BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32355_g1_i1 len=140 path=[1:0-139]

Length=140
                                                                      Score     E

ref|XP_007213212.1|  hypothetical protein PRUPE_ppb013620mg           57.4    7e-08   
emb|CAB10337.1|  reverse transcriptase like protein                   55.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215248.1|  hypothetical protein PRUPE_ppa014660mg           50.8    7e-07   
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...  54.3    8e-07   
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    9e-07   
ref|XP_007048710.1|  LINE-type retrotransposon LIb DNA, Insertion...  53.5    2e-06   
ref|XP_007031181.1|  Uncharacterized protein TCM_026784               51.6    6e-06   
ref|XP_010673150.1|  PREDICTED: uncharacterized protein LOC104889591  51.6    8e-06   
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...  51.2    9e-06   
ref|XP_010471448.1|  PREDICTED: uncharacterized protein LOC104751234  50.8    1e-05   
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...  50.8    1e-05   
ref|XP_008228034.1|  PREDICTED: putative ribonuclease H protein A...  50.8    1e-05   
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089  50.8    2e-05   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431  50.8    2e-05   
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803  50.4    2e-05   
ref|XP_010682494.1|  PREDICTED: uncharacterized protein LOC104897333  50.1    2e-05   
ref|XP_007015138.1|  Uncharacterized protein TCM_040787               47.8    2e-05   
gb|KDP39672.1|  hypothetical protein JCGZ_02692                       49.3    2e-05   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764  49.7    3e-05   
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...  49.7    3e-05   
emb|CCA66009.1|  hypothetical protein                                 49.3    5e-05   
ref|XP_007216353.1|  hypothetical protein PRUPE_ppa020508mg           45.8    5e-05   
ref|XP_007221160.1|  hypothetical protein PRUPE_ppa020332mg           48.1    6e-05   
dbj|BAE79384.1|  unnamed protein product                              48.9    7e-05   Ipomoea batatas [batate]
gb|EEC71228.1|  hypothetical protein OsI_03168                        48.5    7e-05   Oryza sativa Indica Group [Indian rice]
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...  48.5    8e-05   Medicago truncatula
gb|EPS71400.1|  hypothetical protein M569_03359                       45.4    8e-05   
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...  48.5    9e-05   
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase   48.5    9e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CCA66188.1|  hypothetical protein                                 48.1    1e-04   
ref|XP_008351723.1|  PREDICTED: putative ribonuclease H protein A...  48.1    1e-04   
ref|XP_007206481.1|  hypothetical protein PRUPE_ppa018770mg           48.1    1e-04   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase   48.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513759.1|  PREDICTED: uncharacterized protein LOC104789811  47.8    1e-04   
emb|CAB75484.1|  putative protein                                     47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE79382.1|  unnamed protein product                              48.1    1e-04   Ipomoea batatas [batate]
gb|AAF23831.1|AC007234_3  F1E22.12                                    48.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037297.1|  Uncharacterized protein TCM_013937               47.0    2e-04   
ref|XP_010484828.1|  PREDICTED: uncharacterized protein LOC104763110  47.4    2e-04   
dbj|BAE79385.1|  unnamed protein product                              47.8    2e-04   Ipomoea batatas [batate]
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase   47.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CCA66235.1|  hypothetical protein                                 47.0    2e-04   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085  47.0    3e-04   
ref|XP_010478574.1|  PREDICTED: uncharacterized protein LOC104757...  46.2    4e-04   
gb|EEE66057.1|  hypothetical protein OsJ_22054                        46.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                  46.2    5e-04   
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                  46.2    5e-04   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                  46.2    5e-04   
ref|XP_003629928.1|  Cytochrome P450                                  46.2    5e-04   
ref|XP_010238942.1|  PREDICTED: uncharacterized protein LOC100831270  46.2    6e-04   
ref|XP_010478571.1|  PREDICTED: uncharacterized protein LOC104757...  45.8    6e-04   
ref|XP_010478572.1|  PREDICTED: uncharacterized protein LOC104757...  45.8    6e-04   
ref|XP_010495165.1|  PREDICTED: uncharacterized protein LOC104772227  45.8    6e-04   
ref|XP_010473926.1|  PREDICTED: uncharacterized protein LOC104753360  45.4    8e-04   
gb|KFK31800.1|  hypothetical protein AALP_AA6G160500                  45.4    9e-04   
ref|XP_007048802.1|  Uncharacterized protein TCM_001819               44.7    0.001   
ref|XP_008367475.1|  PREDICTED: uncharacterized protein LOC103431103  45.4    0.001   
ref|XP_010668313.1|  PREDICTED: uncharacterized protein LOC104885316  44.7    0.001   



>ref|XP_007213212.1| hypothetical protein PRUPE_ppb013620mg [Prunus persica]
 gb|EMJ14411.1| hypothetical protein PRUPE_ppb013620mg [Prunus persica]
Length=993

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L IE+LSHI+  +V   +WK ++ S N P++SH
Sbjct  847  IRQGDPLSPYLFVLCIEKLSHIIVDAVKRKLWKPIKTSRNGPSVSH  892



>emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana]
 emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana]
Length=929

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDPI P LF L IERL H ++++V  G WK + IS   P +SH
Sbjct  448  LRQGDPISPYLFVLCIERLCHQIETAVGRGDWKSISISQGGPKVSH  493



>ref|XP_007215248.1| hypothetical protein PRUPE_ppa014660mg, partial [Prunus persica]
 gb|EMJ16447.1| hypothetical protein PRUPE_ppa014660mg, partial [Prunus persica]
Length=80

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDPI P LF    E LS ++Q +   G+ +G+R+SH AP +SH
Sbjct  1    LRQGDPISPYLFLFVSEVLSLMIQKACLTGVLQGIRLSHTAPTISH  46



>ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P +F L +E+LSH++ S V  G WK VR S + P +SH
Sbjct  248  IRQGDPLSPYIFVLCMEKLSHLINSVVDMGYWKPVRASQSGPKVSH  293



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
             +RQGDP+ P LF L +ERL H+++ SV+   WK +R+S   P++SH
Sbjct  1059  LRQGDPLSPYLFVLCMERLCHLIEFSVAKKEWKPIRLSRGGPSLSH  1104



>ref|XP_007048710.1| LINE-type retrotransposon LIb DNA, Insertion at the S11 site-like 
protein [Theobroma cacao]
 gb|EOX92867.1| LINE-type retrotransposon LIb DNA, Insertion at the S11 site-like 
protein [Theobroma cacao]
Length=780

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L IERLSH +  +V  G+WK +++  + P +SH
Sbjct  683  VRQGDPLSPYLFVLCIERLSHAINIAVVQGLWKPIKLGRHYPLISH  728



>ref|XP_007031181.1| Uncharacterized protein TCM_026784 [Theobroma cacao]
 gb|EOY11683.1| Uncharacterized protein TCM_026784 [Theobroma cacao]
Length=702

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP  P LF L IERLSH +  ++  G+WK +++  + P +SH
Sbjct  401  VRQGDPHSPYLFVLCIERLSHAINIAMEQGLWKPIKLGRHCPPISH  446



>ref|XP_010673150.1| PREDICTED: uncharacterized protein LOC104889591 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +E LS +++ +VSCG+W+GV  S     ++H
Sbjct  542  LRQGDPLSPFLFVLAVECLSLVIKKAVSCGLWEGVEASRGGRKITH  587



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL H+++ +V    WK +++S   P +SH
Sbjct  277  LRQGDPLSPYLFVLCMERLCHLIEEAVEEKRWKPIKLSRGGPELSH  322



>ref|XP_010471448.1| PREDICTED: uncharacterized protein LOC104751234 [Camelina sativa]
Length=506

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL H+++ S+    WK + +S   P +SH
Sbjct  112  LRQGDPLSPYLFVLCLERLCHLIEGSIEEKKWKPISLSRGGPKLSH  157



>ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=782

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL H+++ +V    WK +++S   P +SH
Sbjct  48   LRQGDPLSPYLFVLCMERLCHLIEEAVEEKRWKPIKLSRGGPELSH  93



>ref|XP_008228034.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=751

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L IE+LSHI+  +VS   W+ V+ S + P +SH
Sbjct  213  IRQGDPLSPYLFVLCIEKLSHIICDAVSKKKWRPVKSSQSGPAISH  258



>ref|XP_010484806.1| PREDICTED: uncharacterized protein LOC104763089 [Camelina sativa]
Length=1130

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF + +ERL H+++ SV+   WK + +S   P +SH
Sbjct  552  LRQGDPLSPYLFVMCLERLCHLIEISVNSKEWKPISLSRGGPKLSH  597



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
             +RQGDP+ P LF L +ERL H ++ SV+   WK +++S   P++SH
Sbjct  1095  LRQGDPLSPYLFVLCMERLCHQIELSVANKEWKPIKLSRGGPSVSH  1140



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L +E+L HI+   ++   WK V++  N P++SH
Sbjct  760  IRQGDPLSPYLFVLCMEKLXHIIXGCITTKKWKPVKLXRNGPSVSH  805



>ref|XP_010682494.1| PREDICTED: uncharacterized protein LOC104897333 [Beta vulgaris 
subsp. vulgaris]
Length=506

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P L+ + +ERL+H++   V  G WK VR S + P +S+
Sbjct  278  IRQGDPLSPYLYVICMERLAHLIDKEVRSGGWKPVRASRHGPQISN  323



>ref|XP_007015138.1| Uncharacterized protein TCM_040787 [Theobroma cacao]
 gb|EOY32757.1| Uncharacterized protein TCM_040787 [Theobroma cacao]
Length=178

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L +E LS +V   VS G WK + ++   P ++H
Sbjct  33   IRQGDPLSPYLFVLCLETLSQLVNEEVSLGNWKPLVVTTRGPYLTH  78



>gb|KDP39672.1| hypothetical protein JCGZ_02692 [Jatropha curcas]
Length=320

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDPI P LF L +ERL H +  +VS   W+ + I   AP +SH
Sbjct  105  IRQGDPISPYLFVLAMERLGHCISQAVSDKCWRPISIPRQAPAISH  150



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L +E+LSHI+   ++   WK V++S   P +SH
Sbjct  632  IRQGDPLSPYLFVLCMEKLSHIINGCITTKKWKPVKLSRYGPPVSH  677



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P +F L +E+LSH++Q  +    WK V+I    P++SH
Sbjct  188  IRQGDPLSPYIFVLCMEKLSHLIQQKIQDRAWKSVQICQGDPHISH  233



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P L+ + +ERL+H++   V+ G WK V+ S N P +S+
Sbjct  639  LRQGDPLSPYLYVICMERLAHLIDQEVTNGNWKPVKASRNGPPISN  684



>ref|XP_007216353.1| hypothetical protein PRUPE_ppa020508mg, partial [Prunus persica]
 gb|EMJ17552.1| hypothetical protein PRUPE_ppa020508mg, partial [Prunus persica]
Length=77

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  12   GDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            GDPI P LF    E LS ++Q +   G+ +G+R+SH AP +SH
Sbjct  1    GDPISPYLFLFVSEVLSLMIQKACLTGVLQGIRLSHTAPTISH  43



>ref|XP_007221160.1| hypothetical protein PRUPE_ppa020332mg, partial [Prunus persica]
 gb|EMJ22359.1| hypothetical protein PRUPE_ppa020332mg, partial [Prunus persica]
Length=337

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    RQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            RQGDP+ P LF L I++LSH++  +V   IWK ++     P +SH
Sbjct  85   RQGDPLSPYLFVLCIDKLSHLIMEAVGKQIWKPIKAYQAGPAVSH  129



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
             +RQGDP+ P LF L +ERL+H +Q+ V+   WK V I+     +SH
Sbjct  1169  LRQGDPLVPYLFNLVMERLAHDIQTRVNARTWKPVHITRGGTGISH  1214



>gb|EEC71228.1| hypothetical protein OsI_03168 [Oryza sativa Indica Group]
Length=995

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L IE LS+++Q   S G+  G+R  H  P +SH
Sbjct  372  IRQGDPVSPYLFLLCIEGLSYLLQRKESLGLLHGIRNGHQGPPISH  417



>gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptase); Polynucleotidyl 
transferase, Ribonuclease H fold [Medicago truncatula]
Length=729

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF + +ERLSHI+   V    WK +R     P +SH
Sbjct  63   IRQGDPLSPYLFVICMERLSHIIADQVEADYWKPMRAGRYGPPISH  108



>gb|EPS71400.1| hypothetical protein M569_03359 [Genlisea aurea]
Length=103

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF +  E LS ++ S+      KG R+S NAP++SH
Sbjct  27   LRQGDPLSPFLFLICAEGLSSLLTSAELSNEIKGFRVSRNAPSISH  72



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL H ++ +V+   WK +++S   P +SH
Sbjct  496  LRQGDPLSPYLFVLCMERLCHQIEFAVAKEDWKPIKLSRGGPALSH  541



>gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1524

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L  + LSH++    S G  +GVRI + AP ++H
Sbjct  789  IRQGDPLSPYLFILCGDILSHLINGRASSGDLRGVRIGNGAPAITH  834



>emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +E LS ++Q +   G+W+GV ++ N   ++H
Sbjct  630  LRQGDPLSPFLFDLVVETLSLVIQKASHLGLWEGVEVTKNGEKITH  675



>ref|XP_008351723.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=678

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +E+  H++  +VS   WK V+++ N   +SH
Sbjct  192  VRQGDPLSPYLFVLCVEKFGHLISEAVSNKCWKPVKVAKNGSAISH  237



>ref|XP_007206481.1| hypothetical protein PRUPE_ppa018770mg [Prunus persica]
 gb|EMJ07680.1| hypothetical protein PRUPE_ppa018770mg [Prunus persica]
Length=790

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGD + P LF L IE+LSH++  +VS   W+ V+ S + P +SH
Sbjct  538  IRQGDLLSPYLFVLCIEKLSHVICDAVSKKKWRPVKSSQSGPAISH  583



>gb|AAD20714.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1750

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
             IRQGDP+ P LF L  + LSH++    S G  +GVRI + AP ++H
Sbjct  1015  IRQGDPLSPYLFILCGDILSHLINGRASSGDLRGVRIGNGAPAITH  1060



>ref|XP_010513759.1| PREDICTED: uncharacterized protein LOC104789811 [Camelina sativa]
Length=717

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL H++ +S+    WK +++    P +SH
Sbjct  304  LRQGDPLSPYLFMLCLERLCHLIDTSIREKKWKPIKLLVYGPRLSH  349



>emb|CAB75484.1| putative protein [Arabidopsis thaliana]
Length=851

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L  + LSH+++   S G  +GVRI + AP ++H
Sbjct  254  IRQGDPLSPYLFILCGDILSHLIKVKASSGDIRGVRIGNGAPAITH  299



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL+H +Q+ V+   WK V I+     +SH
Sbjct  637  LRQGDPLAPYLFNLVMERLAHDIQTRVNARTWKPVHITRGGTGISH  682



>gb|AAF23831.1|AC007234_3 F1E22.12 [Arabidopsis thaliana]
Length=1055

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGD + P LF L +ERL H+++ S++   WK + +S   P +SH
Sbjct  73   LRQGDLLSPYLFVLCMERLCHLIERSINAKQWKPINLSRGGPKLSH  118



>ref|XP_007037297.1| Uncharacterized protein TCM_013937 [Theobroma cacao]
 gb|EOY21798.1| Uncharacterized protein TCM_013937 [Theobroma cacao]
Length=309

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L +E+LS ++ + V  G W+ + ++ N P ++H
Sbjct  122  IRQGDPLSPYLFVLCLEKLSQLIDNKVWLGNWRPLLLTRNGPFLAH  167



>ref|XP_010484828.1| PREDICTED: uncharacterized protein LOC104763110 [Camelina sativa]
Length=520

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+   LF L +E L H++ SS+  G WK + ++ + P +SH
Sbjct  279  LRQGDPLSLYLFVLCLEWLCHMIDSSIGSGDWKHITLARDGPKLSH  324



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL+H +Q+ V+   WK V I+     +SH
Sbjct  637  LRQGDPLAPYLFNLVMERLAHDIQTRVNARTWKPVHITRGGTGISH  682



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +ERL H++++SV    WK + +S     +SH
Sbjct  496  LRQGDPLSPYLFVLCLERLCHLIEASVGKREWKPIAVSCGGSKLSH  541



>emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1380

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +E L+ ++  ++S G W+GV +S     +SH
Sbjct  630  LRQGDPLSPFLFVLVVETLNLLINKAISLGFWEGVEVSKGGLKLSH  675



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
             +RQGDP+ P +F L IERLSH +  S+  G WK +R++     +SH
Sbjct  1129  VRQGDPLSPYIFVLCIERLSHGISRSIQQGHWKPIRLARMGTPLSH  1174



>ref|XP_010478574.1| PREDICTED: uncharacterized protein LOC104757523 isoform X4 [Camelina 
sativa]
Length=458

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDPI P ++ L  E LS ++Q ++  G   G + S N P +SH
Sbjct  378  IRQGDPISPYIYLLCTEALSALIQENIRLGKLHGFKASRNGPAISH  423



>gb|EEE66057.1| hypothetical protein OsJ_22054 [Oryza sativa Japonica Group]
Length=940

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDPI P LF L  E LS I+Q   S G+ +G+R  H  P +SH
Sbjct  263  LRQGDPISPYLFLLCTEGLSSILQKKESMGVIQGIRNGHLGPPISH  308



>gb|KFK27799.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1234

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P +F L  E LSH+   + +    KG++ISH  P ++H
Sbjct  607  IRQGDPLSPYIFILCAEVLSHLFTRAAASKQLKGMKISHTGPTVNH  652



>gb|KFK27798.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1250

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P +F L  E LSH+   + +    KG++ISH  P ++H
Sbjct  630  IRQGDPLSPYIFILCAEVLSHLFTRAAASKQLKGMKISHTGPTVNH  675



>gb|KFK27800.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1257

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P +F L  E LSH+   + +    KG++ISH  P ++H
Sbjct  630  IRQGDPLSPYIFILCAEVLSHLFTRAAASKQLKGMKISHTGPTVNH  675



>ref|XP_003629928.1| Cytochrome P450 [Medicago truncatula]
Length=948

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +E LS +V+S+ +CG++  +++ ++  ++SH
Sbjct  527  LRQGDPLAPFLFLLVVEGLSGLVRSAEACGLYLDIKVGNSGLSISH  572



>ref|XP_010238942.1| PREDICTED: uncharacterized protein LOC100831270 [Brachypodium 
distachyon]
Length=1468

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L  E LS  +QS  + G+ + ++I  N+P +SH
Sbjct  154  LRQGDPLSPYLFLLVAEGLSASIQSKTASGMLEDLKICKNSPGISH  199



>ref|XP_010478571.1| PREDICTED: uncharacterized protein LOC104757523 isoform X1 [Camelina 
sativa]
Length=653

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDPI P ++ L  E LS ++Q ++  G   G + S N P +SH
Sbjct  378  IRQGDPISPYIYLLCTEALSALIQENIRLGKLHGFKASRNGPAISH  423



>ref|XP_010478572.1| PREDICTED: uncharacterized protein LOC104757523 isoform X2 [Camelina 
sativa]
Length=630

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDPI P ++ L  E LS ++Q ++  G   G + S N P +SH
Sbjct  355  IRQGDPISPYIYLLCTEALSALIQENIRLGKLHGFKASRNGPAISH  400



>ref|XP_010495165.1| PREDICTED: uncharacterized protein LOC104772227 [Camelina sativa]
Length=1148

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            I QGDP+ P LF L  E LSH+++ + + G+ KG++IS+ +P +SH
Sbjct  484  ILQGDPLSPYLFILCAEVLSHMMKRAEAEGLIKGIKISNASPAISH  529



>ref|XP_010473926.1| PREDICTED: uncharacterized protein LOC104753360 [Camelina sativa]
Length=811

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            + +GDP+ P LF L +ERL H++  +V    WK + +S   P +SH
Sbjct  439  LSEGDPLSPFLFVLCMERLCHLIDRAVVNKQWKPISLSRGGPQLSH  484



>gb|KFK31800.1| hypothetical protein AALP_AA6G160500 [Arabis alpina]
Length=1096

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+ P LF L +ERL  ++  S+S   W  + +S   P +SH
Sbjct  928  IRQGDPLSPYLFVLCLERLCLLIDHSISLKEWIPISLSCGGPKLSH  973



>ref|XP_007048802.1| Uncharacterized protein TCM_001819 [Theobroma cacao]
 gb|EOX92959.1| Uncharacterized protein TCM_001819 [Theobroma cacao]
Length=374

 Score = 44.7 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            ++QGD + P LF L IER +H + + V+  IWK +++S   P ++H
Sbjct  84   VKQGDSLSPYLFVLCIERFTHRINAVVANSIWKSMKLSPRCPLLTH  129



>ref|XP_008367475.1| PREDICTED: uncharacterized protein LOC103431103 [Malus domestica]
Length=1108

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            +RQGDP+ P LF L +E+  H++  +VS   WK V+++     +SH
Sbjct  598  VRQGDPLSPYLFVLCVEKFGHLIXEAVSNKCWKPVKVAKXGSAISH  643



>ref|XP_010668313.1| PREDICTED: uncharacterized protein LOC104885316 [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score = 44.7 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    IRQGDPIFPLLFFL*IERLSHIVQSSVSCGIWKGVRISHNAPNMSH  140
            IRQGDP+   LF L +ERL+ +V+ ++    W  +R S N P +S+
Sbjct  66   IRQGDPLSAYLFVLCMERLNQVVEEAILANHWLLIRASRNGPKLSN  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509157648584