             +++++   G+ GSGYKVT+ +Y T  +++P  T   + +S WIGYVAV  DE E+R LGR
Sbjct  66    KNSMLREVGMAGSGYKVTKYIYATPDISIP--TQSGTCRSRWIGYVAVSGDE-EVRSLGR  122

Query  1047  RDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSASD----A  886
             RD+++++RGT T  EW+ N  ++LT  P  + P +  P   V+ GFLSLYTS       +
Sbjct  123   RDILVSFRGTVTNTEWIANFMSSLT--PARLDPHDPRPDVKVESGFLSLYTSDDSSCKFS  180

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT-------TQFRHAP  727
               S ++ +  E+++I+  Y DE LSIT+ GHS+G++LA +  YD+           R  P
Sbjct  181   SGSCREQLLSEVSRIVNKYKDEELSITLAGHSMGSSLALLLGYDLAELGLNRDASNREVP  240

Query  726   LVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPS  547
              +TV SFGGPRVGN  F+ + +  G KVLR+VN +DP+TK+PG  ++ +     G  +  
Sbjct  241   -ITVYSFGGPRVGNSGFKERCDELGVKVLRVVNVNDPVTKLPGVFLNENLRVLAGRFE--  297

Query  546   GMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLR  367
               L W   C      YA VG EL   + D    K+ A  HDL  Y+  +      KCP  
Sbjct  298   --LPWSCSC------YAHVGVEL---ALDFFKMKNPACVHDLDAYIGLL------KCPKM  340

Query  366   ATAKRVIEKNHGKRRRVLA  310
             A  K+  E    K ++ L 
Sbjct  341   AQVKKDGENLLNKAKKYLG  359



>ref|XP_009589831.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=460

 Score =   253 bits (647),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 155/377 (41%), Positives = 208/377 (55%), Gaps = 39/377 (10%)
 Frame = -3

Query  1431  CLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASP  1252
             C    +   +L S W E QG  +WE L DPLD  LR+EI+RYG+FV A Y +FD D  S 
Sbjct  63    CSSNNNNIERLASMWREVQGSNNWENLADPLDSLLREEIIRYGEFVAACYDAFDLDPNSK  122

Query  1251  TYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW-TNLVSPKS--SWIGYVAVC  1081
              Y  C+Y +  ++   GLG SGY+VT+ +Y T  +NV     N +   S   WIGY+AV 
Sbjct  123   RYLNCKYGKKRMLREVGLGNSGYQVTKYIYATPDINVFHIGVNNIGSSSCGRWIGYIAVS  182

Query  1080  DDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM--VQRGFLSL  907
             +DE E +RLGRRDV++ +RGT T PEW+ NL ++LT  P  + P N  P   V+ GFLSL
Sbjct  183   NDE-ETKRLGRRDVLVTFRGTVTSPEWIANLMSSLT--PARLDPHNPRPQVKVEAGFLSL  239

Query  906   YTSASDAHPSL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT---  745
             YTS       L   ++ +  E+ K++  Y  E +SIT+ GHS+G+ALA + AYDI+    
Sbjct  240   YTSNEGEKFGLESCREQLLSEVGKVLNKYKGEEMSITLAGHSMGSALALLLAYDISELGL  299

Query  744   -----QFRHAPL-VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS  583
                     H  + VTV SFGGPRVGN  F+ + E+ G KVLRI N +DPITK+PG  ++ 
Sbjct  300   NRDRLSNNHTIVPVTVFSFGGPRVGNSGFKERCEDLGVKVLRITNVNDPITKLPGVFLNE  359

Query  582   DDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHC  403
                   G  +    + W   C      YA VG E+     D     + +  HDL TYL  
Sbjct  360   HFRVLGGWYE----VPWSCSC------YAHVGVEI---LLDFFKMHNPSCVHDLGTYL--  404

Query  402   IDNWSSCKCPLRATAKR  352
                 S  KCP R   +R
Sbjct  405   ----SLLKCPKRLQVQR  417



>ref|XP_010258763.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic [Nelumbo nucifera]
Length=538

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 152/371 (41%), Positives = 220/371 (59%), Gaps = 43/371 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L  +W EY G  DW GLLDPLD+ LR+E++RYG+FV+AAY  F    ++P+ +   +   
Sbjct  148   LGKRWPEYHGSNDWAGLLDPLDENLRREVVRYGEFVQAAYHGFQ---SNPSTSEGEF---  201

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
             ++     L    Y++T++LY T +V +P W + V+P       ++SWIGYVAVCDD  EI
Sbjct  202   SMPRNVALPDKSYRLTKSLYATSSVGLPEWVDNVAPDLRWMTQRTSWIGYVAVCDDRKEI  261

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM---------VQRGFLS  910
              R+GRRD++++ RGT+T  EW EN R  L  +P D +                V++GF S
Sbjct  262   SRMGRRDILVSLRGTSTCLEWAENFRGLLVQVPGDDSDSEDSGSSSHGPSPPKVEQGFWS  321

Query  909   LYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHA  730
             LY ++    PSL +S+ +E+ +++E Y  E LSIT+TGHSLGAALA + A +++T     
Sbjct  322   LYKTSGTDVPSLAESVVEEVRRLMEVYKGESLSITVTGHSLGAALALLAADELSTCAPSM  381

Query  729   PLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQP  550
             P + V SFG PRVGN+ F +++ N G +VLR+VNS D ITKVPG  V  + + +   +  
Sbjct  382   PPIAVFSFGSPRVGNRGFANRIRNKGVRVLRVVNSQDVITKVPGMPVVGEGLENTPLS--  439

Query  549   SGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCK  379
                             Y+++G ELRV SK S     + DVA CHDL+ YLH +D + +  
Sbjct  440   ----------------YSDIGTELRVDSKMSPYLKPNADVACCHDLEAYLHLVDGFLASN  483

Query  378   CPLRATAKRVI  346
             CP RA AKR +
Sbjct  484   CPFRANAKRSL  494



>ref|XP_009407137.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=545

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/381 (40%), Positives = 209/381 (55%), Gaps = 62/381 (16%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W +Y G  DW+GLLDPLD  LR+E++RYG+F +A Y +F    ++PT A       
Sbjct  157   IAPRWHQYHGAADWDGLLDPLDHDLRRELIRYGEFAQATYHAFH---SNPTAAPPDRPRA  213

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP------KSSWIGYVAVCDDEDEIR  1060
              V     L    Y+VTRNL+ T +V +P W + V+P       +SW+GYVAVCD+E EI+
Sbjct  214   VV-----LPDRSYRVTRNLFATASVELPPWVDTVAPWMMTATPTSWVGYVAVCDNEREIQ  268

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA-----------------PRNCEPM  931
             R+GRRD+VIA RGT+T  EW EN R  L  +P D                   PR   P 
Sbjct  269   RMGRRDIVIALRGTSTCLEWAENFRTWL--VPIDEEEQEAEEEESSEGEQTEKPRGTVPK  326

Query  930   VQRGFLSLYTSASDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI  751
             V+ GF SL+ +A    PSL   + +E+ +++E Y  E LSIT+ GHSLGAALA + A ++
Sbjct  327   VECGFRSLFKTAGPDAPSLSSMVAEEVRRLMEQYAGEELSITVVGHSLGAALAVLVADEL  386

Query  750   TTQFR-HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDV  574
                   H P   V SFGGPRVGN+ F  ++E    KVLR+VN+ D +T+VP  +    D 
Sbjct  387   AASVSPHVP-TAVFSFGGPRVGNQAFADRVERRAVKVLRVVNAHDLVTRVPCVLPARAD-  444

Query  573   SDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHC  403
                                     YA VG+ELRV ++ S Y +     A CHDL+ YLH 
Sbjct  445   -----------------------GYAHVGRELRVDNRMSPYLRPDADAACCHDLEAYLHL  481

Query  402   IDNWSSCKCPLRATAKRVIEK  340
             +D + +  CP R+ AKR + +
Sbjct  482   VDGFMATNCPFRSDAKRSLAR  502



>ref|XP_006364696.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Solanum 
tuberosum]
Length=731

 Score =   259 bits (662),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 208/364 (57%), Gaps = 34/364 (9%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
              +L S W E QG ++WE L+DPLD  LR EI+RYG+FV A Y +FD D  S  Y  C+Y 
Sbjct  65    GRLSSMWREVQGSKNWENLVDPLDSLLRSEIIRYGEFVAACYDAFDLDPNSKRYLNCKYG  124

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTC-AVNV-PRWTNLVSPKSSWIGYVAVCDDEDEIRRL  1054
             +  +++  GLG SGY+VT+ +Y T   +NV P   ++ S    WIGY+AV +DE E +RL
Sbjct  125   KRRMLSEVGLGESGYQVTKYIYATPDIINVFPNNISIGSSCGKWIGYIAVSNDE-ETKRL  183

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM--VQRGFLSLYTSASDAHP  880
             GRRDVV+ +RGT T  EW+ NL ++LT  P  + P N  P   V+ GFLSLYTS  D   
Sbjct  184   GRRDVVVTFRGTVTSHEWIANLMSSLT--PARLDPHNPRPQVKVEAGFLSLYTSNEDKKF  241

Query  879   SL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI-----TTQFRHAPL  724
              L   ++ +  EI +++  Y  E LSIT+ GHS+G+ALA + AYDI      T   H   
Sbjct  242   GLGSCREQLLSEIGRVVNKYKGEELSITLAGHSMGSALALLLAYDIAELGLNTHDDHTVP  301

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             VTV SFGGPRVGN  F+ + E  G KVLRI N +DPITK+PG  ++ +     G  +   
Sbjct  302   VTVFSFGGPRVGNSGFKERCEELGVKVLRITNVNDPITKLPGVFLNENFRVLGGKYE---  358

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
              + W   C      YA VG E+     D     + +  HDL TYL      S  KCP R 
Sbjct  359   -VPWSCSC------YAHVGVEI---LLDFFKMHNPSCVHDLATYL------SLLKCPKRL  402

Query  363   TAKR  352
               +R
Sbjct  403   HVQR  406



>ref|XP_009791702.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Nicotiana 
sylvestris]
Length=412

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 202/366 (55%), Gaps = 49/366 (13%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S W E QG ++W+ L++PLD+ L+ EI+RYG+FV A Y +FD D  S  Y  C+Y ++
Sbjct  19    LASMWREIQGSKNWQNLVNPLDNLLQNEIIRYGEFVAACYNAFDLDPNSKRYLNCKYGKN  78

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             +++   GLG SGY VT+ +Y T  +NV       S    WIGYVAV ++E E +RLGRRD
Sbjct  79    SMLNEVGLGNSGYNVTKYIYATTDINVLSIGQKCS-SGRWIGYVAVSNNE-ESKRLGRRD  136

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSASDAHPSL--  874
             V+I +RGT T PEW+ NL +TLT  P  + P N  P   V+ GFLSLYTS       L  
Sbjct  137   VLITFRGTVTNPEWIANLMSTLT--PARLDPNNLRPEIKVEAGFLSLYTSNEGEKFGLGS  194

Query  873   -KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT-----------TQFRHA  730
              ++ +  EI ++I  Y  E +SITI GHS+G+ALA + AYDI            +Q  H 
Sbjct  195   CREQLLSEIRRVINMYKGEEMSITIAGHSMGSALALLLAYDIAELGLNTTTAPESQVSHQ  254

Query  729   PL---------------VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGF  595
                              VTV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG 
Sbjct  255   NRLYESSPSVSENNIIPVTVFSFGGPRVGNLGFKERCEELGIKVLRIVNVNDPITKLPGV  314

Query  594   VVDSDDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATC-HDLK  418
              ++ +     G       + W   C      YA VG E+        ++    TC HDL 
Sbjct  315   FLNENFRVLLGGKYE---VPWSCSC------YAHVGVEI----LLDFFNMQNPTCVHDLG  361

Query  417   TYLHCI  400
             TYL+ +
Sbjct  362   TYLNLL  367



>ref|XP_007024951.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY27573.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=511

 Score =   253 bits (646),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 146/376 (39%), Positives = 214/376 (57%), Gaps = 57/376 (15%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  KW +  G  DW  LLDPL  +LR+EI++YG+F +A Y +FDFD+ S    +CRY+ +
Sbjct  93    IADKWRDIHGSMDWVNLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEFCGSCRYNRN  152

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW---TNLV---SPKSSWIGYVAVCDDEDEIR  1060
              +  + G G +GYKVT+ +Y    + +P+W   ++L+   S  S+W+GYVAV DDE E R
Sbjct  153   KLFEKLGHGKNGYKVTKYIYAMSHIEMPQWLERSHLMDTWSKDSNWMGYVAVSDDE-ETR  211

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM------VQRGFLSLYTS  898
             R+GRRD+V+A+RGT  P EW E+ +            RN EP+      V+ GFLS+YTS
Sbjct  212   RIGRRDIVVAWRGTVAPAEWYEDFQ------------RNLEPIGIGDAKVEHGFLSIYTS  259

Query  897   ASDA----HPSLKDSIRDEITKIIETY--GDEPLSITITGHSLGAALATITAYDITTQFR  736
              +++      S  + + +E+TK+++ Y    E +S+TITGHSLG ALA + AY+      
Sbjct  260   KNESTRYNKSSASEQVMEEVTKLVQFYQGNGEEVSLTITGHSLGGALALLNAYEAAASLP  319

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS-----DDVS  571
               P V+V+SFG PRVGN  FR +L+  G K LR+V   D + ++PG V +      DD++
Sbjct  320   GLP-VSVISFGAPRVGNSAFRDELDGLGVKTLRVVVKQDLVPRMPGIVFNESLQRFDDIT  378

Query  570   DCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCI  400
               GT                +WVY  VG ELR+    S Y K   +    H L+TYLH +
Sbjct  379   --GTL---------------EWVYTHVGAELRLDVSSSPYLKRGFSPLGFHSLETYLHLV  421

Query  399   DNWSSCKCPLRATAKR  352
             D + S     R+ A+R
Sbjct  422   DGFHSADSAFRSDARR  437



>ref|XP_002321113.2| hypothetical protein POPTR_0014s14860g [Populus trichocarpa]
 gb|EEE99428.2| hypothetical protein POPTR_0014s14860g [Populus trichocarpa]
Length=393

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 151/381 (40%), Positives = 212/381 (56%), Gaps = 38/381 (10%)
 Frame = -3

Query  1422  AADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYA  1243
             ++ R + L   W E QG  +WEGL++PL  +LR+EI+RYG+FV A Y++FD D  S  Y 
Sbjct  9     SSTRTSTLAHMWREVQGCNNWEGLVEPLHPFLRQEIIRYGEFVTACYQAFDLDPNSKRYL  68

Query  1242  TCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPK-SSWIGYVAVCDDEDE  1066
             TC+Y +  +    G+G  GY+VT+ +Y T  VN+P       P    W+GYVAV  D D 
Sbjct  69    TCKYGKKNLFREVGMGNPGYEVTKYIYATPDVNIPIQN---EPSCGRWVGYVAVSSD-DA  124

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSAS  892
             +RRLGRRD+VI +RGT T PEW+ N  ++LT  P  +   N  P   V+ GFLSLYTS  
Sbjct  125   VRRLGRRDIVITFRGTVTNPEWIANFMSSLT--PAKLDHNNPRPDVKVESGFLSLYTSNE  182

Query  891   DAH----PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT--QFRHA  730
                     S ++ +  E+++++  Y  E LSI+++GHS+G++LA + AYDI      R  
Sbjct  183   SGDKFGLKSCREQLLSEVSRLLNRYKGEELSISLSGHSMGSSLALLLAYDIAELGLNRLG  242

Query  729   P----LVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
             P     VTV SFGGPRVGN  F+ + E  G +VLRIVN +DPITK+PG  ++ +     G
Sbjct  243   PNLDIPVTVFSFGGPRVGNLGFKERCEELGVRVLRIVNVNDPITKLPGVFLNENFRVLGG  302

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSC  382
               +      W   C      YA VG E+     D    ++ +  HDL +Y+      S  
Sbjct  303   RYE----FPWSCSC------YAHVGVEI---VLDFFNMQNPSCVHDLGSYI------SLL  343

Query  381   KCPLRATAKRVIEKNHGKRRR  319
             KCP +    R  E+N   R R
Sbjct  344   KCPKKGDQVRKDEQNIFIRAR  364



>ref|XP_007015095.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32714.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=508

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/372 (39%), Positives = 207/372 (56%), Gaps = 39/372 (10%)
 Frame = -3

Query  1434  KCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTAS  1255
             + LV  +    LC  W E QG  DW+GLLDP++ +LR+EI+RYG+F +A Y SFDFD  S
Sbjct  66    EALVLEEDERPLCQIWKEIQGCNDWDGLLDPMNPHLRREIIRYGEFAQACYDSFDFDPHS  125

Query  1254  PTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGY  1093
                 +C+Y       + G+   GY+++R LY T  +N+P +      +++ S  ++W+GY
Sbjct  126   KYCGSCKYQGAHFFEKLGMADRGYQISRYLYATSNINLPNFFQKSNLSSVWSTHANWMGY  185

Query  1092  VAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQR--G  919
             VAVC DEDEI+RLGRRD+VI++RGT T  EW+ +L+  L       A    +P ++   G
Sbjct  186   VAVCTDEDEIKRLGRRDIVISWRGTVTYLEWIYDLKDIL-----HQANFTKDPSIKMELG  240

Query  918   FLSLYTSASDA----HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDI  751
             F  LYT   +A      S ++ +  EI +++E Y  E +SITITGHSLGAALA ITAYDI
Sbjct  241   FYDLYTKKENACNYCSFSAREQVLAEIKRLLEYYDGEEISITITGHSLGAALALITAYDI  300

Query  750   TT---------QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPG  598
                        +  +   +TV SF GPRVGN  F+ + +  G KVLR VN  D +  VPG
Sbjct  301   AELGLNLVEEGELSNKVPITVYSFAGPRVGNLKFKERCDELGVKVLRAVNVHDKVPTVPG  360

Query  597   FVVDSDDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKEL---RvsskdssyskdVATCH  427
                +          +      +L++ V   W YA VG EL      S     + D+A  H
Sbjct  361   IFAN----------EKLQFQKYLEEAVSFPWSYAHVGVELALDHTCSPFLKSTNDLACAH  410

Query  426   DLKTYLHCIDNW  391
             +L+ +LH +D +
Sbjct  411   NLEAHLHLLDGY  422



>ref|XP_002268142.1| PREDICTED: galactolipase DONGLE, chloroplastic [Vitis vinifera]
Length=446

 Score =   249 bits (635),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 215/377 (57%), Gaps = 38/377 (10%)
 Frame = -3

Query  1443  ASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD  1264
             A+ +   + + ++ L   W E QG  +WE L++PLD  LR EI+RYG+FV A Y++FD D
Sbjct  55    ATGRVSRSIETSSGLADVWREIQGCNNWEDLVEPLDSLLRNEIIRYGEFVTACYKAFDLD  114

Query  1263  TASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAV  1084
               S  Y  C+Y +  ++   G+  SGY+VT+ +Y T  +N+P        +  WIGYVAV
Sbjct  115   PNSKRYLNCKYGKQNLLREVGMEKSGYEVTKYIYATPDINIPIQNGASCGR--WIGYVAV  172

Query  1083  CDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLS  910
               DE E +RLGRRDV+I +RGT T  EW+ NL ++LT  P  + P N  P   V+ GFLS
Sbjct  173   SSDE-ETKRLGRRDVLITFRGTVTNHEWIANLMSSLT--PARLDPHNPRPDVKVEAGFLS  229

Query  909   LYTS-ASDAHPSL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT-  745
             LYTS  SD+   L   ++ +  E+++++  Y  E LSIT+ GHS+G++LA + AYDI   
Sbjct  230   LYTSDESDSKFGLESCREQLLSEVSRLLNQYKGEELSITLAGHSMGSSLALLLAYDIAEL  289

Query  744   ------QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS  583
                     R  P +TV SFGGPRVGN +F+ + E  G KVLR+VN +DPITK+PG V + 
Sbjct  290   GLNRDHSSREIP-ITVFSFGGPRVGNSSFKERCEELGLKVLRVVNVNDPITKLPGIVFNE  348

Query  582   DDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHC  403
             +     G  +      W   C      YA VG E+     D    ++ +  HDL++Y++ 
Sbjct  349   NFRVLGGRYE----FPWSCSC------YAHVGVEV---VLDFFKMENPSYVHDLESYINL  395

Query  402   IDNWSSCKCPLRATAKR  352
             +      KCP R   ++
Sbjct  396   L------KCPQRVQVQK  406



>ref|XP_004300345.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=507

 Score =   251 bits (640),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 200/363 (55%), Gaps = 55/363 (15%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S+W EY G  +W GLLDPLD+ LR+E++R                             
Sbjct  148   LVSRWREYHGSNNWAGLLDPLDENLRREVVR-----------------------------  178

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP-------KSSWIGYVAVCDDEDEI  1063
                         YKVT++LY T A+ +P W + V+P       +SSWIGYVAVCDD  EI
Sbjct  179   -----------SYKVTKSLYATSAIGLPDWVDDVAPDLGWMTQRSSWIGYVAVCDDRREI  227

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPD-DMAPRNCEPMVQRGFLSLYTSASDA  886
              R+GRRD+VIA RGT+T  EW EN+RA L  +P  +      +  V+ GF SLY +    
Sbjct  228   ARMGRRDIVIALRGTSTCLEWAENMRAQLIQIPPTEEGGEEAQAKVECGFQSLYKTPGVH  287

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVVSF  706
              PSL  S+ +EI ++ E Y  E LSIT+TGHSLGAA+A +   ++ T     P V V SF
Sbjct  288   VPSLSQSVVEEIKRLKELYKGEELSITVTGHSLGAAIALLVGDELKTCAEDMPPVAVFSF  347

Query  705   GGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQ  526
             GGPRVGN+ F +++E    KVLRIVNS D IT+VPG  V    + +    + S +   L 
Sbjct  348   GGPRVGNRGFANRMEAKNVKVLRIVNSQDLITRVPGIFVGEGVLEE--KLKNSKIADLLD  405

Query  525   KCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
             K +     Y+ VG ELRV +K S     + DVA CHDL+ YLH +D + +  CP R  AK
Sbjct  406   KKMP--LAYSHVGTELRVDTKMSPYLKPNADVACCHDLEAYLHLVDGFMASNCPFRKNAK  463

Query  354   RVI  346
             R +
Sbjct  464   RSL  466



>ref|XP_010326961.1| PREDICTED: galactolipase DONGLE, chloroplastic [Solanum lycopersicum]
Length=433

 Score =   248 bits (634),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 162/392 (41%), Positives = 221/392 (56%), Gaps = 46/392 (12%)
 Frame = -3

Query  1494  EFSTLKNTKSWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEI  1315
             + S+ KN  S     + A  +C  ++ R   L S W E QG ++WE L+DPLD  LR EI
Sbjct  23    KLSSTKNIAS----DDIAMDRCRCSSGRL--LSSMWREVQGSKNWENLVDPLDSLLRSEI  76

Query  1314  LRYGDFVEAAYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPR  1135
             +RYG+FV A Y +FD DT S  Y  C+Y +  +++  GLG SGY+VT+ +Y T  + +  
Sbjct  77    IRYGEFVAACYDAFDLDTNSKRYLNCKYGKSRMLSEVGLGESGYQVTKYIYATPDLII--  134

Query  1134  WTNLVSPKSS---WIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLP  964
              +N +S  SS   WIGY+AV +DE E +RLGRRDV++ +RGT T PEW+ NL ++LT  P
Sbjct  135   GSNNISIGSSCGKWIGYIAVSNDE-ETKRLGRRDVLVTFRGTVTSPEWIANLMSSLT--P  191

Query  963   DDMAPRNCEPM--VQRGFLSLYTSASDAHPSL---KDSIRDEITKIIET-YGDEPLSITI  802
               + P N  P   V+ GFLSLYTS  D    L   ++ +  EI +++   Y  E +SITI
Sbjct  192   ARLDPHNPRPQVKVEAGFLSLYTSNEDKKFGLGSCREQLLSEIGRLVNKYYKQEDMSITI  251

Query  801   TGHSLGAALATITAYDIT-------TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKV  643
              GHS+G+ALA + AYDI            H   VTV SFGGPRVGN  F+ + E  G KV
Sbjct  252   AGHSMGSALALLLAYDIAELGLNTHHHHHHMTTVTVFSFGGPRVGNSGFKERCEELGVKV  311

Query  642   LRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvssk  463
             LRI N +DPITK+PG  ++ +     G  +    + W   C      YA VG E+     
Sbjct  312   LRITNVNDPITKLPGVFLNENSRVLGGKYE----VPWSCSC------YAHVGVEI---LL  358

Query  462   dssyskdVATCHDLKTYLHCIDNWSSCKCPLR  367
             D     + +  HDL TYL+ +      KCP R
Sbjct  359   DFFKMHNPSCVHDLGTYLNLL------KCPKR  384



>gb|KCW75867.1| hypothetical protein EUGRSUZ_D00253 [Eucalyptus grandis]
Length=433

 Score =   248 bits (634),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 142/368 (39%), Positives = 209/368 (57%), Gaps = 37/368 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + SKW E  G  DW+ LLDPL  +LR+EI++YG+  +A Y +FDFD++S    +CRY++ 
Sbjct  7     ISSKWREMHGSSDWKDLLDPLHPWLRREIIKYGELAQATYDAFDFDSSSEYCGSCRYNKH  66

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +    GL  +GYKVT  +Y    + +PRW       +  S  S+WIGY+A C D++E R
Sbjct  67    KLFDELGLKQNGYKVTEYIYAMSHMEIPRWLERSRLADTWSKDSNWIGYIA-CSDDEETR  125

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCL--PDDMAPRNCEPMVQRGFLSLYTSASDA  886
             R+GRRD+++A+RGT  P EW E+ +  L  +   DD   R     V+ GFLS+YTS S +
Sbjct  126   RIGRRDILVAWRGTVAPSEWYEDFQRKLEPIGHGDDHHAR-----VEHGFLSIYTSKSKS  180

Query  885   ----HPSLKDSIRDEITKIIETYGD--EPLSITITGHSLGAALATITAYDITTQFRHAPL  724
                   S  + +  EI K+++ Y D  E +S+TITGHSLG ALA + A++ ++   + P 
Sbjct  181   TRYNKSSASEQVMSEIRKLVDLYRDRGEEVSLTITGHSLGGALALLNAHEASSTIPNLP-  239

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             V+V+SFG PRVGN  FR +L   G K LR+V   D + K+PG V +             G
Sbjct  240   VSVISFGAPRVGNGAFRDELHQKGVKTLRVVVKQDMVPKMPGLVFN------------EG  287

Query  543   MLSWLQKCVDS-QWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDNWSSCKC  376
             +  + +    + +WVY  VG EL++  + S Y K        H  +TYLH +D + S + 
Sbjct  288   LERFDEHITGALEWVYTHVGAELKLDVQSSPYLKHGLNFLGFHMTETYLHLVDGFLSTRS  347

Query  375   PLRATAKR  352
               R  AKR
Sbjct  348   NFRVDAKR  355



>gb|EAY79528.1| hypothetical protein OsI_34658 [Oryza sativa Indica Group]
Length=534

 Score =   251 bits (641),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/377 (40%), Positives = 212/377 (56%), Gaps = 50/377 (13%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W  Y G   W+GLLDPLD  LR+E+LRYGDFV+AAY +F    + P+ ++    + 
Sbjct  135   IAGEWRRYHGEGGWDGLLDPLDQNLRREVLRYGDFVQAAYTAFH---SMPSSSSAAASQH  191

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL------VSPKSSWIGYVAVCDDEDEIR  1060
             +      L    Y+ TR+L+ T ++++P W         ++ +SS++GYVAVCD+E E++
Sbjct  192   SQHRTLVLPDRSYRPTRSLFATSSLSIPAWARRRSAPGWLTQRSSFVGYVAVCDNEGEVQ  251

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDM-----APRNCEPMVQRGFLSLYTSA  895
             R+GRRD+ I  RGTAT PEW ENLRA L  + DD      +P+N  P V +GFLSLY +A
Sbjct  252   RMGRRDIAIVLRGTATCPEWAENLRAGLVPVDDDDDDDVGSPQNA-PKVAKGFLSLYKTA  310

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITA--------YDITTQF  739
              D  PSL D+I DE+ ++IE Y  E LSIT+ GHSLGA+LA + A         D+    
Sbjct  311   GDHVPSLSDAIVDEVRRLIEVYEGEELSITVVGHSLGASLAVLAADELSACLSADVAEHR  370

Query  738   RHAPLVTVVSFGGPRVGNKNFRSQLENS-GTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
             R  P + VVSFGGP+ GN+ F  +L+N  G  VLR+VN+ D +T+VP   +  +      
Sbjct  371   RRPPPIAVVSFGGPKTGNRAFADRLQNGRGVNVLRVVNAGDVVTRVPAPAMAREGEG---  427

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNW  391
                                 +   G ELR+ S+DS         A CHDL+ YLH +D +
Sbjct  428   --------------------HVHAGAELRLDSRDSPCLRPDAGPACCHDLEAYLHLLDGF  467

Query  390   SSCKCPLRATAKRVIEK  340
             +    P RA A R + +
Sbjct  468   AGSGRPFRADASRSVAR  484



>ref|XP_010025922.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Eucalyptus 
grandis]
Length=472

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 203/358 (57%), Gaps = 35/358 (10%)
 Frame = -3

Query  1428  LVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPT  1249
             L AA   + LC  W E QG  +WE LL+PL   LR+EI+RYG+FV A Y +FD D AS  
Sbjct  73    LKAATTTSALCPSWREIQGCANWEHLLEPLHPVLRREIVRYGEFVTACYLAFDLDPASKR  132

Query  1248  YATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDED  1069
             Y  C+Y +  ++   G+  SGY+VT+ +Y T  V++P           WIGYVAV  D D
Sbjct  133   YLNCKYGKRRLLEEVGMSDSGYEVTKYIYATTDVSIPMPNGAAPCCGRWIGYVAVASD-D  191

Query  1068  EIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC--EPMVQRGFLSLYTSA  895
               RRLGRRDVVI++RGT T PEW+ N  ++LT  P  + P NC  +  V+ GFL+LYT+ 
Sbjct  192   MARRLGRRDVVISFRGTVTSPEWIANFMSSLT--PARLDPHNCREDVKVESGFLNLYTAD  249

Query  894   SDAH-----PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT-----  745
               A       S ++ +  E++++I+ +  E +SIT+ GHS+G++LA + AYDI+      
Sbjct  250   EAASSKFGIKSCREQLLSEVSRLIKKHKGEEMSITLAGHSMGSSLALLLAYDISEIGLNK  309

Query  744   ------QFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS  583
                     R  P +TV SFGGPRVGN  F+ + +  G KVLRI N +DPITK+PG V + 
Sbjct  310   VTSKNDSIRDIP-ITVFSFGGPRVGNSAFKERCDELGIKVLRIANVNDPITKLPGMVFNE  368

Query  582   DDVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYL  409
                   G  +      W   C      YA VG EL   + D    ++ +  HDL+TYL
Sbjct  369   HFRVLGGKFE----FPWSCSC------YAHVGIEL---ALDFFNVQNPSCVHDLETYL  413



>ref|XP_008371821.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=516

 Score =   250 bits (639),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 141/372 (38%), Positives = 209/372 (56%), Gaps = 44/372 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  KW E  G  DWEGLLDPL  +LR+EI++YG+F +A Y +FDFD+ S    +CRY+++
Sbjct  90    MSEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKN  149

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +    GL  +GY V++ +Y    +++P+W       +  S  S+W+GYVAV DDE E R
Sbjct  150   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVSDDE-ETR  208

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA--  886
             R+GRRD+V+A+RGT  P EW E+++  L  +       + +  V+ GF  +YT+ SD   
Sbjct  209   RIGRRDIVVAWRGTVVPSEWYEDMQRKLEPIG------SGDAKVEHGFHGIYTAKSDTTR  262

Query  885   --HPSLKDSIRDEITKIIETY--GDEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                 S  + +  E+T+++E Y    E +S+TITGHSLG ALA + AY+   +     +++
Sbjct  263   YNKSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALLNAYEAAEKLP-GIMIS  321

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V+SFG PRVGN  F+ +L   G K LR+V   D + K+PG V++                
Sbjct  322   VISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLNES--------------  367

Query  537   SWLQKCVDS----QWVYAEVGKELRvsskdssyskdVA----TCHDLKTYLHCIDNWSSC  382
               LQK  D      WVYA VG EL++    S Y K         H L+TYLH +D + S 
Sbjct  368   --LQKFDDITGTLDWVYAHVGAELKLEIGSSPYLKHGGFNLPGFHSLETYLHLVDGFLST  425

Query  381   KCPLRATAKRVI  346
             +   R+ A+R I
Sbjct  426   ETTFRSNARRDI  437



>ref|XP_008222660.1| PREDICTED: galactolipase DONGLE, chloroplastic [Prunus mume]
Length=471

 Score =   248 bits (634),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 207/376 (55%), Gaps = 33/376 (9%)
 Frame = -3

Query  1443  ASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD  1264
             A++K   +    + L ++W E QG  +WE L++PL   LR+EI+RYGDFV A Y++FD D
Sbjct  65    ANTKTTASTRITSNLANQWREIQGSNNWENLVEPLHPLLRQEIIRYGDFVTACYKAFDLD  124

Query  1263  TASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAV  1084
               S  Y  C+Y +  +    GL   GY+VT+ +Y T  +N+P        +  W+GYVAV
Sbjct  125   PNSKRYLNCKYGKKNMFREVGLESCGYEVTKYIYATPDINIPIQNGESCGR--WMGYVAV  182

Query  1083  CDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC--EPMVQRGFLS  910
               D D ++RLGRRD+VI +RGT T PEW+ NL ++LT  P  + P N   +  V+ GFLS
Sbjct  183   SSD-DAVKRLGRRDIVITFRGTVTNPEWVANLMSSLT--PARLDPHNPRDDVKVESGFLS  239

Query  909   LYTSASDAHP----SLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT--  748
             LYTS          S ++ +  E+++++  Y  E LSIT+ GHS+G++LA +  YDI   
Sbjct  240   LYTSDESESKFGLGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLGYDIAEL  299

Query  747   ----TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSD  580
                    R    +TV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG V + +
Sbjct  300   GLNRENSRRKIPITVFSFGGPRVGNSGFKQRCEELGVKVLRIVNVNDPITKMPGVVFNLE  359

Query  579   DVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
             +    G    S    W   C      Y  VG EL     D    ++ +  HDL TYL  +
Sbjct  360   NFRVLGGGG-SFEFPWSCSC------YTHVGVEL---VLDFFNMQNPSCVHDLGTYLSLL  409

Query  399   DNWSSCKCPLRATAKR  352
                   KCP R   ++
Sbjct  410   ------KCPNRVQIQK  419



>ref|XP_004154680.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Cucumis 
sativus]
Length=455

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 146/377 (39%), Positives = 201/377 (53%), Gaps = 37/377 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L   W + QG+ +WE LLDPL+ +LRKEI+RYG+F +A Y SFDFD  S    TC+Y   
Sbjct  26    LSEIWRDIQGMNNWEALLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQAS  85

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTN-----LVSPKSSWIGYVAVCDDEDEIRR  1057
                 +  +   GY +TR LY T  +N+P +       L S  ++W+GYVAV  D DEI+R
Sbjct  86    HFFNKLLMPDPGYNITRYLYATSNINLPNFFKKSKFTLWSQHANWMGYVAVATDADEIKR  145

Query  1056  LGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASD----  889
             LGRRD+VIA+RGT T  EW+ +L+  L   P    P +    ++ GF  LYT   +    
Sbjct  146   LGRRDIVIAWRGTVTYLEWIHDLKDILR--PAGFIPDDTSVKIESGFYDLYTMKEENCNY  203

Query  888   AHPSLKDSIRDEITKIIETY---GDEPLSITITGHSLGAALATITAYDITTQFRH-----  733
                S ++ I  E+ +++E Y   G E +SIT+TGHSLGAALA ITAYDI     +     
Sbjct  204   CGFSAREQILAEVKRLVEKYCKLGGEEISITVTGHSLGAALALITAYDIAEMKLNIVARG  263

Query  732   -----APLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSD  568
                  A  +TV SF GPRVGN  F+ + E  G KVLR++N  D +  VPG + +      
Sbjct  264   GSSAVAVPITVYSFAGPRVGNLKFKERCEELGVKVLRVINVHDKVPMVPGIIAN------  317

Query  567   CGTTQPSGMLSWLQKCVDSQWVYAEVGKEL---RvsskdssyskdVATCHDLKTYLHCID  397
                 +      +L++ +   W YA VG EL      S     + D+   H+L+ YLH ID
Sbjct  318   ----EKLQFQKYLEEAIAFPWSYAHVGTELSLDHTHSPFLMSTNDLGCAHNLEAYLHLID  373

Query  396   NWSSCKCPLRATAKRVI  346
              +       R   KR I
Sbjct  374   GYHGKGRKFRLETKRDI  390



>gb|KHN12425.1| Phospholipase A1-Igamma1, chloroplastic [Glycine soja]
Length=820

 Score =   256 bits (653),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 143/368 (39%), Positives = 209/368 (57%), Gaps = 37/368 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  KW E QG  +WE +LDPL  +LR+EI++YG+F +A Y +FD+D+ S    +CRY+++
Sbjct  7     ISQKWREIQGYHNWEDILDPLQPWLRREIVKYGEFAQATYDAFDYDSFSEYCGSCRYNQN  66

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +  + GL  + Y VTR +Y    + +PRW       +  S  S+WIG+VAV DD DE R
Sbjct  67    KLFEKLGLTRNSYTVTRYIYAMSHIELPRWLERSHVADTWSKDSNWIGFVAVSDD-DETR  125

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA--  886
             R+GRRD+V+A+RGT  P EW E+ +  L  +       + +  V+ GFLS+Y S S+   
Sbjct  126   RIGRRDIVVAWRGTVAPCEWYEDFQRKLDPIG------HGDAKVEHGFLSIYKSKSETTR  179

Query  885   --HPSLKDSIRDEITKIIETY---GDEPLSITITGHSLGAALATITAYDITTQFRHAPLV  721
                 S  D +  E+TK++  Y     E +S+TITGHSLG ALA I AY++ T F   P V
Sbjct  180   YNKSSASDQVMKEVTKLVNFYKGKKGEEVSLTITGHSLGGALALINAYEVATTFLDLP-V  238

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM  541
             +V+SFG PRVGN  F+ +L   G K+LR+V   D + K+PG + +               
Sbjct  239   SVISFGAPRVGNIAFKDELHQMGVKLLRVVVKQDWVPKMPGLLFNEK-------------  285

Query  540   LSWLQKCVDSQWVYAEVGKELRvsskdssys---kdVATCHDLKTYLHCIDNWSSCKCPL  370
             L    +    +WVY  VG EL +    S Y     +++  H L+TYLH ID + S + P 
Sbjct  286   LKMFDEITGLEWVYTHVGAELALDVHSSPYLKGGMNLSGFHSLETYLHLIDGYLSHETPF  345

Query  369   RATAKRVI  346
             R+ A+R I
Sbjct  346   RSEARRDI  353



>ref|XP_009792730.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Nicotiana 
sylvestris]
Length=505

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 207/369 (56%), Gaps = 43/369 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W +  G+++WEGLLDPL   LR+EI++YG+F +A Y + DFD  S    +C Y+  
Sbjct  94    ISDRWRDIHGVQEWEGLLDPLHPLLRREIVKYGEFAQATYDALDFDAFSEYCGSCMYNSQ  153

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +  + GL  SGYKVT+ +Y    +++P+W      T   S  S+WIG+VAV DDE E R
Sbjct  154   KLFDKLGLSKSGYKVTKYIYAMSHIDMPQWLERSRLTYTWSKDSNWIGFVAVSDDE-ESR  212

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHP  880
             R+GRRD+V+A+RGT TP EW EN++  L  +       + +  V+ GFLS+YTS SD+  
Sbjct  213   RIGRRDIVVAWRGTVTPSEWYENMQRKLEPIG------HMDSKVEHGFLSIYTSKSDSTR  266

Query  879   SLKDSIRDEITKIIETYGD------EPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
               K S  +++ K ++   D      E +S+TITGHSLG ALA + AY+   +F   P ++
Sbjct  267   YNKSSASEQVMKELKILVDFYKSKGEEVSLTITGHSLGGALALLNAYESAAKFPRIP-IS  325

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V+SF  PRVGN  FR ++   G K+LR+    D + ++PG V +                
Sbjct  326   VISFAAPRVGNIAFRDEIYQMGVKILRVTVKQDLVPRMPGIVFNES--------------  371

Query  537   SWLQKCVDS----QWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDNWSSCK  379
               LQK  D     +W+Y  VG EL++  + S Y K        H L+TYLH +D + S  
Sbjct  372   --LQKFDDFTGTLEWIYTHVGAELKLDVRSSPYLKRGFNFIGFHMLETYLHLVDGFVSTS  429

Query  378   CPLRATAKR  352
                R+ AKR
Sbjct  430   STFRSNAKR  438



>ref|XP_010052014.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Eucalyptus 
grandis]
Length=520

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/368 (39%), Positives = 209/368 (57%), Gaps = 37/368 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + SKW E  G  DW+ LLDPL  +LR+EI++YG+  +A Y +FDFD++S    +CRY++ 
Sbjct  94    ISSKWREMHGSSDWKDLLDPLHPWLRREIIKYGELAQATYDAFDFDSSSEYCGSCRYNKH  153

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +    GL  +GYKVT  +Y    + +PRW       +  S  S+WIGY+A C D++E R
Sbjct  154   KLFDELGLKQNGYKVTEYIYAMSHMEIPRWLERSRLADTWSKDSNWIGYIA-CSDDEETR  212

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCL--PDDMAPRNCEPMVQRGFLSLYTSASDA  886
             R+GRRD+++A+RGT  P EW E+ +  L  +   DD   R     V+ GFLS+YTS S +
Sbjct  213   RIGRRDILVAWRGTVAPSEWYEDFQRKLEPIGHGDDHHAR-----VEHGFLSIYTSKSKS  267

Query  885   ----HPSLKDSIRDEITKIIETYGD--EPLSITITGHSLGAALATITAYDITTQFRHAPL  724
                   S  + +  EI K+++ Y D  E +S+TITGHSLG ALA + A++ ++   + P 
Sbjct  268   TRYNKSSASEQVMSEIRKLVDLYRDRGEEVSLTITGHSLGGALALLNAHEASSTIPNLP-  326

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             V+V+SFG PRVGN  FR +L   G K LR+V   D + K+PG V +             G
Sbjct  327   VSVISFGAPRVGNGAFRDELHQKGVKTLRVVVKQDMVPKMPGLVFN------------EG  374

Query  543   MLSWLQKCVDS-QWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDNWSSCKC  376
             +  + +    + +WVY  VG EL++  + S Y K        H  +TYLH +D + S + 
Sbjct  375   LERFDEHITGALEWVYTHVGAELKLDVQSSPYLKHGLNFLGFHMTETYLHLVDGFLSTRS  434

Query  375   PLRATAKR  352
               R  AKR
Sbjct  435   NFRVDAKR  442



>ref|XP_007033998.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY04924.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=448

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 147/354 (42%), Positives = 206/354 (58%), Gaps = 32/354 (9%)
 Frame = -3

Query  1422  AADRAAKLCSK-WMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTY  1246
             A  + + + S+ W E QG  +WE L++PL   LRKEI+RYG+FV A Y++FD D  S  Y
Sbjct  63    AVSKTSSILSRFWREIQGSNNWENLVEPLHPLLRKEIIRYGEFVAACYKAFDLDPNSRRY  122

Query  1245  ATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDE  1066
               C+Y + +++   G+  SGY+VT+ +Y T  VN+P  T   +    WIGYVAV  D D 
Sbjct  123   LNCKYGKKSMLKEVGMENSGYQVTKYIYATPDVNIPIQT---ASCGRWIGYVAVSSD-DA  178

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTS-A  895
             ++RLGRRDV+I +RGT T  EW+ N  ++LT  P  + P N  P   V+ GFLSLYTS  
Sbjct  179   VKRLGRRDVLITFRGTVTNHEWVANFMSSLT--PARLDPHNPRPEVKVESGFLSLYTSDE  236

Query  894   SDAHPSL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT------TQ  742
             +D+   L   ++ +  E+++I+  Y  E LSIT+ GHS+G+ALA + AYDIT      T 
Sbjct  237   TDSKFGLESCREQLLSEVSRILNKYKGEKLSITVAGHSMGSALALLFAYDITELGLNKTD  296

Query  741   FRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
                   VTV SFGGPRVGN +F+ + E  G KVLRI N +DPITK+PG + + +     G
Sbjct  297   SDQEIPVTVFSFGGPRVGNSSFKQRCEELGVKVLRIANVNDPITKLPGVLFNENFRVLGG  356

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
               +      W   C      YA VG EL     D    ++ +  HDL+TY+  +
Sbjct  357   RYE----FPWSCSC------YAHVGVEL---VLDFFNVQNPSCVHDLETYISLL  397



>ref|XP_008783953.1| PREDICTED: galactolipase DONGLE, chloroplastic-like [Phoenix 
dactylifera]
Length=442

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 211/364 (58%), Gaps = 38/364 (10%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             L S W E QG  DWE L++PL+  LR+EI+RYG+FV A Y++FD D +S  Y  C+Y + 
Sbjct  64    LASVWREIQGSDDWEDLVEPLNPLLRQEIVRYGEFVAACYKAFDLDPSSKRYLNCKYGKR  123

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGRRD  1042
             +++   G+  SGY+VT+ +Y T  +++P  T   + +S W+GYVAV  DE E+RRLGRRD
Sbjct  124   SMLREVGMESSGYEVTKYVYATPDIDIP--TQGGTCRSRWVGYVAVSKDE-EVRRLGRRD  180

Query  1041  VVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSASD----AHP  880
             +++++RGT T  EW+ NL+ +LT  P  + P    P   V+ GFLSLYTS       +  
Sbjct  181   ILVSFRGTVTNTEWIANLKCSLT--PARLDPHEPRPDVKVESGFLSLYTSDESSCKFSSG  238

Query  879   SLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT-------QFRHAPLV  721
             S ++ +  E+++II  Y DE LSIT+ GHS+G++LA +  YD+           R  P +
Sbjct  239   SCREQLLSEVSRIINKYKDEELSITLAGHSMGSSLALLLGYDLAELGLNRDGSNRDVP-I  297

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM  541
             TV SF GPRVGN  F+ + E  G KVLR+VN +DP+TK+PG  ++ +     G  +    
Sbjct  298   TVYSFAGPRVGNSGFKERCEELGVKVLRVVNVNDPVTKLPGVFLNENSQVLAGRYK----  353

Query  540   LSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRAT  361
             L W   C      YA VG EL   + D    K+ A  HD+  Y+  +      KCP  A 
Sbjct  354   LPWSCSC------YAHVGVEL---ALDFFKMKNPACVHDIDAYIGLL------KCPKMAA  398

Query  360   AKRV  349
               ++
Sbjct  399   QVKM  402



>ref|XP_007223991.1| hypothetical protein PRUPE_ppa014790mg, partial [Prunus persica]
 gb|EMJ25190.1| hypothetical protein PRUPE_ppa014790mg, partial [Prunus persica]
Length=418

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 201/364 (55%), Gaps = 33/364 (9%)
 Frame = -3

Query  1407  AKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYD  1228
             + L  +W E QG  +WE L++PL   LR+EI+RYGDFV A Y++F+ D  S  Y  C+Y 
Sbjct  24    SNLAHQWREIQGSNNWENLVEPLHPLLRQEIIRYGDFVTACYKAFNLDPNSKRYLNCKYG  83

Query  1227  EDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLGR  1048
             +  +    GL   GY+VT+ +Y T  +N+P           W+GYVAV  D D ++RLGR
Sbjct  84    KKNMFREVGLESCGYEVTKYIYATPDINIPIQNG--ESCGRWMGYVAVSSD-DAVKRLGR  140

Query  1047  RDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC--EPMVQRGFLSLYTSASDAHP--  880
             RD+VI +RGT T PEW+ NL ++LT  P  + P N   +  V+ GFLSLYTS        
Sbjct  141   RDIVITFRGTVTNPEWVANLMSSLT--PARLDPHNPRDDVKVESGFLSLYTSDESESKFG  198

Query  879   --SLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT------TQFRHAPL  724
               S ++ +  E+++++  Y  E LSIT+ GHS+G++LA +  YDI          R    
Sbjct  199   LGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLGYDIAELGLNRENSRRKIP  258

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             +TV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG V + ++    G  + S 
Sbjct  259   ITVFSFGGPRVGNSGFKQRCEELGVKVLRIVNVNDPITKMPGVVFNLENFRVLGGGE-SF  317

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
                W   C      Y  VG EL     D    ++ +  HDL TYL      S  KCP R 
Sbjct  318   EFPWSCSC------YTHVGVEL---VLDFFNMQNPSCVHDLGTYL------SLLKCPNRV  362

Query  363   TAKR  352
               ++
Sbjct  363   QIQK  366



>ref|XP_006478993.1| PREDICTED: phospholipase A1-Ialpha2, chloroplastic-like [Citrus 
sinensis]
Length=431

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 216/363 (60%), Gaps = 32/363 (9%)
 Frame = -3

Query  1446  AASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDF  1267
             AASS   VAA   + L   W E QG  DWE L++PL   LR+EI+RYG+ V A Y++FD 
Sbjct  31    AASS---VAAKTCSMLAHFWREIQGFNDWENLVEPLHPLLRQEIIRYGELVTACYKAFDL  87

Query  1266  DTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSS----WI  1099
             D  S  +  C+Y ++++M   GL  SGY+VT+ +Y T  +N+      V+  SS    WI
Sbjct  88    DPVSKRFLNCKYGKNSMMREVGLQDSGYQVTKYIYATPDININIPIQNVASSSSSCSRWI  147

Query  1098  GYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQ  925
             GYVAV  DE  ++RLGRRDVV+++RGT T PEW+ N  ++LT  P  + P N  P   V+
Sbjct  148   GYVAVSSDES-VKRLGRRDVVVSFRGTVTNPEWIANFMSSLT--PARLDPNNPRPDVKVE  204

Query  924   RGFLSLYTS-ASDAH--PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYD  754
              GFLSLYTS  SD     S ++ +  E+++++  Y  E LSIT+ GHS+G++LA + AYD
Sbjct  205   SGFLSLYTSDESDKFGLGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLAYD  264

Query  753   IT----TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVD  586
             I      + +    VTV S+GGPRVGN  F+++ +  G KVLRIVN +DPITK+PG +++
Sbjct  265   IAELGLNKTQSQIPVTVFSYGGPRVGNSGFKARCDELGVKVLRIVNINDPITKLPGVLLN  324

Query  585   SD-DVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYL  409
              +  V + G     G   +   C      YA VG EL     D    ++ +  HDL++Y+
Sbjct  325   ENFRVLELG-----GRFEFPWSCS----CYAHVGVEL---VLDFFNVQNPSCVHDLESYI  372

Query  408   HCI  400
             + +
Sbjct  373   NLL  375



>ref|XP_009798317.1| PREDICTED: galactolipase DONGLE, chloroplastic [Nicotiana sylvestris]
Length=459

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/368 (41%), Positives = 203/368 (55%), Gaps = 39/368 (11%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             +L S W E QG  +WE L+DPLD  LR+EI+RYG+FV A Y +FD D  S  Y  C+Y +
Sbjct  71    RLASMWREVQGSNNWENLVDPLDSLLREEIIRYGEFVAACYDAFDLDPNSKRYLNCKYGK  130

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW--TNLVSPK-SSWIGYVAVCDDEDEIRRL  1054
               ++   GL  SGY+VT+ +Y T  +NV      N+ S     WIGY+AV +DE E +RL
Sbjct  131   KRMLREVGLEDSGYQVTKYIYATPDINVFHIGGNNIGSSSCGRWIGYIAVSNDE-ETKRL  189

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM--VQRGFLSLYTSASDAHP  880
             GRRDV++ +RGT T PEW+ NL ++LT  P  + P N  P   V+ GFLSLYTS      
Sbjct  190   GRRDVLVTFRGTVTSPEWIANLMSSLT--PARLDPHNPRPQVKVEAGFLSLYTSNEGEKF  247

Query  879   SL---KDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT--------QFRH  733
              L   ++ +  E+ K++  Y  E +SIT+ GHS+G+ALA + AYDI             H
Sbjct  248   GLESCREQLLSEVGKVLNKYKGEEMSITLAGHSMGSALAILLAYDIAELGLNRNRLSNNH  307

Query  732   APL-VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
               + VTV SFGGPRVGN  F+ + E  G KVLRI N +DPITK+PG  ++       G  
Sbjct  308   TVVPVTVFSFGGPRVGNSGFKERCEELGVKVLRITNVNDPITKLPGVFLNEHFRVLGGWY  367

Query  555   QPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKC  376
             +    + W   C      YA VG E+     D     + +  HDL TYL      S  KC
Sbjct  368   E----VPWSCSC------YAHVGVEI---LLDFFKMHNPSCVHDLGTYL------SLLKC  408

Query  375   PLRATAKR  352
             P R    +
Sbjct  409   PKRLQVHK  416



>ref|XP_009605461.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Nicotiana 
tomentosiformis]
Length=505

 Score =   248 bits (632),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 206/369 (56%), Gaps = 43/369 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W +  G+++WEGLLDPL   LR+EI++YG+F +A Y + DFD  S    +C Y+  
Sbjct  94    ISDRWRDIHGVQEWEGLLDPLHPLLRREIVKYGEFAQATYDALDFDAFSEYCGSCMYNSH  153

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +  + GL  SGYKVT+ +Y    +++P+W      T   S  S+WIG+VAV DDE E R
Sbjct  154   KLFDKLGLSKSGYKVTKYIYAMSHIDMPQWLEKSRLTYTWSKDSNWIGFVAVSDDE-ESR  212

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDAHP  880
             R+GRRD+V+A+RGT TP EW EN++  L  +       + +  V+ GFLS+YTS SD   
Sbjct  213   RIGRRDIVVAWRGTVTPSEWYENMQRKLEPIG------HVDSKVEHGFLSIYTSKSDLTR  266

Query  879   SLKDSIRDEITKIIETYGD------EPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
               K S  +++ K ++   D      E +S+TITGHSLG ALA + AY+   +F   P ++
Sbjct  267   YNKSSASEQVMKELKILVDYYKSKGEEVSLTITGHSLGGALALLNAYESAAKFPRLP-IS  325

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V+SF  PRVGN  FR ++   G K+LR+    D + ++PG V +                
Sbjct  326   VISFAAPRVGNIAFRDEIYQMGIKILRVTVKQDLVPRMPGIVFNES--------------  371

Query  537   SWLQKCVDS----QWVYAEVGKELRvsskdssyskdVAT---CHDLKTYLHCIDNWSSCK  379
               LQK  D     +W+Y  VG EL++  + S Y K        H L+TYLH +D + S  
Sbjct  372   --LQKFDDFTGTLEWIYTHVGAELKLDVRSSPYLKRGFNFIGFHMLETYLHLVDGFVSTS  429

Query  378   CPLRATAKR  352
                R+ AKR
Sbjct  430   STFRSNAKR  438



>ref|XP_006443133.1| hypothetical protein CICLE_v10024085mg, partial [Citrus clementina]
 gb|ESR56373.1| hypothetical protein CICLE_v10024085mg, partial [Citrus clementina]
Length=476

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 216/363 (60%), Gaps = 32/363 (9%)
 Frame = -3

Query  1446  AASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDF  1267
             AASS   VAA   + L   W E QG  DWE L++PL   LR+EI+RYG+ V A Y++FD 
Sbjct  76    AASS---VAAKTCSMLAHFWREIQGFNDWENLVEPLHPLLRQEIIRYGELVTACYKAFDL  132

Query  1266  DTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSS----WI  1099
             D  S  +  C+Y ++++M   GL  SGY+VT+ +Y T  +N+      V+  SS    WI
Sbjct  133   DPVSKRFLNCKYGKNSMMREVGLQDSGYQVTKYIYATPDININIPIQNVASSSSSCSRWI  192

Query  1098  GYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQ  925
             GYVAV  DE  ++RLGRRDVV+++RGT T PEW+ N  ++LT  P  + P N  P   V+
Sbjct  193   GYVAVSSDES-VKRLGRRDVVVSFRGTVTNPEWIANFMSSLT--PARLDPNNPRPDVKVE  249

Query  924   RGFLSLYTS-ASDAH--PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYD  754
              GFLSLYTS  SD     S ++ +  E+++++  Y  E LSIT+ GHS+G++LA + AYD
Sbjct  250   SGFLSLYTSDESDKFGLGSCREQLLSEVSRLLNKYKGEELSITLAGHSMGSSLALLLAYD  309

Query  753   IT----TQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVD  586
             I      + +    VTV S+GGPRVGN  F+++ +  G KVLRIVN +DPITK+PG +++
Sbjct  310   IAELGLNKTQSQIPVTVFSYGGPRVGNSGFKARCDELGVKVLRIVNINDPITKLPGVLLN  369

Query  585   SD-DVSDCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYL  409
              +  V + G     G   +   C      YA VG EL     D    ++ +  HDL++Y+
Sbjct  370   ENFRVLELG-----GRFEFPWSCS----CYAHVGVEL---VLDFFNVQNPSCVHDLESYI  417

Query  408   HCI  400
             + +
Sbjct  418   NLL  420



>emb|CDP14642.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   246 bits (627),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 144/355 (41%), Positives = 203/355 (57%), Gaps = 41/355 (12%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
              ++L   W E QG+ +WE L++PLD  LR+EI+RYG+FV A Y++F+ D  S  Y  C+Y
Sbjct  72    GSRLACVWREIQGMNNWENLVEPLDSLLREEIIRYGEFVVACYKAFELDPNSKRYLNCKY  131

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPK-SSWIGYVAVCDDEDEIRRL  1054
              +  ++   GL  SGY+VT+ +Y T  +NVP      SP    W+GYVAV  D  E  +L
Sbjct  132   GKRNLLNDVGLENSGYEVTKYIYATPDINVPIQN---SPSCGRWVGYVAVSSDH-ESAKL  187

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTS----AS  892
             GRRD++I +RGT T PEW+ NL ++LT     + P N  P   V+ GFLSLYT+    + 
Sbjct  188   GRRDLLITFRGTVTNPEWIANLMSSLT--EARLDPHNPRPEVKVESGFLSLYTADESQSK  245

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT--------TQFR  736
                PS ++ +  E+++++  Y  E +SITI GHS+G++LA + AYDI+        +   
Sbjct  246   FGLPSCREQLLSEVSRVLNKYQGEEMSITIAGHSMGSSLALLLAYDISELGLNKEVSTND  305

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
             H P VTV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG   +          
Sbjct  306   HVP-VTVFSFGGPRVGNSGFKERCEELGVKVLRIVNVNDPITKLPGVFFNES--------  356

Query  555   QPSGMLSWLQKCVDSQW---VYAEVGKELRvsskdssyskdVATCHDLKTYLHCI  400
                  L  L +  D  W    YA VG EL     D     + +  HDL+TY++ +
Sbjct  357   -----LKVLAERYDLPWSCSCYAHVGVEL---LLDFFKMHNPSCVHDLETYINLL  403



>ref|XP_011000043.1| PREDICTED: galactolipase DONGLE, chloroplastic [Populus euphratica]
Length=450

 Score =   245 bits (626),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 208/370 (56%), Gaps = 38/370 (10%)
 Frame = -3

Query  1422  AADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYA  1243
             ++ R + L   W E  G  +WEGL++PL  +LR+EI+RYG+FV A Y++FD D  S  Y 
Sbjct  67    SSSRTSTLAHMWREVHGCNNWEGLVEPLHPFLRQEIIRYGEFVTACYQAFDLDPNSKRYL  126

Query  1242  TCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPK-SSWIGYVAVCDDEDE  1066
             TC+Y +  +    G+G  GY+VT+ +Y T  VN+P       P    W+GYVAV  D D 
Sbjct  127   TCKYGKKNLFREVGMGNPGYEVTKYIYATPDVNIPIQN---EPSCGRWVGYVAVSSD-DA  182

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTS-A  895
             +RRLGRRD+VI +RGT T PEW+ N  ++LT  P  +   N  P   V+ GFLSLYTS  
Sbjct  183   VRRLGRRDIVITFRGTVTNPEWIANFMSSLT--PAKLDHNNPRPDVKVESGFLSLYTSNE  240

Query  894   SDAHPSLK---DSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITT--QFRHA  730
             SD    LK   + +  E+++++  Y  E LSI+++GHS+G++LA + AYDI      R +
Sbjct  241   SDDKFGLKSCREQLLSEVSRLLNRYKGEELSISLSGHSMGSSLALLLAYDIAELGLNRLS  300

Query  729   P----LVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
             P     VTV SFGGPRVGN  F+ + E  G +VLRIVN +DPITK+PG   + +     G
Sbjct  301   PNLDIPVTVFSFGGPRVGNLGFKERCEELGVRVLRIVNVNDPITKLPGVFFNENFRVLGG  360

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSC  382
               +      W   C      YA VG E+     D    ++ +  HDL +Y+      S  
Sbjct  361   RYE----FPWSCSC------YAHVGVEI---VLDFFNMQNPSCVHDLGSYI------SLL  401

Query  381   KCPLRATAKR  352
             KCP +    R
Sbjct  402   KCPKKGDQVR  411



>ref|XP_011073877.1| PREDICTED: galactolipase DONGLE, chloroplastic [Sesamum indicum]
Length=460

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 203/363 (56%), Gaps = 39/363 (11%)
 Frame = -3

Query  1422  AADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYA  1243
             A    +KL S W + QG+ +WE L++PLD  LR EI+RYG+ V A Y++FD D +S  Y 
Sbjct  73    AKSVVSKLASAWRDIQGLNNWENLVEPLDPLLRHEIIRYGELVAACYKAFDLDPSSKRYL  132

Query  1242  TCRYDEDAVMTRCGLGGSGYKVTRNLYGTCA-VNVPRWTNLVSPKSSWIGYVAVCDDEDE  1066
              C+Y + +++   GL  SGY+VT+ +Y     +N+P  T      + WIGYV V  D  E
Sbjct  133   NCKYGKRSMLREAGLADSGYEVTKYIYAAAPDINIPIQTG----AARWIGYVGVASDR-E  187

Query  1065  IRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEP--MVQRGFLSLYTSAS  892
             ++ LGRRD+VI +RGT T PEWL NL ++LT  P  + P +  P   V+ GFLSLYTS  
Sbjct  188   VKTLGRRDIVITFRGTVTNPEWLANLMSSLT--PARLDPHDPRPNVKVEAGFLSLYTSNE  245

Query  891   DAH----PSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
                     S ++ +  E+++++  + DE +SIT+ GHS+G++LA + AYDI     + P 
Sbjct  246   SGSRFGLESCREQLLSEVSRLVHKHKDEEISITLAGHSMGSSLALLLAYDIAELGLNKPS  305

Query  723   ---------VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVS  571
                      VTV SFGGPRVGN  F+ + E  G KVLR+VN +DPITK+PG V + +   
Sbjct  306   NNGSEKEIPVTVFSFGGPRVGNSGFKKRCEELGVKVLRVVNVNDPITKLPGVVFNENFRG  365

Query  570   DCGTTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTY---LHCI  400
               G  +      W   C      YA VG EL     D     + +  HDL+ Y   L C 
Sbjct  366   FGGGFE----FPWSCSC------YAHVGVEL---MLDFFKMHNPSCVHDLENYIGLLKCP  412

Query  399   DNW  391
              +W
Sbjct  413   KSW  415



>ref|XP_004167249.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
Length=534

 Score =   247 bits (631),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 208/367 (57%), Gaps = 33/367 (9%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             K+ + W +  G  DWEGLLDPL  +LR+EI++YG+F +A Y +FDFD  S    +CRY+ 
Sbjct  127   KISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNR  186

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEI  1063
               ++   GL  +GYKVT+ +Y    V+ P W        + S  S+W+G+VAV  DE E 
Sbjct  187   QKLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGFVAVSSDE-ES  245

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASD--  889
              R+GRRD+++++RGT TP EW  +L+  L  +       N +  VQRGFL++Y S  +  
Sbjct  246   DRIGRRDILVSWRGTVTPTEWYIDLKTKLKKIDRS----NKKVKVQRGFLTIYKSKDEDS  301

Query  888   --AHPSLKDSIRDEITKIIETY---GDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
                  S  + + +E+ ++I+ +   GD  +S+TITGHSLG AL+ +TAY+    F     
Sbjct  302   KFNKTSASEQVMEELHRLIDFFKQKGDREISLTITGHSLGGALSLLTAYEAGVTFPADVH  361

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             V+VVSFG PRVGN  FR +L   G K+LR+V   D + K+PG  V+S        T   G
Sbjct  362   VSVVSFGAPRVGNLAFREKLNEMGVKILRVVIGQDIVPKLPGLFVNSIVNKLSAVT---G  418

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
              L+         WVY  VGKELR++   S       D++  H+L+ YLH +D + + K  
Sbjct  419   KLN---------WVYRHVGKELRMNMFMSPYLKKDSDMSGSHNLEIYLHLVDGFVTKKGK  469

Query  372   LRATAKR  352
              R  ++R
Sbjct  470   FRWNSRR  476



>gb|ABR17156.1| unknown [Picea sitchensis]
Length=489

 Score =   246 bits (627),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/396 (37%), Positives = 218/396 (55%), Gaps = 42/396 (11%)
 Frame = -3

Query  1467  SWTTLGNAASSKCLVAADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEA  1288
             S TT GN+      V+  + A L   W + QGI  W+G LDP++  L+ EILRYG+F + 
Sbjct  26    SGTTDGNS-DGPAQVSQPQVANL---WPDIQGINSWKGFLDPINPILKAEILRYGEFAQL  81

Query  1287  AYRSFDFDTASPTYATCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKS  1108
              Y +FD    S  Y TC++ + ++  + G G SGY++T+ +Y    V    +      + 
Sbjct  82    CYDAFDDRHYSKYYGTCKHSKRSLFGKTGFGNSGYEITKYIYANTHVLGSFFGERSRDEG  141

Query  1107  SWIGYVAVCDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMA--------  952
              WIG++AVC D  EI+RLGRRD+VIA+RGT+TP EW+E+L+  L       A        
Sbjct  142   VWIGFIAVCTDPKEIKRLGRRDIVIAWRGTSTPQEWIEDLKDILVTATLSHAKSPGRPSS  201

Query  951   ---PRNCEPMV--QRGFLSLYTSASDAHPSLKDSIRD----EITKIIETYGDEPLSITIT  799
                P + +P V  ++GF+  YTS ++       S RD    EI+++++ Y  E LSIT+T
Sbjct  202   TTVPSSPDPNVRIEKGFMDCYTSMNEESEKCSRSARDIVVGEISRLLKQYEGESLSITLT  261

Query  798   GHSLGAALATITAYDI----TTQFRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIV  631
             GHSLGAALAT++AYDI     T  + A  VTV +F  PRVGN  F  ++E  G KVLR+V
Sbjct  262   GHSLGAALATLSAYDIKETVNTSMQSAIPVTVFAFASPRVGNPTFARRMEEIGVKVLRLV  321

Query  630   NSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWLQKCVD-SQWVYAEVGKELR---vssk  463
             N DD + K PGF ++ +             + WL + +D   W Y+ VG ++     SS 
Sbjct  322   NKDDVVPKFPGFFMNEN-------------MGWLSRLLDWLPWTYSHVGIKVSLDIESSS  368

Query  462   dssyskdVATCHDLKTYLHCIDNWSSCKCPLRATAK  355
                 +  ++  H L+ YLH +D + + K P + + +
Sbjct  369   FLKQTHSLSDFHSLEVYLHLLDGFVAEKKPFKPSGR  404



>ref|NP_001065393.2| Os10g0562200 [Oryza sativa Japonica Group]
 gb|AAK31273.1|AC079890_9 putative lipase [Oryza sativa Japonica Group]
 gb|AAP55024.1| Lipase family protein [Oryza sativa Japonica Group]
 gb|EAZ16984.1| hypothetical protein OsJ_32469 [Oryza sativa Japonica Group]
 dbj|BAF27230.2| Os10g0562200 [Oryza sativa Japonica Group]
Length=534

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/374 (39%), Positives = 209/374 (56%), Gaps = 44/374 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W  Y     W+GLLDPLD  LR+E+LRYGDFV+AAY +F    + P+ ++    + 
Sbjct  135   IAGEWRRYHSEGGWDGLLDPLDQNLRREVLRYGDFVQAAYTAFH---SMPSSSSAAASQH  191

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL------VSPKSSWIGYVAVCDDEDEIR  1060
             +      L    Y+ TR+L+ T ++++P W         ++ +SS++GYVAVCD+E E++
Sbjct  192   SQHRTLVLPDRSYRPTRSLFATSSLSIPAWARRRSAPGWLTQRSSFVGYVAVCDNEGEVQ  251

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDM-----APRNCEPMVQRGFLSLYTSA  895
             R+GRRD+ I  RGTAT PEW ENLRA L  + DD      +P+N  P V +GFLSLY +A
Sbjct  252   RMGRRDIAIVLRGTATCPEWAENLRAGLVPVDDDDDDDVGSPQNA-PKVAKGFLSLYKTA  310

Query  894   SDAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITA--------YDITTQF  739
              D  PSL D+I DE+ +++E +  E LSIT+ GHSLGA+LA + A         D+    
Sbjct  311   GDHVPSLSDAIVDEVRRLVEVFEGEELSITVVGHSLGASLAVLAADELSACLSADVAEHR  370

Query  738   RHAPLVTVVSFGGPRVGNKNFRSQLENS-GTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
             R  P + VVSFGGP+ GN+ F  +L+N  G  VLR+VN+ D +T+VP   +  +     G
Sbjct  371   RRPPPIAVVSFGGPKTGNRAFADRLQNGRGVNVLRVVNAGDVVTRVPAPAMAREGE---G  427

Query  561   TTQPSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSC  382
                    L    +  DS  +  + G                A CHDL+ YLH +D ++  
Sbjct  428   HVHAGAELRLDSR--DSPCLRPDAGP---------------ACCHDLEAYLHLLDGFAGS  470

Query  381   KCPLRATAKRVIEK  340
               P RA A R + +
Sbjct  471   GRPFRADASRSVAR  484



>ref|XP_008444745.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Cucumis melo]
Length=535

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 209/366 (57%), Gaps = 33/366 (9%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + + W +  G  DWEGLLDPL  +LR+EI++YG+F +A Y +FDFD  S    +CRY+  
Sbjct  129   ISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNRH  188

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              ++   GL  +GYKVT+ +Y    V+ P W        + S  S+W+GYVAV  DE E  
Sbjct  189   KLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGYVAVSSDE-ESD  247

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASD---  889
             R+GRRD+++A+RGT TP EW  +L+  L  +       N +  VQRGFL++Y S  +   
Sbjct  248   RIGRRDILVAWRGTVTPTEWYIDLKTKLKKIDRS----NKKVKVQRGFLTIYKSKDEDSK  303

Query  888   -AHPSLKDSIRDEITKIIETY---GDEPLSITITGHSLGAALATITAYDITTQFRHAPLV  721
                 S  + + +E+ ++I+ +   GD  +S+TITGHSLG AL+ +TAY+    F     V
Sbjct  304   FNKTSASEQVMEELHRLIDFFKEKGDREISLTITGHSLGGALSLLTAYEAGVTFPADVHV  363

Query  720   TVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGM  541
             +VVSFG PRVGN  FR +L   G K LR+V   D + K+PG  V+S  V+  G    +G 
Sbjct  364   SVVSFGAPRVGNLAFREKLNEMGVKTLRVVIRQDIVPKLPGLFVNS-IVNKLGAV--TGK  420

Query  540   LSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPL  370
             L+         WVY  VGKELR++   S       D++  H+L+ YLH +D + + K   
Sbjct  421   LN---------WVYRHVGKELRMNMYMSPYLKKDSDMSGSHNLEIYLHLVDGFVAKKGKF  471

Query  369   RATAKR  352
             R  ++R
Sbjct  472   RWNSRR  477



>ref|XP_004135535.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65881.1| hypothetical protein Csa_1G537320 [Cucumis sativus]
Length=534

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 208/367 (57%), Gaps = 33/367 (9%)
 Frame = -3

Query  1404  KLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDE  1225
             K+ + W +  G  DWEGLLDPL  +LR+EI++YG+F +A Y +FDFD  S    +CRY+ 
Sbjct  127   KISAVWRDLHGASDWEGLLDPLHPFLRREIVKYGEFAQATYDAFDFDPLSEFCGSCRYNR  186

Query  1224  DAVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEI  1063
               ++   GL  +GYKVT+ +Y    V+ P W        + S  S+W+G+VAV  DE E 
Sbjct  187   QKLLNELGLAQNGYKVTKYIYALSPVDGPDWFESSKIGEVWSRDSNWMGFVAVSSDE-ES  245

Query  1062  RRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASD--  889
              R+GRRD+++++RGT TP EW  +L+  L  +       N +  VQRGFL++Y S  +  
Sbjct  246   DRIGRRDILVSWRGTVTPTEWYIDLKTKLKKIDRS----NKKVKVQRGFLTIYKSKDEDS  301

Query  888   --AHPSLKDSIRDEITKIIETY---GDEPLSITITGHSLGAALATITAYDITTQFRHAPL  724
                  S  + + +E+ ++I+ +   GD  +S+TITGHSLG AL+ +TAY+    F     
Sbjct  302   KFNKTSASEQVMEELHRLIDFFKQKGDREISLTITGHSLGGALSLLTAYEAGVTFPADVH  361

Query  723   VTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSG  544
             V+VVSFG PRVGN  FR +L   G K+LR+V   D + K+PG  V+S        T   G
Sbjct  362   VSVVSFGAPRVGNLAFREKLNEMGVKILRVVIGQDIVPKLPGLFVNSIVNKLSAVT---G  418

Query  543   MLSWLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCP  373
              L+         WVY  VGKELR++   S       D++  H+L+ YLH +D + + K  
Sbjct  419   KLN---------WVYRHVGKELRMNMFMSPYLKKDSDMSGSHNLEIYLHLVDGFVTKKGK  469

Query  372   LRATAKR  352
              R  ++R
Sbjct  470   FRWNSRR  476



>ref|XP_010655697.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Vitis 
vinifera]
Length=510

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/372 (38%), Positives = 212/372 (57%), Gaps = 45/372 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             + +KW E  G  DW+ LLDPL  +LR+EI++YG+F +A Y +FDFD+ S    +CRY++ 
Sbjct  90    ISNKWSEIHGSCDWDNLLDPLQPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNQH  149

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW---TNLV---SPKSSWIGYVAVCDDEDEIR  1060
              +    GL  +GY V++ +Y    ++VP+W   ++L+   S  S+W+GYVAV DD+ E R
Sbjct  150   KLFKELGLEKNGYMVSKYIYAMSHIDVPQWLERSHLLDTWSKDSNWMGYVAVSDDQ-ESR  208

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA--  886
             R+GRRD+V+++RGT  P EW E+ +  L  +       + E  V+ GFLS+YTS  ++  
Sbjct  209   RIGRRDIVVSWRGTVAPSEWYEDFQRKLEPVG------SGEAKVEHGFLSIYTSKRESSR  262

Query  885   --HPSLKDSIRDEITKIIETYGD--EPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                 S  D +  E+T++++ Y    E +S+TITGHSLG ALA + AY+  T     P ++
Sbjct  263   YNKSSASDQVMKEVTRLVQLYKQRGEQVSLTITGHSLGGALALLNAYEAATSLPGLP-IS  321

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDS-----DDVSDCGTTQ  553
             V+SFG PRVGN  FR +L   G K LR+V   D + ++PG V +      DD++  GT  
Sbjct  322   VISFGAPRVGNIAFRDELHQLGVKTLRVVVKQDMVPRMPGLVFNERLQKFDDIT--GTL-  378

Query  552   PSGMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATC---HDLKTYLHCIDNWSSC  382
                           +WVY  VG EL++  + S Y K        H L+TYLH ID + S 
Sbjct  379   --------------KWVYTHVGAELKLDVQSSPYLKRGFNLPGFHSLETYLHLIDGFHSK  424

Query  381   KCPLRATAKRVI  346
                 R  A+R I
Sbjct  425   TSTFREGARRDI  436



>ref|XP_009362274.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=519

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/378 (37%), Positives = 207/378 (55%), Gaps = 56/378 (15%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  KW E  G  DWEGLLDPL  ++R+EI++YG+F +A Y +FDFD  S    +CRY+++
Sbjct  95    ISEKWREIHGSNDWEGLLDPLHPWIRREIVKYGEFAQATYDAFDFDFFSEYCGSCRYNKN  154

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +    GL  +GY V++ +Y    +++P+W       +  S  S+W+GYVAV  DE+E R
Sbjct  155   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVS-DEEETR  213

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPM------VQRGFLSLYTS  898
             R+GRRD+V+A+RGT  P EW E+++            R  EP+      V+ GF  +YT+
Sbjct  214   RIGRRDIVVAWRGTVVPSEWYEDMQ------------RKLEPIGGGDAKVEHGFHGIYTA  261

Query  897   ASDA----HPSLKDSIRDEITKIIETY--GDEPLSITITGHSLGAALATITAYDITTQFR  736
              SD       S  + +  E+T+++E Y    E +S+TITGHSLG ALA + AY+   +  
Sbjct  262   KSDTTRYNKSSASEQVMKEVTRLVELYQAKGEEVSLTITGHSLGGALALVNAYEAAEKLP  321

Query  735   HAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTT  556
               P ++V+SFG PRVGN  F+ +L   G K LR+V   D + K+PG V++          
Sbjct  322   GLP-ISVISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLNES--------  372

Query  555   QPSGMLSWLQKCVDS----QWVYAEVGKELRvsskdssyskdVA----TCHDLKTYLHCI  400
                     LQK  D      WVY  VG EL++    S Y K         H L+TYLH +
Sbjct  373   --------LQKFDDITGTLDWVYTHVGAELKLEVGFSPYLKRGGFNLPGFHSLETYLHLV  424

Query  399   DNWSSCKCPLRATAKRVI  346
             D + S +   R+ A+R I
Sbjct  425   DGFLSTETTFRSNARRDI  442



>ref|XP_009339909.1| PREDICTED: galactolipase DONGLE, chloroplastic [Pyrus x bretschneideri]
Length=421

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 201/365 (55%), Gaps = 33/365 (9%)
 Frame = -3

Query  1410  AAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRY  1231
             +  L  +W E QG  +WE L++PL   LR+EI+RYGDFV A Y+ FD D  S  Y  C+Y
Sbjct  25    STSLADQWREIQGSNNWENLVEPLHPLLRQEIIRYGDFVTACYKGFDLDPNSKRYLNCKY  84

Query  1230  DEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSPKSSWIGYVAVCDDEDEIRRLG  1051
              +  +    G+   GY+VT+ +Y T  +N+P        +  WIGYVAV  D D ++RLG
Sbjct  85    GKKNMFREVGMENCGYEVTKYIYATPDINIPIQNGESCGR--WIGYVAVSSD-DAVKRLG  141

Query  1050  RRDVVIAYRGTATPPEWLENLRATLT-CLPDDMAPRNCEPMVQRGFLSLYTSASDAHP--  880
             RRD+++ +RGT T PEW+ NL ++LT    D   PRN +  V+ GFLSLYTS        
Sbjct  142   RRDIIVTFRGTVTNPEWVANLMSSLTPARLDPHNPRN-DVKVESGFLSLYTSDESQSKFG  200

Query  879   --SLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDIT-------TQFRHAP  727
               S ++ +  E+++++  Y  E LSIT+ GHS+G++LA +  YDI              P
Sbjct  201   LGSCREQLLSEVSRLLNKYKGEKLSITMAGHSMGSSLALLLGYDIAELGLNRDNSGTKTP  260

Query  726   LVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPS  547
              +TV SFGGPRVGN  F+ + E  G KVLRIVN +DPITK+PG V + ++       + S
Sbjct  261   -ITVFSFGGPRVGNSGFKQRCEELGVKVLRIVNVNDPITKMPGVVFNHENFRVLA-GEGS  318

Query  546   GMLSWLQKCVDSQWVYAEVGKELRvsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLR  367
                 W   C      YA VG EL     D    ++ +  HDL TY+  +      KCP R
Sbjct  319   FEFPWSCSC------YAHVGVEL---VLDFFNMQNPSCVHDLGTYISLL------KCPKR  363

Query  366   ATAKR  352
                ++
Sbjct  364   VQIQK  368



>ref|XP_009417247.1| PREDICTED: phospholipase A1-Ibeta2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=545

 Score =   246 bits (629),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/366 (41%), Positives = 205/366 (56%), Gaps = 49/366 (13%)
 Frame = -3

Query  1392  KWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFD-TASPTYATCRYDEDAV  1216
             +W +Y G  +W+GLL+PLD +LR+E++RYG+ V+A Y +F  +  A+P       D    
Sbjct  165   RWRQYHGAANWDGLLEPLDVHLRRELVRYGELVQATYHAFHSNLIAAPP------DRPRP  218

Query  1215  MTRCGLGGSGYKVTRNLYGTCAVNVPRWTNLVSP------KSSWIGYVAVCDDEDEIRRL  1054
             +    L    Y+VTRNL+ T +V +P W   V+P      ++SWIGYVAVCD+E EI+R+
Sbjct  219   VV---LPDWSYRVTRNLFATASVELPSWVQTVAPWMMAAQRTSWIGYVAVCDNEREIQRM  275

Query  1053  GRRDVVIAYRGTATPPEWLENLRATLTCLPDD----MAPRNCEPMVQRGFLSLYTSASDA  886
             GRRD+VIA RGT+T  EW ENLR  L  + DD      P+   P V+ GF SLY +A   
Sbjct  276   GRRDIVIALRGTSTCLEWAENLRTGLVPVDDDGEDVTDPQGDVPKVECGFRSLYKTAGPD  335

Query  885   HPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQF-RHAPLVTVVS  709
              PSL  S+  E+ K+ E Y  E +SIT+ GHSLGAALA + A ++  +   H P   V S
Sbjct  336   MPSLSSSVVAEVRKLTEKYAGEEISITVVGHSLGAALAVLIADELAARAPPHVP-TAVFS  394

Query  708   FGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLSWL  529
             FG PRVGN+ F +++E  G KVLR+VN+ D +T VP  +      S  G           
Sbjct  395   FGSPRVGNQAFAARVERRGVKVLRVVNARDLVTHVPMVL-----PSRTGG----------  439

Query  528   QKCVDSQWVYAEVGKELR---vsskdssyskdVATCHDLKTYLHCIDNWSSCKCPLRATA  358
                      YA VG+EL      S       D A CHDL+ YLH +D + +   P R+ A
Sbjct  440   ---------YAHVGRELLVDCRMSPYLRPDADPACCHDLEAYLHLVDGFMATNSPFRSDA  490

Query  357   KRVIEK  340
             KR + +
Sbjct  491   KRGLAR  496



>ref|XP_010540608.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Tarenaya 
hassleriana]
Length=535

 Score =   246 bits (628),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 143/374 (38%), Positives = 205/374 (55%), Gaps = 34/374 (9%)
 Frame = -3

Query  1422  AADRAAKLCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYA  1243
             AA     +   W E  G  +WE LLDPL  +LR+EI++YG+FVEA Y S DFD  S    
Sbjct  117   AASPRENISKMWREIHGSNNWENLLDPLHPWLRREIIKYGEFVEAVYDSLDFDPLSEFCG  176

Query  1242  TCRYDEDAVMTRCGLGGSGYKVTRNLYGTCAVNVPRWT------NLVSPKSSWIGYVAV-  1084
             +CRY+ + +    GL   GYKVT+ +Y    V+VP+W          S  S+W+G V V 
Sbjct  177   SCRYNRNKLFEELGLARHGYKVTKYIYAMSHVDVPQWFLRSALGETWSKDSNWMGLVGVS  236

Query  1083  CDDEDEIRRLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLY  904
             CD E   RR+GRRD+V+A+RGT TP EW  +L+     L  +    N +  VQ GFLS+Y
Sbjct  237   CDRES--RRIGRRDIVVAWRGTVTPTEWFLDLKTKKEPLERNGTHENVK--VQSGFLSIY  292

Query  903   TSASD----AHPSLKDSIRDEITKIIETYGD--EPLSITITGHSLGAALATITAYDITTQ  742
              S  +       S  + + +EI  +++ + D  E +S+TITGHSLG ALA + AY++   
Sbjct  293   QSKGENTRYNKQSASEQVMEEIKHMVKFFRDRGEEVSVTITGHSLGGALALLNAYEVARD  352

Query  741   FRHAPLVTVVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCG  562
                   ++V+SFG PRVGN  F+ +L + G KVLR+VN  D + K+PG V +        
Sbjct  353   IPALSNISVISFGAPRVGNLAFKERLNHLGVKVLRVVNKQDIVPKLPGIVFNK-------  405

Query  561   TTQPSGMLSWLQKCVDS-QWVYAEVGKELRvsskdssyskd---VATCHDLKTYLHCIDN  394
                   +L+ +        WVY  VG +L+++   S Y K    +A CH+L+ YLH +D 
Sbjct  406   ------ILNKINPITSRLNWVYRHVGIQLKLNVFKSPYLKQDSDLAGCHNLEVYLHVLDG  459

Query  393   WSSCKCPLRATAKR  352
             + S K   R  A+R
Sbjct  460   FHSKKSKFRVNARR  473



>ref|XP_008371806.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Malus 
domestica]
Length=519

 Score =   245 bits (626),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/372 (37%), Positives = 206/372 (55%), Gaps = 44/372 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  KW E  G  DWEGLLDPL  +LR+EI++YG+F +A Y +FDFD+ S    +CRY+++
Sbjct  95    ISEKWREIHGSNDWEGLLDPLHPWLRREIVKYGEFAQATYDAFDFDSFSEYCGSCRYNKN  154

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRW------TNLVSPKSSWIGYVAVCDDEDEIR  1060
              +    GL  +GY V++ +Y    +++P+W       +  S  S+W+GYVAV  DE+E R
Sbjct  155   KLFDVLGLDKNGYNVSKYIYAMSHIDMPQWLERSHLADTWSKHSNWMGYVAVS-DEEETR  213

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNCEPMVQRGFLSLYTSASDA--  886
             R+GRRD+V+A+RGT  P EW E+++  L  +    A       V+ GF  +YT+ SD   
Sbjct  214   RIGRRDIVVAWRGTVAPSEWYEDMQRKLEPIGSGDAK------VEHGFHGIYTAKSDTTR  267

Query  885   --HPSLKDSIRDEITKIIETYG--DEPLSITITGHSLGAALATITAYDITTQFRHAPLVT  718
                 S  + +  E+ +++E Y    E +S+TITGHSLG ALA + AY+   +    P ++
Sbjct  268   YNRSSASEQVMKEVARLVELYQARGEEVSLTITGHSLGGALALLNAYEAAEKLPGLP-IS  326

Query  717   VVSFGGPRVGNKNFRSQLENSGTKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGML  538
             V+SFG PRVGN  F+ +L   G K LR+V   D + K+PG V++                
Sbjct  327   VISFGAPRVGNIAFKEELHQMGVKTLRVVVKQDMVPKMPGLVLNES--------------  372

Query  537   SWLQKCVDS----QWVYAEVGKELRvsskds----syskdVATCHDLKTYLHCIDNWSSC  382
               LQK  D      WVY  VG EL++    S        ++   H L+TYLH +D + S 
Sbjct  373   --LQKFDDITGTLDWVYTHVGAELKLEVGSSPYLKHGRFNLPGFHSLETYLHLVDGFFST  430

Query  381   KCPLRATAKRVI  346
             +   R+ A+R I
Sbjct  431   ETTFRSNARRDI  442



>dbj|BAK07023.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00183.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   246 bits (628),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 205/366 (56%), Gaps = 45/366 (12%)
 Frame = -3

Query  1401  LCSKWMEYQGIRDWEGLLDPLDDYLRKEILRYGDFVEAAYRSFDFDTASPTYATCRYDED  1222
             +  +W    G   W GLLDPLD  LR+E+LRYGDFV+AAY++F    + PT A  R+   
Sbjct  164   IGPRWRSLHGEGGWAGLLDPLDSDLRRELLRYGDFVQAAYQAFH---SLPT-AAARHRGL  219

Query  1221  AVMTRCGLGGSGYKVTRNLYGTCAVNVPRWTNL------VSPKSSWIGYVAVCDDEDEIR  1060
              +  R       Y+ TR+L+ T A+++P W         ++ +S+WIGYVAVC+ E E+ 
Sbjct  220   MLPDRS------YRPTRSLFATSALSMPPWAKRPNTPEWLTQQSNWIGYVAVCESEREVA  273

Query  1059  RLGRRDVVIAYRGTATPPEWLENLRATLTCLPDDMAPRNC----EPMVQRGFLSLYTSAS  892
             R+GRRD+ I  RGTAT  EW ENLRA+L  L  +          +P V RGF SLY +A 
Sbjct  274   RMGRRDIAIVLRGTATCLEWAENLRASLVPLDGETGEGKQAGPEDPKVARGFRSLYKTAG  333

Query  891   DAHPSLKDSIRDEITKIIETYGDEPLSITITGHSLGAALATITAYDITTQFRHAPLVTVV  712
             +   SL   + DE+ +++E Y  E LSITI GHSLG ALA + A +I T    AP V VV
Sbjct  334   EKVNSLSQDVMDEVRRLMEKYKGEELSITIVGHSLGGALALLVADEIATTVPDAPPVAVV  393

Query  711   SFGGPRVGNKNFRSQLENSG-TKVLRIVNSDDPITKVPGFVVDSDDVSDCGTTQPSGMLS  535
             SFGGP+VGN  F  +L+ SG   VLRIVN+ D +TKVPG               P   LS
Sbjct  394   SFGGPKVGNAAFVEKLKQSGKVNVLRIVNAGDMVTKVPGVA-------------PRLPLS  440

Query  534   WLQKCVDSQWVYAEVGKELRvsskds---syskdVATCHDLKTYLHCIDNWSSCKCPLRA  364
               Q        Y  VG ELR+ SK+S         A+ HDL+ YLH ID +++   P R 
Sbjct  441   KEQ--------YQHVGAELRIDSKNSPCLRPDVGPASRHDLEAYLHLIDGFTATGHPFRY  492

Query  363   TAKRVI  346
              A+R +
Sbjct  493   DARRSV  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4696885476248