BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32318_g1_i1 len=1196 path=[1174:0-1195]

Length=1196
                                                                      Score     E

ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 387   1e-126   
ref|XP_004500841.1|  PREDICTED: MLO-like protein 5-like isoform X1      381   1e-123   
ref|XP_004500842.1|  PREDICTED: MLO-like protein 5-like isoform X2      378   1e-122   
ref|XP_004144292.1|  PREDICTED: MLO-like protein 5-like                 372   3e-120   
ref|XP_004245231.1|  PREDICTED: MLO-like protein 9                      369   2e-119   
ref|XP_010256542.1|  PREDICTED: MLO-like protein 9                      369   2e-119   
emb|CAN71968.1|  hypothetical protein VITISV_007362                     363   3e-119   Vitis vinifera
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      368   5e-119   
ref|XP_009586729.1|  PREDICTED: MLO-like protein 9                      367   2e-118   
ref|XP_008464826.1|  PREDICTED: MLO-like protein 9                      367   3e-118   
emb|CBI40748.3|  unnamed protein product                                363   9e-118   
ref|XP_002510710.1|  Protein MLO, putative                              362   1e-117   Ricinus communis
ref|XP_010064954.1|  PREDICTED: MLO-like protein 9                      363   1e-116   
ref|XP_010686828.1|  PREDICTED: MLO-like protein 9                      361   1e-116   
ref|XP_007135969.1|  hypothetical protein PHAVU_009G007000g             361   3e-116   
ref|XP_003603856.1|  MLO-like protein                                   360   5e-116   
ref|XP_010094531.1|  MLO-like protein 5                                 359   5e-116   
ref|XP_011034832.1|  PREDICTED: MLO-like protein 9 isoform X1           358   5e-115   
ref|XP_002301905.2|  hypothetical protein POPTR_0002s00800g             358   7e-115   Populus trichocarpa [western balsam poplar]
emb|CDP07267.1|  unnamed protein product                                356   2e-114   
ref|XP_009779293.1|  PREDICTED: MLO-like protein 9                      356   2e-114   
ref|XP_003523524.1|  PREDICTED: MLO-like protein 5-like                 356   2e-114   
ref|XP_003527633.1|  PREDICTED: MLO-like protein 5-like                 355   6e-114   
ref|XP_009372611.1|  PREDICTED: MLO-like protein 9                      354   8e-114   
ref|XP_008804596.1|  PREDICTED: MLO-like protein 10 isoform X3          348   5e-113   
ref|XP_007211108.1|  hypothetical protein PRUPE_ppa024488mg             350   3e-112   
ref|XP_008373392.1|  PREDICTED: MLO-like protein 9                      350   3e-112   
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      351   6e-112   
ref|XP_008804580.1|  PREDICTED: MLO-like protein 9 isoform X1           350   1e-111   
ref|XP_008237943.1|  PREDICTED: MLO-like protein 9                      346   7e-111   
ref|XP_007018110.1|  Seven transmembrane MLO family protein             345   3e-110   
ref|XP_002276608.1|  PREDICTED: MLO-like protein 10                     345   8e-110   Vitis vinifera
ref|XP_008242102.1|  PREDICTED: MLO-like protein 8                      345   9e-110   
ref|XP_006467107.1|  PREDICTED: MLO-like protein 10-like                345   1e-109   
ref|XP_006425252.1|  hypothetical protein CICLE_v10025242mg             345   1e-109   
ref|XP_007204311.1|  hypothetical protein PRUPE_ppa003435mg             343   8e-109   
ref|XP_004301623.1|  PREDICTED: MLO-like protein 5-like                 337   1e-108   
ref|XP_004169166.1|  PREDICTED: MLO-like protein 8-like                 341   3e-108   
ref|XP_008440929.1|  PREDICTED: MLO-like protein 8                      341   3e-108   
ref|XP_011074255.1|  PREDICTED: MLO-like protein 9                      338   1e-107   
gb|AHF52923.1|  Mlo protein                                             336   3e-106   
ref|XP_007046462.1|  Seven transmembrane MLO family protein             336   4e-106   
ref|XP_002532472.1|  calmodulin binding protein, putative               331   7e-106   Ricinus communis
gb|AHF52924.1|  Mlo protein                                             335   1e-105   
ref|XP_004134822.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    334   1e-105   
ref|XP_008448445.1|  PREDICTED: MLO-like protein 10 isoform X1          334   2e-105   
ref|XP_010523625.1|  PREDICTED: MLO-like protein 9                      332   5e-105   
ref|XP_009395397.1|  PREDICTED: MLO-like protein 9                      333   5e-105   
ref|XP_009772716.1|  PREDICTED: MLO-like protein 10                     332   7e-105   
ref|XP_008379649.1|  PREDICTED: MLO-like protein 8                      333   8e-105   
gb|KHG22053.1|  MLO-like protein 8                                      332   1e-104   
ref|XP_004287711.1|  PREDICTED: MLO-like protein 8-like                 332   2e-104   
gb|KFK31027.1|  hypothetical protein AALP_AA6G058600                    330   2e-104   
ref|XP_009369784.1|  PREDICTED: MLO-like protein 8                      332   2e-104   
gb|KDP43787.1|  hypothetical protein JCGZ_22414                         330   5e-104   
emb|CDP06355.1|  unnamed protein product                                330   6e-104   
ref|XP_009359622.1|  PREDICTED: MLO-like protein 8                      331   6e-104   
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      330   7e-104   
ref|XP_004232584.1|  PREDICTED: MLO-like protein 8                      329   1e-103   
ref|XP_009790030.1|  PREDICTED: MLO-like protein 8                      329   1e-103   
ref|XP_009619517.1|  PREDICTED: MLO-like protein 8                      329   1e-103   
ref|XP_004146181.1|  PREDICTED: MLO-like protein 8-like                 329   2e-103   
ref|XP_006410510.1|  hypothetical protein EUTSA_v10016533mg             327   2e-103   
ref|XP_002439069.1|  hypothetical protein SORBIDRAFT_10g031010          327   2e-103   Sorghum bicolor [broomcorn]
ref|XP_009601752.1|  PREDICTED: MLO-like protein 8                      328   2e-103   
gb|KEH20339.1|  seven transmembrane MLO family protein                  323   5e-103   
ref|XP_006654121.1|  PREDICTED: MLO-like protein 5-like                 327   9e-103   
gb|KEH20340.1|  seven transmembrane MLO family protein                  322   1e-102   
gb|EYU39427.1|  hypothetical protein MIMGU_mgv1a007858mg                320   3e-102   
ref|XP_006366655.1|  PREDICTED: MLO-like protein 8-like isoform X1      325   3e-102   
ref|XP_004978312.1|  PREDICTED: MLO-like protein 5-like                 325   4e-102   
ref|XP_011098015.1|  PREDICTED: MLO-like protein 10 isoform X1          325   5e-102   
gb|EYU36583.1|  hypothetical protein MIMGU_mgv1a019580mg                323   5e-102   
ref|XP_004253244.1|  PREDICTED: MLO-like protein 9                      325   5e-102   
gb|KCW56485.1|  hypothetical protein EUGRSUZ_I02212                     325   6e-102   
ref|XP_010029568.1|  PREDICTED: MLO-like protein 10                     325   7e-102   
emb|CDY23718.1|  BnaC04g44040D                                          321   7e-102   
ref|XP_006296403.1|  hypothetical protein CARUB_v10025579mg             323   8e-102   
ref|XP_003517123.1|  PREDICTED: MLO-like protein 8-like isoform 1       325   2e-101   
ref|XP_003629098.1|  MLO-like protein                                   324   3e-101   
gb|ACF82832.1|  unknown                                                 316   3e-101   Zea mays [maize]
gb|KHN35943.1|  MLO-like protein 8                                      323   3e-101   
gb|EMS53724.1|  MLO-like protein 5                                      322   3e-101   
ref|XP_006473920.1|  PREDICTED: MLO-like protein 9-like                 322   5e-101   
gb|AAK53798.1|AF369566_1  membrane protein Mlo5                         321   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      323   5e-101   
ref|NP_180923.1|  MLO-like protein 5                                    321   5e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY26810.1|  BnaC09g09370D                                          323   6e-101   
emb|CDY30363.1|  BnaA09g09140D                                          323   6e-101   
ref|XP_009112431.1|  PREDICTED: MLO-like protein 8                      323   6e-101   
ref|NP_001105170.1|  barley mlo defense gene homolog6                   320   9e-101   Zea mays [maize]
emb|CDY37702.1|  BnaA04g19660D                                          318   1e-100   
ref|XP_006599251.1|  PREDICTED: MLO-like protein 8-like                 321   2e-100   
ref|XP_010514988.1|  PREDICTED: MLO-like protein 8                      322   2e-100   
ref|XP_010469445.1|  PREDICTED: MLO-like protein 5                      318   4e-100   
ref|XP_009386660.1|  PREDICTED: MLO-like protein 9                      320   4e-100   
ref|XP_002310695.2|  MLO-like protein 8                                 320   6e-100   Populus trichocarpa [western balsam poplar]
ref|XP_009141335.1|  PREDICTED: MLO-like protein 5                      318   6e-100   
ref|XP_003534232.1|  PREDICTED: MLO-like protein 10-like isoform X1     320   1e-99    
gb|EPS67078.1|  hypothetical protein M569_07698                         310   1e-99    
ref|XP_003537693.1|  PREDICTED: MLO-like protein 8-like                 320   1e-99    
ref|XP_002893934.1|  hypothetical protein ARALYDRAFT_473744             316   1e-99    
gb|AFW69614.1|  hypothetical protein ZEAMMB73_948296                    320   1e-99    
ref|XP_006303812.1|  hypothetical protein CARUB_v10012285mg             316   1e-99    
ref|XP_006299646.1|  hypothetical protein CARUB_v10015833mg             320   2e-99    
ref|XP_002879463.1|  hypothetical protein ARALYDRAFT_482315             317   2e-99    
ref|XP_008647383.1|  PREDICTED: uncharacterized protein LOC100193...    316   2e-99    
gb|EPS58714.1|  hypothetical protein M569_16096                         312   2e-99    
ref|XP_011014773.1|  PREDICTED: MLO-like protein 10 isoform X1          319   2e-99    
gb|KHN12501.1|  MLO-like protein 8                                      319   2e-99    
ref|XP_007156260.1|  hypothetical protein PHAVU_003G271300g             319   2e-99    
ref|XP_010033601.1|  PREDICTED: MLO-like protein 8                      318   3e-99    
ref|XP_010413828.1|  PREDICTED: MLO-like protein 5                      316   4e-99    
ref|NP_174980.3|  MLO-like protein 9                                    314   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      317   5e-99    
ref|XP_010467520.1|  PREDICTED: MLO-like protein 8                      318   6e-99    
ref|XP_010906858.1|  PREDICTED: MLO-like protein 10                     313   6e-99    
ref|XP_010509851.1|  PREDICTED: MLO-like protein 5                      315   6e-99    
gb|AAG51314.1|AC025815_1  Mlo-like protein                              314   7e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             318   7e-99    Populus trichocarpa [western balsam poplar]
gb|AGT16511.1|  hypothetical protein SHCRBa_119_B13_R_20                313   8e-99    
ref|XP_010489376.1|  PREDICTED: MLO-like protein 8                      318   1e-98    
ref|XP_006435412.1|  hypothetical protein CICLE_v10000748mg             316   2e-98    
ref|XP_004509461.1|  PREDICTED: MLO-like protein 10-like                317   2e-98    
ref|XP_007158026.1|  hypothetical protein PHAVU_002G117900g             317   2e-98    
gb|ADV29809.1|  MLO1 protein                                            316   2e-98    
emb|CDY20802.1|  BnaC07g06510D                                          317   3e-98    
ref|XP_009121111.1|  PREDICTED: MLO-like protein 8                      316   3e-98    
emb|CDY24339.1|  BnaA07g02640D                                          316   3e-98    
ref|XP_003568790.1|  PREDICTED: MLO-like protein 9                      315   9e-98    
gb|KGN49000.1|  hypothetical protein Csa_6G509690                       313   1e-97    
ref|XP_010034715.1|  PREDICTED: MLO-like protein 8                      312   3e-97    
gb|KFK29153.1|  hypothetical protein AALP_AA7G095800                    309   4e-97    
gb|KFK40125.1|  hypothetical protein AALP_AA3G333500                    313   7e-97    
ref|XP_010539025.1|  PREDICTED: MLO-like protein 9                      310   8e-97    
gb|AAG51234.1|AC035249_9  disease resistance protein MLO, putativ...    308   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855670.1|  hypothetical protein AMTR_s00044p00123510          310   2e-96    
ref|NP_565416.1|  MLO-like protein 8                                    310   6e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478983.1|  PREDICTED: MLO-like protein 9                      306   7e-96    
ref|XP_010530986.1|  PREDICTED: MLO-like protein 8                      309   1e-95    
ref|XP_010680631.1|  PREDICTED: MLO-like protein 10 isoform X1          308   2e-95    
ref|XP_011034833.1|  PREDICTED: MLO-like protein 5 isoform X2           305   3e-95    
ref|XP_009390757.1|  PREDICTED: MLO-like protein 9 isoform X2           306   5e-95    
ref|XP_009382074.1|  PREDICTED: MLO-like protein 9                      306   9e-95    
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           306   1e-94    
ref|XP_004512433.1|  PREDICTED: MLO-like protein 10-like                306   2e-94    
ref|XP_002886115.1|  hypothetical protein ARALYDRAFT_480631             306   3e-94    
ref|XP_010680632.1|  PREDICTED: MLO-like protein 10 isoform X2          303   5e-94    
ref|XP_008804588.1|  PREDICTED: MLO-like protein 9 isoform X2           301   2e-93    
dbj|BAJ34234.1|  unnamed protein product                                303   4e-93    
ref|XP_010097644.1|  MLO-like protein 8                                 302   1e-92    
ref|XP_006393785.1|  hypothetical protein EUTSA_v10003913mg             301   1e-92    
ref|XP_010548198.1|  PREDICTED: MLO-like protein 8                      301   2e-92    
ref|XP_006409301.1|  hypothetical protein EUTSA_v10022612mg             298   3e-91    
ref|XP_006366656.1|  PREDICTED: MLO-like protein 8-like isoform X2      295   3e-91    
gb|KDO71550.1|  hypothetical protein CISIN_1g008408mg                   289   4e-91    
gb|KDO71549.1|  hypothetical protein CISIN_1g008408mg                   288   1e-90    
ref|XP_010466376.1|  PREDICTED: MLO-like protein 10                     295   2e-90    
ref|NP_201398.1|  MLO-like protein 10                                   295   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865092.1|  hypothetical protein ARALYDRAFT_497027             295   2e-90    
gb|ACX55086.1|  Mlo3                                                    292   5e-90    
gb|KHN33779.1|  MLO-like protein 5                                      291   8e-90    
ref|XP_010484707.1|  PREDICTED: MLO-like protein 10                     293   9e-90    
gb|KFK28258.1|  hypothetical protein AALP_AA8G493400                    293   1e-89    
gb|KHN20092.1|  MLO-like protein 5                                      290   1e-89    
gb|KDO71547.1|  hypothetical protein CISIN_1g008408mg                   290   2e-89    
ref|NP_179335.3|  MLO-like protein 7                                    291   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500219.1|  PREDICTED: MLO-like protein 9                      289   4e-89    
ref|XP_006281817.1|  hypothetical protein CARUB_v10028002mg             291   5e-89    
ref|XP_010550512.1|  PREDICTED: MLO-like protein 10 isoform X2          289   5e-89    
tpg|DAA46107.1|  TPA: hypothetical protein ZEAMMB73_604520              285   9e-89    
ref|XP_009112429.1|  PREDICTED: MLO-like protein 7                      290   1e-88    
gb|AES95366.2|  seven transmembrane MLO family protein                  290   2e-88    
ref|XP_004985865.1|  PREDICTED: MLO protein homolog 1-like              290   2e-88    
emb|CDY26808.1|  BnaC09g09350D                                          289   2e-88    
emb|CDY30365.1|  BnaA09g09120D                                          289   2e-88    
ref|XP_010444861.1|  PREDICTED: MLO-like protein 10                     289   3e-88    
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          290   4e-88    
ref|XP_003574266.1|  PREDICTED: MLO-like protein 9                      288   1e-87    
ref|XP_003612408.1|  Mlo family protein                                 288   1e-87    
ref|XP_008448446.1|  PREDICTED: MLO-like protein 8 isoform X2           285   2e-87    
ref|XP_008786739.1|  PREDICTED: MLO protein homolog 1                   286   5e-87    
ref|XP_008648416.1|  PREDICTED: barley mlo defense gene homolog2 ...    285   9e-87    
ref|XP_002465934.1|  hypothetical protein SORBIDRAFT_01g048500          285   1e-86    Sorghum bicolor [broomcorn]
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   285   1e-86    
ref|NP_001105168.1|  barley mlo defense gene homolog2                   285   2e-86    Zea mays [maize]
ref|XP_004159746.1|  PREDICTED: MLO-like protein 8-like                 282   3e-86    
ref|XP_002884057.1|  ATMLO7/MLO7                                        283   3e-86    
ref|XP_008349735.1|  PREDICTED: MLO protein homolog 1-like              283   5e-86    
ref|XP_008228898.1|  PREDICTED: MLO protein homolog 1-like              282   1e-85    
ref|XP_009603532.1|  PREDICTED: MLO-like protein 6                      283   2e-85    
gb|AAK94907.1|AF384030_1  seven transmembrane protein MLO2              281   3e-85    Oryza sativa Indica Group [Indian rice]
ref|NP_001048845.1|  Os03g0129100                                       281   3e-85    Oryza sativa Japonica Group [Japonica rice]
gb|AAN17391.1|  Putative OsMlo-h1                                       281   5e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006299666.1|  hypothetical protein CARUB_v10015854mg             280   5e-85    
ref|XP_008237952.1|  PREDICTED: MLO protein homolog 1-like              281   6e-85    
ref|XP_011098016.1|  PREDICTED: MLO-like protein 10 isoform X2          277   3e-84    
dbj|BAJ24150.1|  seven trans-membrane protein                           279   3e-84    
gb|EAY79378.1|  hypothetical protein OsI_34504                          280   3e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_010489369.1|  PREDICTED: MLO-like protein 7                      278   3e-84    
ref|XP_010550511.1|  PREDICTED: MLO-like protein 10 isoform X1          278   4e-84    
ref|XP_006649324.1|  PREDICTED: MLO protein homolog 1-like              278   4e-84    
ref|XP_010270523.1|  PREDICTED: MLO-like protein 10 isoform X2          273   5e-84    
ref|XP_010467513.1|  PREDICTED: MLO-like protein 7                      278   5e-84    
ref|XP_003558907.1|  PREDICTED: protein MLO-like                        278   5e-84    
ref|XP_006409308.1|  hypothetical protein EUTSA_v10023186mg             277   7e-84    
ref|XP_007210822.1|  hypothetical protein PRUPE_ppa020311mg             278   1e-83    
gb|KFK40130.1|  hypothetical protein AALP_AA3G334400                    276   2e-83    
ref|XP_009801961.1|  PREDICTED: MLO-like protein 6                      277   3e-83    
ref|XP_006855667.1|  hypothetical protein AMTR_s00044p00120330          268   5e-83    
ref|XP_010270522.1|  PREDICTED: MLO-like protein 9 isoform X1           275   5e-83    
ref|XP_006662559.1|  PREDICTED: MLO-like protein 9-like                 276   6e-83    
gb|AAK72963.1|AF388195_1  Mlo                                           275   1e-82    Oryza sativa [red rice]
ref|XP_009384603.1|  PREDICTED: MLO-like protein 10                     271   1e-82    
ref|XP_006343449.1|  PREDICTED: MLO-like protein 6-like                 275   1e-82    
ref|NP_001105660.1|  barley mlo defense gene homolog1                   274   2e-82    Zea mays [maize]
ref|XP_009372684.1|  PREDICTED: MLO protein homolog 1-like              274   2e-82    
ref|XP_004240581.1|  PREDICTED: MLO-like protein 6                      275   3e-82    
gb|EYU45068.1|  hypothetical protein MIMGU_mgv1a009898mg                264   3e-81    
gb|AGV68799.1|  MLO1                                                    272   3e-81    
ref|XP_010104115.1|  MLO-like protein 6                                 271   4e-81    
ref|XP_006592218.1|  PREDICTED: MLO-like protein 6-like isoform X2      266   6e-81    
ref|XP_010264736.1|  PREDICTED: MLO-like protein 6 isoform X2           266   8e-81    
ref|XP_007027290.1|  Seven transmembrane MLO family protein             269   2e-80    
ref|XP_004983794.1|  PREDICTED: MLO-like protein 5-like                 269   3e-80    
ref|XP_008225371.1|  PREDICTED: MLO-like protein 6                      269   3e-80    
gb|KHN05728.1|  MLO-like protein 6                                      267   3e-80    
ref|XP_002465008.1|  hypothetical protein SORBIDRAFT_01g030400          268   3e-80    Sorghum bicolor [broomcorn]
ref|XP_011014774.1|  PREDICTED: MLO-like protein 10 isoform X2          266   4e-80    
ref|XP_010473363.1|  PREDICTED: MLO-like protein 6 isoform X2           266   5e-80    
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      268   5e-80    
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                268   6e-80    
ref|NP_001268013.1|  MLO11 protein                                      268   7e-80    
ref|XP_008796803.1|  PREDICTED: MLO-like protein 6                      268   8e-80    
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      268   9e-80    
gb|KEH25655.1|  seven transmembrane MLO family protein                  262   1e-79    
ref|XP_011089887.1|  PREDICTED: MLO-like protein 6                      267   1e-79    
ref|XP_010032020.1|  PREDICTED: MLO-like protein 6                      267   2e-79    
ref|XP_006579025.1|  PREDICTED: MLO protein homolog 1-like              261   2e-79    
ref|XP_002510708.1|  Protein MLO, putative                              266   2e-79    Ricinus communis
ref|XP_010264735.1|  PREDICTED: MLO-like protein 6 isoform X1           266   3e-79    
ref|XP_010043721.1|  PREDICTED: MLO-like protein 6 isoform X2           261   3e-79    
ref|XP_011044385.1|  PREDICTED: MLO-like protein 6 isoform X2           267   3e-79    
ref|XP_002526372.1|  Protein MLO, putative                              266   4e-79    Ricinus communis
ref|XP_007204981.1|  hypothetical protein PRUPE_ppa003207mg             266   5e-79    
gb|AAG46114.1|AC073166_12  putative Mlo (pathogen resistance) pro...    265   7e-79    Oryza sativa [red rice]
ref|XP_010473362.1|  PREDICTED: MLO-like protein 6 isoform X1           266   8e-79    
ref|XP_010418123.1|  PREDICTED: MLO-like protein 6                      265   9e-79    
gb|KDO71546.1|  hypothetical protein CISIN_1g008408mg                   265   1e-78    
ref|XP_009777573.1|  PREDICTED: MLO-like protein 6                      265   2e-78    
ref|XP_010430163.1|  PREDICTED: MLO-like protein 6 isoform X2           265   3e-78    
ref|XP_007135967.1|  hypothetical protein PHAVU_009G006800g             263   3e-78    
ref|NP_176350.1|  MLO-like protein 6                                    263   4e-78    Arabidopsis thaliana [mouse-ear cress]
gb|ADV40949.1|  MLO1                                                    263   4e-78    
ref|XP_010430162.1|  PREDICTED: MLO-like protein 6 isoform X1           265   5e-78    
ref|XP_009148458.1|  PREDICTED: MLO-like protein 2                      263   5e-78    
ref|XP_008796805.1|  PREDICTED: MLO-like protein 6                      263   6e-78    
ref|XP_010905123.1|  PREDICTED: MLO-like protein 6                      263   9e-78    
ref|XP_010253610.1|  PREDICTED: MLO-like protein 6 isoform X1           262   1e-77    
ref|XP_002886534.1|  hypothetical protein ARALYDRAFT_315221             263   1e-77    
ref|XP_010043720.1|  PREDICTED: MLO-like protein 6 isoform X1           262   1e-77    
ref|XP_003538050.1|  PREDICTED: MLO-like protein 6-like                 261   2e-77    
gb|KHN33781.1|  MLO protein like 1                                      260   2e-77    
ref|NP_001065189.1|  Os10g0541000                                       260   2e-77    Oryza sativa Japonica Group [Japonica rice]
emb|CDP07138.1|  unnamed protein product                                261   3e-77    
ref|XP_003539406.1|  PREDICTED: MLO-like protein 6-like                 261   3e-77    
emb|CDY15021.1|  BnaCnng04240D                                          261   4e-77    
ref|XP_006302048.1|  hypothetical protein CARUB_v10020030mg             261   4e-77    
ref|XP_002310696.2|  hypothetical protein POPTR_0007s08570g             260   4e-77    Populus trichocarpa [western balsam poplar]
gb|EMT01433.1|  MLO-like protein 5                                      259   4e-77    
gb|EMT06541.1|  MLO protein-1-like protein                              263   5e-77    
gb|KEH36352.1|  seven transmembrane MLO family protein                  255   5e-77    
ref|XP_007150220.1|  hypothetical protein PHAVU_005G136700g             256   6e-77    
gb|EEC80635.1|  hypothetical protein OsI_23017                          259   6e-77    Oryza sativa Indica Group [Indian rice]
gb|KHN20094.1|  MLO protein like 1                                      259   9e-77    
sp|A2YD22.2|MLOH1_ORYSI  RecName: Full=MLO protein homolog 1; Alt...    259   1e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_002314276.1|  hypothetical protein POPTR_0009s01710g             261   1e-76    Populus trichocarpa [western balsam poplar]
gb|KFK35674.1|  hypothetical protein AALP_AA4G022500                    259   1e-76    
ref|NP_001057664.1|  Os06g0486300                                       258   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004301626.1|  PREDICTED: MLO protein homolog 1-like              259   2e-76    
gb|EEE65742.1|  hypothetical protein OsJ_21392                          258   2e-76    
sp|Q0DC45.2|MLOH1_ORYSJ  RecName: Full=MLO protein homolog 1; Alt...    258   2e-76    
ref|XP_010905121.1|  PREDICTED: MLO-like protein 6                      259   2e-76    
ref|XP_010476039.1|  PREDICTED: MLO-like protein 2 isoform X1           259   2e-76    
ref|XP_004500844.1|  PREDICTED: MLO protein homolog 1-like              258   2e-76    
ref|XP_003527634.1|  PREDICTED: MLO protein homolog 1-like              258   3e-76    
emb|CDY57371.1|  BnaCnng31840D                                          255   3e-76    
gb|AAX31277.1|  MLO1                                                    258   3e-76    
emb|CDY26348.1|  BnaA03g60240D                                          258   4e-76    
emb|CDP06724.1|  unnamed protein product                                258   4e-76    
emb|CDY03836.1|  BnaC01g29530D                                          255   4e-76    
ref|XP_003539407.1|  PREDICTED: MLO-like protein 6-like                 258   4e-76    
ref|XP_007018107.1|  Seven transmembrane MLO family protein             257   5e-76    
ref|XP_009124631.1|  PREDICTED: MLO-like protein 6                      258   6e-76    
ref|XP_010253612.1|  PREDICTED: MLO-like protein 6 isoform X2           250   9e-76    
gb|KHN25048.1|  MLO-like protein 6                                      257   9e-76    
ref|XP_009347038.1|  PREDICTED: MLO-like protein 6                      257   1e-75    
gb|KEH36351.1|  seven transmembrane MLO family protein                  254   2e-75    
ref|XP_007150219.1|  hypothetical protein PHAVU_005G136700g             256   2e-75    
ref|XP_009596416.1|  PREDICTED: MLO-like protein 6                      256   3e-75    
ref|XP_009113127.1|  PREDICTED: MLO-like protein 6                      256   3e-75    
emb|CDY47582.1|  BnaA01g22680D                                          255   4e-75    
ref|XP_009133342.1|  PREDICTED: MLO-like protein 12 isoform X1          256   4e-75    
ref|XP_003603854.1|  MLO protein-like protein                           254   5e-75    
ref|XP_007015436.1|  Seven transmembrane MLO family protein isofo...    255   6e-75    
ref|XP_006307103.1|  hypothetical protein CARUB_v10008691mg             255   7e-75    
gb|AFW98801.1|  MLO protein 1                                           255   7e-75    
ref|XP_010458517.1|  PREDICTED: MLO-like protein 2                      254   7e-75    
emb|CDY12904.1|  BnaA09g13700D                                          255   8e-75    
ref|XP_004309423.1|  PREDICTED: MLO-like protein 6-like                 255   8e-75    
ref|XP_009104728.1|  PREDICTED: MLO-like protein 6                      255   8e-75    
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                254   1e-74    
ref|XP_006340147.1|  PREDICTED: MLO-like protein 6-like                 254   1e-74    
ref|XP_009133347.1|  PREDICTED: MLO-like protein 12                     254   1e-74    
ref|XP_011034835.1|  PREDICTED: MLO protein homolog 1-like              254   1e-74    
ref|XP_006383784.1|  hypothetical protein POPTR_0005s27620g             248   2e-74    
ref|XP_009133345.1|  PREDICTED: MLO-like protein 12                     253   3e-74    
ref|XP_010492667.1|  PREDICTED: MLO-like protein 2                      253   4e-74    
ref|XP_008463775.1|  PREDICTED: MLO-like protein 6                      253   5e-74    
ref|XP_006417368.1|  hypothetical protein EUTSA_v10007208mg             252   6e-74    
ref|XP_006293900.1|  hypothetical protein CARUB_v10022893mg             252   7e-74    
ref|XP_006411145.1|  hypothetical protein EUTSA_v10016436mg             252   8e-74    
dbj|BAH20363.1|  AT2G17480                                              250   8e-74    
gb|AAS93630.1|  Mlo protein                                             247   1e-73    
sp|O49873.1|MLOH1_HORVU  RecName: Full=MLO protein homolog 1            251   1e-73    
ref|XP_009141792.1|  PREDICTED: MLO-like protein 12                     251   2e-73    
emb|CDP01770.1|  unnamed protein product                                250   2e-73    
ref|NP_001117268.1|  MLO-like protein 2                                 247   2e-73    
ref|XP_006391995.1|  hypothetical protein EUTSA_v10023372mg             251   2e-73    
ref|XP_002892636.1|  hypothetical protein ARALYDRAFT_471266             251   3e-73    
ref|XP_007009792.1|  Seven transmembrane MLO family protein             250   3e-73    
gb|ACO07297.1|  MLO1                                                    249   5e-73    
ref|NP_001288934.1|  MLO-like protein 2                                 249   7e-73    
gb|AAK60567.1|AF384145_1  MLo1 protein                                  248   7e-73    
ref|XP_002881634.1|  hypothetical protein ARALYDRAFT_903160             249   7e-73    
gb|EMT06538.1|  Protein MLO                                             248   7e-73    
gb|ACV31921.1|  Mlo protein                                             248   7e-73    
gb|ACV31920.1|  Mlo protein                                             248   8e-73    
ref|XP_010558749.1|  PREDICTED: MLO-like protein 6                      249   8e-73    
ref|XP_010476040.1|  PREDICTED: MLO-like protein 2 isoform X2           249   1e-72    
ref|NP_565902.1|  protein MILDEW RESISTANCE LOCUS O 12                  249   1e-72    
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      249   1e-72    
gb|EPS70534.1|  hypothetical protein M569_04226                         251   1e-72    
ref|XP_009335054.1|  PREDICTED: MLO-like protein 6                      249   2e-72    
ref|XP_010547373.1|  PREDICTED: MLO-like protein 6                      248   2e-72    
ref|XP_004148785.1|  PREDICTED: MLO-like protein 6-like                 248   2e-72    
sp|P93766.1|MLO_HORVU  RecName: Full=Protein MLO                        247   2e-72    
gb|AAK94904.1|AF361932_1  seven transmembrane-spanning protein          247   3e-72    
ref|XP_008463927.1|  PREDICTED: MLO-like protein 6 isoform X2           243   4e-72    
ref|XP_010253607.1|  PREDICTED: MLO-like protein 3                      247   4e-72    
ref|XP_002312021.2|  MLO-like protein 12                                247   7e-72    
ref|XP_010412940.1|  PREDICTED: MLO-like protein 12                     245   7e-72    
ref|XP_006425251.1|  hypothetical protein CICLE_v10025242mg             244   8e-72    
ref|XP_011031756.1|  PREDICTED: MLO-like protein 6                      246   8e-72    
ref|XP_007015440.1|  MLO, putative                                      246   9e-72    
gb|KHG27081.1|  MLO-like protein 3                                      245   9e-72    
emb|CDY07075.1|  BnaA04g22400D                                          246   1e-71    
ref|XP_011041289.1|  PREDICTED: MLO protein homolog 1-like              246   1e-71    
ref|NP_172598.1|  MLO-like protein 2                                    246   1e-71    
gb|EMS47417.1|  Protein MLO                                             245   1e-71    
ref|XP_010509062.1|  PREDICTED: MLO-like protein 12                     246   2e-71    
gb|AAK60566.1|AF384144_1  MLo protein                                   244   2e-71    
ref|XP_004515994.1|  PREDICTED: MLO-like protein 2-like                 245   2e-71    
ref|XP_004157520.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    245   3e-71    
ref|XP_010505587.1|  PREDICTED: MLO-like protein 12 isoform X2          245   3e-71    
ref|XP_010505586.1|  PREDICTED: MLO-like protein 12 isoform X1          245   3e-71    
ref|XP_004142393.1|  PREDICTED: MLO-like protein 6-like                 245   3e-71    
ref|XP_002306989.1|  hypothetical protein POPTR_0005s27570g             244   3e-71    
ref|XP_010064953.1|  PREDICTED: MLO protein homolog 1-like              244   4e-71    
ref|XP_002273002.1|  PREDICTED: MLO protein homolog 1-like              244   5e-71    
ref|XP_006599405.1|  PREDICTED: MLO-like protein 12-like isoform X2     239   7e-71    
emb|CBI40746.3|  unnamed protein product                                243   9e-71    
ref|XP_008463924.1|  PREDICTED: MLO-like protein 6 isoform X1           244   9e-71    
ref|XP_002533246.1|  Protein MLO, putative                              244   1e-70    
ref|NP_001284458.1|  MLO-like protein 12                                243   1e-70    
ref|XP_008387612.1|  PREDICTED: MLO-like protein 6 isoform X2           239   1e-70    
gb|KDO85189.1|  hypothetical protein CISIN_1g041242mg                   243   1e-70    
ref|XP_009342698.1|  PREDICTED: MLO-like protein 6 isoform X2           243   2e-70    
ref|XP_010658319.1|  PREDICTED: MLO7 protein isoform X1                 237   3e-70    
ref|XP_008369779.1|  PREDICTED: MLO-like protein 6 isoform X2           243   3e-70    
ref|XP_009342695.1|  PREDICTED: MLO-like protein 6 isoform X1           242   3e-70    
gb|KGN47314.1|  hypothetical protein Csa_6G292430                       243   3e-70    
ref|XP_006435410.1|  hypothetical protein CICLE_v10003446mg             242   4e-70    
ref|XP_009358149.1|  PREDICTED: MLO-like protein 6                      242   4e-70    
ref|XP_008233336.1|  PREDICTED: MLO-like protein 6                      242   4e-70    
gb|KFK40693.1|  hypothetical protein AALP_AA2G029100                    242   5e-70    
ref|XP_007150221.1|  hypothetical protein PHAVU_005G136800g             241   5e-70    
ref|XP_006836488.1|  hypothetical protein AMTR_s00108p00111960          241   5e-70    
gb|KFK36813.1|  hypothetical protein AALP_AA4G174800                    242   6e-70    
emb|CDP07140.1|  unnamed protein product                                241   6e-70    
ref|XP_007151752.1|  hypothetical protein PHAVU_004G071700g             241   7e-70    
gb|AGV68801.1|  MLO4                                                    241   1e-69    
emb|CAN64133.1|  hypothetical protein VITISV_032771                     241   1e-69    
ref|XP_009385958.1|  PREDICTED: MLO-like protein 6                      241   1e-69    
ref|XP_003548912.1|  PREDICTED: MLO-like protein 12-like isoform X1     240   2e-69    
ref|XP_008786683.1|  PREDICTED: MLO-like protein 10                     238   2e-69    
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      241   3e-69    
ref|XP_004304412.1|  PREDICTED: MLO-like protein 3-like                 239   3e-69    
ref|XP_006488133.1|  PREDICTED: MLO-like protein 6-like isoform X2      235   4e-69    
ref|XP_004163384.1|  PREDICTED: MLO-like protein 6-like                 239   5e-69    
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      239   5e-69    
ref|XP_007132193.1|  hypothetical protein PHAVU_011G073800g             239   6e-69    
ref|XP_004149543.1|  PREDICTED: MLO-like protein 6-like                 234   7e-69    
gb|KDO48444.1|  hypothetical protein CISIN_1g008391mg                   234   7e-69    
ref|XP_011013684.1|  PREDICTED: MLO-like protein 12                     236   8e-69    
ref|XP_003597192.1|  MLO-like protein                                   239   8e-69    
ref|XP_010264740.1|  PREDICTED: MLO-like protein 3                      239   8e-69    
ref|XP_004304413.1|  PREDICTED: MLO-like protein 6-like                 238   9e-69    
ref|XP_006656978.1|  PREDICTED: MLO protein homolog 1-like              239   1e-68    
ref|XP_006424617.1|  hypothetical protein CICLE_v10028153mg             238   1e-68    
ref|XP_010107563.1|  MLO-like protein 3                                 237   1e-68    
ref|XP_006485875.1|  PREDICTED: MLO-like protein 12-like                234   1e-68    
ref|XP_002282198.1|  PREDICTED: MLO-like protein 3 isoform X1           237   2e-68    
gb|KCW70337.1|  hypothetical protein EUGRSUZ_F03580                     237   2e-68    
ref|XP_011077127.1|  PREDICTED: MLO-like protein 12                     236   2e-68    
ref|XP_002282216.1|  PREDICTED: MLO-like protein 6                      238   2e-68    
gb|AIK01832.1|  MLO                                                     235   3e-68    
ref|XP_004487134.1|  PREDICTED: MLO-like protein 6-like                 237   3e-68    
ref|XP_010032208.1|  PREDICTED: MLO-like protein 2 isoform X2           236   5e-68    
ref|XP_010032207.1|  PREDICTED: MLO-like protein 2 isoform X1           235   8e-68    
ref|XP_011004622.1|  PREDICTED: MLO-like protein 6                      233   9e-68    
ref|XP_011074078.1|  PREDICTED: MLO protein homolog 1-like              236   9e-68    
emb|CBI16290.3|  unnamed protein product                                238   1e-67    
ref|XP_010043719.1|  PREDICTED: MLO-like protein 3                      235   1e-67    
emb|CAN70220.1|  hypothetical protein VITISV_000578                     233   2e-67    
ref|XP_006424615.1|  hypothetical protein CICLE_v10028092mg             235   2e-67    
ref|XP_011040971.1|  PREDICTED: MLO-like protein 6                      234   4e-67    
gb|KDO48443.1|  hypothetical protein CISIN_1g008391mg                   234   4e-67    
emb|CDO99726.1|  unnamed protein product                                233   4e-67    
emb|CDY14402.1|  BnaC03g21930D                                          234   5e-67    
ref|XP_008369778.1|  PREDICTED: MLO-like protein 6 isoform X1           234   5e-67    
ref|XP_006307459.1|  hypothetical protein CARUB_v10009086mg             231   6e-67    
ref|XP_010476041.1|  PREDICTED: MLO-like protein 2 isoform X3           233   6e-67    
ref|XP_007027289.1|  Seven transmembrane MLO family protein, puta...    229   8e-67    
ref|XP_002315295.2|  hypothetical protein POPTR_0010s22730g             233   8e-67    
ref|XP_011089886.1|  PREDICTED: MLO-like protein 3                      232   9e-67    
ref|XP_004309869.1|  PREDICTED: MLO-like protein 3-like                 232   1e-66    
gb|AFW98802.1|  MLO protein 2                                           233   2e-66    
gb|AFM35696.1|  Mlo                                                     232   2e-66    
gb|KHN13369.1|  MLO-like protein 12                                     233   2e-66    
ref|NP_001268005.1|  MLO6 protein                                       231   2e-66    
emb|CDY20991.1|  BnaA08g25340D                                          231   3e-66    
gb|KEH36350.1|  seven transmembrane MLO family protein                  230   3e-66    
ref|XP_009110727.1|  PREDICTED: MLO-like protein 2                      231   5e-66    
ref|XP_002322867.1|  hypothetical protein POPTR_0016s08940g             229   6e-66    
ref|XP_010068861.1|  PREDICTED: MLO-like protein 2                      230   1e-65    
emb|CBI31481.3|  unnamed protein product                                229   1e-65    
ref|XP_010534417.1|  PREDICTED: MLO-like protein 12                     230   2e-65    
gb|ABB47940.1|  MLO-like protein 10, putative, expressed                228   2e-65    
ref|XP_007151753.1|  hypothetical protein PHAVU_004G071800g             229   2e-65    
ref|XP_010476042.1|  PREDICTED: MLO-like protein 2 isoform X4           226   2e-65    
ref|XP_010313404.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    229   2e-65    
ref|XP_007027288.1|  Seven transmembrane MLO family protein, puta...    229   2e-65    
ref|XP_002275360.2|  PREDICTED: MLO-like protein 3                      228   2e-65    
ref|XP_008239391.1|  PREDICTED: MLO-like protein 3                      229   3e-65    
gb|KDO71552.1|  hypothetical protein CISIN_1g008408mg                   225   4e-65    
gb|EYU36197.1|  hypothetical protein MIMGU_mgv1a003903mg                228   5e-65    
gb|AGV68800.1|  MLO3                                                    229   5e-65    
gb|AAK53802.1|AF369570_1  membrane protein Mlo9                         222   6e-65    
ref|XP_007208289.1|  hypothetical protein PRUPE_ppa003437mg             228   8e-65    
ref|XP_008243901.1|  PREDICTED: MLO-like protein 6                      228   8e-65    
ref|XP_010039224.1|  PREDICTED: MLO-like protein 3                      228   8e-65    
ref|XP_006381474.1|  hypothetical protein POPTR_0006s13170g             227   9e-65    
ref|XP_008380968.1|  PREDICTED: MLO-like protein 3                      226   2e-64    
ref|XP_010046751.1|  PREDICTED: MLO-like protein 6                      226   3e-64    
ref|XP_010492678.1|  PREDICTED: MLO-like protein 2                      226   4e-64    
ref|XP_003548913.1|  PREDICTED: MLO-like protein 12-like                226   6e-64    
emb|CDX97946.1|  BnaA06g06970D                                          224   2e-63    
gb|EYU41181.1|  hypothetical protein MIMGU_mgv1a007661mg                220   2e-63    
ref|XP_009333712.1|  PREDICTED: MLO-like protein 6                      224   2e-63    
gb|AFW98803.1|  MLO protein 3                                           224   2e-63    
gb|AFW98804.1|  MLO protein 4                                           224   2e-63    
ref|XP_006356488.1|  PREDICTED: MLO-like protein 6-like                 223   3e-63    
emb|CDP07269.1|  unnamed protein product                                223   3e-63    
ref|XP_003519926.1|  PREDICTED: MLO-like protein 12-like                224   3e-63    
ref|XP_004235223.1|  PREDICTED: MLO-like protein 2 isoform X1           222   4e-63    
emb|CDY19353.1|  BnaC05g08620D                                          222   6e-63    
ref|XP_009342675.1|  PREDICTED: MLO-like protein 3                      222   9e-63    
gb|KCW88826.1|  hypothetical protein EUGRSUZ_A01164                     223   1e-62    
ref|XP_009786897.1|  PREDICTED: MLO-like protein 3 isoform X3           214   2e-62    
ref|XP_009786898.1|  PREDICTED: MLO-like protein 3 isoform X4           213   2e-62    
ref|XP_011048573.1|  PREDICTED: MLO-like protein 3 isoform X2           217   3e-62    
ref|XP_007015437.1|  Seven transmembrane MLO family protein isofo...    220   3e-62    
ref|XP_004163965.1|  PREDICTED: MLO-like protein 3-like                 221   3e-62    
ref|XP_011048572.1|  PREDICTED: MLO-like protein 3 isoform X1           217   4e-62    
ref|XP_011003713.1|  PREDICTED: MLO-like protein 3 isoform X1           220   5e-62    
ref|XP_006587547.1|  PREDICTED: MLO-like protein 10-like isoform X2     218   6e-62    
gb|AEC12478.1|  membrane protein                                        220   7e-62    
ref|XP_009786896.1|  PREDICTED: MLO-like protein 3 isoform X2           213   8e-62    
ref|XP_010922537.1|  PREDICTED: MLO-like protein 3 isoform X2           216   1e-61    
ref|XP_010922536.1|  PREDICTED: MLO-like protein 3 isoform X1           216   1e-61    
ref|XP_008225351.1|  PREDICTED: MLO-like protein 3 isoform X1           219   1e-61    
ref|XP_010030836.1|  PREDICTED: MLO protein homolog 1-like              219   2e-61    
ref|XP_006473919.1|  PREDICTED: MLO protein homolog 1-like              217   2e-61    
ref|XP_004147296.1|  PREDICTED: MLO-like protein 3-like                 219   2e-61    
gb|AAK53800.1|AF369568_1  membrane protein Mlo7                         215   2e-61    
ref|XP_007206665.1|  hypothetical protein PRUPE_ppa022847mg             218   3e-61    
ref|XP_009601693.1|  PREDICTED: MLO-like protein 3                      216   3e-61    
ref|XP_009378090.1|  PREDICTED: MLO-like protein 6                      218   4e-61    
ref|XP_009786895.1|  PREDICTED: MLO-like protein 3 isoform X1           213   5e-61    



>ref|XP_006356610.1| PREDICTED: MLO-like protein 5-like [Solanum tuberosum]
Length=532

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 238/300 (79%), Gaps = 15/300 (5%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVALVC VIV+IS++LEK+LHK+G TFER++K ALVEALEKIK ELMVLGF
Sbjct  9     RELDQTPTWAVALVCAVIVLISILLEKVLHKVGQTFERRRKSALVEALEKIKAELMVLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI++ICIPE   +TMLPC       +H   G+G        G HAP +  
Sbjct  69    ISLLLTFGQNYISRICIPERVADTMLPCPAQ----QHARLGYGG-------GHHAPGQGH  117

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             HQ P    GE HRRLL   R + +    E C+ G +PLIS +GLHQLHIFIFFLAVFHVI
Sbjct  118   HQPPGT--GEAHRRLLSDHRILAADSPAETCRPGQVPLISTHGLHQLHIFIFFLAVFHVI  175

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR+KIR WKEWE     + EA+ND SR+RLTKETSFV++NTSF T TP++FY
Sbjct  176   YSAITMLLGRLKIREWKEWERQVEHEYEASNDASRFRLTKETSFVRDNTSFGT-TPIIFY  234

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
             SVCFFRQFFRSVR+ADYL MRHGFI+VHLAPGSKF+FQKYIKRSLEDDFKV+VGIN +LW
Sbjct  235   SVCFFRQFFRSVRKADYLTMRHGFITVHLAPGSKFNFQKYIKRSLEDDFKVIVGINSLLW  294



>ref|XP_004500841.1| PREDICTED: MLO-like protein 5-like isoform X1 [Cicer arietinum]
Length=581

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/343 (63%), Positives = 240/343 (70%), Gaps = 43/343 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC VIV+IS+ LEKL+HKI   FE KKK AL+EALEKIK ELMVLGF
Sbjct  11    RQLDVTPTWAVAAVCAVIVIISISLEKLIHKIAKVFEEKKKHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEH-----------------VEHQAPGHG  601
             ISLLLTFGQ+YI+K+CIP    NTMLPCL  D+                    H+ P  G
Sbjct  71    ISLLLTFGQNYISKVCIPTRYSNTMLPCLPLDQRQAGHPSEPAQTGHEPPTTGHEPPTTG  130

Query  602   EHAPSGEH----GEHAPPEDEHQEPAE-------------------AGGEHHRRLLWSMR  712
                P+ EH     EH PP  EH EPA                    + GEHHRRLL   R
Sbjct  131   HEPPTTEHEPPTTEHEPPTTEH-EPAPTEHEPPPTAHEAPAEEAEPSKGEHHRRLLSYER  189

Query  713   RVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEW  889
             RVLSG      CK G +PLI++NGLHQLHIFIFFLAVFHVIY AITM LGR KI+GWKEW
Sbjct  190   RVLSGGGGGHGCKLGYVPLIAVNGLHQLHIFIFFLAVFHVIYSAITMTLGRAKIKGWKEW  249

Query  890   EMATAQDEAA-NDPSRYRLTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLA  1066
             E     DE A NDP R+RLT ETSFV+++ SF T+TPV FY VCFFRQFFRSVRRADYL 
Sbjct  250   EQDHVVDEDALNDPRRFRLTHETSFVRDHNSFWTKTPVSFYFVCFFRQFFRSVRRADYLT  309

Query  1067  MRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLWCA  1195
             MRHGF+SVHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +LW +
Sbjct  310   MRHGFVSVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLLWAS  352



>ref|XP_004500842.1| PREDICTED: MLO-like protein 5-like isoform X2 [Cicer arietinum]
Length=543

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 236/307 (77%), Gaps = 9/307 (3%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC VIV+IS+ LEKL+HKI   FE KKK AL+EALEKIK ELMVLGF
Sbjct  11    RQLDVTPTWAVAAVCAVIVIISISLEKLIHKIAKVFEEKKKHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+K+CIP    NTMLPCL  D+    QA    E A      EH PP   
Sbjct  71    ISLLLTFGQNYISKVCIPTRYSNTMLPCLPLDQR---QAGHPSEPAQEPAPTEHEPPPTA  127

Query  653   HQEPAE----AGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLA  817
             H+ PAE    + GEHHRRLL   RRVLSG      CK G +PLI++NGLHQLHIFIFFLA
Sbjct  128   HEAPAEEAEPSKGEHHRRLLSYERRVLSGGGGGHGCKLGYVPLIAVNGLHQLHIFIFFLA  187

Query  818   VFHVIYGAITMALGRMKIRGWKEWEMATAQDEAA-NDPSRYRLTKETSFVKENTSFMTQT  994
             VFHVIY AITM LGR KI+GWKEWE     DE A NDP R+RLT ETSFV+++ SF T+T
Sbjct  188   VFHVIYSAITMTLGRAKIKGWKEWEQDHVVDEDALNDPRRFRLTHETSFVRDHNSFWTKT  247

Query  995   PVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGI  1174
             PV FY VCFFRQFFRSVRRADYL MRHGF+SVHLAPGSKFDFQKYIKRSLEDDFKVVVGI
Sbjct  248   PVSFYFVCFFRQFFRSVRRADYLTMRHGFVSVHLAPGSKFDFQKYIKRSLEDDFKVVVGI  307

Query  1175  NLMLWCA  1195
             + +LW +
Sbjct  308   SPLLWAS  314



>ref|XP_004144292.1| PREDICTED: MLO-like protein 5-like [Cucumis sativus]
 ref|XP_004158310.1| PREDICTED: MLO-like protein 5-like [Cucumis sativus]
 gb|KGN47524.1| hypothetical protein Csa_6G355430 [Cucumis sativus]
Length=544

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 233/303 (77%), Gaps = 18/303 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK+LH +G  F+++KK+AL EALEK+KGELMVLGF
Sbjct  12    RELDQTPTWAVAAVCAVIILISIILEKVLHMVGEIFQKRKKKALYEALEKVKGELMVLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIAK+CIP    NTMLPC           P  G      +   HA P+D+
Sbjct  72    ISLLLTFGQNYIAKVCIPSKYENTMLPC-----------PFRGSSTTLPKSSHHAEPDDD  120

Query  653   HQEPAEAGGEHHRRLLW-SMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                  E   +HHRRLLW   RR+  G +VE CK G   LISLNGLHQ+HIFIFFLAV HV
Sbjct  121   -----EETSDHHRRLLWYEHRRLGGGGSVEGCKPGYTQLISLNGLHQIHIFIFFLAVLHV  175

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             ++ AITM LGR+KIR WK WE  T Q+ +A NDP+R+RLT ETSFV++++SF T+TP+ F
Sbjct  176   VFSAITMTLGRLKIRAWKVWERQTEQEHDAMNDPTRFRLTHETSFVRDHSSFWTKTPLSF  235

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCF+RQFFRSV R DYL++RHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  236   YFVCFWRQFFRSVSRPDYLSLRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLL  295

Query  1187  WCA  1195
             W +
Sbjct  296   WAS  298



>ref|XP_004245231.1| PREDICTED: MLO-like protein 9 [Solanum lycopersicum]
Length=532

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 235/300 (78%), Gaps = 15/300 (5%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVALVC VIV+IS++LEK+LHK+G TFER++K ALVEALEKIK ELMVLGF
Sbjct  10    RELDQTPTWAVALVCAVIVLISILLEKVLHKVGQTFERRRKSALVEALEKIKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ++I++ICIPE   +TMLPC       +H   G+G        G H  PE  
Sbjct  70    ISLLLTFGQNFISQICIPERVADTMLPCPAQ----QHSRLGYGGGHHGPGQGHHKTPE--  123

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                     GE HRRLL   R + +    + C+ G +PLIS++GLHQLHIFIFFLAVFHVI
Sbjct  124   -------AGEAHRRLLSDHRILAADSPGDTCRPGQVPLISIHGLHQLHIFIFFLAVFHVI  176

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR+KIR WKEWE     + EA+ND SR+RLTKETSFV++NTSF T TPV+FY
Sbjct  177   YSAITMLLGRLKIREWKEWERQVEHEYEASNDASRFRLTKETSFVRDNTSFGT-TPVVFY  235

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
             SVCFFRQFFRSVR+ADYL MRHGFISVHLAPGSKF+FQKYIKRSLEDDFKV+VGIN +LW
Sbjct  236   SVCFFRQFFRSVRKADYLTMRHGFISVHLAPGSKFNFQKYIKRSLEDDFKVIVGINSLLW  295



>ref|XP_010256542.1| PREDICTED: MLO-like protein 9 [Nelumbo nucifera]
Length=537

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 234/312 (75%), Gaps = 20/312 (6%)
 Frame = +2

Query  266   MSgggggkgRELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKI  445
             MSGG   + R+LDQTPTWAVA VC  I++IS++LEK+LH++G  F+ ++K+AL EALEK+
Sbjct  1     MSGGDNSQSRQLDQTPTWAVAFVCAFIIIISIVLEKVLHRVGEWFQERRKKALYEALEKV  60

Query  446   KGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEH  625
             KGELM+LGFISLLLTFGQ YIAK+CIPE   NTMLPC        ++A G    A  GEH
Sbjct  61    KGELMILGFISLLLTFGQIYIAKVCIPEHFANTMLPC-------PYRAGGLAHGAEDGEH  113

Query  626   GEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFI  805
                        +   AG  HHR+LLW+ RR+LSG    +C EG  PLIS+NGLHQLHIFI
Sbjct  114   -----------KTESAGEGHHRKLLWNERRILSGGGDYKCMEGYEPLISINGLHQLHIFI  162

Query  806   FFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTS  979
             FFLAVFHV+Y   TMALGR+KIRGW+ WE  T     E + D +R+RLTKETSFVK + +
Sbjct  163   FFLAVFHVVYSCATMALGRLKIRGWRAWETETLSHDYEFSQDQARFRLTKETSFVKAHNN  222

Query  980   FMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFK  1159
             F T+ P LF  VCFFRQFFRSVR+ADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFK
Sbjct  223   FWTRVPFLFIIVCFFRQFFRSVRKADYLTMRHGFVAVHLAPGSKFDFQKYIKRSLEDDFK  282

Query  1160  VVVGINLMLWCA  1195
             VVVGI+ +LW +
Sbjct  283   VVVGISPLLWAS  294



>emb|CAN71968.1| hypothetical protein VITISV_007362 [Vitis vinifera]
Length=359

 Score =   363 bits (931),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 231/301 (77%), Gaps = 34/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK+LH +G  F+R++K+AL EALEK+KGELM+LGF
Sbjct  9     RELDQTPTWAVAAVCAVIILISIILEKVLHLVGELFQRRRKKALYEALEKVKGELMILGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIP    +TMLPC                  PSG    H   E E
Sbjct  69    ISLLLTFGQNYISKICIPSDLADTMLPC------------------PSGGQAHH---EAE  107

Query  653   HQ-EPAEAGGEHHRRLLWSMRRVLSGHAVEE----CKEGLIPLISLNGLHQLHIFIFFLA  817
             H+ EPAE  GEHHR+LLW+  R LS   VE     CKEG +PLIS +GLHQLHIFIFFLA
Sbjct  108   HKPEPAE--GEHHRKLLWNEHRFLS---VESEGVVCKEGHVPLISTHGLHQLHIFIFFLA  162

Query  818   VFHVIYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTP  997
             VFHVIY AITMALGR+K R WKEWE  T  D   ND +R+RLT ETSFV++++SF T+TP
Sbjct  163   VFHVIYSAITMALGRLKTRAWKEWERETEYD---NDAARFRLTHETSFVRDHSSFWTKTP  219

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
              LF  VCFFRQFFRSVR+ADYL MRHGF++VHLAPGSKF+FQKYIKRSLEDDFKVVVGI 
Sbjct  220   FLFVIVCFFRQFFRSVRKADYLTMRHGFVTVHLAPGSKFNFQKYIKRSLEDDFKVVVGIR  279

Query  1178  L  1180
             +
Sbjct  280   M  280



>ref|XP_010663996.1| PREDICTED: MLO-like protein 9 [Vitis vinifera]
Length=531

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 235/306 (77%), Gaps = 34/306 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK+LH +G  F+R++K+AL EALEK+KGELM+LGF
Sbjct  9     RELDQTPTWAVAAVCAVIILISIILEKVLHLVGELFQRRRKKALYEALEKVKGELMILGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIP    +TMLPC                  PSG    H   E E
Sbjct  69    ISLLLTFGQNYISKICIPSDLADTMLPC------------------PSGGQAHH---EAE  107

Query  653   HQ-EPAEAGGEHHRRLLWSMRRVLSGHAVEE----CKEGLIPLISLNGLHQLHIFIFFLA  817
             H+ EPAE  GEHHR+LLW+  R LS   VE     CKEG +PLIS +GLHQLHIFIFFLA
Sbjct  108   HKPEPAE--GEHHRKLLWNEHRFLS---VESEGVVCKEGHVPLISTHGLHQLHIFIFFLA  162

Query  818   VFHVIYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTP  997
             VFHVIY AITMALGR+K R WKEWE  T  D   ND +R+RLT ETSFV++++SF T+TP
Sbjct  163   VFHVIYSAITMALGRLKTRAWKEWERETEYD---NDAARFRLTHETSFVRDHSSFWTKTP  219

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
              LF  VCFFRQFFRSVR+ADYL MRHGF++VHLAPGSKF+FQKYIKRSLEDDFKVVVGI+
Sbjct  220   FLFVIVCFFRQFFRSVRKADYLTMRHGFVTVHLAPGSKFNFQKYIKRSLEDDFKVVVGIS  279

Query  1178  LMLWCA  1195
              +LW +
Sbjct  280   PVLWAS  285



>ref|XP_009586729.1| PREDICTED: MLO-like protein 9 [Nicotiana tomentosiformis]
Length=531

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 231/301 (77%), Gaps = 26/301 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVALVC VIV+IS++LEK+LH +G TFER++K ALVEALEKIKGELMVLGF
Sbjct  10    RELDQTPTWAVALVCAVIVLISILLEKVLHAVGETFERRRKSALVEALEKIKGELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIP    NTMLPC           P    H               
Sbjct  70    ISLLLTFGQNYISKICIPVRVANTMLPC-----------PAQHGHG------------HG  106

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H       GEHHRRLLW   R+L+  +    CK G +PLISLNGLHQLHIFIFFLAVFHV
Sbjct  107   HGHGHTDTGEHHRRLLWDHFRILAADSPARACKPGHVPLISLNGLHQLHIFIFFLAVFHV  166

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR+KIR WKEWE     D EA+ND SR+RLTKETSFV++NTSF T TP+LF
Sbjct  167   IYSAITMLLGRLKIREWKEWEKEVEHDYEASNDSSRFRLTKETSFVRDNTSFGT-TPILF  225

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             YSVCFFRQFFRSVR+ADYL MRHGFISVHLAPGSKF+FQKYIKRSLEDDFK+VVGIN +L
Sbjct  226   YSVCFFRQFFRSVRKADYLTMRHGFISVHLAPGSKFNFQKYIKRSLEDDFKIVVGINSLL  285

Query  1187  W  1189
             W
Sbjct  286   W  286



>ref|XP_008464826.1| PREDICTED: MLO-like protein 9 [Cucumis melo]
 ref|XP_008464827.1| PREDICTED: MLO-like protein 9 [Cucumis melo]
 ref|XP_008464828.1| PREDICTED: MLO-like protein 9 [Cucumis melo]
Length=542

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 232/304 (76%), Gaps = 20/304 (7%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK+LH +G  F+++KK+AL EALEK+KGELMVLGF
Sbjct  12    RELDQTPTWAVAAVCAVIILISIILEKVLHMVGEIFQKRKKKALYEALEKVKGELMVLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEH-APSGEHGEHAPPED  649
             ISLLLTFGQ+YIAK+CIP    NTMLPC           P  G   AP   HG    PED
Sbjct  72    ISLLLTFGQNYIAKVCIPSKYENTMLPC-----------PYRGSTTAPKSSHG--GEPED  118

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
               +E  +    HHRRLLW   R L+G   VE CK G   LISLNGLHQ+HIFIFFLAV H
Sbjct  119   HDEETTD----HHRRLLWYEHRHLAGGGPVEGCKPGYTQLISLNGLHQIHIFIFFLAVLH  174

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             V++ AITM LGR+KIRGWK WE  T Q+ +A NDP+R+RLT ETSFV++++SF T+TP+ 
Sbjct  175   VVFSAITMTLGRLKIRGWKVWERQTEQEHDAMNDPTRFRLTHETSFVRDHSSFWTKTPLS  234

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY V F+RQFFRSV R DYL++RHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI  +
Sbjct  235   FYFVSFWRQFFRSVSRPDYLSLRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGITPL  294

Query  1184  LWCA  1195
             LW +
Sbjct  295   LWAS  298



>emb|CBI40748.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   363 bits (933),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 231/306 (75%), Gaps = 37/306 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK+LH +G  F+R++K+AL EALEK+KGELM+LGF
Sbjct  9     RELDQTPTWAVAAVCAVIILISIILEKVLHLVGELFQRRRKKALYEALEKVKGELMILGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIP    +TMLPC                  PSG    H   E E
Sbjct  69    ISLLLTFGQNYISKICIPSDLADTMLPC------------------PSGGQAHH---EAE  107

Query  653   HQ-EPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H+ EPAE  GEHHR+LLW+  R LSGH         +PLIS +GLHQLHIFIFFLAVFHV
Sbjct  108   HKPEPAE--GEHHRKLLWNEHRFLSGH---------VPLISTHGLHQLHIFIFFLAVFHV  156

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAA----NDPSRYRLTKETSFVKENTSFMTQTP  997
             IY AITMALGR+K R WKEWE  T  D       ND +R+RLT ETSFV++++SF T+TP
Sbjct  157   IYSAITMALGRLKTRAWKEWERETEYDNGILLDDNDAARFRLTHETSFVRDHSSFWTKTP  216

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
              LF  VCFFRQFFRSVR+ADYL MRHGF++VHLAPGSKF+FQKYIKRSLEDDFKVVVGI+
Sbjct  217   FLFVIVCFFRQFFRSVRKADYLTMRHGFVTVHLAPGSKFNFQKYIKRSLEDDFKVVVGIS  276

Query  1178  LMLWCA  1195
              +LW +
Sbjct  277   PVLWAS  282



>ref|XP_002510710.1| Protein MLO, putative [Ricinus communis]
 gb|EEF52897.1| Protein MLO, putative [Ricinus communis]
Length=467

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 229/303 (76%), Gaps = 26/303 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +IV++S++LEK LH  G  F+ + KRAL EALEK+KGELMVLGF
Sbjct  10    RELDQTPTWAVAAVCAIIVLLSIILEKFLHWTGEWFQERHKRALYEALEKVKGELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTF Q++IA+ICI E   NTMLPC           P  G+H        H P  D 
Sbjct  70    ISLLLTFSQNFIARICIREKFANTMLPC-----------PQKGKH--------HEPDSDP  110

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +E      +HHRRLL   RR L+  +    CK G +PLIS+NGLHQLHIFIFFLAVFHV
Sbjct  111   FKEE-----DHHRRLLLYDRRFLAADSSGAGCKAGHVPLISVNGLHQLHIFIFFLAVFHV  165

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR+KIRGWKEWE  +++D +A NDP+R+RLT ETSFV+++TSF T+ P L 
Sbjct  166   IYSAITMMLGRLKIRGWKEWERESSKDHDALNDPTRFRLTHETSFVRDHTSFWTKMPALH  225

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCFFRQFFRSV +ADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  226   YVVCFFRQFFRSVTKADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLL  285

Query  1187  WCA  1195
             W +
Sbjct  286   WAS  288



>ref|XP_010064954.1| PREDICTED: MLO-like protein 9 [Eucalyptus grandis]
 gb|KCW70340.1| hypothetical protein EUGRSUZ_F03583 [Eucalyptus grandis]
Length=559

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 234/307 (76%), Gaps = 12/307 (4%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC  IV+IS++LEK+LH +G  F +++K A++EALEK+KGELMVLGF
Sbjct  11    RELDQTPTWAVSAVCASIVLISILLEKVLHSVGSIFRKRRKAAMLEALEKLKGELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIAK+CIPE A +TMLPC +       Q+  HG++A   + G       E
Sbjct  71    ISLLLTFGQTYIAKVCIPERAADTMLPCPLA------QSNHHGDNAAGDKGGGGGGGGGE  124

Query  653   HQEPAEAGGE----HHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLA  817
               E  E GG     HHRRLLW   RVL+  +    CK G + ++S+N LHQLHIFIFFLA
Sbjct  125   EAEAGEGGGSSSGEHHRRLLWFAHRVLAAESGGAGCKAGYVSMVSVNALHQLHIFIFFLA  184

Query  818   VFHVIYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQT  994
             VFHV+Y A+TM LGR+KIRGWKEWE  T  D E  NDPSR+RLT ETSFV+E++    +T
Sbjct  185   VFHVLYSAVTMTLGRLKIRGWKEWERETMTDFEFLNDPSRFRLTHETSFVREHSHLGNKT  244

Query  995   PVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGI  1174
             P LFY VCFFRQFFR+VRRADYL MRHGFI+VHLAPGSKFDFQKYIKRSLEDDFKVVVGI
Sbjct  245   PCLFYVVCFFRQFFRAVRRADYLTMRHGFITVHLAPGSKFDFQKYIKRSLEDDFKVVVGI  304

Query  1175  NLMLWCA  1195
             + +LW +
Sbjct  305   SPLLWAS  311



>ref|XP_010686828.1| PREDICTED: MLO-like protein 9 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 224/304 (74%), Gaps = 26/304 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC +I+VIS++LEK+LH IG  F +K K+AL EALEKIKGELMVLGF
Sbjct  15    RQLDQTPTWAVASVCAIIIVISIVLEKVLHHIGEYFHKKHKKALYEALEKIKGELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI  ICIP    NTMLPC     H                       E +
Sbjct  75    ISLLLTFGQTYIISICIPMHLANTMLPCAYKPNH-----------------------EKK  111

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
               E  EA  +HHRRLLW  RR+LSG A    CKEG +PLIS NGLHQLHIFIFFLAVFHV
Sbjct  112   SHEHGEAKADHHRRLLWYERRMLSGGAAPVGCKEGYVPLISANGLHQLHIFIFFLAVFHV  171

Query  830   IYGAITMALGRMKIRGWKEWEM--ATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             IY  ITMALGRMKIR WK+WE+    ++D    D S++RLT ETSFVK + SF T+ PVL
Sbjct  172   IYSCITMALGRMKIRRWKDWELEAVNSKDGFGADASKFRLTHETSFVKGHNSFWTKNPVL  231

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             F   CFFRQF+R+VRR+DYLA+RHGF+SVHLAPGSKFDFQKYIKRSLEDD+KVVVGI+ +
Sbjct  232   FGLGCFFRQFYRAVRRSDYLALRHGFVSVHLAPGSKFDFQKYIKRSLEDDYKVVVGISPL  291

Query  1184  LWCA  1195
             LW +
Sbjct  292   LWAS  295



>ref|XP_007135969.1| hypothetical protein PHAVU_009G007000g [Phaseolus vulgaris]
 gb|ESW07963.1| hypothetical protein PHAVU_009G007000g [Phaseolus vulgaris]
Length=550

 Score =   361 bits (927),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 239/323 (74%), Gaps = 15/323 (5%)
 Frame = +2

Query  266   MSgggggkgRELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKI  445
             MSGGGGG  R+LD TPTWAVA VC +IV+IS++LEK++HK    FE KKK AL+EALEKI
Sbjct  1     MSGGGGGDSRQLDLTPTWAVAAVCAIIVLISILLEKIIHKFARMFEEKKKHALLEALEKI  60

Query  446   KGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEH------VEHQAPGHGEH  607
             K ELMVLGFISLLLTFGQ+YI+K+CIP+   +TMLPCL  D+        EH A    EH
Sbjct  61    KAELMVLGFISLLLTFGQNYISKVCIPQKYAHTMLPCLPIDQRDGGGPATEHGAGAATEH  120

Query  608   APSG--EHGEHAPPEDEHQEPAEAGGE-----HHRRLLWSMRRVLSGHAV-EECKEGLIP  763
                   EHG  A  E E +   E G       H RR+L   RR LSG      CK G +P
Sbjct  121   GAGAATEHGAGAATEHEVEPEGEGGESAEGGGHRRRILSYDRRFLSGGGGGPSCKPGKLP  180

Query  764   LISLNGLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDE-AANDPSRYR  940
             LIS+NGLHQLHIFIFFLAVFHVIY AITM LGR KIRGWK WE     DE A NDP R+R
Sbjct  181   LISVNGLHQLHIFIFFLAVFHVIYSAITMTLGRAKIRGWKAWEEDHVVDEDALNDPRRFR  240

Query  941   LTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDF  1120
             LT ETSFV++++SF T+TPV FY VCFFRQFFRSVRRADYL MRHGF++VHLAPGSKFDF
Sbjct  241   LTHETSFVRDHSSFWTKTPVSFYFVCFFRQFFRSVRRADYLTMRHGFVTVHLAPGSKFDF  300

Query  1121  QKYIKRSLEDDFKVVVGINLMLW  1189
             QKYIKRSLEDDFKVVVGI+ +LW
Sbjct  301   QKYIKRSLEDDFKVVVGISPILW  323



>ref|XP_003603856.1| MLO-like protein [Medicago truncatula]
 gb|AES74107.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=537

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/303 (65%), Positives = 225/303 (74%), Gaps = 5/303 (2%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC +IV+IS++LEKL+HK    FE +KK AL+EALEKIK ELMVLGF
Sbjct  11    RQLDVTPTWAVAAVCAIIVIISILLEKLIHKFASVFEERKKHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+K+CIP    NTMLPC       E  A   GE A   +  EH P  + 
Sbjct  71    ISLLLTFGQNYISKVCIPVKYSNTMLPC---QPLAERTADHPGEPALEPQGTEHEPTPNI  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEG-LIPLISLNGLHQLHIFIFFLAVFHV  829
                  E+ GEHHRRLL   RR L G       +    PLIS++GLHQLHIFIFFLAVFHV
Sbjct  128   PAGEGESKGEHHRRLLSYERRFLGGGGGGPGCKPGFTPLISVDGLHQLHIFIFFLAVFHV  187

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAA-NDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             I+ AITM LGR KI+GWKEWE     DE A NDP R+RLT ETSFV+++ SF T+TPV F
Sbjct  188   IFSAITMTLGRAKIKGWKEWEQDHLVDEDALNDPRRFRLTHETSFVRDHNSFWTKTPVTF  247

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCFFRQF RSVRRADYL MRHGF+SVHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  248   YFVCFFRQFLRSVRRADYLTMRHGFVSVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPIL  307

Query  1187  WCA  1195
             W +
Sbjct  308   WAS  310



>ref|XP_010094531.1| MLO-like protein 5 [Morus notabilis]
 gb|EXB56285.1| MLO-like protein 5 [Morus notabilis]
Length=495

 Score =   359 bits (921),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 226/297 (76%), Gaps = 21/297 (7%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI+VIS++LEK+LH +G  F+ +KK+AL EAL+K+KGELMVLGF
Sbjct  62    RELDQTPTWAVASVCAVIIVISIILEKVLHLVGEWFQERKKKALFEALQKVKGELMVLGF  121

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLL+TFGQ+YI +ICIP    +TMLPC +      +++ GH      G+H         
Sbjct  122   ISLLMTFGQNYIVRICIPMKIADTMLPCPLTGSDHNYES-GHETEVTGGDH---------  171

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAV-EECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      EHHR+LLW  RR L+  +V  +CK G +PLISLNGLHQLHIFIFFLA+FHV
Sbjct  172   ---------EHHRKLLWYERRFLAAGSVGADCKLGHVPLISLNGLHQLHIFIFFLALFHV  222

Query  830   IYGAITMALGRMKIRGWKEWEMATAQ-DEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY A+TM LGR+KIRGWK WE  TA   E  NDPS++RLT ETSFVK++T F T+TPV F
Sbjct  223   IYSAMTMTLGRLKIRGWKVWERETAHHQEFMNDPSKFRLTHETSFVKDHTRFWTKTPVTF  282

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             Y VCF RQFFRSV +ADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+
Sbjct  283   YGVCFLRQFFRSVTKADYLTMRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGIS  339



>ref|XP_011034832.1| PREDICTED: MLO-like protein 9 isoform X1 [Populus euphratica]
Length=538

 Score =   358 bits (919),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 230/303 (76%), Gaps = 30/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L+QTPTWAV+ VC  ++++S++LEK+LH+ G  F++K   AL +ALEK+KGELMVLGF
Sbjct  10    RDLEQTPTWAVSAVCAAMIIVSIILEKVLHRTGQWFQKKHNTALFDALEKVKGELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL LTF QSYIA ICIP    NTMLPC           P  G+                
Sbjct  70    ISLTLTFSQSYIAGICIPLRYANTMLPC-----------PAKGKKGQD------------  106

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                  ++GGE+HR+LLWS  R L+G +  ++CK+G +PLIS+ GLHQLHIFIFFLAVFHV
Sbjct  107   -----DSGGENHRKLLWSQHRFLAGESGSKDCKDGSVPLISVEGLHQLHIFIFFLAVFHV  161

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             +Y AITM LG++KIR WK+WE  + ++ +A NDP+R+RLT ETSFV+ +TSF T+TP+LF
Sbjct  162   VYSAITMMLGKLKIRNWKDWERESWREHDAMNDPARFRLTHETSFVRGHTSFWTKTPILF  221

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             YS+CF+RQFFRSVR++DYL MRHGFISVHLAPGSKF+FQKYIK++LEDDFKVVVGI+ +L
Sbjct  222   YSLCFYRQFFRSVRKSDYLTMRHGFISVHLAPGSKFNFQKYIKKTLEDDFKVVVGISPLL  281

Query  1187  WCA  1195
             W +
Sbjct  282   WAS  284



>ref|XP_002301905.2| hypothetical protein POPTR_0002s00800g [Populus trichocarpa]
 gb|EEE81178.2| hypothetical protein POPTR_0002s00800g [Populus trichocarpa]
Length=538

 Score =   358 bits (918),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 230/303 (76%), Gaps = 30/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L+QTPTWAV++VC  ++++S++L+K+LH+ G  F++K   AL +ALEK+KGELMVLGF
Sbjct  10    RDLEQTPTWAVSVVCAAMIIVSIILDKVLHRTGQWFQKKHNTALFDALEKVKGELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL LTF QSYIA ICIP    NTMLPC           P  G+    G  GE+      
Sbjct  70    ISLTLTFSQSYIAGICIPLRYANTMLPC-----------PAKGQKGQLGSRGEN------  112

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                        HRRLLWS  R L+G +  +ECK+G +PLIS++GLHQLHIFIFFLAVFHV
Sbjct  113   -----------HRRLLWSQHRFLAGDSGSKECKDGSVPLISVDGLHQLHIFIFFLAVFHV  161

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             +Y AITM LG++KIR WK+WE  + ++ +A NDP+R+RLT ETSFV+ +TSF T+TP+LF
Sbjct  162   VYSAITMMLGKLKIRNWKDWERESWREHDAMNDPARFRLTHETSFVRGHTSFWTKTPILF  221

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             YS+CF+RQFFRSVR++DYL MRHGFISVHLAPGSKF+FQKYIK++LEDDFKVVVGI+ +L
Sbjct  222   YSLCFYRQFFRSVRKSDYLTMRHGFISVHLAPGSKFNFQKYIKKTLEDDFKVVVGISPLL  281

Query  1187  WCA  1195
             W +
Sbjct  282   WAS  284



>emb|CDP07267.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   356 bits (914),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 224/303 (74%), Gaps = 34/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVALV  VIVV+S++LEK LH IG TF+RK+K AL EALEKIK ELMVLGF
Sbjct  8     RTLEKTPTWAVALVSAVIVVVSILLEKALHGIGKTFQRKRKEALNEALEKIKAELMVLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQ+YI+KICIP     TMLPC                                
Sbjct  68    ISLILTFGQNYISKICIPLKVAETMLPC-------------------------------S  96

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H++P E  GEHHRRLLW+  R L+  +    CK   +P+IS+NGLHQLHIFIFFLAVFHV
Sbjct  97    HKDP-EVEGEHHRRLLWNEHRFLAADSPATACKSEYVPVISVNGLHQLHIFIFFLAVFHV  155

Query  830   IYGAITMALGRMKIRGWKEWEM-ATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             I+GA+TM LGR++ RGWKEWE  A  + EA+ND SR+RLT ETSFV++NT  M + P+LF
Sbjct  156   IFGAMTMTLGRLQTRGWKEWEREAVRETEASNDTSRFRLTHETSFVRDNTGSMARNPILF  215

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCF+RQFFRSVR+ADY+ MRHGFISVHLAPGSKFDFQKYI+RSLEDDFK+VVGI+  L
Sbjct  216   YPVCFYRQFFRSVRKADYMTMRHGFISVHLAPGSKFDFQKYIRRSLEDDFKIVVGISPTL  275

Query  1187  WCA  1195
             W +
Sbjct  276   WAS  278



>ref|XP_009779293.1| PREDICTED: MLO-like protein 9 [Nicotiana sylvestris]
Length=529

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 230/301 (76%), Gaps = 28/301 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVALVC VIV+IS++LEK+LH +G TFER++K ALVEALEKIKGELMVLGF
Sbjct  10    RELDQTPTWAVALVCAVIVLISILLEKVLHAVGETFERRRKSALVEALEKIKGELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIP    NTMLPC                          A     
Sbjct  70    ISLLLTFGQNYISKICIPVKVANTMLPC-------------------------PAQHGHG  104

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H       GEHHRRLLW   R+L+  +    CK G +PLISLNGLHQLHIFIFFLAVFHV
Sbjct  105   HGHGHGHTGEHHRRLLWDHFRILAADSPARACKPGHVPLISLNGLHQLHIFIFFLAVFHV  164

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR+KIR WKEWE     D EA+ND SR+RLTKETSFV++NTSF T TP+LF
Sbjct  165   IYSAITMLLGRLKIREWKEWEKEVEHDYEASNDSSRFRLTKETSFVRDNTSFGT-TPILF  223

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             YSVCFFRQFFRSVR+ADYL MRHGFISVHLAPGSKF+FQKYIKRSLEDDFK+VVGIN +L
Sbjct  224   YSVCFFRQFFRSVRKADYLTMRHGFISVHLAPGSKFNFQKYIKRSLEDDFKIVVGINSLL  283

Query  1187  W  1189
             W
Sbjct  284   W  284



>ref|XP_003523524.1| PREDICTED: MLO-like protein 5-like [Glycine max]
Length=524

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 224/301 (74%), Gaps = 19/301 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC +IV+IS++LEK++HK    FE +K+ AL+EALEKIK ELMVLGF
Sbjct  11    RQLDLTPTWAVAAVCAIIVIISILLEKIIHKFAKMFEERKQHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+K+CIP     TMLPC+  +E   H A  H E A  GE          
Sbjct  71    ISLLLTFGQNYISKMCIPSKYAKTMLPCVPPEE--RHGAGHHTEEAGGGE----------  118

Query  653   HQEPAEAGGEHHRRLLWSMRRVL-SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                 A+ GG H RRLL   RR L SG   + CK G  PLIS+ GLHQLHIFIFFLAVFHV
Sbjct  119   ----AKDGG-HRRRLLSYERRFLASGGGGQSCKPGYTPLISVTGLHQLHIFIFFLAVFHV  173

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWK WE     D +A NDP R+RLT ETSFV+++ S  T+TPV F
Sbjct  174   IYSAITMTLGRAKIRGWKAWEADHIVDQDALNDPRRFRLTHETSFVRDHNSIWTKTPVSF  233

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCFFRQFFRSVRRADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  234   YLVCFFRQFFRSVRRADYLTMRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLL  293

Query  1187  W  1189
             W
Sbjct  294   W  294



>ref|XP_003527633.1| PREDICTED: MLO-like protein 5-like [Glycine max]
Length=527

 Score =   355 bits (911),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 224/301 (74%), Gaps = 11/301 (4%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC +IV+IS++LEK++HK    FE +KK AL+EALEKIK ELMVLGF
Sbjct  11    RQLDLTPTWAVAAVCAIIVIISILLEKIIHKFAKVFEERKKHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+K+CIP     TMLPCL  +E        HG  AP+ EHG        
Sbjct  71    ISLLLTFGQNYISKMCIPAKYARTMLPCLPLEER-------HGG-APATEHGAQTEEGGG  122

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAV-EECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG HHRRLL   RR L+     + C  G  PLIS++GLHQLHIFIFFLAVFHV
Sbjct  123   GGG-EAEGGGHHRRLLSYERRFLAAEGGGQSCNPGYTPLISVSGLHQLHIFIFFLAVFHV  181

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWKEWE     D +A NDP R+RLT ETSFV+++ S  T+TPV F
Sbjct  182   IYSAITMTLGRAKIRGWKEWEEDHIVDQDALNDPRRFRLTHETSFVRDHNSIWTKTPVSF  241

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCFFRQFFRSVRRADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  242   YFVCFFRQFFRSVRRADYLTMRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLL  301

Query  1187  W  1189
             W
Sbjct  302   W  302



>ref|XP_009372611.1| PREDICTED: MLO-like protein 9 [Pyrus x bretschneideri]
Length=506

 Score =   354 bits (908),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 219/302 (73%), Gaps = 28/302 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWA+A VC +I++IS++LEK+LH +G  F  KKK  L+EALEK+KGELMVLGF
Sbjct  11    RELDQTPTWALAAVCFIIIIISIVLEKVLHMVGEFFHHKKKVGLLEALEKVKGELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ YI+++CIP  A +TMLPC                           P  D 
Sbjct  71    ISLLLTFGQKYISQVCIPIEAADTMLPC---------------------------PYRDP  103

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +E    GG+H RRLLW  RR L+G  A   CK G +PLISLNGLHQLHIFIFFLA+FHV
Sbjct  104   DEEAGGGGGDHRRRLLWYERRYLAGGSAGPGCKAGKVPLISLNGLHQLHIFIFFLAIFHV  163

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
              YGA+TM LGR+KIR WK WE     D   NDP+++RLT ETSFV+++T   T+TPV FY
Sbjct  164   FYGALTMTLGRLKIRAWKVWEREMENDNEFNDPTKFRLTHETSFVRDHTKCWTKTPVTFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              V FFRQFFRSVRRADYL MRHGFI+VHLAPGSKFDFQKYIKRSLEDDFKVVVGI  +LW
Sbjct  224   LVSFFRQFFRSVRRADYLTMRHGFIAVHLAPGSKFDFQKYIKRSLEDDFKVVVGITPLLW  283

Query  1190  CA  1195
               
Sbjct  284   TT  285



>ref|XP_008804596.1| PREDICTED: MLO-like protein 10 isoform X3 [Phoenix dactylifera]
Length=409

 Score =   348 bits (894),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 226/309 (73%), Gaps = 37/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS++LEK+LH IG  F  ++K+AL EALEK+K ELM+LGF
Sbjct  13    RELDQTPTWAVASVCSIIIIISILLEKVLHHIGEWFRERRKKALFEALEKVKAELMILGF  72

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIPE A +TMLPC + ++ VE                        
Sbjct  73    ISLLLTFGQNYISKICIPEKAADTMLPCQLDEDQVE------------------------  108

Query  653   HQEPAEAGGEHHRRLLWSM-------RRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIF  808
               E AE G  HHRRLLW          R LS   +V  C +G +PLIS NGLHQLHIFIF
Sbjct  109   -AELAEGG--HHRRLLWDAIMDLYPKHRFLSEASSVSRCPQGKVPLISTNGLHQLHIFIF  165

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSF  982
             FLAVFHV+  A+TMALGR KIR WKEWE  T     E  NDPSR+RLT E SFV+++ SF
Sbjct  166   FLAVFHVLSSAVTMALGRAKIRRWKEWEKETLSTDYEFFNDPSRFRLTHEISFVRQHASF  225

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
               ++P+LFY+V FFRQFFRSVR+ADYLAMRHGFI+VHLAPGSKFDFQKYIKRSLEDDFK+
Sbjct  226   WNRSPILFYAVSFFRQFFRSVRKADYLAMRHGFITVHLAPGSKFDFQKYIKRSLEDDFKI  285

Query  1163  VVGINLMLW  1189
             +VGI+ +LW
Sbjct  286   IVGISHVLW  294



>ref|XP_007211108.1| hypothetical protein PRUPE_ppa024488mg [Prunus persica]
 gb|EMJ12307.1| hypothetical protein PRUPE_ppa024488mg [Prunus persica]
Length=504

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 220/302 (73%), Gaps = 28/302 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWA+A VC +I++IS++LEK+LH IGH FE +KK  L+EALEK+KGELMVLGF
Sbjct  9     RELDQTPTWALATVCFIIIIISIVLEKVLHMIGHWFEHRKKSGLLEALEKVKGELMVLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ YIAK+CIP  A +TMLPC                           P   E
Sbjct  69    ISLLLTFGQQYIAKVCIPIEAADTMLPC---------------------------PYRGE  101

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +E    GG+H RRLLW  RR L+G      CKEG +PLIS NGLHQLHIFIFFLA+FHV
Sbjct  102   EKEGGGGGGDHRRRLLWYERRYLAGGGDGPGCKEGKVPLISTNGLHQLHIFIFFLAIFHV  161

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             +YGAITM LGR+KIR WK WE     D   NDP+++RLT ETSFV+++T   T+ P  FY
Sbjct  162   VYGAITMTLGRLKIRAWKVWEREMEHDNEFNDPTKFRLTHETSFVRDHTRCWTKNPFTFY  221

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              V F RQFFRSVRRADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +LW
Sbjct  222   FVSFLRQFFRSVRRADYLTMRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLLW  281

Query  1190  CA  1195
              +
Sbjct  282   TS  283



>ref|XP_008373392.1| PREDICTED: MLO-like protein 9 [Malus domestica]
Length=508

 Score =   350 bits (898),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 217/300 (72%), Gaps = 26/300 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWA+A VC +I++IS++LEK+LH +G  F  KKK  L+EALEK+KGELMVLGF
Sbjct  11    RELDQTPTWALAAVCFIIIIISIVLEKVLHMVGEFFHHKKKVGLLEALEKVKGELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ YI+++CIP  A +TMLPC   D                          DE
Sbjct  71    ISLLLTFGQKYISQVCIPIEAADTMLPCPYRDP-------------------------DE  105

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG+H RRLLW  RR L+G  A   CK G +PLISLNGLHQLHIFIFFLA+FHV
Sbjct  106   EAGGGGGGGDHRRRLLWYERRYLAGGSAGPGCKAGKVPLISLNGLHQLHIFIFFLAIFHV  165

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             +YGA+TM LGR+KIR WK WE     D   NDP+++RLT ETSFV+++T   T+TP  FY
Sbjct  166   VYGALTMTLGRLKIRAWKVWEREMENDNEFNDPTKFRLTHETSFVRDHTKCWTKTPFTFY  225

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              V FFRQFFRSVRRADYL MRHGFI+VHLAPGSKFDF KYIKRSLEDDFKVVVGI  +LW
Sbjct  226   LVSFFRQFFRSVRRADYLTMRHGFIAVHLAPGSKFDFXKYIKRSLEDDFKVVVGITPLLW  285



>ref|XP_010935416.1| PREDICTED: MLO-like protein 9 [Elaeis guineensis]
Length=560

 Score =   351 bits (900),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 226/309 (73%), Gaps = 37/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK LH IG  F  ++K+AL EALEK+K ELM+LGF
Sbjct  15    RELDQTPTWAVASVCAVIIIISILLEKALHHIGEWFRERRKKALFEALEKVKAELMILGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIPE A +TMLPC + D+ +E                        
Sbjct  75    ISLLLTFGQNYISKICIPEKAADTMLPCHLDDDQME------------------------  110

Query  653   HQEPAEAGGEHHRRLLWSM-------RRVL-SGHAVEECKEGLIPLISLNGLHQLHIFIF  808
               E AE G  HHRRLLW         RR L +  +V  C  G + LIS NGLHQLHIFIF
Sbjct  111   -AELAEGG--HHRRLLWDAIMDLYPERRFLGAASSVSRCPPGKVSLISTNGLHQLHIFIF  167

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSFVKENTSF  982
             FLAVFHV+  AITMALGR KIR WKEWE  A + D E  NDPSR+RLT E SFV+++ SF
Sbjct  168   FLAVFHVLSSAITMALGRAKIRRWKEWEKEALSPDYEFFNDPSRFRLTHEISFVRQHASF  227

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
               ++P+LFY+V FFRQFFRSVR+ADYLAMRHGFI+VHLAPGSKFDFQKYIKRSLEDDFKV
Sbjct  228   WNRSPILFYTVSFFRQFFRSVRKADYLAMRHGFITVHLAPGSKFDFQKYIKRSLEDDFKV  287

Query  1163  VVGINLMLW  1189
             +VGI+ +LW
Sbjct  288   IVGISHVLW  296



>ref|XP_008804580.1| PREDICTED: MLO-like protein 9 isoform X1 [Phoenix dactylifera]
Length=558

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 226/309 (73%), Gaps = 37/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS++LEK+LH IG  F  ++K+AL EALEK+K ELM+LGF
Sbjct  13    RELDQTPTWAVASVCSIIIIISILLEKVLHHIGEWFRERRKKALFEALEKVKAELMILGF  72

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+KICIPE A +TMLPC + ++ VE                        
Sbjct  73    ISLLLTFGQNYISKICIPEKAADTMLPCQLDEDQVE------------------------  108

Query  653   HQEPAEAGGEHHRRLLWSM-------RRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIF  808
               E AE G  HHRRLLW          R LS   +V  C +G +PLIS NGLHQLHIFIF
Sbjct  109   -AELAEGG--HHRRLLWDAIMDLYPKHRFLSEASSVSRCPQGKVPLISTNGLHQLHIFIF  165

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSF  982
             FLAVFHV+  A+TMALGR KIR WKEWE  T     E  NDPSR+RLT E SFV+++ SF
Sbjct  166   FLAVFHVLSSAVTMALGRAKIRRWKEWEKETLSTDYEFFNDPSRFRLTHEISFVRQHASF  225

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
               ++P+LFY+V FFRQFFRSVR+ADYLAMRHGFI+VHLAPGSKFDFQKYIKRSLEDDFK+
Sbjct  226   WNRSPILFYAVSFFRQFFRSVRKADYLAMRHGFITVHLAPGSKFDFQKYIKRSLEDDFKI  285

Query  1163  VVGINLMLW  1189
             +VGI+ +LW
Sbjct  286   IVGISHVLW  294



>ref|XP_008237943.1| PREDICTED: MLO-like protein 9 [Prunus mume]
Length=507

 Score =   346 bits (888),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 219/302 (73%), Gaps = 25/302 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWA+A VC +I++IS++LEK+LH IGH FE +KK  L+EALEK+KGELMVLGF
Sbjct  9     RELDQTPTWALATVCFIIIIISILLEKVLHMIGHWFEHRKKSGLLEALEKVKGELMVLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ YIAK+CIP  A +TMLPC                         +   E E
Sbjct  69    ISLLLTFGQQYIAKVCIPIEAADTMLPC------------------------PYRGEEQE  104

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG+H RRLLW  RR L+G      CKEG +PLIS NGLHQLHIFIFFLA+FHV
Sbjct  105   GGGGGGGGGDHRRRLLWYERRYLAGGGDGPGCKEGKVPLISTNGLHQLHIFIFFLAIFHV  164

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             +YGAITM LGR+KIR WK WE     D   NDP+++RLT ETSFV+++T   T+ P  FY
Sbjct  165   VYGAITMTLGRLKIRAWKVWEREMEFDNEFNDPTKFRLTHETSFVRDHTRCWTKNPFTFY  224

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              V F RQFFRSVRRADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +LW
Sbjct  225   FVSFLRQFFRSVRRADYLTMRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLLW  284

Query  1190  CA  1195
              +
Sbjct  285   TS  286



>ref|XP_007018110.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY15335.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=532

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 224/303 (74%), Gaps = 21/303 (7%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA+VC VIVVIS++LEKLLH IG  FE ++K AL EAL+K+KGELMVLGF
Sbjct  12    RELDQTPTWAVAVVCAVIVVISIVLEKLLHAIGEWFEERRKMALYEALQKVKGELMVLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI+ ICIP    +TML C    +   H+A             ++  PE +
Sbjct  72    ISLLLTFGQSYISNICIPVKVADTMLFCPKRVDTTHHKA-------------QNKQPEQQ  118

Query  653   HQEPAEAGGEH-HRRLLWSMRRVLSGHAV-EECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
             H      GGE  HRRLL+  RR L G +    C+ G +PLIS+NGLHQLHIFIFFLAVFH
Sbjct  119   H------GGESAHRRLLFYERRFLGGASKGAACEHGYVPLISVNGLHQLHIFIFFLAVFH  172

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             V Y AITM LGR+K RGWKEWE         NDPSR+RLT ETSFV+++T   T+T   F
Sbjct  173   VTYSAITMLLGRLKTRGWKEWERECTGVNEFNDPSRFRLTHETSFVRDHTRPWTKTKFSF  232

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y VCF+RQFFRSVR+ADYL MRHGF++VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ ML
Sbjct  233   YFVCFWRQFFRSVRKADYLTMRHGFVTVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPML  292

Query  1187  WCA  1195
             W +
Sbjct  293   WAS  295



>ref|XP_002276608.1| PREDICTED: MLO-like protein 10 [Vitis vinifera]
 emb|CBI21574.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   345 bits (886),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 221/304 (73%), Gaps = 32/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA +C V+++IS++LEK+LH++G  F  ++KRAL EALEK+K ELMVLGF
Sbjct  13    RELDQTPTWAVAGICAVMIIISIVLEKVLHRVGKWFTERRKRALFEALEKVKAELMVLGF  72

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ++I KICIPE A +TMLPC           P +GE   S E          
Sbjct  73    ISLLLTFGQNFIVKICIPEKAADTMLPC-----------PYNGEKDSSSE----------  111

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      E  RRLLW   R+L+       CKEG  P+IS+NGLHQLHI IFFLAVFHV
Sbjct  112   --------TESRRRLLWYNHRLLAAATYSSSCKEGYEPIISVNGLHQLHILIFFLAVFHV  163

Query  830   IYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y AITM LGR+KIRGWK+WE   +T   E +ND +R+RLT ETSFV+ +TSF T+ P  
Sbjct  164   LYSAITMMLGRLKIRGWKQWEEETSTHDYEFSNDAARFRLTHETSFVRAHTSFWTRIPFF  223

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV R+DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVGI+ +
Sbjct  224   FYVGCFFRQFFRSVSRSDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGISPV  283

Query  1184  LWCA  1195
             LW +
Sbjct  284   LWAS  287



>ref|XP_008242102.1| PREDICTED: MLO-like protein 8 [Prunus mume]
Length=572

 Score =   345 bits (886),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 218/303 (72%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAV+ VC VI++ISL+LEK+LHK+G     + K AL EALEK+K ELM+LGF
Sbjct  29    RELDRTPTWAVSGVCAVIIIISLVLEKVLHKVGTFLTDRHKSALFEALEKVKAELMILGF  88

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIA+ICIP    +TMLPC + DE                        ED+
Sbjct  89    ISLLLTFGQSYIARICIPLKVADTMLPCTVKDE------------------------EDD  124

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                        HRRLLW  RR L+  A  +CK G  PLIS+NGLHQLHI IFFLAVFHV+
Sbjct  125   -------STTSHRRLLWYDRRSLAAAADYKCKTGHEPLISINGLHQLHILIFFLAVFHVL  177

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P  F
Sbjct  178   YSAITMLLGRLKIRGWKQWEAETSSHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFF  237

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV R+DYL +R+GFI+VHL PGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  238   YVGCFFRQFFRSVSRSDYLTVRNGFITVHLGPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  297

Query  1187  WCA  1195
             W +
Sbjct  298   WAS  300



>ref|XP_006467107.1| PREDICTED: MLO-like protein 10-like [Citrus sinensis]
Length=582

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 221/304 (73%), Gaps = 28/304 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC VI++IS++LEK LHK+G  F  + KRAL EALEKIK ELMVLGF
Sbjct  32    RELNQTPTWAVAGVCTVIILISILLEKSLHKLGTWFTERHKRALFEALEKIKAELMVLGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQSYI+KICIP    +TMLPC              G+H  S   G      DE
Sbjct  92    ISLILTFGQSYISKICIPSKVADTMLPC-----------KADGKHDASDTSG------DE  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H        EH RRLLW   R L+  A   EC++G  PLI++  LHQLHI IFFLAVFHV
Sbjct  135   H--------EHRRRLLWFQHRYLAAAATSTECEKGSEPLITVEALHQLHILIFFLAVFHV  186

Query  830   IYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y AITM LGR+KIRGWK+WE   +T   E +NDPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  187   LYSAITMMLGRLKIRGWKKWEEETSTHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFF  246

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV RADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VVG++ +
Sbjct  247   FYVGCFFRQFFRSVSRADYLTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKIVVGVSPV  306

Query  1184  LWCA  1195
             LW +
Sbjct  307   LWTS  310



>ref|XP_006425252.1| hypothetical protein CICLE_v10025242mg [Citrus clementina]
 gb|ESR38492.1| hypothetical protein CICLE_v10025242mg [Citrus clementina]
Length=582

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 221/304 (73%), Gaps = 28/304 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC VI++IS++LEK LHK+G  F  + KRAL EALEKIK ELMVLGF
Sbjct  32    RELNQTPTWAVAGVCTVIILISILLEKSLHKLGTWFTERHKRALFEALEKIKAELMVLGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQSYI+KICIP    +TMLPC              G+H  S   G      DE
Sbjct  92    ISLILTFGQSYISKICIPSKVADTMLPC-----------KADGKHDASDTSG------DE  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H        EH RRLLW   R L+  A   EC++G  PLI++  LHQLHI IFFLAVFHV
Sbjct  135   H--------EHRRRLLWFQHRYLAAAATSTECEKGSEPLITVEALHQLHILIFFLAVFHV  186

Query  830   IYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y AITM LGR+KIRGWK+WE   +T   E +NDPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  187   LYSAITMMLGRLKIRGWKKWEEETSTHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFF  246

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV RADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VVG++ +
Sbjct  247   FYVGCFFRQFFRSVSRADYLTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKIVVGVSPV  306

Query  1184  LWCA  1195
             LW +
Sbjct  307   LWTS  310



>ref|XP_007204311.1| hypothetical protein PRUPE_ppa003435mg [Prunus persica]
 gb|EMJ05510.1| hypothetical protein PRUPE_ppa003435mg [Prunus persica]
Length=574

 Score =   343 bits (880),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 219/303 (72%), Gaps = 31/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAV+ VC VI++ISL+LEK+LHK+G     + KRAL EALEK+K ELM+LGF
Sbjct  29    RELDRTPTWAVSGVCAVIIIISLVLEKVLHKVGTFLTDRHKRALFEALEKVKAELMILGF  88

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIA+ICIP    +TMLPC + D                         +DE
Sbjct  89    ISLLLTFGQSYIARICIPLKVADTMLPCTVKD------------------------VKDE  124

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +        HRRLLW+ RR L+  +  +CK G  PLIS+NGLHQLHI IFFLAVFHV+
Sbjct  125   EDDSTS-----HRRLLWNDRRSLAAASDYKCKTGYEPLISINGLHQLHILIFFLAVFHVL  179

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P  F
Sbjct  180   YSAITMLLGRLKIRGWKQWEAETSSHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFF  239

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV ++DYL +R+GFI+VHL  GSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  240   YVGCFFRQFFRSVSKSDYLTVRNGFITVHLGAGSKFNFQKYIKRSLEDDFKVVVGVSPVL  299

Query  1187  WCA  1195
             W +
Sbjct  300   WAS  302



>ref|XP_004301623.1| PREDICTED: MLO-like protein 5-like [Fragaria vesca subsp. vesca]
Length=395

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 218/304 (72%), Gaps = 25/304 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC  I+VIS+ LEK++H +GH F+R+KK  L+EALE +K ELMVLGF
Sbjct  10    RELDQTPTWAVAGVCFTIIVISIALEKIIHLVGHWFQRRKKAGLLEALEIVKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTF Q +IA++CIP +  NTMLPC  H                S +H         
Sbjct  70    ISLILTFAQQHIAQLCIPVSYANTMLPCPYHK---------------SEDH-------SG  107

Query  653   HQEPAEAGGEHHRRLLW--SMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVF  823
                    GG  HRRLLW    RR+L+ G     C +G +PLIS+NGLHQLHIFIFFLAVF
Sbjct  108   GGGKGGGGGGGHRRLLWYEQERRILAAGSMGAGCSKGKVPLISINGLHQLHIFIFFLAVF  167

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             HV+YGAITM LGR+KIR WK+WE     D+  NDP+++RLT ETSFV+++T   T+T   
Sbjct  168   HVVYGAITMTLGRLKIREWKKWEREAVNDQDFNDPTKFRLTHETSFVRDHTKSWTKTKFT  227

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY V FFRQFFRSVRRAD+L MRHGF+SVHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +
Sbjct  228   FYFVSFFRQFFRSVRRADFLTMRHGFVSVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPL  287

Query  1184  LWCA  1195
             LW  
Sbjct  288   LWTT  291



>ref|XP_004169166.1| PREDICTED: MLO-like protein 8-like [Cucumis sativus]
Length=560

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 224/305 (73%), Gaps = 33/305 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS+ LEKLLHK G     K KRAL EALEK+K ELM+LGF
Sbjct  28    RELDQTPTWAVAGVCAIIILISIALEKLLHKAGTWLTEKHKRALFEALEKVKAELMILGF  87

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP    NTMLPC                          A  ED+
Sbjct  88    ISLLLTFGQNYIIKICIPTKVANTMLPC--------------------------AAKEDK  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS--GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++  E  GEHHRRLL   RR L+  G AV  CKEG +PLIS++GLHQLH+FIFFLAVFH
Sbjct  122   LEKGDE--GEHHRRLLMYERRFLAAAGGAVS-CKEGHVPLISISGLHQLHLFIFFLAVFH  178

Query  827   VIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y AITM LGR+KIRGWK WE   +T   E +ND +R+RLT ETSFVK +TSF T+ PV
Sbjct  179   VVYSAITMMLGRLKIRGWKAWEEETSTHNYEFSNDNARFRLTHETSFVKAHTSFWTKLPV  238

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQFF+SV +ADYLA+R+GFI+VHLAPGSKFDFQKYIKRSLEDDFK++VG++ 
Sbjct  239   FFYIGCFFRQFFKSVGKADYLALRNGFIAVHLAPGSKFDFQKYIKRSLEDDFKIIVGVSP  298

Query  1181  MLWCA  1195
             +LW +
Sbjct  299   VLWTS  303



>ref|XP_008440929.1| PREDICTED: MLO-like protein 8 [Cucumis melo]
Length=567

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 224/305 (73%), Gaps = 33/305 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS+ LEKLLHK G     K KRAL EALEK+K ELM+LGF
Sbjct  28    RELDQTPTWAVAGVCAIIILISIALEKLLHKAGTWLTEKHKRALFEALEKVKAELMILGF  87

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP    NTMLPC                          A  ED+
Sbjct  88    ISLLLTFGQNYIIKICIPTKVANTMLPC--------------------------AAKEDK  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS--GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++  E  GEHHRRLL   RR L+  G AV  CKEG +PLIS++GLHQLH+FIFFLAVFH
Sbjct  122   LEKADE--GEHHRRLLMYERRFLAAAGGAVS-CKEGHVPLISISGLHQLHLFIFFLAVFH  178

Query  827   VIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y AITM LGR+KIRGWK WE   +T   E +ND +R+RLT ETSFVK +TSF T+ PV
Sbjct  179   VVYSAITMMLGRLKIRGWKAWEEETSTHNYEFSNDNARFRLTHETSFVKAHTSFWTKLPV  238

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQFF+SV +ADYLA+R+GFI+VHLAPGSKFDFQKYIKRSLEDDFK++VG++ 
Sbjct  239   FFYIGCFFRQFFKSVGKADYLALRNGFIAVHLAPGSKFDFQKYIKRSLEDDFKIIVGVSP  298

Query  1181  MLWCA  1195
             +LW +
Sbjct  299   VLWTS  303



>ref|XP_011074255.1| PREDICTED: MLO-like protein 9 [Sesamum indicum]
Length=515

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 217/301 (72%), Gaps = 34/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVALVC +IV+IS++LEK +HK+G +F R+KK +L+EAL+KIK ELM+LGF
Sbjct  12    RQLDQTPTWAVALVCAIIVIISVILEKSIHKVGESFSRRKKFSLLEALDKIKAELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ++IAKIC+PE  GNTMLPC                           P  +E
Sbjct  72    ISLLLTFGQNFIAKICVPEHIGNTMLPC------------------------SRKPHANE  107

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H        +HHRRLLW  RR L   +  E CK+G +PLIS++GLHQLHIFIFFLA+FHV
Sbjct  108   H--------DHHRRLLWHERRFLGADSPAEGCKKGYVPLISVSGLHQLHIFIFFLAIFHV  159

Query  830   IYGAITMALGRMKIRGWKEWEMA-TAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             I    TM LGRMKIR WKEWE A  A++E+ANDP+R+RLT ETSFVK +TS       LF
Sbjct  160   INSGATMRLGRMKIRAWKEWEQAIAAEEESANDPTRFRLTHETSFVKGHTSPWVTNAALF  219

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y   FFR    +VR+ADYLA+RHGFISVHLAPG KFDFQKYIKRSLEDDFKV+VGI   L
Sbjct  220   YIASFFRHMLWAVRKADYLALRHGFISVHLAPGKKFDFQKYIKRSLEDDFKVIVGIPPAL  279

Query  1187  W  1189
             W
Sbjct  280   W  280



>gb|AHF52923.1| Mlo protein [Hevea brasiliensis]
Length=555

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 215/304 (71%), Gaps = 34/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V+++IS++LEK LHK G     + KRAL EALEK+K ELMVLGF
Sbjct  12    RKLDQTPTWAVAGVCAVMIIISILLEKGLHKFGTWLTERHKRALFEALEKVKAELMVLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP+   +TMLPC                          A  E++
Sbjct  72    ISLLLTFGQTYIIKICIPQNVADTMLPC-------------------------RADGEND  106

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
               E      EH RRLLW   R L+G     +CK G  PLI+++GLHQLHI IFFLAVFHV
Sbjct  107   QTE------EHRRRLLWFEHRFLAGAETTSKCKTGYEPLITVDGLHQLHILIFFLAVFHV  160

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y   TM LGR+KIRGWKEWE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  161   LYSLTTMMLGRLKIRGWKEWEQETSSHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFF  220

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV +ADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  221   FYIGCFFRQFFRSVSKADYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPI  280

Query  1184  LWCA  1195
             LW +
Sbjct  281   LWAS  284



>ref|XP_007046462.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOX90619.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=575

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 212/304 (70%), Gaps = 30/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L QTPTWAVA VC VI++IS++LEK+LHK+G  F  + KRAL EAL+K+K ELMVLGF
Sbjct  30    RKLYQTPTWAVAGVCAVIIIISILLEKVLHKLGTWFTERHKRALYEALDKVKAELMVLGF  89

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIA+ICIP    NTMLPC                             + E
Sbjct  90    ISLLLTFGQSYIARICIPTNVANTMLPC---------------------------KADSE  122

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                   +  EH RRLLW  RR L+      +CKEG  PLIS  GLH+LHI IFFLAVFHV
Sbjct  123   QDTSTSSEEEHRRRLLWFERRFLAAVSTARKCKEGHEPLISTEGLHELHILIFFLAVFHV  182

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  +TM LGR+KIRGWK WE  T     E +NDPSR+RLT ETSFVK +TSF T+ P  
Sbjct  183   LYSFVTMMLGRLKIRGWKVWEQETLSHDYEFSNDPSRFRLTHETSFVKAHTSFWTRIPFF  242

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV R DYL +R+GFI+VHLAPGSKFDFQKYIKRSLEDDFK+VVG++ +
Sbjct  243   FYIGCFFRQFFRSVGRVDYLTLRNGFITVHLAPGSKFDFQKYIKRSLEDDFKIVVGVSPV  302

Query  1184  LWCA  1195
             LW +
Sbjct  303   LWAS  306



>ref|XP_002532472.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF29896.1| calmodulin binding protein, putative [Ricinus communis]
Length=438

 Score =   331 bits (849),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 179/304 (59%), Positives = 211/304 (69%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V+++IS++LEK LHK G     K KRAL EALEK+K ELMVLGF
Sbjct  11    RKLDQTPTWAVASVCAVMIIISILLEKGLHKFGTWLTHKHKRALFEALEKVKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI +IC+ +   +TMLPC                              D 
Sbjct  71    ISLLLTFGQTYITRICVSQKVADTMLPC----------------------------KGDA  102

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
               +  E+  EH RRLLW  RR L+G      CKEG  PLIS +GLHQLHI IFFLAVFHV
Sbjct  103   VLDTEESTEEHRRRLLWFERRFLAGAETTTLCKEGHEPLISADGLHQLHILIFFLAVFHV  162

Query  830   IYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y   TM LGR+KIRGWK WE   +T   E +NDPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  163   VYSLTTMTLGRLKIRGWKAWEEETSTHDYEFSNDPSRFRLTHETSFVRSHTSFWTRIPFF  222

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV +ADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK VVGI+ +
Sbjct  223   FYVGCFFRQFFRSVSKADYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKYVVGISPI  282

Query  1184  LWCA  1195
             LW +
Sbjct  283   LWAS  286



>gb|AHF52924.1| Mlo protein [Hevea brasiliensis]
Length=574

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 215/304 (71%), Gaps = 34/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V+++IS++LEK LHK G     + KRAL EALEK+K ELMVLGF
Sbjct  31    RKLDQTPTWAVAGVCAVMIIISILLEKGLHKFGTWLTERHKRALFEALEKVKAELMVLGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP+   +TMLPC                          A  E++
Sbjct  91    ISLLLTFGQTYIIKICIPQNVADTMLPC-------------------------RADGEND  125

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
               E      EH RRLLW   R L+G     +CK G  PLI+++GLHQLHI IFFLAVFHV
Sbjct  126   QTE------EHRRRLLWFEHRFLAGAETTSKCKTGYEPLITVDGLHQLHILIFFLAVFHV  179

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y   TM LGR+KIRGWKEWE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  180   LYSLTTMMLGRLKIRGWKEWEQETSSHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFF  239

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV +ADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  240   FYIGCFFRQFFRSVSKADYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPI  299

Query  1184  LWCA  1195
             LW +
Sbjct  300   LWAS  303



>ref|XP_004134822.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 8-like [Cucumis 
sativus]
Length=560

 Score =   334 bits (857),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 222/305 (73%), Gaps = 33/305 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS+ LEKLLHK G     K KRAL EALEK+K ELM+LGF
Sbjct  28    RELDQTPTWAVAGVCAIIILISIALEKLLHKAGTWLTEKHKRALFEALEKVKAELMILGF  87

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP    NTMLPC                          A  ED+
Sbjct  88    ISLLLTFGQNYIIKICIPTKVANTMLPC--------------------------AAKEDK  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS--GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++  E  GEHHRRLL   RR L+  G AV  CKEG +PLIS++GLHQLH+FIFFLAVFH
Sbjct  122   LEKGDE--GEHHRRLLMYERRFLAAAGGAVS-CKEGHVPLISISGLHQLHLFIFFLAVFH  178

Query  827   VIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y AITM LGR+KIRGWK WE   +T   E + D + ++LT ETSFVK +TSF T+ PV
Sbjct  179   VVYSAITMMLGRLKIRGWKAWEEETSTHNYEFSADNAXFKLTHETSFVKAHTSFWTKLPV  238

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQFF+SV +ADYLA+R+GFI+VHLAPGSKFDFQKYIKRSLEDDFK++VG++ 
Sbjct  239   FFYIGCFFRQFFKSVGKADYLALRNGFIAVHLAPGSKFDFQKYIKRSLEDDFKIIVGVSP  298

Query  1181  MLWCA  1195
             +LW +
Sbjct  299   VLWTS  303



>ref|XP_008448445.1| PREDICTED: MLO-like protein 10 isoform X1 [Cucumis melo]
Length=572

 Score =   334 bits (857),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 212/302 (70%), Gaps = 29/302 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC   V+IS++LE +LHK+G     K+K +L EALEK+K ELM+LGF
Sbjct  27    RDLDNTPTWAVAAVCFFFVLISIVLENVLHKLGTWLTEKRKSSLYEALEKVKAELMILGF  86

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTF Q+YI +ICIP +  N+MLPC                  P  E    +   DE
Sbjct  87    ISLLLTFAQAYIVQICIPPSIANSMLPC------------------PLKEKDASSSTTDE  128

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      EHHRRL W +RR L+G H V  CK+G + LIS++GLHQLHI IFFLAVFHV
Sbjct  129   D--------EHHRRLQWLIRRSLAGGHNVVSCKDGKVSLISIDGLHQLHILIFFLAVFHV  180

Query  830   IYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             ++  ITM LGR+KIRGWKEWE  T     E  NDP+R+RLT ETSFVK +TSF T+ P  
Sbjct  181   LFSVITMTLGRVKIRGWKEWEQETLTHNYEFFNDPARFRLTHETSFVKAHTSFWTRLPFF  240

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+ SV RADYL +R+GFI+VHLAPGSKF+FQ+YIKRSLEDDFKVVVG++  
Sbjct  241   FYISCFFRQFYGSVSRADYLTLRNGFITVHLAPGSKFNFQRYIKRSLEDDFKVVVGVSPF  300

Query  1184  LW  1189
             LW
Sbjct  301   LW  302



>ref|XP_010523625.1| PREDICTED: MLO-like protein 9 [Tarenaya hassleriana]
Length=528

 Score =   332 bits (851),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 214/302 (71%), Gaps = 21/302 (7%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE  +HKIG  F+RKKK+AL+EAL KIK ELMVLGF
Sbjct  14    RELDQTPTWAVSTVCGVIILISIVLEMFIHKIGVIFDRKKKKALLEALLKIKNELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHD-EHVEHQAPGHGEHAPSGEHGEHAPPED  649
             ISLLLTFGQ+YIA IC+P   G  M  C  +D   ++ +A  HG HA    H        
Sbjct  74    ISLLLTFGQNYIASICVPSRYGQAMSFCGPYDGPDMDPKAQVHGIHALHKPH--------  125

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                        H RRLL   RR+L+  +   C  G +PLISLN LHQ+HIFIFFLAVFHV
Sbjct  126   -----------HDRRLLSLERRILADFSPVNCDYGYVPLISLNALHQIHIFIFFLAVFHV  174

Query  830   IYGAITMALGRMKIRGWKEWEM-ATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWKEWE     + E  NDPSR+RLT ETSFV+E+ +  T+    F
Sbjct  175   IYSAITMMLGRAKIRGWKEWEQEIMTEQEMMNDPSRFRLTHETSFVREHVNPWTRNRFSF  234

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  L
Sbjct  235   YMICFFRQIVRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPPL  294

Query  1187  WC  1192
             W 
Sbjct  295   WA  296



>ref|XP_009395397.1| PREDICTED: MLO-like protein 9 [Musa acuminata subsp. malaccensis]
Length=556

 Score =   333 bits (853),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 217/311 (70%), Gaps = 39/311 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++IS++LEK LH +G  F  ++K+A+ EALEKIK ELM+LGF
Sbjct  11    RELDETPTWAVASVCAVIILISILLEKGLHHLGQWFTERRKKAMFEALEKIKDELMILGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI +ICIPE A +TMLPCL                              E
Sbjct  71    ISLLLTFGQNYIIQICIPEEAADTMLPCL-----------------------------KE  101

Query  653   HQEPAEAGGEHHRRLLWSM--------RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIF  808
              +E    G  H RRLLWS         R ++   +   C EG +PLISL+GLHQLHIFIF
Sbjct  102   GKEETIEGEGHRRRLLWSSLEGFGSKHRMLVEASSSPHCPEGKVPLISLHGLHQLHIFIF  161

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSF  982
             FLA+FHV    +TMALGR KI  WKEWE+ T+    E +NDPSR+R + ETSFV+++TSF
Sbjct  162   FLAIFHVTISGLTMALGREKISSWKEWEIETSSPDYEFSNDPSRFRFSHETSFVRQHTSF  221

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
               + PV FY V FFRQFF SVR+ADYLAMR GFI+VHLAPGSKFDFQKYIKRSLEDDFKV
Sbjct  222   WNRIPVSFYIVSFFRQFFISVRKADYLAMRQGFITVHLAPGSKFDFQKYIKRSLEDDFKV  281

Query  1163  VVGINLMLWCA  1195
             VVGI+ +LW +
Sbjct  282   VVGISPLLWAS  292



>ref|XP_009772716.1| PREDICTED: MLO-like protein 10 [Nicotiana sylvestris]
Length=554

 Score =   332 bits (852),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 216/304 (71%), Gaps = 35/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK++HK+G     + K+AL EALEK+K ELM+LGF
Sbjct  10    RQLDQTPTWAVAGVCAVIILISIALEKIIHKLGTWLTDRHKKALYEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPC-LIHDEHVEHQAPGHGEHAPSGEHGEHAPPED  649
             ISL L F Q YIA+ICIP +  NTMLPC  +H +                          
Sbjct  70    ISLTLVFSQYYIARICIPSSVANTMLPCPAVHKD--------------------------  103

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                  AE   EH RRLLW  RR+L+G A   CKEG + LIS++ LHQ+HI IFFLAV HV
Sbjct  104   -----AEKKEEHRRRLLWFERRILAG-AETTCKEGRVALISVDALHQIHILIFFLAVLHV  157

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y AITM LGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P+ 
Sbjct  158   LYSAITMWLGRLKIRGWKQWEQETSTHYYEFSNDPSRFRLTHETSFVRAHTSFWTRLPIF  217

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CF RQFFRSV ++DYL +R+GFISVHLAPGSKFDFQKYIKRSLEDDFKVVVG++ +
Sbjct  218   FYIGCFLRQFFRSVSKSDYLTLRNGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGVSPV  277

Query  1184  LWCA  1195
             LW +
Sbjct  278   LWAS  281



>ref|XP_008379649.1| PREDICTED: MLO-like protein 8 [Malus domestica]
Length=579

 Score =   333 bits (853),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 213/303 (70%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++IS  LEK+LHK+G     + K+AL EALEK+K ELM+LGF
Sbjct  32    RELDRTPTWAVAGVCAVIIIISFGLEKVLHKVGTWLTDRHKKALFEALEKVKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQSYIAKICIP   G+TMLPC + DE  +  A                     
Sbjct  92    ISLILTFGQSYIAKICIPLKVGDTMLPCSVADEEEDSTAS--------------------  131

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                         RRLLW  RR L+  +  +CK G  PLIS+NGLHQLHI IFFLAVFHVI
Sbjct  132   -----------RRRLLWYERRSLATASDYKCKTGYEPLISVNGLHQLHILIFFLAVFHVI  180

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P  F
Sbjct  181   YSLITMLLGRLKIRGWKQWEAETSTHNYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFF  240

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV ++DYL +R+GFI+VHL  G KF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  241   YVGCFFRQFFRSVSKSDYLTVRNGFITVHLGAGRKFNFQKYIKRSLEDDFKVVVGVSPVL  300

Query  1187  WCA  1195
             W +
Sbjct  301   WAS  303



>gb|KHG22053.1| MLO-like protein 8 [Gossypium arboreum]
Length=560

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 216/316 (68%), Gaps = 30/316 (9%)
 Frame = +2

Query  257   NKKMSgggggkgRELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEAL  436
              K M        R+LDQTPTWAVA VC VI++IS++LE +LHK+G  F  + K AL EAL
Sbjct  19    GKVMGATESSGERKLDQTPTWAVAGVCAVIIIISIVLETVLHKLGTWFTERHKSALFEAL  78

Query  437   EKIKGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPS  616
             +K+K ELMV+GFISLLLTFGQSYIA+ICIP    NTMLPC                    
Sbjct  79    DKVKAELMVMGFISLLLTFGQSYIARICIPIDVANTMLPC-----------------KSD  121

Query  617   GEHGEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQL  793
              E G     E+EH+          RRLLW  RR LS      +CKEG  PLIS+ GLH+L
Sbjct  122   SEKGTSESSEEEHR----------RRLLWFDRRSLSTISTAPKCKEGHEPLISVEGLHEL  171

Query  794   HIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVK  967
             HI IFFLAVFHV+Y  +TM LGR+KIRGWK WE  T     E +NDPSR+RLT ETSFVK
Sbjct  172   HILIFFLAVFHVLYSFVTMMLGRLKIRGWKVWEQETLSHDYEFSNDPSRFRLTHETSFVK  231

Query  968   ENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLE  1147
              +TSF T+ P  FY  CFFRQFFRSV R DYL +R+GFI+VHLAPGSKF+FQKYIKRSLE
Sbjct  232   AHTSFWTRIPFFFYIGCFFRQFFRSVGRVDYLTLRNGFINVHLAPGSKFNFQKYIKRSLE  291

Query  1148  DDFKVVVGINLMLWCA  1195
             DDFK+VVG++ +LW +
Sbjct  292   DDFKIVVGVSPVLWAS  307



>ref|XP_004287711.1| PREDICTED: MLO-like protein 8-like [Fragaria vesca subsp. vesca]
Length=588

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 212/303 (70%), Gaps = 32/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++ISL+LEK+LH +G     + KR L EALEK+K ELM+LGF
Sbjct  33    RELDRTPTWAVAGVCAVIIIISLVLEKVLHTVGTWLSERHKRGLFEALEKVKAELMILGF  92

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTF QSYIAKICIP    NTMLPC +                        A  E E
Sbjct  93    ISLILTFSQSYIAKICIPVKVANTMLPCSL------------------------ASTEKE  128

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              +  +       RRLL + RR L+      CK G  PLIS+NGLHQLHI IFFLA FHV 
Sbjct  129   EETTSR------RRLLSTDRRFLAEATTTTCKSGYEPLISINGLHQLHILIFFLAAFHVA  182

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KIRGWK WE  T+    E +NDPSR+RLT ETSFVK +TS+ T+ PV F
Sbjct  183   YSAITMLLGRLKIRGWKAWEAETSSHSYEFSNDPSRFRLTHETSFVKAHTSYWTRIPVFF  242

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV ++DYL +R+GFISVHLAPGSKF+FQKYIKRSLEDDF+VVVG++ +L
Sbjct  243   YVGCFFRQFFRSVSKSDYLTVRNGFISVHLAPGSKFNFQKYIKRSLEDDFQVVVGVSPVL  302

Query  1187  WCA  1195
             W +
Sbjct  303   WAS  305



>gb|KFK31027.1| hypothetical protein AALP_AA6G058600 [Arabis alpina]
Length=499

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 212/301 (70%), Gaps = 25/301 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F RKKK+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGELFSRKKKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C  HD             APS    +  P    
Sbjct  75    ISLLLTFGQNYIASICVPSKYGHVMAFCGPHD-------------APSSYPKK--PKTTS  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +         R LL   RRVL+  A  +CK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HID---------RHLLDFQRRVLADAAPAKCKKGYVPLISLNALHQVHIFIFFLAVFHVI  170

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  171   YSAITMMLGRAKIRGWKVWEEDVISDQEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  230

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVRR+DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  231   VMCFFRQMLRSVRRSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPELW  290

Query  1190  C  1192
              
Sbjct  291   A  291



>ref|XP_009369784.1| PREDICTED: MLO-like protein 8 [Pyrus x bretschneideri]
Length=573

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 213/303 (70%), Gaps = 34/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++ISL+LEK+LHK+G     + KRAL E+LEK+K ELM+LGF
Sbjct  32    RELDRTPTWAVAGVCAVIIIISLILEKVLHKVGIWLTDRHKRALFESLEKVKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQSYIAKICIP    +TMLPC + D+  E  +                     
Sbjct  92    ISLILTFGQSYIAKICIPLNVADTMLPCRVDDKEEESTS---------------------  130

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                        HRRLLW  RR L+  +  +CK G  PLI++NGLHQLHI IFFLA FHV+
Sbjct  131   -----------HRRLLWYERRSLAAASDYKCKTGYEPLITVNGLHQLHILIFFLAAFHVL  179

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK WE  T+    E +NDPSR+RLT +TSFV+ +TSF T+ P  F
Sbjct  180   YSLITMLLGRLKIRGWKHWEAETSSHNYEFSNDPSRFRLTHQTSFVRAHTSFWTRIPFFF  239

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV +ADYL +R+GFI+VHL  G KF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  240   YVGCFFRQFFRSVSKADYLTLRNGFITVHLGAGKKFNFQKYIKRSLEDDFKVVVGVSPLL  299

Query  1187  WCA  1195
             W +
Sbjct  300   WAS  302



>gb|KDP43787.1| hypothetical protein JCGZ_22414 [Jatropha curcas]
Length=566

 Score =   330 bits (847),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 212/304 (70%), Gaps = 33/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC V+++IS++LEK LHK G     + KRAL EALEKIK EL+VLGF
Sbjct  22    RELDQTPTWAVAGVCAVMIIISILLEKGLHKFGTWLTERHKRALFEALEKIKSELIVLGF  81

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP+   +TMLPC         +A G  +    G           
Sbjct  82    ISLLLTFGQTYITKICIPQKVADTMLPC---------RADGVNDETEEG-----------  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                       H RRLLW  RR LSG  +   CK G  PLIS++GLHQLHI +FFLAVFHV
Sbjct  122   ----------HRRRLLWFERRNLSGSESTTICKTGYEPLISVDGLHQLHILLFFLAVFHV  171

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y   TM LGR+KIRGWK WE  T     E +NDPSR RLT ETSFV+ +TSF T+ P  
Sbjct  172   VYSLTTMMLGRLKIRGWKVWEQETLSHDYEFSNDPSRIRLTHETSFVRAHTSFWTRIPFF  231

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV ++DY+ +RHGFI+VHL+PGSKF+FQKYIKRSLEDDFK+VVG++ +
Sbjct  232   FYIGCFFRQFFRSVSKSDYMTLRHGFITVHLSPGSKFNFQKYIKRSLEDDFKIVVGVSPI  291

Query  1184  LWCA  1195
             LW +
Sbjct  292   LWAS  295



>emb|CDP06355.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   330 bits (846),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 213/304 (70%), Gaps = 33/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEKLLHKIG     + K+AL EALEK+K ELM+LGF
Sbjct  10    RQLDQTPTWAVAGVCAVIILISIALEKLLHKIGTWLTDRHKKALYEALEKVKNELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL F Q YI +IC+P    ++MLPC   D+                           
Sbjct  70    ISLLLVFSQYYITQICVPSGVADSMLPCRARDK---------------------------  102

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                 A     H RRL+   RRVL+  A E  CK+G +PLIS++GLHQLHI IFFLAVFHV
Sbjct  103   ---VATKNDGHRRRLIGYERRVLAAGAKEPSCKQGRVPLISVDGLHQLHILIFFLAVFHV  159

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             IY A+TMALGR+KIRGWK+WE  T+    E +NDP+R+RLT ETSFV+ +TSF T  P+ 
Sbjct  160   IYSAVTMALGRLKIRGWKDWEQETSSHHYEFSNDPTRFRLTHETSFVRAHTSFWTSIPIF  219

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFF SV ++DYL +R+GFISVHLAPGSKF+FQKYIKRSLEDDFK VVG++ +
Sbjct  220   FYIGCFFRQFFHSVSKSDYLTLRNGFISVHLAPGSKFNFQKYIKRSLEDDFKTVVGVSPV  279

Query  1184  LWCA  1195
             LW +
Sbjct  280   LWAS  283



>ref|XP_009359622.1| PREDICTED: MLO-like protein 8 [Pyrus x bretschneideri]
Length=579

 Score =   331 bits (848),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 212/303 (70%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++IS  LEK+LHK G     + K+AL EALEK+K ELM+LGF
Sbjct  32    RELDRTPTWAVAGVCAVIIIISFGLEKVLHKAGTWLTDRHKKALFEALEKVKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQSYIAKICIP   G+TMLPC + DE  +  A                     
Sbjct  92    ISLILTFGQSYIAKICIPLKVGDTMLPCSVADEEEDSTAS--------------------  131

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                         RRLLW  RR L+  +  +CK G  PLIS+NGLHQLHI IFFLAVFHVI
Sbjct  132   -----------RRRLLWYERRSLATASGYKCKTGYEPLISVNGLHQLHILIFFLAVFHVI  180

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P  F
Sbjct  181   YSLITMLLGRLKIRGWKHWEAETSTHNYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFF  240

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFF+SV ++DYL +R+GFI+VHL  GSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  241   YVGCFFRQFFKSVSKSDYLTVRNGFITVHLGAGSKFNFQKYIKRSLEDDFKVVVGVSPVL  300

Query  1187  WCA  1195
             W +
Sbjct  301   WAS  303



>ref|XP_009418888.1| PREDICTED: MLO-like protein 9 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   330 bits (846),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 179/311 (58%), Positives = 214/311 (69%), Gaps = 41/311 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++IS++LEK LH +G  F  + ++A+ EALEKIK ELM+LGF
Sbjct  11    RELDETPTWAVASVCAVIILISILLEKGLHHLGEWFAERHRKAMFEALEKIKAELMILGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI +ICIPE A +TMLPCL   E                           
Sbjct  71    ISLLLTFGQNYIVQICIPEEAADTMLPCLKEVE---------------------------  103

Query  653   HQEPAEAGGEHHRRLLWSM--------RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIF  808
                  E G  HHRRLLW          R ++       C +G +PLISL+GLHQLHIFIF
Sbjct  104   ----TEEGETHHRRLLWGTPDRINLKHRMLVESSGNPHCSKGKVPLISLHGLHQLHIFIF  159

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMAT--AQDEAANDPSRYRLTKETSFVKENTSF  982
             FLA+FHV Y A+TMA GR KI GWKEWE  T     E +NDPSR+R + ETSFV+++TSF
Sbjct  160   FLAIFHVFYSALTMAFGRAKIHGWKEWEKETLSLDYEFSNDPSRFRFSHETSFVRQHTSF  219

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
               + P+ FY V FFRQFF SV +ADYLAMRHGFI+VHLAPGSKFDFQKYI+RSLEDDFKV
Sbjct  220   WNRIPISFYMVSFFRQFFISVGKADYLAMRHGFITVHLAPGSKFDFQKYIERSLEDDFKV  279

Query  1163  VVGINLMLWCA  1195
             VVGI+ +LW +
Sbjct  280   VVGISPILWAS  290



>ref|XP_004232584.1| PREDICTED: MLO-like protein 8 [Solanum lycopersicum]
Length=553

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 216/303 (71%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK+LHK+G     + K+AL EALEK+K ELM+LGF
Sbjct  10    RQLDQTPTWAVAGVCAVIILISIALEKILHKLGTWLTDRHKKALFEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL L F Q YIA ICIP +  +TMLPC           P + + A   E          
Sbjct  70    ISLTLVFSQYYIAGICIPPSVADTMLPC-----------PANNKDAAKEE----------  108

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                      EH R+LLW  RR+L+G A  +CKEG +PL+++  LHQ+HI IFFLAV HV+
Sbjct  109   ---------EHRRKLLWYERRILAG-AEPKCKEGRVPLVTVEALHQIHILIFFLAVLHVL  158

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KIRGWK WE  T+    E  NDPSR+RLT ETSFV+ +TSF T+ P+ F
Sbjct  159   YSAITMWLGRLKIRGWKGWEQETSTHSYEFTNDPSRFRLTHETSFVRAHTSFWTRIPIFF  218

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFF+SV ++DYLA+R+GFISVHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  219   YIGCFFRQFFKSVSKSDYLALRNGFISVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  278

Query  1187  WCA  1195
             W +
Sbjct  279   WAS  281



>ref|XP_009790030.1| PREDICTED: MLO-like protein 8 [Nicotiana sylvestris]
Length=554

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 217/301 (72%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK++HK+G     + K+AL EALEK+K ELM+LGF
Sbjct  10    RQLDQTPTWAVAGVCAVIIIISIALEKIIHKLGTWLTDRHKKALYEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL L F Q YIA ICIP +  +TMLPC                           P  D+
Sbjct  70    ISLTLVFSQYYIAGICIPPSVADTMLPC---------------------------PAVDK  102

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             + +  EA  E HRRLLW  RR+L+G A  +CK+G + LIS++ LHQ+HI IFFLAV HVI
Sbjct  103   NAKTEEA--EEHRRLLWYERRILAG-AEPKCKDGRVSLISVDALHQIHILIFFLAVLHVI  159

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LG++KIRGWK WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P+ F
Sbjct  160   YSAITMWLGKLKIRGWKGWEQETSTHNYEFSNDPSRFRLTHETSFVRAHTSFWTRIPIFF  219

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV ++DYL +R+GFISVHLAPGSKF+FQKYIKRSLEDD+KVVVG++ +L
Sbjct  220   YIGCFFRQFFRSVNKSDYLTLRNGFISVHLAPGSKFNFQKYIKRSLEDDYKVVVGVSPVL  279

Query  1187  W  1189
             W
Sbjct  280   W  280



>ref|XP_009619517.1| PREDICTED: MLO-like protein 8 [Nicotiana tomentosiformis]
Length=555

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 216/301 (72%), Gaps = 31/301 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK++HK+G     + K+AL EALEK+K ELM+LGF
Sbjct  10    RQLDQTPTWAVAGVCAVIIIISIALEKIIHKLGTWLTDRHKKALYEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL L F Q YIA ICIP +  +TMLPC                           P  D+
Sbjct  70    ISLTLVFSQYYIAGICIPSSVADTMLPC---------------------------PAIDK  102

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +  EA  EH RRLLW  RR+L+G A  +CK+G + LIS++ LHQ+HI IFFLAV HVI
Sbjct  103   SAKTDEAE-EHRRRLLWYERRILAG-AESKCKDGRVSLISVDALHQIHILIFFLAVLHVI  160

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LG++KIRGWK WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P+ F
Sbjct  161   YSAITMWLGKLKIRGWKGWEQETSTHNYEFSNDPSRFRLTHETSFVRAHTSFWTRIPIFF  220

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV ++DYL +R+GFISVHLAPGSKF+FQKYIKRSLEDD+KVVVG++ +L
Sbjct  221   YIGCFFRQFFRSVNKSDYLTLRNGFISVHLAPGSKFNFQKYIKRSLEDDYKVVVGVSPVL  280

Query  1187  W  1189
             W
Sbjct  281   W  281



>ref|XP_004146181.1| PREDICTED: MLO-like protein 8-like [Cucumis sativus]
 gb|KGN55592.1| hypothetical protein Csa_3G000160 [Cucumis sativus]
Length=569

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 212/304 (70%), Gaps = 32/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC   V+IS++LE ++HK+G    +K K +L EALEK+K ELM+LGF
Sbjct  27    RDLDNTPTWAVAAVCFFFVLISIVLENVIHKLGTWLTKKHKSSLYEALEKVKAELMILGF  86

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTF Q+YI +ICIP A  N+MLPC                               E
Sbjct  87    ISLLLTFAQAYIVQICIPPAIANSMLPC-----------------------------RRE  117

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +  +    EHHRRL W +RR L+ GH V  C++G + LIS++GLHQLHI IFFLAVFHV
Sbjct  118   EKNASTDEDEHHRRLQWLIRRSLAGGHNVVSCEDGKVSLISIDGLHQLHILIFFLAVFHV  177

Query  830   IYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             ++  ITM LGR+KIRGWKEWE  T+    E  NDP+R+RLT ETSFVK +TSF T+ P  
Sbjct  178   LFSVITMTLGRIKIRGWKEWEQETSTHNYEFFNDPARFRLTHETSFVKAHTSFWTRLPFF  237

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+ SV +ADYL +R+GFI+VHLAPGSKF+FQ+YIKRSLEDDFKVVVG++  
Sbjct  238   FYISCFFRQFYGSVSKADYLTLRNGFITVHLAPGSKFNFQRYIKRSLEDDFKVVVGVSPF  297

Query  1184  LWCA  1195
             LW +
Sbjct  298   LWSS  301



>ref|XP_006410510.1| hypothetical protein EUTSA_v10016533mg [Eutrema salsugineum]
 gb|ESQ51963.1| hypothetical protein EUTSA_v10016533mg [Eutrema salsugineum]
Length=510

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 214/301 (71%), Gaps = 25/301 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  FE++KK+AL EAL+KIK ELMVLGF
Sbjct  17    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGELFEKRKKKALYEALQKIKNELMVLGF  76

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+P   G+ M  C  +D              PSG+  +  P   +
Sbjct  77    ISLLLTFGQNYIASMCVPSRYGHAMSFCGPYD-------------GPSGDAKK--PKTTD  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +         R LL   RRVL+  A  +CK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  122   HIQ---------RHLLSFQRRVLADAAPAQCKKGYVPLISLNALHQVHIFIFFLAVFHVI  172

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  173   YSAITMMLGRAKIRGWKVWEEEVINDHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  232

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI   LW
Sbjct  233   IMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGIRPELW  292

Query  1190  C  1192
              
Sbjct  293   A  293



>ref|XP_002439069.1| hypothetical protein SORBIDRAFT_10g031010 [Sorghum bicolor]
 gb|EER90436.1| hypothetical protein SORBIDRAFT_10g031010 [Sorghum bicolor]
Length=515

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 224/315 (71%), Gaps = 16/315 (5%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  12    RELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEH--GEHAPPE  646
             ISLLL FGQ+YI KICI + A +TMLPC +  E VE    GHG+    G+   G+    +
Sbjct  72    ISLLLVFGQNYIIKICISKNAASTMLPCKL--EAVEAAGAGHGKEPAEGKAAGGKDGHGK  129

Query  647   DEHQEPAE--AGGEHHRRLL-W-------SMRRVLSGHAVEECKEGLIPLISLNGLHQLH  796
             +    P +  A  EH   +L W       + R ++   +  +C EG + LIS+N LHQLH
Sbjct  130   EGAAVPGKKKAAAEHLGGVLDWPPPYYAHNARMLMEASSKSKCPEGKVSLISINALHQLH  189

Query  797   IFIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSFVKE  970
             IFIFFLAVFHV Y AITMALGR KIR WKEWE  A  QD E +NDP+R+R T ETSFV+ 
Sbjct  190   IFIFFLAVFHVSYSAITMALGRAKIRAWKEWEKEAAGQDYEFSNDPTRFRFTHETSFVRN  249

Query  971   NTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLED  1150
             + + + + P  FY   FFRQFFRSVR+ADY A+RH F++VHLAPGSKFDFQKYIKRSLED
Sbjct  250   HMNVLNKFPASFYISNFFRQFFRSVRQADYSALRHSFVNVHLAPGSKFDFQKYIKRSLED  309

Query  1151  DFKVVVGINLMLWCA  1195
             DFKV+VGI+  LW +
Sbjct  310   DFKVIVGISPTLWAS  324



>ref|XP_009601752.1| PREDICTED: MLO-like protein 8 [Nicotiana tomentosiformis]
Length=554

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 213/303 (70%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK++HK+G     + K+AL EALEK+K ELM+LGF
Sbjct  10    RQLDQTPTWAVAGVCAVIILISIALEKIIHKLGTWLTDRHKKALYEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL L F Q YIA ICIP    NTMLPC    + VE +                      
Sbjct  70    ISLTLVFSQYYIAGICIPPNVANTMLPCPAVHKDVEKEE---------------------  108

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                      EH RRLLW  RR+L+G A   CKEG + LIS++ LHQ+HI IFFLAV HV+
Sbjct  109   ---------EHRRRLLWYERRILAG-AEPTCKEGRVALISVDALHQIHILIFFLAVLHVL  158

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P+ F
Sbjct  159   YSAITMWLGRLKIRGWKQWEQETSTHNYEFSNDPSRFRLTHETSFVRAHTSFWTRLPIFF  218

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CF RQFFRSV ++DYL +R+GFISVHLAPGSKFDFQKYIKRSLEDDFKVVVG++ +L
Sbjct  219   YIGCFLRQFFRSVSKSDYLTLRNGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGVSPVL  278

Query  1187  WCA  1195
             W +
Sbjct  279   WAS  281



>gb|KEH20339.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=417

 Score =   323 bits (828),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 216/304 (71%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LD+TPTWAV  VC V +++S++LEK LHKIG     + K+AL+EALEK+K ELM+LGF
Sbjct  38    KDLDKTPTWAVGCVCTVFILVSIILEKSLHKIGTWLGDRHKKALLEALEKVKAELMILGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSY+ K+C+P  A + MLPC                          A  + +
Sbjct  98    LSLLLTFGQSYMVKLCMPANATDIMLPC-----------------------QSRATRDAK  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             + E      EHHR+LL+  RR LS   A   CKEG  PLIS+NGLHQLHI IFFLAV HV
Sbjct  135   NDE-----DEHHRKLLYYERRYLSEDGAPYNCKEGQEPLISVNGLHQLHILIFFLAVLHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             IY A+TM LGR+KIRGWK WE  T+    E A DPSR+RLT ETSFV+++ +F T+ P+ 
Sbjct  190   IYSAVTMLLGRLKIRGWKAWEAETSSHGYEFATDPSRFRLTHETSFVRQHATFWTKIPIF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV ++DYL +R+GFI+VHL+PGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  250   FYISCFFRQFYRSVEKSDYLTLRNGFIAVHLSPGSKFNFQKYIKRSLEDDFKVVVGVSPV  309

Query  1184  LWCA  1195
             LW +
Sbjct  310   LWAS  313



>ref|XP_006654121.1| PREDICTED: MLO-like protein 5-like [Oryza brachyantha]
Length=552

 Score =   327 bits (838),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 218/318 (69%), Gaps = 29/318 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK LHKIG  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGVIILISILLEKGLHKIGEFFSHRKKKAMVEALEKVKTELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQA---------------PGHGEH  607
             ISLLL FGQ+YI KICI E A +TMLPC +    +E +                PGH   
Sbjct  71    ISLLLVFGQNYIIKICITEKAADTMLPCRLKASTIEAETDKGHHGGGEAAGAKEPGHMAK  130

Query  608   APSGEHGEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLH  787
              P+   G    P       A +   HHR L              +C EG + LIS+N LH
Sbjct  131   -PAEHFGLMGTPF----AAAFSAPPHHRLLA-------EAKMSTKCPEGKVSLISINALH  178

Query  788   QLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSF  961
             QLHIFIFFLAVFHV Y AITMALGR KIRGWK+WE  A  QD E +NDP+R+R T ETSF
Sbjct  179   QLHIFIFFLAVFHVTYSAITMALGRAKIRGWKDWEKEAAGQDFEFSNDPTRFRFTHETSF  238

Query  962   VKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRS  1141
             V+++ + + +TP  FY   FFRQFFRSVRRADY A+RH F++VHLAPGSKFDFQKYIKRS
Sbjct  239   VRQHMNVLNKTPASFYISNFFRQFFRSVRRADYCALRHSFVNVHLAPGSKFDFQKYIKRS  298

Query  1142  LEDDFKVVVGINLMLWCA  1195
             LEDDFKV+VGI+  LW +
Sbjct  299   LEDDFKVIVGISPPLWAS  316



>gb|KEH20340.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=416

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 216/304 (71%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LD+TPTWAV  VC V +++S++LEK LHKIG     + K+AL+EALEK+K ELM+LGF
Sbjct  38    KDLDKTPTWAVGCVCTVFILVSIILEKSLHKIGTWLGDRHKKALLEALEKVKAELMILGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSY+ K+C+P  A + MLPC                          A  + +
Sbjct  98    LSLLLTFGQSYMVKLCMPANATDIMLPC-----------------------QSRATRDAK  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             + E      EHHR+LL+  RR LS   A   CKEG  PLIS+NGLHQLHI IFFLAV HV
Sbjct  135   NDE-----DEHHRKLLYYERRYLSEDGAPYNCKEGQEPLISVNGLHQLHILIFFLAVLHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             IY A+TM LGR+KIRGWK WE  T+    E A DPSR+RLT ETSFV+++ +F T+ P+ 
Sbjct  190   IYSAVTMLLGRLKIRGWKAWEAETSSHGYEFATDPSRFRLTHETSFVRQHATFWTKIPIF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV ++DYL +R+GFI+VHL+PGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  250   FYISCFFRQFYRSVEKSDYLTLRNGFIAVHLSPGSKFNFQKYIKRSLEDDFKVVVGVSPV  309

Query  1184  LWCA  1195
             LW +
Sbjct  310   LWAS  313



>gb|EYU39427.1| hypothetical protein MIMGU_mgv1a007858mg [Erythranthe guttata]
Length=393

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 211/303 (70%), Gaps = 32/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQT TWAVA VC VI+++S++LEK+LHK+G     + K+AL EALEK+K ELMVLGF
Sbjct  10    RYLDQTATWAVAGVCAVIIILSIILEKVLHKVGTWLTERHKKALYEALEKVKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL F Q YIA+ICIP    +TMLPC                          A  +D+
Sbjct  70    ISLLLVFSQYYIAEICIPLKIADTMLPC-------------------------PAKIKDD  104

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              +     G ++ RRLL   RR L+G     CK G +P+I++ GLHQ+HI IFFLA FHV 
Sbjct  105   AK-----GTDNRRRLLSYERRFLAGQKKNPCKAGTVPIITVTGLHQIHILIFFLACFHVF  159

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y A+TMALGR+KIRGWK+WE  T     E  NDPSR+RLT ETSFV+ +TSF T+ P+ F
Sbjct  160   YSAVTMALGRLKIRGWKQWEQETLSHDYEFTNDPSRFRLTHETSFVRAHTSFWTRIPLFF  219

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV R+DYL +R+GFI+VHLAPGSKF+FQ+YIKRSLEDD+K VVGI+ +L
Sbjct  220   YIGCFFRQFFRSVSRSDYLTLRNGFIAVHLAPGSKFNFQQYIKRSLEDDYKTVVGISPLL  279

Query  1187  WCA  1195
             W +
Sbjct  280   WAS  282



>ref|XP_006366655.1| PREDICTED: MLO-like protein 8-like isoform X1 [Solanum tuberosum]
Length=550

 Score =   325 bits (834),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 213/301 (71%), Gaps = 34/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK++HK+G     + K+AL EALEK+K ELMVLGF
Sbjct  10    RQLDQTPTWAVAGVCAVIILISIALEKIIHKLGTWLTERHKKALFEALEKVKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL L F Q YIA ICIP +  NT+LPC                            P   
Sbjct  70    ISLTLVFSQYYIAGICIPTSVANTLLPC----------------------------PAVN  101

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              ++  E   EH RRLLW  RR+L+G A  +C +G + LIS++ LHQ+HI IFFLAVFHV+
Sbjct  102   KEDKTE---EHRRRLLWHERRILAG-AEPKCDDGRVSLISIDALHQIHILIFFLAVFHVV  157

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LG++KIRGWK WE+ T+    E +NDPSR+RLT ETSFV+ +TSF T  P+ F
Sbjct  158   YSAITMWLGKLKIRGWKCWELETSTHNYEFSNDPSRFRLTHETSFVRAHTSFWTNIPIFF  217

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CF RQFFRSV ++DYL +R+GFISVHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  218   YIGCFLRQFFRSVNKSDYLTLRNGFISVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  277

Query  1187  W  1189
             W
Sbjct  278   W  278



>ref|XP_004978312.1| PREDICTED: MLO-like protein 5-like [Setaria italica]
Length=553

 Score =   325 bits (833),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 221/323 (68%), Gaps = 30/323 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPS---GEHGEHAPP  643
             ISLLL FGQ+YI KICI   A +TMLPC +  E  E          P+   G HG   P 
Sbjct  71    ISLLLVFGQNYIIKICISNHAADTMLPCKLKSELAEAAGGHGAAKEPAEAAGGHGGQEPD  130

Query  644   EDEHQEPAEAGGE---------------HHRRLLW--SMRRVLSGHAVEECKEGLIPLIS  772
             E +    AE  G+               HH RLL   SM+         +C +G + LIS
Sbjct  131   EKKGGGAAEHLGDIIAWPPPPPHYFANPHHSRLLGEASMK--------TKCPDGKVSLIS  182

Query  773   LNGLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLT  946
             +N LHQLHIFIFFLAVFHV Y AITMALGR KIR WKEWE  A  QD E +NDP+R+R T
Sbjct  183   INALHQLHIFIFFLAVFHVSYSAITMALGRAKIRAWKEWEKEAAGQDYEFSNDPTRFRFT  242

Query  947   KETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQK  1126
              ETSFV+++ + + +TP  FY   FFRQFFRSVR+ADY A+RH F++VHLAPGSKFDFQK
Sbjct  243   HETSFVRQHMNVLNKTPASFYISNFFRQFFRSVRKADYCALRHSFVNVHLAPGSKFDFQK  302

Query  1127  YIKRSLEDDFKVVVGINLMLWCA  1195
             YIKRSLEDDFKV+VGI+  LW +
Sbjct  303   YIKRSLEDDFKVIVGISPPLWAS  325



>ref|XP_011098015.1| PREDICTED: MLO-like protein 10 isoform X1 [Sesamum indicum]
Length=565

 Score =   325 bits (834),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 214/301 (71%), Gaps = 33/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC +I++IS+ LEK+LHK+G     + K+AL EALEK+K ELM+LGF
Sbjct  12    RNLDQTPTWAVAGVCAIIIIISIALEKVLHKVGTWLTDRHKKALYEALEKVKAELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+L F Q YIA+ICIP    +TMLPC                          A  +D+
Sbjct  72    ISLILVFSQYYIAEICIPTNVADTMLPC-------------------------RASADDK  106

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              +E      EH RRLL   RRVL+      C EG + LIS+NGLHQ+HI IFFLAVFHVI
Sbjct  107   AKE------EHRRRLLSYERRVLAAKKEPTCGEGHVALISVNGLHQIHILIFFLAVFHVI  160

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITMALGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+ P+ F
Sbjct  161   YSAITMALGRLKIRGWKQWEQETSSHNYEFSNDPSRFRLTHETSFVRAHTSFWTRIPLFF  220

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFF+SV ++DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK VVG++ +L
Sbjct  221   YIGCFFRQFFKSVSKSDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKTVVGVSPVL  280

Query  1187  W  1189
             W
Sbjct  281   W  281



>gb|EYU36583.1| hypothetical protein MIMGU_mgv1a019580mg [Erythranthe guttata]
Length=492

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 210/303 (69%), Gaps = 30/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VIV+IS++LEK LHKI  +  R++K ALVEALEKIK ELM+LGF
Sbjct  10    RELDQTPTWAVSFVCSVIVIISIILEKTLHKIRESLSRRRKFALVEALEKIKSELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI +ICIP    NTMLPC     H   +   H                  
Sbjct  70    ISLLLTFGQNYITRICIPVRIANTMLPCAHLKRHFHEKDKDH------------------  111

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                       HHRRLLW   R+L+  +    CK G IP+IS+NGLHQLHIFIFFLA+FHV
Sbjct  112   ----------HHRRLLWYEHRILAADSPTRSCKRGHIPIISVNGLHQLHIFIFFLAIFHV  161

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDEAAN-DPSRYRLTKETSFVKENTSFMTQTPVLF  1006
              Y AITM LGRMKIR WKEWE   A +   + D +++RLT E SFVK +TS  T+ PVLF
Sbjct  162   FYSAITMMLGRMKIREWKEWEREIANNTNESIDSAQFRLTHEDSFVKGHTSPWTKHPVLF  221

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFR    SVRRADYL +R+GFISVHLAPG+KF+FQKYIKRSLEDDFKV+VGI  +L
Sbjct  222   YIACFFRHMLWSVRRADYLTLRNGFISVHLAPGTKFNFQKYIKRSLEDDFKVIVGIPPLL  281

Query  1187  WCA  1195
             W A
Sbjct  282   WTA  284



>ref|XP_004253244.1| PREDICTED: MLO-like protein 9 [Solanum lycopersicum]
 ref|XP_010314898.1| PREDICTED: MLO-like protein 9 [Solanum lycopersicum]
Length=554

 Score =   325 bits (832),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 211/301 (70%), Gaps = 34/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS+ LEK++HK+G     + K+AL EALEKIK ELMVLGF
Sbjct  10    RQLDQTPTWAVAGVCAVIILISIALEKIIHKLGTWLTERHKKALFEALEKIKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL L F Q YIA ICIP    NT+LPC                            P   
Sbjct  70    ISLTLVFSQYYIAGICIPTDVANTLLPC----------------------------PAVH  101

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              ++  E   EH RRLLW  RR+L+G A  +C +G + LIS++ LHQ+HI IFFLAV HVI
Sbjct  102   KEDKTE---EHRRRLLWHERRILAG-AEPKCDDGRVSLISIDALHQIHILIFFLAVLHVI  157

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LG++KIRGWK WE  TA    E +NDPSR+RLT ETSFV+ +TSF T  P+ F
Sbjct  158   YSAITMWLGKLKIRGWKCWEQETATHDYEFSNDPSRFRLTHETSFVRAHTSFWTNIPIFF  217

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV ++DYL +R+GFISVHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  218   YIGCFFRQFFRSVNKSDYLTLRNGFISVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  277

Query  1187  W  1189
             W
Sbjct  278   W  278



>gb|KCW56485.1| hypothetical protein EUGRSUZ_I02212 [Eucalyptus grandis]
Length=569

 Score =   325 bits (833),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 214/304 (70%), Gaps = 34/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL QTPTWAVA+VC   + ISL+LEKLLHKIG     + KRAL EAL+K+K ELM+LGF
Sbjct  12    RELTQTPTWAVAIVCAAFIFISLVLEKLLHKIGTWLTERHKRALYEALDKVKSELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSY++ IC+P+   +TMLPC    ++ E +                      
Sbjct  72    ISLLLTFGQSYVSSICVPQKVADTMLPCRKDSKYDESK----------------------  109

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG+  R+LLW  RR L+ G     C++G  PLIS+NGLHQLHI IFFLAV HV
Sbjct  110   -------GGQ--RKLLWYERRSLAAGSYAPSCEKGQEPLISVNGLHQLHILIFFLAVVHV  160

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A+TM LGR+KIRGWK+WE  T     E + DPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  161   LYSAVTMMLGRLKIRGWKQWEQETLSHDYEFSTDPSRFRLTHETSFVRAHTSFWTRIPFF  220

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFF+SV +ADYL +R+GFI+VHLAPGSKF+FQKY+KRSLEDDFKV+VG++ +
Sbjct  221   FYIGCFFRQFFKSVGKADYLTLRNGFIAVHLAPGSKFNFQKYVKRSLEDDFKVIVGVSPV  280

Query  1184  LWCA  1195
             LW +
Sbjct  281   LWAS  284



>ref|XP_010029568.1| PREDICTED: MLO-like protein 10 [Eucalyptus grandis]
Length=570

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 214/304 (70%), Gaps = 34/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL QTPTWAVA+VC   + ISL+LEKLLHKIG     + KRAL EAL+K+K ELM+LGF
Sbjct  12    RELTQTPTWAVAIVCAAFIFISLVLEKLLHKIGTWLTERHKRALYEALDKVKSELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSY++ IC+P+   +TMLPC    ++ E +                      
Sbjct  72    ISLLLTFGQSYVSSICVPQKVADTMLPCRKDSKYDESK----------------------  109

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG+  R+LLW  RR L+ G     C++G  PLIS+NGLHQLHI IFFLAV HV
Sbjct  110   -------GGQ--RKLLWYERRSLAAGSYAPSCEKGQEPLISVNGLHQLHILIFFLAVVHV  160

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A+TM LGR+KIRGWK+WE  T     E + DPSR+RLT ETSFV+ +TSF T+ P  
Sbjct  161   LYSAVTMMLGRLKIRGWKQWEQETLSHDYEFSTDPSRFRLTHETSFVRAHTSFWTRIPFF  220

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFF+SV +ADYL +R+GFI+VHLAPGSKF+FQKY+KRSLEDDFKV+VG++ +
Sbjct  221   FYIGCFFRQFFKSVGKADYLTLRNGFIAVHLAPGSKFNFQKYVKRSLEDDFKVIVGVSPV  280

Query  1184  LWCA  1195
             LW +
Sbjct  281   LWAS  284



>emb|CDY23718.1| BnaC04g44040D [Brassica napus]
Length=440

 Score =   321 bits (822),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 180/300 (60%), Positives = 215/300 (72%), Gaps = 25/300 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HK+G  FE+KKK+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIILELMIHKVGSVFEKKKKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    GN M  C  +D              PSG+  +    + +
Sbjct  75    ISLLLTFGQNYIASLCVASKYGNAMSFCGPYD-------------GPSGDTKK--VKDTD  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +         R LL   RRVL+G A  ECK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HMQ---------RHLLSLQRRVLAGGAPAECKKGYVPLISLNALHQVHIFIFFLAVFHVI  170

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  +DPSR+RLT ETSFV+E+ +   +    FY
Sbjct  171   YSAITMMLGRAKIRGWKVWEEEVVNDHEMMDDPSRFRLTHETSFVREHVNTWARNRFSFY  230

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  231   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPALW  290



>ref|XP_006296403.1| hypothetical protein CARUB_v10025579mg [Capsella rubella]
 gb|EOA29301.1| hypothetical protein CARUB_v10025579mg [Capsella rubella]
Length=501

 Score =   323 bits (827),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 211/301 (70%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F +++K+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGELFTKRRKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    GN M  C  +D              PSG++ +  P   +
Sbjct  75    ISLLLTFGQNYIASLCVASRYGNAMSFCGPYD-------------GPSGDYKK--PKTTD  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +                RRVL+  A  +CK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HLQ----------------RRVLADAAPAQCKKGYVPLISLNALHQVHIFIFFLAVFHVI  163

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  164   YSAITMMLGRAKIRGWKVWEEEVVNDHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  224   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPELW  283

Query  1190  C  1192
              
Sbjct  284   A  284



>ref|XP_003517123.1| PREDICTED: MLO-like protein 8-like isoform 1 [Glycine max]
Length=598

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 216/305 (71%), Gaps = 30/305 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V +++S+ LEK LHK+G    +KKK+AL+EALEK+K ELM+LGF
Sbjct  35    RDLDQTPTWAVAAVCTVFILVSIALEKSLHKVGTWLGQKKKKALLEALEKVKAELMILGF  94

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI +ICIPE   + MLPC                         +   ED+
Sbjct  95    ISLLLTFGQSYIVRICIPEKLADNMLPC------------------------PYKYKEDK  130

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-EC-KEGLIPLISLNGLHQLHIFIFFLAVFH  826
                 +E   EH R+LL   RR L+      +C +EG  PL+S+NGLHQLHI +FFLAV H
Sbjct  131   KASDSEE--EHRRKLLSYERRYLAADTTSFKCSREGHEPLLSVNGLHQLHILVFFLAVIH  188

Query  827   VIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y AITM LGR+KIRGWK WE  T+    E AN  SR+RLT ETSFV+ ++SF+T+ P+
Sbjct  189   VLYSAITMMLGRLKIRGWKAWEAETSTHNYEFANAASRFRLTHETSFVRAHSSFLTRIPI  248

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQF+RSV + DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ 
Sbjct  249   FFYIRCFFRQFYRSVNKTDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSP  308

Query  1181  MLWCA  1195
             +LW +
Sbjct  309   ILWAS  313



>ref|XP_003629098.1| MLO-like protein [Medicago truncatula]
 gb|AET03574.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=588

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 216/304 (71%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LD+TPTWAV  VC V +++S++LEK LHKIG     + K+AL+EALEK+K ELM+LGF
Sbjct  38    KDLDKTPTWAVGCVCTVFILVSIILEKSLHKIGTWLGDRHKKALLEALEKVKAELMILGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSY+ K+C+P  A + MLPC                          A  + +
Sbjct  98    LSLLLTFGQSYMVKLCMPANATDIMLPC-----------------------QSRATRDAK  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             + E      EHHR+LL+  RR LS   A   CKEG  PLIS+NGLHQLHI IFFLAV HV
Sbjct  135   NDE-----DEHHRKLLYYERRYLSEDGAPYNCKEGQEPLISVNGLHQLHILIFFLAVLHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             IY A+TM LGR+KIRGWK WE  T+    E A DPSR+RLT ETSFV+++ +F T+ P+ 
Sbjct  190   IYSAVTMLLGRLKIRGWKAWEAETSSHGYEFATDPSRFRLTHETSFVRQHATFWTKIPIF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV ++DYL +R+GFI+VHL+PGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  250   FYISCFFRQFYRSVEKSDYLTLRNGFIAVHLSPGSKFNFQKYIKRSLEDDFKVVVGVSPV  309

Query  1184  LWCA  1195
             LW +
Sbjct  310   LWAS  313



>gb|ACF82832.1| unknown [Zea mays]
Length=337

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 208/303 (69%), Gaps = 18/303 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  10    RELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL FGQ+YI K+CI   A NTMLPC + +  V  +          G   +  PP   
Sbjct  70    ISLLLVFGQNYIVKVCISNHAANTMLPCKLKEAAVPGKKKAAAAAEHLGGVLDWPPPYYA  129

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H                  R +       +C EG + LIS+N LHQLHIFIFFLAVFHV 
Sbjct  130   HNG----------------RMLAEASMATKCPEGKVSLISINALHQLHIFIFFLAVFHVS  173

Query  833   YGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITMALGR KIR WKEWE  A  QD E +NDP+R+R T ETSFV+++ + + + P  F
Sbjct  174   YSAITMALGRAKIRAWKEWEKEAAGQDYEFSNDPTRFRFTHETSFVRQHMNVLNKFPASF  233

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y   FFRQFFRSVRRADY A+RH F++VHLAPG+KFDFQKYIKRSLEDDFKV+VGI+  L
Sbjct  234   YISNFFRQFFRSVRRADYCALRHSFVNVHLAPGTKFDFQKYIKRSLEDDFKVIVGISPPL  293

Query  1187  WCA  1195
             W +
Sbjct  294   WAS  296



>gb|KHN35943.1| MLO-like protein 8 [Glycine soja]
Length=573

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 213/304 (70%), Gaps = 29/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V +++S+ LEK LHK+G    +KKK+AL+EALEK+K ELM+LGF
Sbjct  11    RDLDQTPTWAVAAVCTVFILVSIALEKSLHKVGTWLGQKKKKALLEALEKVKAELMILGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI +ICIPE   + MLPC                         +   ED+
Sbjct  71    ISLLLTFGQSYIVRICIPEKLADNMLPC------------------------PYKYKEDK  106

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                 +E   EH R+LL   RR L+      +C     PL+S+NGLHQLHI +FFLAV HV
Sbjct  107   KASDSEE--EHRRKLLSYERRYLAADTTSFKCSREHEPLLSVNGLHQLHILVFFLAVIHV  164

Query  830   IYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y AITM LGR+KIRGWK WE  T+    E AN  SR+RLT ETSFV+ ++SF+T+ P+ 
Sbjct  165   LYSAITMMLGRLKIRGWKAWEAETSTHNYEFANAASRFRLTHETSFVRAHSSFLTRIPIF  224

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV + DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  225   FYIRCFFRQFYRSVNKTDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPI  284

Query  1184  LWCA  1195
             LW +
Sbjct  285   LWAS  288



>gb|EMS53724.1| MLO-like protein 5 [Triticum urartu]
Length=539

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 221/318 (69%), Gaps = 17/318 (5%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LE  LHK+G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGVIVLISILLEMGLHKVGEWFAHRKKKAMVEALEKVKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSG-----EHGEHA  637
             ISLLL FGQSYI KICI EAA +TMLPC +    VE +    G H         EHG   
Sbjct  71    ISLLLVFGQSYIIKICISEAAADTMLPCRLKKATVEVEIAKDGGHGAPAGGAKEEHGAKQ  130

Query  638   PPE----DEHQEPAEAGGEHHRRLLWSMR-----RVLS-GHAVEECKEGLIPLISLNGLH  787
             P E      +   A +    HR L  +       R+LS  +   +C  G + LIS+N LH
Sbjct  131   PEEHFSLGTNPFTATSFSVPHRMLSEATSFSVPHRMLSEANMNTKCPPGKVSLISINALH  190

Query  788   QLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQDE-AANDPSRYRLTKETSF  961
             QLHIFIFFLAVFHV Y A TMALGR KIRGWKE E  A  QDE   NDPS++R T ETSF
Sbjct  191   QLHIFIFFLAVFHVCYSATTMALGRAKIRGWKEGEKEAAGQDEEVTNDPSQFRFTHETSF  250

Query  962   VKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRS  1141
             V+++ + + +TP  FY   FFRQFFRSVRRADY A+RH F++VHLAPGSKFDFQKYIKRS
Sbjct  251   VRQHMNVLNKTPASFYISNFFRQFFRSVRRADYCALRHSFVNVHLAPGSKFDFQKYIKRS  310

Query  1142  LEDDFKVVVGINLMLWCA  1195
             LEDDFKV+VGI+ +LW +
Sbjct  311   LEDDFKVIVGISPILWAS  328



>ref|XP_006473920.1| PREDICTED: MLO-like protein 9-like [Citrus sinensis]
Length=549

 Score =   322 bits (826),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 217/303 (72%), Gaps = 30/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV++VC +IV +S +LE + H +   F ++ K A++EALEKIKGELM+LGF
Sbjct  12    RELDQTPTWAVSMVCGIIVALSFVLEGIFHLVAKIFHKRHKYAMLEALEKIKGELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA+ICIP    +TMLPC               E     +H         
Sbjct  72    ISLLLTFGQNYIAQICIPVEVADTMLPC-------------RKERLKKVKH---------  109

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
               +  ++ G    R LW  +R+L+G A +  C +G +PLIS++GLHQLHIFIFFLAVFHV
Sbjct  110   --DLFDSRG----RALWYEQRLLAGEADDVGCHKGKVPLISVHGLHQLHIFIFFLAVFHV  163

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDE-AANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
              Y AITM LGR+KIR WK+WE  T  ++   ND SR+RLT ETSFV+ +T+   ++P +F
Sbjct  164   FYSAITMTLGRLKIRKWKQWERETESEQHMVNDSSRFRLTHETSFVRGHTNNWMKSPTIF  223

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y +CFFRQFFRSVR+ADYL MRHGFI+VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+  L
Sbjct  224   YLICFFRQFFRSVRKADYLTMRHGFINVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPPL  283

Query  1187  WCA  1195
             W +
Sbjct  284   WAS  286



>gb|AAK53798.1|AF369566_1 membrane protein Mlo5 [Arabidopsis thaliana]
Length=500

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 209/301 (69%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F  ++K+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    G+ M  C  +D              PSGE  +  P   E
Sbjct  75    ISLLLTFGQNYIASLCVASRYGHAMSFCGPYD-------------GPSGESKK--PKTTE  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H E                RRVL+  A  +CK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HLE----------------RRVLADAAPAQCKKGYVPLISLNALHQVHIFIFFLAVFHVI  163

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  164   YSAITMMLGRAKIRGWKVWEEEVINDHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  224   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPELW  283

Query  1190  C  1192
              
Sbjct  284   A  284



>ref|XP_011022136.1| PREDICTED: MLO-like protein 8 [Populus euphratica]
Length=578

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 215/304 (71%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC VI++IS++LEK+LHK+G  F  K K+AL EALEK+K ELM+LGF
Sbjct  30    RKLDQTPTWAVAGVCAVIIIISILLEKILHKVGSWFTEKHKKALFEALEKVKAELMILGF  89

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIAKIC+P+    TMLPC                             ++ 
Sbjct  90    ISLLLTFGQSYIAKICVPQDVAGTMLPC----------------------------KKEG  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              ++ +   GE  R LLW  RR L+G  +  +CK+G   LIS+ GLHQLHI IFFLA+FHV
Sbjct  122   SEKSSSTEGERRRALLWFDRRFLAGAESAVKCKDGYEQLISVEGLHQLHILIFFLAIFHV  181

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             ++  ITM LGR+K R WK WE+ T     E +NDPSR+RL  ETSFV+ +TSF ++ P  
Sbjct  182   LFSVITMTLGRLKSRAWKRWELETLSHDYEFSNDPSRFRLAHETSFVRAHTSFWSRIPFF  241

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFF+QFFRSV R+DYL +R+GFI+VHLAPGSKF+F+KY+KRSLEDDFK+VVG++ +
Sbjct  242   FYIGCFFQQFFRSVSRSDYLTLRNGFITVHLAPGSKFNFRKYLKRSLEDDFKLVVGVSPV  301

Query  1184  LWCA  1195
             LW +
Sbjct  302   LWAS  305



>ref|NP_180923.1| MLO-like protein 5 [Arabidopsis thaliana]
 sp|O22815.1|MLO5_ARATH RecName: Full=MLO-like protein 5; Short=AtMlo5 [Arabidopsis thaliana]
 gb|AAM14803.1| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC08867.1| MLO-like protein 5 [Arabidopsis thaliana]
Length=501

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 209/301 (69%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F  ++K+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    G+ M  C  +D              PSGE  +  P   E
Sbjct  75    ISLLLTFGQNYIASLCVASRYGHAMSFCGPYD-------------GPSGESKK--PKTTE  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H E                RRVL+  A  +CK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HLE----------------RRVLADAAPAQCKKGYVPLISLNALHQVHIFIFFLAVFHVI  163

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  164   YSAITMMLGRAKIRGWKVWEEEVINDHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  224   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPELW  283

Query  1190  C  1192
              
Sbjct  284   A  284



>emb|CDY26810.1| BnaC09g09370D [Brassica napus]
Length=601

 Score =   323 bits (829),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 213/303 (70%), Gaps = 29/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC   +V+S++LEKL+HK+G     ++K+AL++ALEKIK ELMVLGF
Sbjct  40    RELNQTPTWAVAGVCTFFIVVSVVLEKLIHKVGTVLWDRQKKALLDALEKIKSELMVLGF  99

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG SYI KICIP    +TMLPC          AP              AP E E
Sbjct  100   ISLLLTFGSSYILKICIPSHVAHTMLPC---------PAP--------------APLEKE  136

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +     G+ HR+LLW   R LS  +  +CKEG   LIS   LHQLHI IFFLA+FHV+
Sbjct  137   EDDK----GQGHRKLLWFEHRFLSETSSTKCKEGYEQLISSEALHQLHILIFFLAIFHVV  192

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+E+TSF T+ P  F
Sbjct  193   YSFLTMMLGRLKIRGWKHWEKETSSHHYEFSTDTSRFRLTHETSFVREHTSFWTRIPFFF  252

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV R DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFK+VVG++ +L
Sbjct  253   YVECFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKLVVGVSPVL  312

Query  1187  WCA  1195
             W +
Sbjct  313   WAS  315



>emb|CDY30363.1| BnaA09g09140D [Brassica napus]
Length=592

 Score =   323 bits (828),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 212/303 (70%), Gaps = 29/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELMVLGF
Sbjct  31    RELNQTPTWAVAGVCTFFIVVSVVLEKLIHKVGTVLWDRHKKALLDALEKIKSELMVLGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG SYI KICIP    +TMLPC          AP              AP E E
Sbjct  91    ISLLLTFGSSYILKICIPSHVAHTMLPC---------PAP--------------APLEKE  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +     GE HR+LLW   R LS  +  +CKEG   LIS   LHQLHI IFFLA+FHV+
Sbjct  128   EDDK----GEGHRKLLWFEHRFLSETSSTKCKEGYEQLISSEALHQLHILIFFLAIFHVV  183

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+E+TSF T+ P  F
Sbjct  184   YSFLTMMLGRLKIRGWKHWEKETSSHHYEFSTDTSRFRLTHETSFVREHTSFWTRIPFFF  243

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV R DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFK+VVG++ +L
Sbjct  244   YVECFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKLVVGVSPVL  303

Query  1187  WCA  1195
             W +
Sbjct  304   WAS  306



>ref|XP_009112431.1| PREDICTED: MLO-like protein 8 [Brassica rapa]
 ref|XP_009112432.1| PREDICTED: MLO-like protein 8 [Brassica rapa]
Length=592

 Score =   323 bits (828),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 212/303 (70%), Gaps = 29/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELMVLGF
Sbjct  31    RELNQTPTWAVAGVCTFFIVVSVVLEKLIHKVGTVLWDRHKKALLDALEKIKSELMVLGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG SYI KICIP    +TMLPC          AP              AP E E
Sbjct  91    ISLLLTFGSSYILKICIPSHVAHTMLPC---------PAP--------------APLEKE  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +     GE HR+LLW   R LS  +  +CKEG   LIS   LHQLHI IFFLA+FHV+
Sbjct  128   EDDK----GEGHRKLLWFEHRFLSETSSTKCKEGYEQLISSEALHQLHILIFFLAIFHVV  183

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+E+TSF T+ P  F
Sbjct  184   YSFLTMMLGRLKIRGWKHWEKETSSHHYEFSTDTSRFRLTHETSFVREHTSFWTRIPFFF  243

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV R DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFK+VVG++ +L
Sbjct  244   YVECFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKLVVGVSPVL  303

Query  1187  WCA  1195
             W +
Sbjct  304   WAS  306



>ref|NP_001105170.1| barley mlo defense gene homolog6 [Zea mays]
 gb|AAK38342.1| seven transmembrane protein Mlo6 [Zea mays]
 gb|ACN27049.1| unknown [Zea mays]
 gb|AFW69613.1| Seven transmembrane protein Mlo6 [Zea mays]
Length=515

 Score =   320 bits (821),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 222/314 (71%), Gaps = 14/314 (4%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEH----AP  640
             ISLLL FGQ+YI K+CI   A NTMLPC +    VE +  GHG+ A +   G+     A 
Sbjct  71    ISLLLVFGQNYIIKVCISNHAANTMLPCKLEAAAVEGK-DGHGKEAAAVVAGKKKVAVAV  129

Query  641   PEDEHQEPAEAGGEHHRRLLW-------SMRRVLSGHAVEECKEGLIPLISLNGLHQLHI  799
             P  + ++ A A       + W       + R +       +C EG +PLIS+N LHQLHI
Sbjct  130   PGKKKKKAAAAADHLGGVVDWPPPYYAHNARMLAEASMATKCPEGKVPLISINALHQLHI  189

Query  800   FIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSFVKEN  973
             FIFFLAVFHV Y AITMALGR KIR WKEWE  A  QD E ++DP+R+R T ETSFV+++
Sbjct  190   FIFFLAVFHVSYSAITMALGRAKIRAWKEWEKEAAGQDYEFSHDPTRFRFTHETSFVRQH  249

Query  974   TSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDD  1153
              + + + P  FY   FFRQFFRSVR+ADY A+RH F++VHLAPGSKFDFQKYIKRSLEDD
Sbjct  250   MNVLNKFPASFYISNFFRQFFRSVRQADYCALRHSFVNVHLAPGSKFDFQKYIKRSLEDD  309

Query  1154  FKVVVGINLMLWCA  1195
             FKV+VGI+  LW +
Sbjct  310   FKVIVGISPPLWAS  323



>emb|CDY37702.1| BnaA04g19660D [Brassica napus]
Length=440

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 214/300 (71%), Gaps = 25/300 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HK+G  FE+KKK+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIILELMIHKVGSVFEKKKKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    GN M  C  +D              PSG+  +    + +
Sbjct  75    ISLLLTFGQNYIASLCVASKYGNAMSFCGPYD-------------GPSGDTKK--VKDTD  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +         R LL   RRVL+G A  ECK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HMQ---------RHLLSLHRRVLAGGAPAECKKGYVPLISLNALHQVHIFIFFLAVFHVI  170

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  +DPSR+RLT ETSFV+E+ +   +    FY
Sbjct  171   YSAITMMLGRAKIRGWKVWEEEVVNDHEMMDDPSRFRLTHETSFVREHVNTWARNRFSFY  230

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CF RQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  231   VMCFLRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPALW  290



>ref|XP_006599251.1| PREDICTED: MLO-like protein 8-like [Glycine max]
Length=576

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 212/304 (70%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LDQTPTWAVA VC V ++IS+ LEK LHK+G     K K+AL+EALEK+K ELMVLGF
Sbjct  34    KDLDQTPTWAVACVCTVFILISITLEKSLHKVGTWLREKHKKALLEALEKVKAELMVLGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSYI +ICIP    + +LPC           P  G H   G  GE       
Sbjct  94    LSLLLTFGQSYIVRICIPADVADKLLPC-----------PYVGTH--KGSSGEE------  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      EH R+LL   RR LS  A   +CKE   PL+S NGLHQLHI IFFLAV HV
Sbjct  135   ---------EHRRKLLSYERRYLSDDATPYQCKERHQPLLSGNGLHQLHILIFFLAVLHV  185

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              Y A+TM LGR+KIRGWK WE  T+    E ANDPSR+RLT ETSFV+ + SF T+  + 
Sbjct  186   FYSAVTMLLGRLKIRGWKAWEAETSSHGYEFANDPSRFRLTHETSFVRAHASFWTRYSIF  245

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV +ADYLA+R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  246   FYIGCFFRQFYRSVGKADYLALRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPV  305

Query  1184  LWCA  1195
             LW +
Sbjct  306   LWAS  309



>ref|XP_010514988.1| PREDICTED: MLO-like protein 8 [Camelina sativa]
Length=598

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 214/306 (70%), Gaps = 31/306 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC   +V+S++LEK+LHK+G     + K AL++ALEKIK ELMVLGF
Sbjct  40    RELNQTPTWAVAAVCTFFIVVSVLLEKVLHKVGKVLWDRHKTALLDALEKIKSELMVLGF  99

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI +ICIP     TMLPC          AP H +                
Sbjct  100   ISLLLTFGQSYILRICIPSHVARTMLPC---------PAPKHLK----------------  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG--HAVEECK-EGLIPLISLNGLHQLHIFIFFLAVF  823
              +E  +  GE HRRLLW   RVLSG   +V +CK EG   LIS   LHQLHI IFFLA+F
Sbjct  135   -KEEDDDNGESHRRLLWVAHRVLSGGEASVTKCKKEGHEELISAQALHQLHILIFFLAIF  193

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P
Sbjct  194   HVMYSFLTMMLGRLKIRGWKHWEKETSSHNYEFSTDTSRFRLTHETSFVRAHTSFWTRIP  253

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             + FY  CFFRQFFRSV + DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFKVVVG++
Sbjct  254   IFFYIGCFFRQFFRSVGKTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKVVVGVS  313

Query  1178  LMLWCA  1195
              +LW +
Sbjct  314   PVLWVS  319



>ref|XP_010469445.1| PREDICTED: MLO-like protein 5 [Camelina sativa]
Length=501

 Score =   318 bits (816),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 209/301 (69%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F  ++K+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    G+ M  C  +D              PSG++ +  P   E
Sbjct  75    ISLLLTFGQNYIASLCVASRYGHAMSFCGPYD-------------GPSGDYKK--PKSTE  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +                RRVL+  A  ECK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HLQ----------------RRVLADAAPAECKKGYVPLISLNALHQVHIFIFFLAVFHVI  163

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  164   YSAITMMLGRAKIRGWKVWEEEVIHEHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI   LW
Sbjct  224   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGIRPELW  283

Query  1190  C  1192
              
Sbjct  284   A  284



>ref|XP_009386660.1| PREDICTED: MLO-like protein 9 [Musa acuminata subsp. malaccensis]
Length=563

 Score =   320 bits (820),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 213/311 (68%), Gaps = 38/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VI+VIS++LEK LH++G  F  ++K+AL EALEK+K ELM+LGF
Sbjct  11    RALDQTPTWAVASVCAVIIVISIVLEKGLHRLGEWFTARRKKALFEALEKVKAELMILGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIPE A +TMLPC +                             +
Sbjct  71    ISLLLTFGQNYIIKICIPEKAADTMLPCRL----------------------------KQ  102

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS--------GHAVEECKEGLIPLISLNGLHQLHIFIF  808
              +   E   EHHRRLL    R +S           V  C EG + LISLNGLHQLH+FIF
Sbjct  103   EEVETEEDEEHHRRLLLGAYREMSLKHRILTEDSQVSGCSEGKVSLISLNGLHQLHVFIF  162

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSF  982
             FLAVFHV Y A+ MALGR KIR WKEWE  T+    E + DPSR+R ++ETSFV+ +TSF
Sbjct  163   FLAVFHVTYSALIMALGRAKIRRWKEWEKETSSLHYEFSYDPSRFRFSRETSFVRRHTSF  222

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
               + P+  Y V FF QFF+SVRR DY AMRHGFI+VHL+PGSKF+FQKYIKRSLEDDFKV
Sbjct  223   WNRIPISLYIVSFFSQFFQSVRRTDYWAMRHGFITVHLSPGSKFNFQKYIKRSLEDDFKV  282

Query  1163  VVGINLMLWCA  1195
             VVGI+ +LW +
Sbjct  283   VVGISPVLWAS  293



>ref|XP_002310695.2| MLO-like protein 8 [Populus trichocarpa]
 gb|EEE91145.2| MLO-like protein 8 [Populus trichocarpa]
Length=577

 Score =   320 bits (820),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 214/314 (68%), Gaps = 28/314 (9%)
 Frame = +2

Query  263   KMSgggggkgRELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEK  442
             K +       R+LDQTPTWAVA VC VI++IS++LEK LHK+G  F  K K+AL EALEK
Sbjct  19    KAATESSATTRKLDQTPTWAVASVCAVIIIISILLEKFLHKVGTWFTEKHKQALFEALEK  78

Query  443   IKGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGE  622
             +K ELM+LGFISLLLTFGQ  IAKIC+P+    TMLPC       + Q       +  GE
Sbjct  79    VKAELMILGFISLLLTFGQYNIAKICVPQDVAGTMLPC-------KKQGVTDKSSSTKGE  131

Query  623   HGEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHI  799
                        +EP        RRLLW  RR L+G     +CK+G   LIS++GLHQLHI
Sbjct  132   -----------EEPG-------RRLLWFDRRFLAGAKGAVKCKDGYEQLISVDGLHQLHI  173

Query  800   FIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKEN  973
              IFFLA FHV++  ITM LGR+K R WK WE+ T     E +NDPSR+RLT +TSFV+ +
Sbjct  174   LIFFLACFHVLFSVITMTLGRLKTRAWKRWELETLSHDYEFSNDPSRFRLTHQTSFVRSH  233

Query  974   TSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDD  1153
             TSF T+ P  FY  CF RQFF SV R+DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDD
Sbjct  234   TSFWTRIPFFFYVGCFIRQFFISVSRSDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDD  293

Query  1154  FKVVVGINLMLWCA  1195
             FK+VVG++ +LW +
Sbjct  294   FKLVVGVSPVLWAS  307



>ref|XP_009141335.1| PREDICTED: MLO-like protein 5 [Brassica rapa]
Length=504

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 214/301 (71%), Gaps = 25/301 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HK+G  FE+KKK+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIILELMIHKVGSVFEKKKKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    GN M  C  +D              PSG+  +    + +
Sbjct  75    ISLLLTFGQNYIASLCVASKYGNAMSFCGPYD-------------GPSGDTKK--VKDTD  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +         R LL   RRVL+G A  ECK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HMQ---------RHLLSLHRRVLAGGAPAECKKGYVPLISLNALHQVHIFIFFLAVFHVI  170

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  +DPSR+RLT ETSFV+E+ +   +    FY
Sbjct  171   YSAITMMLGRAKIRGWKVWEEEVVNDHEMMDDPSRFRLTHETSFVREHVNTWARNRFSFY  230

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CF RQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  231   VMCFLRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPALW  290

Query  1190  C  1192
              
Sbjct  291   A  291



>ref|XP_003534232.1| PREDICTED: MLO-like protein 10-like isoform X1 [Glycine max]
 gb|KHN38857.1| MLO-like protein 8 [Glycine soja]
Length=577

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 211/304 (69%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LDQTPTWAVA VC V ++IS+ LEK LHK+G     K K+AL+EALEK+K ELMVLGF
Sbjct  34    KDLDQTPTWAVAGVCTVFILISITLEKSLHKVGTWLREKHKKALLEALEKVKAELMVLGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSYI +ICIP    + +LPC                            P   
Sbjct  94    LSLLLTFGQSYIVRICIPMDVADKLLPC----------------------------PYVG  125

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             + + + +  EH R+LL   RR LS  A   +CKE   PLIS NGLHQLHI +FFLAV HV
Sbjct  126   NDKGSSSEEEHRRKLLSYERRYLSDDATPYQCKERHQPLISGNGLHQLHILVFFLAVLHV  185

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              Y AITM LGR+KIRGWK WE  T+    E ANDPSR+RLT ETSFVK + SF T+  + 
Sbjct  186   FYSAITMLLGRLKIRGWKAWEAETSSHGYEFANDPSRFRLTHETSFVKAHASFWTRYSIF  245

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV +ADYLA+R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  246   FYIGCFFRQFYRSVGKADYLALRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPV  305

Query  1184  LWCA  1195
             LW +
Sbjct  306   LWAS  309



>gb|EPS67078.1| hypothetical protein M569_07698, partial [Genlisea aurea]
Length=296

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 207/303 (68%), Gaps = 34/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QT TWAVA VC +I++ISL LEK LHK+G     + K+AL EAL+KIK ELM+LGF
Sbjct  1     RNLEQTSTWAVAGVCAIIILISLALEKGLHKLGEWMTERHKKALHEALDKIKDELMILGF  60

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+L F Q YIA ICIPE+ GNTMLPC +      H                       
Sbjct  61    ISLILVFSQYYIASICIPESVGNTMLPCSLSSAVNTHAV---------------------  99

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                        HRRLL   RR L+  +   C +G +PL+S++GLHQ+HI IFFLAV H+ 
Sbjct  100   -----------HRRLLSYERRFLAAASEPTCPQGQVPLVSVDGLHQIHILIFFLAVLHLT  148

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y A+TM  GR+K++GWK+WE  T  +  E +NDPSR+RL+ ETSFV+ +TSF T+ PV F
Sbjct  149   YSALTMLFGRLKMKGWKQWEQETGSNDYEFSNDPSRFRLSHETSFVRAHTSFWTRIPVFF  208

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV +ADY+ +R+GFI+VHLAPGSKFDFQKYI+RSLEDD+K VVG++ +L
Sbjct  209   YIGCFFRQFFRSVSKADYVTLRNGFIAVHLAPGSKFDFQKYIQRSLEDDYKTVVGVSPVL  268

Query  1187  WCA  1195
             W A
Sbjct  269   WGA  271



>ref|XP_003537693.1| PREDICTED: MLO-like protein 8-like [Glycine max]
 gb|KHN41804.1| MLO-like protein 8 [Glycine soja]
Length=600

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 213/305 (70%), Gaps = 32/305 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V ++IS+ LEK LHK+G    +K K AL+EALEK+K ELM+LGF
Sbjct  35    RDLDQTPTWAVAAVCTVFILISIALEKSLHKVGTWLVQKHKTALLEALEKVKAELMILGF  94

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI +ICIPE   + MLPC                            P  E
Sbjct  95    ISLLLTFGQSYIVRICIPEKLADIMLPC----------------------------PYKE  126

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-EC-KEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++ +++  EH R+LL   RR L+      +C +EG  PL+S+NGLHQLHI IFFLAV H
Sbjct  127   AKKASDSEEEHRRKLLSYERRYLAADTASFKCSREGHEPLLSVNGLHQLHILIFFLAVIH  186

Query  827   VIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V Y AITM LGR+KIRGWK WE  T+    E AN  SR+R T ETSFV+ +TSF+T+ P+
Sbjct  187   VFYSAITMMLGRLKIRGWKAWEAETSTHNYEFANAASRFRFTHETSFVRAHTSFLTRIPI  246

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQF+RSV + DYL +R+GFI+VHLAPGSK++FQK+IKRSLEDDFKVVVG++ 
Sbjct  247   FFYIRCFFRQFYRSVNKTDYLTLRNGFITVHLAPGSKYNFQKFIKRSLEDDFKVVVGVSP  306

Query  1181  MLWCA  1195
             +LW +
Sbjct  307   ILWAS  311



>ref|XP_002893934.1| hypothetical protein ARALYDRAFT_473744 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70193.1| hypothetical protein ARALYDRAFT_473744 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 208/301 (69%), Gaps = 25/301 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  FERKKK+AL EALEKIK ELMVLGF
Sbjct  15    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C                       G +  P ++
Sbjct  75    ISLLLTFGQNYIASICVPSRYGHAMSFC-----------------------GPYDGPSED  111

Query  653   HQEPAEAGGEHHRRLLWSM-RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H +      +H  R+L S+ RR L+      CK+  + LISLN LHQ+HIFIFFLAVFHV
Sbjct  112   HDDKKLKKTDHAMRILSSIQRRSLADAPPVNCKKDYVALISLNALHQIHIFIFFLAVFHV  171

Query  830   IYGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        F
Sbjct  172   IYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFF  231

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   L
Sbjct  232   YVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPEL  291

Query  1187  W  1189
             W
Sbjct  292   W  292



>gb|AFW69614.1| hypothetical protein ZEAMMB73_948296 [Zea mays]
Length=595

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 222/314 (71%), Gaps = 14/314 (4%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEH----AP  640
             ISLLL FGQ+YI K+CI   A NTMLPC +    VE +  GHG+ A +   G+     A 
Sbjct  71    ISLLLVFGQNYIIKVCISNHAANTMLPCKLEAAAVEGK-DGHGKEAAAVVAGKKKVAVAV  129

Query  641   PEDEHQEPAEAGGEHHRRLLW-------SMRRVLSGHAVEECKEGLIPLISLNGLHQLHI  799
             P  + ++ A A       + W       + R +       +C EG +PLIS+N LHQLHI
Sbjct  130   PGKKKKKAAAAADHLGGVVDWPPPYYAHNARMLAEASMATKCPEGKVPLISINALHQLHI  189

Query  800   FIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSFVKEN  973
             FIFFLAVFHV Y AITMALGR KIR WKEWE  A  QD E ++DP+R+R T ETSFV+++
Sbjct  190   FIFFLAVFHVSYSAITMALGRAKIRAWKEWEKEAAGQDYEFSHDPTRFRFTHETSFVRQH  249

Query  974   TSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDD  1153
              + + + P  FY   FFRQFFRSVR+ADY A+RH F++VHLAPGSKFDFQKYIKRSLEDD
Sbjct  250   MNVLNKFPASFYISNFFRQFFRSVRQADYCALRHSFVNVHLAPGSKFDFQKYIKRSLEDD  309

Query  1154  FKVVVGINLMLWCA  1195
             FKV+VGI+  LW +
Sbjct  310   FKVIVGISPPLWAS  323



>ref|XP_006303812.1| hypothetical protein CARUB_v10012285mg [Capsella rubella]
 gb|EOA36710.1| hypothetical protein CARUB_v10012285mg [Capsella rubella]
Length=459

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 209/300 (70%), Gaps = 25/300 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  FER+KK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERRKKKALFEALEKIKNELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P + G+ M  C                       G +  P D+
Sbjct  74    ISLLLTFGQNYIASICVPSSYGHAMSFC-----------------------GPYDGPSDD  110

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             + +  +   +H  R+L   RR L+      CK+G + LISLN LHQ+HIFIFFLAVFHVI
Sbjct  111   NDKKLKKT-DHAMRILSVQRRSLADAPPVNCKKGYVALISLNALHQVHIFIFFLAVFHVI  169

Query  833   YGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        FY
Sbjct  170   YSAITMMLGRAKIRGWKVWEQEIIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFY  229

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   LW
Sbjct  230   VMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELW  289



>ref|XP_006299646.1| hypothetical protein CARUB_v10015833mg [Capsella rubella]
 gb|EOA32544.1| hypothetical protein CARUB_v10015833mg [Capsella rubella]
Length=596

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 214/304 (70%), Gaps = 32/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC   +V+S++LEKLLHK+G     + KRAL++ALEKIK ELMVLGF
Sbjct  39    RELNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKRALLDALEKIKSELMVLGF  98

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI +ICIP     +MLPC          AP H +             ED+
Sbjct  99    ISLLLTFGQSYILEICIPANVARSMLPC---------SAPKHLKKE-----------EDD  138

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAV-EECK-EGLIPLISLNGLHQLHIFIFFLAVF  823
             +       GE HRRLLW   R LS G A   +CK EG   LIS   LHQLHI IFFLA+F
Sbjct  139   N-------GESHRRLLWFDHRFLSEGEASPTKCKKEGYEELISAQALHQLHILIFFLAIF  191

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE+ T+    E + D SR+RLT ETSFV+ +TSF T+ P
Sbjct  192   HVLYSFLTMMLGRLKIRGWKHWEIETSSHNYEFSTDTSRFRLTHETSFVRAHTSFWTRIP  251

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             V FY  CFFRQFFRSV R DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFKVVVG++
Sbjct  252   VFFYIGCFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKVVVGVS  311

Query  1178  LMLW  1189
              +LW
Sbjct  312   PVLW  315



>ref|XP_002879463.1| hypothetical protein ARALYDRAFT_482315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55722.1| hypothetical protein ARALYDRAFT_482315 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 209/301 (69%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F +++K+AL EAL+KIK ELMVLGF
Sbjct  16    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTKRRKKALYEALQKIKNELMVLGF  75

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    G+ M  C                       G +  P  E
Sbjct  76    ISLLLTFGQNYIASLCVATRYGHAMSFC-----------------------GPYDGPSGE  112

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              ++P      HH +     RRVL+  A  +CK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  113   SKKPKTT---HHLQ-----RRVLADAAPTQCKKGYVPLISLNALHQVHIFIFFLAVFHVI  164

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     D E  +DPSR+RLT ETSFV+E+ +   +    FY
Sbjct  165   YSAITMMLGRAKIRGWKVWEEEVINDHEMMDDPSRFRLTHETSFVREHVNPWAKNRFSFY  224

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  225   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGISPELW  284

Query  1190  C  1192
              
Sbjct  285   A  285



>ref|XP_008647383.1| PREDICTED: uncharacterized protein LOC100193407 isoform X1 [Zea 
mays]
 gb|ACL53412.1| unknown [Zea mays]
 gb|AFW75703.1| hypothetical protein ZEAMMB73_458768 [Zea mays]
Length=486

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 208/303 (69%), Gaps = 18/303 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  10    RELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL FGQ+YI K+CI   A NTMLPC + +  V  +          G   +  PP   
Sbjct  70    ISLLLVFGQNYIVKVCISNHAANTMLPCKLKEAAVPGKKKAAAAAEHLGGVLDWPPPYYA  129

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H                  R +       +C EG + LIS+N LHQLHIFIFFLAVFHV 
Sbjct  130   HNG----------------RMLAEASMATKCPEGKVSLISINALHQLHIFIFFLAVFHVS  173

Query  833   YGAITMALGRMKIRGWKEWEM-ATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITMALGR KIR WKEWE  A  QD E +NDP+R+R T ETSFV+++ + + + P  F
Sbjct  174   YSAITMALGRAKIRAWKEWEKEAAGQDYEFSNDPTRFRFTHETSFVRQHMNVLNKFPASF  233

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y   FFRQFFRSVRRADY A+RH F++VHLAPG+KFDFQKYIKRSLEDDFKV+VGI+  L
Sbjct  234   YISNFFRQFFRSVRRADYCALRHSFVNVHLAPGTKFDFQKYIKRSLEDDFKVIVGISPPL  293

Query  1187  WCA  1195
             W +
Sbjct  294   WAS  296



>gb|EPS58714.1| hypothetical protein M569_16096, partial [Genlisea aurea]
Length=373

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 209/303 (69%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QT TWAVA VC VI++ISL+LEK LHK+G  F  K +++L EALEKIK ELM+LGF
Sbjct  12    RNLEQTATWAVAGVCAVIILISLVLEKGLHKLGQYFTEKHRKSLTEALEKIKAELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+L F Q YIA ICIP    +TMLPC +         PG  +                
Sbjct  72    ISLILVFSQYYIASICIPVRVADTMLPCSLR--------PGGNKL---------------  108

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                     G+ HRRL    RR L+      C +G + L+S++GLHQ+HI IFFLAV H+I
Sbjct  109   --------GKFHRRLFSYERRFLAAAKEPICPQGRVALVSIDGLHQIHILIFFLAVVHLI  160

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KI+GWK+WE+ TA    E +NDPSR+RL+ ETSFVK +TSF T+ PV F
Sbjct  161   YSAITMLLGRLKIKGWKQWELETASHDYEFSNDPSRFRLSHETSFVKAHTSFWTRIPVFF  220

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQF RSV ++DYL +R+GFISVHLAPGS F+FQKYIKRSLEDD+K VVG++ +L
Sbjct  221   YIGCFFRQFVRSVSKSDYLTLRNGFISVHLAPGSNFNFQKYIKRSLEDDYKTVVGVSPVL  280

Query  1187  WCA  1195
             WC+
Sbjct  281   WCS  283



>ref|XP_011014773.1| PREDICTED: MLO-like protein 10 isoform X1 [Populus euphratica]
Length=579

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 215/314 (68%), Gaps = 28/314 (9%)
 Frame = +2

Query  263   KMSgggggkgRELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEK  442
             K +       R+LDQTPTWAVA +C VI++IS++LEK LHK+G  F  K K+AL EALEK
Sbjct  19    KAATESSATTRKLDQTPTWAVASICAVIIIISILLEKFLHKVGTWFTEKHKQALFEALEK  78

Query  443   IKGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGE  622
             +K ELM+LGFISLLLTFGQ +IAKIC+P+    TMLPC    E V  ++        S  
Sbjct  79    VKAELMILGFISLLLTFGQYHIAKICVPQDVVGTMLPC--KKEGVTDKS--------SST  128

Query  623   HGEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHI  799
              GE  P                RRLLW  RR L+G  +   CK+G   LIS++GLHQLHI
Sbjct  129   KGEEEP---------------RRRLLWFDRRFLAGAKSAVNCKDGYEQLISVDGLHQLHI  173

Query  800   FIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKEN  973
              IFFLA FHV++  ITM LGR+K R WK WE+ T     E +NDPSR+RLT ETSFV+ +
Sbjct  174   LIFFLACFHVLFSVITMTLGRLKTRAWKRWELETLSHDYEFSNDPSRFRLTHETSFVRSH  233

Query  974   TSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDD  1153
             TSF T+ P  FY  CF RQFF SV R+DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDD
Sbjct  234   TSFWTRIPFFFYVGCFIRQFFISVSRSDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDD  293

Query  1154  FKVVVGINLMLWCA  1195
             FK+VVG++ +LW +
Sbjct  294   FKIVVGVSPVLWAS  307



>gb|KHN12501.1| MLO-like protein 8 [Glycine soja]
Length=576

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 211/304 (69%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LDQTPTWAVA VC V ++IS+ LEK LHK+G     K K+AL+EALEK+K ELMVLGF
Sbjct  34    KDLDQTPTWAVACVCTVFILISITLEKSLHKVGTWLREKHKKALLEALEKVKAELMVLGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSYI +ICIP    + +LPC           P  G H   G  GE       
Sbjct  94    LSLLLTFGQSYIVRICIPADVADKLLPC-----------PYVGTH--KGSSGEE------  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      EH R+LL   RR LS  A   +CKE   PL+S NGLHQLHI IFFLAV HV
Sbjct  135   ---------EHRRKLLSYERRYLSDDATPYQCKERHQPLLSGNGLHQLHILIFFLAVLHV  185

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              Y A+TM LGR+KIRGWK WE  T+    E ANDPSR+RLT ETSFV+ + SF T+  + 
Sbjct  186   FYSAVTMLLGRLKIRGWKAWEAETSSHGYEFANDPSRFRLTHETSFVRAHASFWTRYSIF  245

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV +ADYLA+ +GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +
Sbjct  246   FYIGCFFRQFYRSVGKADYLALHNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPV  305

Query  1184  LWCA  1195
             LW +
Sbjct  306   LWAS  309



>ref|XP_007156260.1| hypothetical protein PHAVU_003G271300g [Phaseolus vulgaris]
 gb|ESW28254.1| hypothetical protein PHAVU_003G271300g [Phaseolus vulgaris]
Length=577

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 214/305 (70%), Gaps = 32/305 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++LDQTPTWAVA VC V ++ISL LEK LHK+G   + K K+AL+EALEK+K ELM+LGF
Sbjct  34    KDLDQTPTWAVACVCTVFILISLTLEKSLHKVGTWLQEKHKKALLEALEKVKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLTFGQSYI +ICIP    + +LPC +                  G   E +  E  
Sbjct  94    LSLLLTFGQSYIVRICIPTDVADKLLPCPL-----------------VGTDRESSSEE--  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGL-IPLISLNGLHQLHIFIFFLAVFH  826
                      EH R+LL   RR LS  A   +CK+G   PLIS+NGLHQLHI IFFLAV H
Sbjct  135   ---------EHRRKLLSYERRYLSDDATPYQCKKGDHQPLISVNGLHQLHILIFFLAVLH  185

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V Y AITM LGR+KIRGWK WE  T+    E ANDPSR+RLT ETSFV+ + SF T+  +
Sbjct  186   VFYSAITMLLGRLKIRGWKAWEEETSSHGYEFANDPSRFRLTHETSFVRAHASFWTRYSI  245

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQF+RSV +ADYLA+R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ 
Sbjct  246   FFYIGCFFRQFYRSVGKADYLALRNGFITVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSP  305

Query  1181  MLWCA  1195
             +LW +
Sbjct  306   VLWAS  310



>ref|XP_010033601.1| PREDICTED: MLO-like protein 8 [Eucalyptus grandis]
 gb|KCW53294.1| hypothetical protein EUGRSUZ_J02551 [Eucalyptus grandis]
Length=556

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 209/304 (69%), Gaps = 35/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS+ LEKLLHK+G    ++ K AL EALEKIK ELM+LGF
Sbjct  11    RELDQTPTWAVAGVCAIIIMISIALEKLLHKVGTWLTQRHKNALYEALEKIKNELMILGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIAKICIP +   TMLPC                                
Sbjct  71    ISLLLTFGQSYIAKICIPTSVAETMLPC-------------------------------T  99

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                 +    E  RRLLW+ RR L+ G     C  G  PLIS+NGLHQLHI IFFLA FHV
Sbjct  100   KSSTSTTTEERRRRLLWNERRSLAAGSYATNCSSG-TPLISVNGLHQLHILIFFLAFFHV  158

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A+TM LGR+KIRGWK+WE  T+    E + DPSR+RLT ETSFV+ ++SF T+ P  
Sbjct  159   LYSAVTMMLGRLKIRGWKQWEQETSSHDYEFSTDPSRFRLTHETSFVRVHSSFWTRIPFF  218

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV + DYL +R+GFI+VH+APGSKF+FQKYIKRSLEDDFK VVG++ +
Sbjct  219   FYVGCFFRQFFRSVHKTDYLTLRNGFIAVHIAPGSKFNFQKYIKRSLEDDFKFVVGVSPV  278

Query  1184  LWCA  1195
             LW +
Sbjct  279   LWAS  282



>ref|XP_010413828.1| PREDICTED: MLO-like protein 5 [Camelina sativa]
Length=502

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 209/301 (69%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F  ++K+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    G+ M  C  +D              PSG++ +  P   +
Sbjct  75    ISLLLTFGQNYIASLCVASRYGHAMSFCGPYD-------------GPSGDYKK--PKTTD  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +                RRVL+  +  ECK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HLQ----------------RRVLADASPAECKKGYVPLISLNALHQVHIFIFFLAVFHVI  163

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  164   YSAITMMLGRAKIRGWKVWEEEVIHEHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI   LW
Sbjct  224   VMCFFRQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGIRPELW  283

Query  1190  C  1192
              
Sbjct  284   A  284



>ref|NP_174980.3| MLO-like protein 9 [Arabidopsis thaliana]
 sp|Q94KB4.2|MLO9_ARATH RecName: Full=MLO-like protein 9; Short=AtMlo9 [Arabidopsis thaliana]
 gb|AEE31927.1| MLO-like protein 9 [Arabidopsis thaliana]
Length=460

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 211/301 (70%), Gaps = 26/301 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  FERKKK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C  +D                       P ED+
Sbjct  74    ISLLLTFGQNYIASICVPSRYGHAMSFCGPYD----------------------GPSEDD  111

Query  653   HQEPAEAGGEHHRRLLWSM-RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              ++  +   +H  R+L+S+ RR L+      CK+  + LISLN LHQ+HIFIFFLAVFHV
Sbjct  112   RKKLKKT--DHAMRILYSVQRRSLADAPPVNCKKDYVALISLNALHQVHIFIFFLAVFHV  169

Query  830   IYGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        F
Sbjct  170   IYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFF  229

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   L
Sbjct  230   YVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPEL  289

Query  1187  W  1189
             W
Sbjct  290   W  290



>ref|XP_010270524.1| PREDICTED: MLO-like protein 9 [Nelumbo nucifera]
Length=561

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 212/304 (70%), Gaps = 35/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VI++IS++LEK+LH++G  F  ++K AL EALEK+K ELMVLGF
Sbjct  12    RELDQTPTWAVAAVCAVIIIISIVLEKVLHRLGEWFTERRKNALFEALEKVKAELMVLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTF QSYI KICIPE     MLPC                                
Sbjct  72    ISLLLTFCQSYIVKICIPEKITRKMLPC--------------------------------  99

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                P+    E HRRLLW+ RR LS      +CKEG  PLISLNGLHQLHIFIFFLAVFHV
Sbjct  100   PYRPSNTEEEDHRRLLWNERRFLSTASKASKCKEGYEPLISLNGLHQLHIFIFFLAVFHV  159

Query  830   IYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A TM LGR+KIRGWK WE  T     E   DPSR+RLT ETSFV+ +T+F T+ P  
Sbjct  160   LYSATTMMLGRLKIRGWKAWERETQSLNYEFHYDPSRFRLTHETSFVRAHTNFWTRIPFF  219

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             F  VCFFR FFRSVR+ADYL +RHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +
Sbjct  220   FVFVCFFRHFFRSVRKADYLTLRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPL  279

Query  1184  LWCA  1195
             LW +
Sbjct  280   LWAS  283



>ref|XP_010467520.1| PREDICTED: MLO-like protein 8 [Camelina sativa]
Length=598

 Score =   318 bits (816),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 213/304 (70%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L+QTPTWAVA VC   +V+S++LEK+LHK+G     + K AL++ALEKIK ELMVLGF
Sbjct  40    RQLNQTPTWAVAAVCTFFIVVSVLLEKVLHKVGKVLWDRHKTALLDALEKIKSELMVLGF  99

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI  ICIP    +TMLPC           PG               P+  
Sbjct  100   ISLLLTFGQSYILAICIPSHVAHTMLPC-----------PG---------------PKHL  133

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG--HAVEECK-EGLIPLISLNGLHQLHIFIFFLAVF  823
              +E  +  GE HRRLLW   RVLSG   + ++CK EG   LIS   LHQLHI IFFLA+F
Sbjct  134   KKEEDDDNGESHRRLLWFAHRVLSGGEASPKKCKKEGHEELISAEALHQLHILIFFLAIF  193

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P
Sbjct  194   HVMYSFLTMMLGRLKIRGWKHWEKETSSHNYEFSTDTSRFRLTHETSFVRAHTSFWTRIP  253

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             + FY  CFFRQFFRSV + DYL +R+GFISVHLAPGS+F+FQKYIKRSLEDDFKVVVG++
Sbjct  254   IFFYIGCFFRQFFRSVGKTDYLTLRNGFISVHLAPGSQFNFQKYIKRSLEDDFKVVVGVS  313

Query  1178  LMLW  1189
              +LW
Sbjct  314   PVLW  317



>ref|XP_010906858.1| PREDICTED: MLO-like protein 10 [Elaeis guineensis]
Length=437

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 211/303 (70%), Gaps = 34/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQT TWA+A VC VI++ISL+LEK LH +G    +K K AL EALEK+K ELM+LGF
Sbjct  10    RDLDQTSTWAIAAVCAVIILISLLLEKGLHHLGEWLTKKHKMALFEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ++I K+CIPE A +TMLPC +  E +            + E GE       
Sbjct  70    ISLLLTLGQNWIVKVCIPEKAASTMLPCRLEKEEL------------AAERGER------  111

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                    G  ++ +L  ++  +          +G +PL+SLN LHQLHIF+FFLAVFHV 
Sbjct  112   -----NHGLGYYSKLPSNLLSI---------SKGKVPLVSLNALHQLHIFVFFLAVFHVA  157

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITMALGR KIR WKEWE  T+    E +NDPSR+R   ETSFVK++TSF  + P+L 
Sbjct  158   YSAITMALGRAKIRRWKEWEKETSSTYYEFSNDPSRFRFAHETSFVKQHTSFWNRIPILL  217

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y V FFRQFFRSVR+ DYLAMRHGFI+VHLAPGS+F+FQKYIKRSLEDDFKVVVGI+  L
Sbjct  218   YIVSFFRQFFRSVRKTDYLAMRHGFINVHLAPGSRFNFQKYIKRSLEDDFKVVVGISPHL  277

Query  1187  WCA  1195
             W +
Sbjct  278   WTS  280



>ref|XP_010509851.1| PREDICTED: MLO-like protein 5 [Camelina sativa]
Length=497

 Score =   315 bits (807),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 208/301 (69%), Gaps = 32/301 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE ++HKIG  F  ++K+AL EAL+KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYEALQKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA +C+    G+ M  C  +D              PSG++ +  P   +
Sbjct  75    ISLLLTFGQNYIASLCVASRYGHAMSFCGPYD-------------GPSGDYKK--PKSTD  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +                RRVL+  A  ECK+G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  120   HLQ----------------RRVLADAAPAECKKGYVPLISLNALHQVHIFIFFLAVFHVI  163

Query  833   YGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  164   YSAITMMLGRAKIRGWKVWEEEVIHEHEMMNDPSRFRLTHETSFVREHVNPWAKNRFSFY  223

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFF Q  RSVR++DYL MRHGFISVHLAPG KF+FQKYIKRSLEDDFKVVVGI   LW
Sbjct  224   VICFFHQMLRSVRKSDYLTMRHGFISVHLAPGMKFNFQKYIKRSLEDDFKVVVGIRPELW  283

Query  1190  C  1192
              
Sbjct  284   A  284



>gb|AAG51314.1|AC025815_1 Mlo-like protein [Arabidopsis thaliana]
Length=467

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 211/301 (70%), Gaps = 26/301 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  FERKKK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C  +D                       P ED+
Sbjct  74    ISLLLTFGQNYIASICVPSRYGHAMSFCGPYD----------------------GPSEDD  111

Query  653   HQEPAEAGGEHHRRLLWSM-RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              ++  +   +H  R+L+S+ RR L+      CK+  + LISLN LHQ+HIFIFFLAVFHV
Sbjct  112   RKKLKKT--DHAMRILYSVQRRSLADAPPVNCKKDYVALISLNALHQVHIFIFFLAVFHV  169

Query  830   IYGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        F
Sbjct  170   IYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFF  229

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   L
Sbjct  230   YVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPEL  289

Query  1187  W  1189
             W
Sbjct  290   W  290



>ref|XP_002307201.1| hypothetical protein POPTR_0005s10210g [Populus trichocarpa]
 gb|EEE94197.1| hypothetical protein POPTR_0005s10210g [Populus trichocarpa]
Length=579

 Score =   318 bits (814),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 215/304 (71%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA +C VI++IS++LEK+LHK+G  F  K K+AL EALEK+K ELM+LGF
Sbjct  30    RKLDQTPTWAVAGICAVIIIISILLEKILHKVGTWFTEKHKKALFEALEKVKAELMILGF  89

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIAKIC+P+    TMLPC                             ++ 
Sbjct  90    ISLLLTFGQSYIAKICVPQDVAGTMLPC----------------------------KKEG  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              ++ +   GEH R LLW  RR L+G  +  +CK+G   LIS+ GLHQLHI IFFLA+FHV
Sbjct  122   SEKSSSTEGEHRRALLWFDRRFLAGAESAVKCKDGYEQLISVEGLHQLHILIFFLAIFHV  181

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             ++  ITM LGR+K R WK WE+ T     E +NDPSR+RL  ETSFV+ +T+F ++ P  
Sbjct  182   LFSVITMTLGRLKSRAWKRWELETLSHDYEFSNDPSRFRLAHETSFVRAHTNFWSRVPFF  241

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             F+  CFF+QFF SV R+DYL +R+GFI+VHLAPGSKF+F+KY+KRSLEDDFK+VVG++ +
Sbjct  242   FHVGCFFQQFFSSVSRSDYLTLRNGFITVHLAPGSKFNFRKYLKRSLEDDFKLVVGVSPV  301

Query  1184  LWCA  1195
             LW +
Sbjct  302   LWAS  305



>gb|AGT16511.1| hypothetical protein SHCRBa_119_B13_R_20 [Saccharum hybrid cultivar 
R570]
Length=442

 Score =   313 bits (802),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 220/332 (66%), Gaps = 52/332 (16%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC VIV+IS++LEK LH +G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGVIVIISILLEKGLHHVGEFFSHRKKKAMVEALEKVKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL F Q+YI KICI   A NTMLPC +  + VE  A GHG                 
Sbjct  71    ISLLLVFCQNYIIKICISNHAANTMLPCKL--KAVE-AAAGHG-----------------  110

Query  653   HQEPAEAGG---------------------EHHRRLL-W-------SMRRVLSGHAVEEC  745
              +EPAEAGG                     EH   +L W       + R +   +   +C
Sbjct  111   -KEPAEAGGNKGHGKEAAAVPGKKKAAAAAEHLGGVLDWPPPYYAHNARMLGEANMKTKC  169

Query  746   KEGLIPLISLNGLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAA  919
              EG + LIS+NGLHQLHIFIFFLAVFHV Y AITMALGR KIR WK WE  A  QD E +
Sbjct  170   PEGKVSLISINGLHQLHIFIFFLAVFHVSYSAITMALGRAKIRAWKVWEKEAAGQDYEFS  229

Query  920   NDPSRYRLTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLA  1099
             NDP+R+R T ETSFV+ + + + + P  FY   FFRQFFRSVR+ADY A+RH F++VHLA
Sbjct  230   NDPTRFRFTHETSFVRNHMNVLNKFPASFYISNFFRQFFRSVRQADYSALRHSFVNVHLA  289

Query  1100  PGSKFDFQKYIKRSLEDDFKVVVGINLMLWCA  1195
             PGSKFDFQKYIKRSLEDDFKV+VGI+  LW +
Sbjct  290   PGSKFDFQKYIKRSLEDDFKVIVGISPPLWAS  321



>ref|XP_010489376.1| PREDICTED: MLO-like protein 8 [Camelina sativa]
Length=599

 Score =   318 bits (814),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 212/306 (69%), Gaps = 31/306 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL+QTPTWAVA VC   +V+S++LEK+LHK+G     + K AL++ALEKIK ELMVLGF
Sbjct  41    RELNQTPTWAVAAVCTFFIVVSVLLEKVLHKVGKVLWDRHKTALLDALEKIKSELMVLGF  100

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI  ICIP     TMLPC          AP H +                
Sbjct  101   ISLLLTFGQSYILTICIPSHVARTMLPC---------PAPKHLK----------------  135

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG--HAVEECK-EGLIPLISLNGLHQLHIFIFFLAVF  823
              +E  +  GE HRRLLW   RVLSG   +  +CK EG   LIS   LHQLHI IFFLA+F
Sbjct  136   -KEEDDDNGESHRRLLWVAHRVLSGGEASPTKCKKEGHEELISAEALHQLHILIFFLAIF  194

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P
Sbjct  195   HVMYSFLTMMLGRLKIRGWKHWEKETSSHNYEFSTDTSRFRLTHETSFVRAHTSFWTRIP  254

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             + FY  CFFRQFFRSV + DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFKVVVG++
Sbjct  255   IFFYIGCFFRQFFRSVGKTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKVVVGVS  314

Query  1178  LMLWCA  1195
              +LW +
Sbjct  315   PVLWVS  320



>ref|XP_006435412.1| hypothetical protein CICLE_v10000748mg [Citrus clementina]
 gb|ESR48652.1| hypothetical protein CICLE_v10000748mg [Citrus clementina]
 gb|KDO85192.1| hypothetical protein CISIN_1g042041mg [Citrus sinensis]
Length=554

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 216/310 (70%), Gaps = 37/310 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV++VC +IV +S +LE + H +   F ++ K A++EALEKIKGELM+LGF
Sbjct  12    RELDQTPTWAVSMVCGIIVALSFVLEGIFHLVAKIFHKRHKYAMLEALEKIKGELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA+ICIP    +TMLPC               E     +H         
Sbjct  72    ISLLLTFGQNYIAQICIPVEVADTMLPC-------------RKERLKKVKH---------  109

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE-CKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
               +  ++ G    R LW  +R+L+G A +  C +G +PLIS++GLHQLHIFIFFLAVFHV
Sbjct  110   --DLFDSRG----RALWYEQRLLAGEADDVGCHKGKVPLISVHGLHQLHIFIFFLAVFHV  163

Query  830   IYGAITMALGRMKIRGWKEWEMATAQDE--------AANDPSRYRLTKETSFVKENTSFM  985
              Y AITM LGR+KIR WK+WE  T  ++           D SR+RLT ETSFV+ +T+  
Sbjct  164   FYSAITMTLGRLKIRKWKQWERETESEQHMVNGIWLDVCDSSRFRLTHETSFVRGHTNNW  223

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVV  1165
              ++P +FY +CFFRQFFRSVR+ADYL MRHGFI+VHLAPGSKFDFQKYIKRSLEDDFKVV
Sbjct  224   MKSPTIFYLICFFRQFFRSVRKADYLTMRHGFINVHLAPGSKFDFQKYIKRSLEDDFKVV  283

Query  1166  VGINLMLWCA  1195
             VGI+  LW +
Sbjct  284   VGISPPLWAS  293



>ref|XP_004509461.1| PREDICTED: MLO-like protein 10-like [Cicer arietinum]
Length=586

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 213/304 (70%), Gaps = 36/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA VC V ++IS+ LEK +HK+G     + K+AL+EALEK+K ELM+LGF
Sbjct  38    RDLDQTPTWAVACVCTVFILISITLEKSIHKVGTWLGERHKKALLEALEKVKAELMILGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI +ICIP    + +LPC                +  +G   E       
Sbjct  98    ISLLLTFGQSYIVRICIPANMADKLLPC---------------PYRHTGSKNEE------  136

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      EHHR+LL    R LS  A   +CKEG  PLIS+NGLHQLHI IFFLAV HV
Sbjct  137   ---------EHHRKLL---HRYLSEDATPYQCKEGHKPLISVNGLHQLHILIFFLAVLHV  184

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A+TM LGR+KIRGWK WE  T+    + ANDPSR+RLT ETSFV+++ +F T+ P+ 
Sbjct  185   LYSAVTMLLGRLKIRGWKAWEAETSSHGYDFANDPSRFRLTHETSFVRQHATFWTKIPIF  244

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQF+RSV +ADYL +R+GFI+VHL+ GSKF+FQKYIKRSLEDDFKVV+G++ +
Sbjct  245   FYISCFFRQFYRSVDKADYLTLRNGFITVHLSAGSKFNFQKYIKRSLEDDFKVVMGVSPV  304

Query  1184  LWCA  1195
             LW +
Sbjct  305   LWAS  308



>ref|XP_007158026.1| hypothetical protein PHAVU_002G117900g [Phaseolus vulgaris]
 gb|ESW30020.1| hypothetical protein PHAVU_002G117900g [Phaseolus vulgaris]
Length=604

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/305 (56%), Positives = 211/305 (69%), Gaps = 29/305 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             +ELDQTPTWAVA+VC V ++IS+ LEK LHK+G    +K+K+AL+EALEK+K ELM+LGF
Sbjct  39    KELDQTPTWAVAVVCTVFILISITLEKSLHKVGTWLGKKQKKALLEALEKVKAELMILGF  98

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI KICIPE   + MLPC    +  E  +   GE                
Sbjct  99    ISLLLTFGQSYIVKICIPEKMADKMLPCPYKYKDAEKASNDDGE----------------  142

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-EC-KEGLIPLISLNGLHQLHIFIFFLAVFH  826
                      +H R+LL   RR L+  ++  +C  EG  PL+S+NGLHQLHI IFFLAV H
Sbjct  143   ---------KHRRKLLSYERRYLAADSISFKCSNEGYEPLLSVNGLHQLHILIFFLAVLH  193

Query  827   VIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y AITM LGR+KIRGWK WE  T+    E A   SR+RLT ETSFV+ +    T+ P+
Sbjct  194   VLYSAITMLLGRLKIRGWKAWEAETSTHNYEFATAASRFRLTHETSFVRAHADLWTRIPI  253

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQF+RSV + DYL +R+GFI+VHLAPGSKF+FQKYIKRS EDDFKVVVG++ 
Sbjct  254   FFYIGCFFRQFYRSVNKTDYLTLRNGFITVHLAPGSKFNFQKYIKRSFEDDFKVVVGVSP  313

Query  1181  MLWCA  1195
             +LW +
Sbjct  314   ILWAS  318



>gb|ADV29809.1| MLO1 protein [Malus toringoides]
Length=573

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 212/303 (70%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELD+TPTWAVA VC VI++ISL+LEK+LHK+G     + KRAL E+LEK+K ELM+LGF
Sbjct  32    RELDRTPTWAVAGVCAVIIIISLVLEKVLHKVGIWLTDRHKRALFESLEKVKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISL+LTFGQSYIAKICIP    +TMLPC + D+  E                        
Sbjct  92    ISLILTFGQSYIAKICIPLNVADTMLPCRVDDKEKEESTSD-------------------  132

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                         RRLLW  RR L+  +  +CK G  PLI++NGLHQLHI IFFLA FHV+
Sbjct  133   ------------RRLLWYERRSLAAASEYKCKTGYEPLITVNGLHQLHILIFFLAAFHVL  180

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  +TM LGR+KIRGWK WE  T+ D  E +NDPSR+RLT + SFV+ +TSF T+ P  F
Sbjct  181   YSLLTMLLGRLKIRGWKHWEAETSSDDYEFSNDPSRFRLTHQISFVRAHTSFWTKIPFFF  240

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFFRSV +ADYL +R+GFI+VHL  GSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  241   YFGCFFRQFFRSVSKADYLTLRNGFITVHLGAGSKFNFQKYIKRSLEDDFKVVVGVSPLL  300

Query  1187  WCA  1195
             W +
Sbjct  301   WAS  303



>emb|CDY20802.1| BnaC07g06510D [Brassica napus]
Length=595

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 210/304 (69%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELMVLGF
Sbjct  38    RQLNQTPTWAVASVCTFFIVVSVLLEKLIHKVGTVLWDRNKKALLDALEKIKSELMVLGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG S+I +ICIP    +TMLPC                            P   
Sbjct  98    ISLLLTFGSSFILEICIPSHVAHTMLPC----------------------------PTTI  129

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +E  E G E HR+LLW   RVLS  +V +CK EG   L S   LHQLHI IFFLA+FHV
Sbjct  130   EKEVDEKGEEGHRKLLWFDHRVLSEISVPKCKREGYEHLFSSKALHQLHILIFFLAIFHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+E+TSF T+ P  
Sbjct  190   FYSFLTMMLGRLKIRGWKHWEKETSSHNYEFSVDTSRFRLTHETSFVREHTSFWTRIPFF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSVRR DY+ +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFK+VVG++ +
Sbjct  250   FYIGCFFRQFFRSVRRTDYMTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKLVVGVSPV  309

Query  1184  LWCA  1195
             LW +
Sbjct  310   LWAS  313



>ref|XP_009121111.1| PREDICTED: MLO-like protein 8 [Brassica rapa]
Length=595

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 210/304 (69%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELMVLGF
Sbjct  38    RQLNQTPTWAVAGVCTFFIVVSVLLEKLIHKVGTVLWDRNKKALLDALEKIKSELMVLGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG S+I +ICIP    +TMLPC                            P   
Sbjct  98    ISLLLTFGSSFILEICIPSHVAHTMLPC----------------------------PTTI  129

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +E  E G E HR+LLW   RVLS  +V +CK EG   L S   LHQLHI IFFLA+FHV
Sbjct  130   EKEVDEKGEEGHRKLLWFDHRVLSEISVPKCKKEGYEHLFSSKALHQLHILIFFLAIFHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+E+TSF T+ P  
Sbjct  190   FYSFLTMMLGRLKIRGWKHWEKETSSHNYEFSVDTSRFRLTHETSFVREHTSFWTRIPFF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSVRR DY+ +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFK+VVG++ +
Sbjct  250   FYIGCFFRQFFRSVRRTDYMTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKLVVGVSPV  309

Query  1184  LWCA  1195
             LW +
Sbjct  310   LWAS  313



>emb|CDY24339.1| BnaA07g02640D [Brassica napus]
Length=595

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 210/304 (69%), Gaps = 31/304 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELMVLGF
Sbjct  38    RQLNQTPTWAVAGVCTFFIVVSVLLEKLIHKVGTVLWDRNKKALLDALEKIKSELMVLGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG S+I +ICIP    +TMLPC                            P   
Sbjct  98    ISLLLTFGSSFILEICIPSHVAHTMLPC----------------------------PTTI  129

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIFIFFLAVFHV  829
              +E  E G E HR+LLW   RVLS  +V +CK EG   L S   LHQLHI IFFLA+FHV
Sbjct  130   EKEVDEKGEEGHRKLLWFDHRVLSEISVPKCKKEGYEHLFSSKALHQLHILIFFLAIFHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+E+TSF T+ P  
Sbjct  190   FYSFLTMMLGRLKIRGWKHWENETSSHNYEFSVDTSRFRLTHETSFVREHTSFWTRIPFF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSVRR DY+ +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFK+VVG++ +
Sbjct  250   FYIGCFFRQFFRSVRRTDYMTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKLVVGVSPV  309

Query  1184  LWCA  1195
             LW +
Sbjct  310   LWAS  313



>ref|XP_003568790.1| PREDICTED: MLO-like protein 9 [Brachypodium distachyon]
Length=572

 Score =   315 bits (806),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 220/330 (67%), Gaps = 30/330 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +IV+IS++LEK LHK+G  F  +KK+A+VEALEK+K ELMVLGF
Sbjct  11    RELDQTPTWAVASVCGIIVLISILLEKGLHKVGEFFAHRKKKAMVEALEKVKTELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPS------------  616
             ISLLL FGQ+YI +ICI E + +TMLPC +    +E +   +  H P+            
Sbjct  71    ISLLLVFGQNYIIRICITEKSADTMLPCPLKKSTIEAET-NNDHHNPAVLAGAAGEHGAA  129

Query  617   ------------GEHGEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSG---HAVEECKE  751
                          E G   P E EH                   R+LSG   +   +C  
Sbjct  130   VAEGEHGAAAAAAEGGHAKPKEAEHFGLGLGPPFTTAASFAVPHRLLSGGEANMKTKCPP  189

Query  752   GLIPLISLNGLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEM-ATAQD-EAAND  925
             G + LIS+N LHQLHIFIFFLAVFHV Y AITMALGR KIRGWKEWE  A  QD + ++D
Sbjct  190   GKVSLISINALHQLHIFIFFLAVFHVSYSAITMALGRAKIRGWKEWEKEAAGQDYDVSSD  249

Query  926   PSRYRLTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPG  1105
             P+R+R T ETSFV+++ + + +TP  FY   FFRQFFRSVRRADY A+RH F++VHLAPG
Sbjct  250   PTRFRFTHETSFVRQHMNVLNKTPASFYISNFFRQFFRSVRRADYCALRHSFVNVHLAPG  309

Query  1106  SKFDFQKYIKRSLEDDFKVVVGINLMLWCA  1195
             SKFDFQKYIKRSLEDDFKV+VGI+  LW +
Sbjct  310   SKFDFQKYIKRSLEDDFKVIVGISPPLWAS  339



>gb|KGN49000.1| hypothetical protein Csa_6G509690 [Cucumis sativus]
Length=545

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 210/303 (69%), Gaps = 44/303 (15%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA VC +I++IS+ LEKLLHK G     K KRAL EALEK+K ELM+LGF
Sbjct  28    RELDQTPTWAVAGVCAIIILISIALEKLLHKAGTWLTEKHKRALFEALEKVKAELMILGF  87

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP    NTMLPC                          A  ED+
Sbjct  88    ISLLLTFGQNYIIKICIPTKVANTMLPC--------------------------AAKEDK  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS--GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++  E  GEHHRRLL   RR L+  G AV  CKEG +PLIS++GLHQLH+FIFFLAVFH
Sbjct  122   LEKGDE--GEHHRRLLMYERRFLAAAGGAVS-CKEGHVPLISISGLHQLHLFIFFLAVFH  178

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             V+Y AITM LGR+KIRGWK WE  T+             T    F   +TSF T+ PV F
Sbjct  179   VVYSAITMMLGRLKIRGWKAWEEETS-------------THNYEFSNAHTSFWTKLPVFF  225

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFF+SV +ADYLA+R+GFI+VHLAPGSKFDFQKYIKRSLEDDFK++VG++ +L
Sbjct  226   YIGCFFRQFFKSVGKADYLALRNGFIAVHLAPGSKFDFQKYIKRSLEDDFKIIVGVSPVL  285

Query  1187  WCA  1195
             W +
Sbjct  286   WTS  288



>ref|XP_010034715.1| PREDICTED: MLO-like protein 8 [Eucalyptus grandis]
 gb|KCW53295.1| hypothetical protein EUGRSUZ_J02553 [Eucalyptus grandis]
Length=549

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 204/304 (67%), Gaps = 35/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTP WAVA VC +I++IS+ LEKLLHK+G     + K+AL EALEK K ELM+LGF
Sbjct  11    RELDQTPMWAVAGVCALIIMISIALEKLLHKVGTWLTERYKKALYEALEKTKNELMILGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
              SLLLTFGQSYIAKICIP +   TMLPC         +                      
Sbjct  71    FSLLLTFGQSYIAKICIPTSVAETMLPCTKSSTSTTTE----------------------  108

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                      +  RRLLW+ RR L+ G     C  G  PLIS+NGLHQLHI IFFLA FHV
Sbjct  109   ---------DRRRRLLWNERRSLAAGSYATNCTSG-TPLISVNGLHQLHILIFFLAFFHV  158

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A+TM LGR+KIRGWK+WE  T+    E + DPSR+RLT ETSFV+ ++SF T+ P  
Sbjct  159   LYSAVTMMLGRLKIRGWKQWEQETSSHDYEFSTDPSRFRLTHETSFVRVHSSFWTRIPFF  218

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV + DYL +R+GFI+VH+ PG KFDFQ+YIKRSLED+FK VVG++ +
Sbjct  219   FYVGCFFRQFFRSVHKTDYLTLRNGFIAVHIGPGRKFDFQEYIKRSLEDEFKFVVGVSPV  278

Query  1184  LWCA  1195
             LW +
Sbjct  279   LWAS  282



>gb|KFK29153.1| hypothetical protein AALP_AA7G095800 [Arabis alpina]
Length=455

 Score =   309 bits (792),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 206/300 (69%), Gaps = 29/300 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE L+HK+G  FERKKK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELLIHKLGQVFERKKKKALFEALEKIKNELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C                       G +  P D+
Sbjct  74    ISLLLTFGQNYIASICVPSKYGHAMSFC-----------------------GPYDGPSDD  110

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              ++       + + +    RR L+      CK G +PLISLN LHQ+HIFIFFLAVFHVI
Sbjct  111   DKKAV-----YKKHISSIQRRSLADAPPVNCKSGYVPLISLNALHQVHIFIFFLAVFHVI  165

Query  833   YGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +   +    FY
Sbjct  166   YSAITMMLGRAKIRGWKVWEQEVIHEQEMLNDPSRFRLTHETSFVREHVNPWARNKFSFY  225

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   LW
Sbjct  226   VMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELW  285



>gb|KFK40125.1| hypothetical protein AALP_AA3G333500 [Arabis alpina]
Length=596

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 211/302 (70%), Gaps = 28/302 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L +TPTWAVA VC   +V+S++LEKLLHK+G     + K+AL++ALEKIK ELMVLGF
Sbjct  35    RQLYETPTWAVAGVCTFFIVVSVLLEKLLHKVGKVLWDRHKKALLDALEKIKSELMVLGF  94

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQS+I KICIPE    TMLPC                  P+ +H E    ED+
Sbjct  95    ISLLLTFGQSFILKICIPENVARTMLPC------------------PAPDHFEKEKEEDD  136

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                     G++HR+LLW   R+LS   +  +C EG   LIS   LHQLHI IFFLAVFHV
Sbjct  137   K-------GDNHRKLLWYDHRILSEVESSSKCHEGYERLISAKALHQLHILIFFLAVFHV  189

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  +TM LGR+KIR WK WE  T     E + D SR+RLT ETSFV+ +TSF T+ PV 
Sbjct  190   LYSFLTMMLGRLKIRRWKHWEKETLSHDYEFSVDTSRFRLTHETSFVRAHTSFWTRIPVF  249

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV + DYL +R+GFI+VHLAPGS+F+FQKYI+RSLEDDF+VVVG++ +
Sbjct  250   FYIGCFFRQFFRSVGKTDYLTLRNGFIAVHLAPGSQFNFQKYIQRSLEDDFQVVVGVSPV  309

Query  1184  LW  1189
             LW
Sbjct  310   LW  311



>ref|XP_010539025.1| PREDICTED: MLO-like protein 9 [Tarenaya hassleriana]
Length=522

 Score =   310 bits (795),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 208/300 (69%), Gaps = 19/300 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAV+ VC VI++IS++LE  +HKIG  F+++KK+AL+EAL KIK ELMVLGF
Sbjct  15    RELDQTPTWAVSTVCGVIILISIVLEMFIHKIGEFFDKRKKKALLEALLKIKNELMVLGF  74

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G  M  C           P  G    S         +  
Sbjct  75    ISLLLTFGQNYIATICVPSRFGQAMSFC----------GPYDGSDMGS--------RKTV  116

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H + +     H RRLL   RR+L+  +  +C EG + LISLN LHQ+HIFIFFLAVFHVI
Sbjct  117   HHKHSSHKSHHERRLLSLERRILANFSAADCDEGYVALISLNALHQIHIFIFFLAVFHVI  176

Query  833   YGAITMALGRMKIRGWKEWEM-ATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIR WK WE     + E  NDPSR+RLT ETSFV+E+ +  T+    FY
Sbjct  177   YSAITMMLGRAKIREWKVWEQDIMTEQELMNDPSRFRLTHETSFVREHVNPWTRNRFSFY  236

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CF RQ  RSVR++DYL MRHGFISVHL+PG KF+FQKYIKRSLEDDFKVVVGI+  LW
Sbjct  237   IICFLRQMLRSVRKSDYLTMRHGFISVHLSPGMKFNFQKYIKRSLEDDFKVVVGISPPLW  296



>gb|AAG51234.1|AC035249_9 disease resistance protein MLO, putative; 5304-2185 [Arabidopsis 
thaliana]
Length=443

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/300 (58%), Positives = 209/300 (70%), Gaps = 29/300 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  FERKKK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C  +D                       P ED+
Sbjct  74    ISLLLTFGQNYIASICVPSRYGHAMSFCGPYD----------------------GPSEDD  111

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              ++  +   +H  R+L+S++R     ++ +     + LISLN LHQ+HIFIFFLAVFHVI
Sbjct  112   RKKLKKT--DHAMRILYSVQR----RSLADAPPDYVALISLNALHQVHIFIFFLAVFHVI  165

Query  833   YGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        FY
Sbjct  166   YSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFY  225

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   LW
Sbjct  226   VMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELW  285



>ref|XP_006855670.1| hypothetical protein AMTR_s00044p00123510 [Amborella trichopoda]
 gb|ERN17137.1| hypothetical protein AMTR_s00044p00123510 [Amborella trichopoda]
Length=556

 Score =   310 bits (795),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 212/310 (68%), Gaps = 41/310 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA VC VI++IS++LEK LH +G  F ++KK ++ EALEK+K ELM+LGF
Sbjct  10    RTLEQTPTWAVAAVCAVILLISILLEKGLHHVGEWFTKRKKMSMFEALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYIAKICIP+   +TMLPC   +                            
Sbjct  70    ISLLLTFGQSYIAKICIPDHVADTMLPCKAAN----------------------------  101

Query  653   HQEPAEAGGEHHRRLLWS------MRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFF  811
                  +   +  +R L+       +RR L+G  +   C +G + L+S N +HQLHIFIFF
Sbjct  102   ----VKTNKKFSKRFLFDELFVNGVRRSLAGADSTASCSKGKVSLVSTNAIHQLHIFIFF  157

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFM  985
             LAVFHVI+ A+ MALGR KIR WKEWE  T     E+++DP+R+R   +TSFV+ ++SF 
Sbjct  158   LAVFHVIFSAVVMALGRAKIRRWKEWEKETQSLNYESSHDPTRFRFAHDTSFVRAHSSFW  217

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVV  1165
              + P +F+ VCFFRQFFRSVR+ADYL MRHGFI+VHLAPGSKFDFQKYIKRSLEDDFK V
Sbjct  218   NKIPFIFHIVCFFRQFFRSVRKADYLTMRHGFIAVHLAPGSKFDFQKYIKRSLEDDFKEV  277

Query  1166  VGINLMLWCA  1195
             VGI+ +LW +
Sbjct  278   VGISPVLWAS  287



>ref|NP_565416.1| MLO-like protein 8 [Arabidopsis thaliana]
 sp|O22757.2|MLO8_ARATH RecName: Full=MLO-like protein 8; Short=AtMlo8 [Arabidopsis thaliana]
 gb|AAK53801.1|AF369569_1 membrane protein Mlo8 [Arabidopsis thaliana]
 gb|AAD32905.2| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AAO22734.1| putative Mlo protein [Arabidopsis thaliana]
 gb|AAO42350.1| putative Mlo protein [Arabidopsis thaliana]
 gb|AEC06633.1| MLO-like protein 8 [Arabidopsis thaliana]
Length=593

 Score =   310 bits (795),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 206/304 (68%), Gaps = 33/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++L+QTPTWAVA VC   +V+S++LEKLLHK+G     + K AL++ALEKIK ELMVLGF
Sbjct  39    KQLNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGF  98

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI  ICIP     TMLPC                            P   
Sbjct  99    ISLLLTFGQTYILDICIPSHVARTMLPC----------------------------PAPN  130

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG--HAVEEC-KEGLIPLISLNGLHQLHIFIFFLAVF  823
              ++  +  GE HRRLL    R LSG   +  +C KEG + LIS   LHQLHI IFFLA+F
Sbjct  131   LKKEDDDNGESHRRLLSFEHRFLSGGEASPTKCTKEGYVELISAEALHQLHILIFFLAIF  190

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P
Sbjct  191   HVLYSFLTMMLGRLKIRGWKHWENETSSHNYEFSTDTSRFRLTHETSFVRAHTSFWTRIP  250

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
               FY  CFFRQFFRSV R DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFKVVVG++
Sbjct  251   FFFYVGCFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKVVVGVS  310

Query  1178  LMLW  1189
              +LW
Sbjct  311   PVLW  314



>ref|XP_010478983.1| PREDICTED: MLO-like protein 9 [Camelina sativa]
Length=461

 Score =   306 bits (784),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 205/300 (68%), Gaps = 23/300 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  F +KKK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFVKKKKKALFEALEKIKSELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C  +D                       P +D+
Sbjct  74    ISLLLTFGQNYIASICVPSRYGHAMSFCGPYD----------------------GPSDDD  111

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +      EH  R+L   RR L+      CK+  + LISLN LHQ+HIFIFFLAVFHVI
Sbjct  112   DNDKKLKKTEHAMRILSIQRRSLADAPPVNCKKDYVALISLNALHQVHIFIFFLAVFHVI  171

Query  833   YGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        FY
Sbjct  172   YSAITMMLGRAKIRGWKVWEQEIIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFY  231

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFFRQ  RSVR++DYL MRHGFISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   LW
Sbjct  232   VMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELW  291



>ref|XP_010530986.1| PREDICTED: MLO-like protein 8 [Tarenaya hassleriana]
 ref|XP_010530987.1| PREDICTED: MLO-like protein 8 [Tarenaya hassleriana]
Length=589

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 210/306 (69%), Gaps = 34/306 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL QTPTWAV+ VC   + +S++LEK LHK+G     + K+AL++ALEK+K ELMVLGF
Sbjct  35    RELSQTPTWAVSAVCTFFIAVSVLLEKFLHKLGTVLWERHKKALLDALEKVKSELMVLGF  94

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQSYI KICIPE A  TMLPC          +PG+ EH            E+E
Sbjct  95    ISLLLTFGQSYILKICIPEKAARTMLPC--------PASPGNSEH------------ENE  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS--GHAVEECKEG-LIPLISLNGLHQLHIFIFFLAVF  823
                      + HR+LLW   R LS  G + ++C E     LIS   LHQLHI IFFLAVF
Sbjct  135   ---------DSHRKLLWFDHRFLSEDGGSAKKCLEAHKQQLISAEALHQLHILIFFLAVF  185

Query  824   HVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE  +++   E + DPSR+RLT ETSFV+ +TSF T+ P
Sbjct  186   HVLYSFLTMMLGRLKIRGWKHWEQEVSSHDYEFSTDPSRFRLTHETSFVRAHTSFWTRIP  245

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
               FY  CFFRQF RSV + DYL +R+GFI+VHL PG +F+FQKYIKRSLEDDFK+VVG++
Sbjct  246   FFFYVGCFFRQFVRSVGKTDYLTLRNGFIAVHLGPGRQFNFQKYIKRSLEDDFKMVVGVS  305

Query  1178  LMLWCA  1195
              +LW +
Sbjct  306   PVLWAS  311



>ref|XP_010680631.1| PREDICTED: MLO-like protein 10 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=554

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 209/304 (69%), Gaps = 35/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L QTPTWAVA VC VI++IS +LEK L +IG    +K+KRAL EAL+K+K ELMV+GF
Sbjct  22    RKLHQTPTWAVAGVCAVIILISFILEKGLQRIGTWLTKKQKRALYEALDKVKEELMVMGF  81

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTF Q Y+AKICIP    + MLPC + +                            
Sbjct  82    ISLLLTFSQGYMAKICIPSKFADHMLPCELKNR---------------------------  114

Query  653   HQEPAEAGGEHHRRLLWSMRRVL-SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                  ++G E+ R+LLW  RR+L +G +   C EG +PLI++   HQLHI IFFLAVFHV
Sbjct  115   -----DSGEENRRKLLWDKRRILVTGESHHSCHEGHVPLITVEAAHQLHILIFFLAVFHV  169

Query  830   IYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A TM LG++KIRGWK+WE   +T   E  N+P R+RLT +T+FV+ + SF T+ P  
Sbjct  170   LYSAATMMLGKLKIRGWKDWERETSTLDYELTNNPLRFRLTHQTTFVRSHNSFWTRIPFF  229

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFFRSV +ADYL +R+GFI+ H+APGS+FDFQKYIKRSLEDDFKVVVG++ +
Sbjct  230   FYVGCFFRQFFRSVTKADYLTLRNGFITAHIAPGSQFDFQKYIKRSLEDDFKVVVGVSPV  289

Query  1184  LWCA  1195
             LW +
Sbjct  290   LWTS  293



>ref|XP_011034833.1| PREDICTED: MLO-like protein 5 isoform X2 [Populus euphratica]
Length=474

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 185/248 (75%), Gaps = 30/248 (12%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             MVLGFISL LTF QSYIA ICIP    NTMLPC           P  G+           
Sbjct  1     MVLGFISLTLTFSQSYIAGICIPLRYANTMLPC-----------PAKGKKGQD-------  42

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHA-VEECKEGLIPLISLNGLHQLHIFIFFL  814
                       ++GGE+HR+LLWS  R L+G +  ++CK+G +PLIS+ GLHQLHIFIFFL
Sbjct  43    ----------DSGGENHRKLLWSQHRFLAGESGSKDCKDGSVPLISVEGLHQLHIFIFFL  92

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQ  991
             AVFHV+Y AITM LG++KIR WK+WE  + ++ +A NDP+R+RLT ETSFV+ +TSF T+
Sbjct  93    AVFHVVYSAITMMLGKLKIRNWKDWERESWREHDAMNDPARFRLTHETSFVRGHTSFWTK  152

Query  992   TPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVG  1171
             TP+LFYS+CF+RQFFRSVR++DYL MRHGFISVHLAPGSKF+FQKYIK++LEDDFKVVVG
Sbjct  153   TPILFYSLCFYRQFFRSVRKSDYLTMRHGFISVHLAPGSKFNFQKYIKKTLEDDFKVVVG  212

Query  1172  INLMLWCA  1195
             I+ +LW +
Sbjct  213   ISPLLWAS  220



>ref|XP_009390757.1| PREDICTED: MLO-like protein 9 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=546

 Score =   306 bits (785),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 162/306 (53%), Positives = 203/306 (66%), Gaps = 34/306 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD+TPTWAVA V  V ++ISL+LEK LH +G    +K K+ L +ALEK+K ELM+LGF
Sbjct  10    RDLDETPTWAVAAVSSVFILISLLLEKGLHHLGEWLTKKHKKTLFDALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G++YI KICIP     TMLPC                           PP D 
Sbjct  70    ISLLLTVGETYITKICIPYKVAETMLPC---------------------------PPNDT  102

Query  653   HQEPAEAGGEHHRRLLW---SMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVF  823
                 +EAGG +HRRLL    + RR+L+  +   C  G +PLIS+NGLHQLHIFIFFLAV 
Sbjct  103   --LTSEAGGGNHRRLLMDQNAKRRILAAGSPASCPMGKVPLISVNGLHQLHIFIFFLAVL  160

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQDEAA--NDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+  A+ MALGR KI  WKEWE  T   + A  +DPSR+R   E +FVK + SF  +  
Sbjct  161   HVVNSAVIMALGRAKIHAWKEWEKETQSVDYAFSSDPSRFRFADEITFVKRHASFWNRIT  220

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             +L Y V FF QF RSV + DYL MRHGFISVHLAPG+KF+F++YIKR++EDDFKVVVG++
Sbjct  221   ILLYVVSFFNQFLRSVSKVDYLTMRHGFISVHLAPGTKFNFKRYIKRAMEDDFKVVVGVS  280

Query  1178  LMLWCA  1195
              +LW +
Sbjct  281   PILWAS  286



>ref|XP_009382074.1| PREDICTED: MLO-like protein 9 [Musa acuminata subsp. malaccensis]
Length=558

 Score =   306 bits (784),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 209/310 (67%), Gaps = 36/310 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             RELDQTPTWAVA+VC VIVVIS++LEK LH+ G     K K+AL EALEKIK ELM+LGF
Sbjct  12    RELDQTPTWAVAVVCAVIVVISILLEKGLHRFGEWLTEKHKKALFEALEKIKAELMILGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ YI KIC+P    +TMLPC                             + +
Sbjct  72    ISLLLTFGQKYIVKICVPYKVADTMLPC---------------------------SRKTD  104

Query  653   HQEPAEAGGEHHRRLLWSM-------RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFF  811
              +   EA G H RRLL +         R+L+  ++  C  G +PLIS NGLHQLHI IFF
Sbjct  105   TETEEEADGRHRRRLLTNALTDPNGKHRILAAGSIVSCSAGKVPLISTNGLHQLHILIFF  164

Query  812   LAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAVFHV     TMALGR+K+R WK W  E+++ + E + DPSR+R T ETSFV+ +TS  
Sbjct  165   LAVFHVASSFTTMALGRLKMRRWKHWESEISSPEYEFSKDPSRFRFTHETSFVRRHTSIW  224

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVV  1165
              +  + FY V FFRQFFRSV +ADYLA+RHGFI+VHLAPGSKF+FQKYIKR+LEDDFK+V
Sbjct  225   NRVTICFYFVSFFRQFFRSVCKADYLALRHGFINVHLAPGSKFNFQKYIKRTLEDDFKMV  284

Query  1166  VGINLMLWCA  1195
              GI+ +LW +
Sbjct  285   AGISPVLWAS  294



>ref|XP_009390750.1| PREDICTED: MLO-like protein 9 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   306 bits (783),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/306 (53%), Positives = 203/306 (66%), Gaps = 34/306 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD+TPTWAVA V  V ++ISL+LEK LH +G    +K K+ L +ALEK+K ELM+LGF
Sbjct  10    RDLDETPTWAVAAVSSVFILISLLLEKGLHHLGEWLTKKHKKTLFDALEKVKAELMILGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G++YI KICIP     TMLPC                           PP D 
Sbjct  70    ISLLLTVGETYITKICIPYKVAETMLPC---------------------------PPNDT  102

Query  653   HQEPAEAGGEHHRRLLW---SMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVF  823
                 +EAGG +HRRLL    + RR+L+  +   C  G +PLIS+NGLHQLHIFIFFLAV 
Sbjct  103   --LTSEAGGGNHRRLLMDQNAKRRILAAGSPASCPMGKVPLISVNGLHQLHIFIFFLAVL  160

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQDEAA--NDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+  A+ MALGR KI  WKEWE  T   + A  +DPSR+R   E +FVK + SF  +  
Sbjct  161   HVVNSAVIMALGRAKIHAWKEWEKETQSVDYAFSSDPSRFRFADEITFVKRHASFWNRIT  220

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
             +L Y V FF QF RSV + DYL MRHGFISVHLAPG+KF+F++YIKR++EDDFKVVVG++
Sbjct  221   ILLYVVSFFNQFLRSVSKVDYLTMRHGFISVHLAPGTKFNFKRYIKRAMEDDFKVVVGVS  280

Query  1178  LMLWCA  1195
              +LW +
Sbjct  281   PILWAS  286



>ref|XP_004512433.1| PREDICTED: MLO-like protein 10-like, partial [Cicer arietinum]
Length=562

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 206/303 (68%), Gaps = 38/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD+TPTWAVA VC V ++IS+ LEK LHK+G    R++K+AL+EALEKIK ELM+LGF
Sbjct  34    RKLDETPTWAVASVCTVFILISIALEKSLHKLGMWLGRRQKKALLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI +ICI E   N MLPC        H+     +   S        P   
Sbjct  94    ISLLLTFGQNYIVRICILEEVANKMLPC-------PHKYSNISDDKKSSRFLAADTP---  143

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                              S +    GH          PL+S+NGLHQLHIFIFFLAVFHV+
Sbjct  144   -----------------SFKCSRKGHE---------PLLSINGLHQLHIFIFFLAVFHVL  177

Query  833   YGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y AITM LGR+KIRGWKEWE  T+   ++ AND +++RLT ETSFV+ +TSF T+  + F
Sbjct  178   YSAITMLLGRLKIRGWKEWEEETSTHGNQFANDAAKFRLTHETSFVRAHTSFWTRIAISF  237

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQF+RSVRR DY  +R+GFISVHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  238   YIGCFFRQFYRSVRRVDYQTLRNGFISVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  297

Query  1187  WCA  1195
             W +
Sbjct  298   WAS  300



>ref|XP_002886115.1| hypothetical protein ARALYDRAFT_480631 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62374.1| hypothetical protein ARALYDRAFT_480631 [Arabidopsis lyrata subsp. 
lyrata]
Length=591

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 205/304 (67%), Gaps = 33/304 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L+QTPTWAVA VC   +V+S++LEKLLHK+G     + K AL++ALEKIK ELMVLGF
Sbjct  35    KMLNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGF  94

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI  ICIP     TMLPC                            P  +
Sbjct  95    ISLLLTFGQTYILDICIPSHVARTMLPC----------------------------PAPK  126

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSG--HAVEEC-KEGLIPLISLNGLHQLHIFIFFLAVF  823
              ++  +  GE HRRLL    R LSG   +  +C KEG   LIS   LHQLHI IFFLAVF
Sbjct  127   PKKEEDDNGESHRRLLSFEHRFLSGGEASPTKCKKEGYEELISAEALHQLHILIFFLAVF  186

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P
Sbjct  187   HVLYSFLTMMLGRLKIRGWKHWENETSSHNYEFSTDTSRFRLTHETSFVRAHTSFWTRIP  246

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
               FY  CFFRQFFRSV R DYL +R+GFI+VHLAPGS+F+FQKYIKRSLEDDFKVVVG++
Sbjct  247   FFFYIGCFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLEDDFKVVVGVS  306

Query  1178  LMLW  1189
              +LW
Sbjct  307   PVLW  310



>ref|XP_010680632.1| PREDICTED: MLO-like protein 10 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=534

 Score =   303 bits (777),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/299 (54%), Positives = 205/299 (69%), Gaps = 35/299 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L QTPTWAVA VC VI++IS +LEK L +IG    +K+KRAL EAL+K+K ELMV+GF
Sbjct  22    RKLHQTPTWAVAGVCAVIILISFILEKGLQRIGTWLTKKQKRALYEALDKVKEELMVMGF  81

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTF Q Y+AKICIP    + MLPC + +                            
Sbjct  82    ISLLLTFSQGYMAKICIPSKFADHMLPCELKNR---------------------------  114

Query  653   HQEPAEAGGEHHRRLLWSMRRVL-SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                  ++G E+ R+LLW  RR+L +G +   C EG +PLI++   HQLHI IFFLAVFHV
Sbjct  115   -----DSGEENRRKLLWDKRRILVTGESHHSCHEGHVPLITVEAAHQLHILIFFLAVFHV  169

Query  830   IYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y A TM LG++KIRGWK+WE   +T   E  N+P R+RLT +T+FV+ + SF T+ P  
Sbjct  170   LYSAATMMLGKLKIRGWKDWERETSTLDYELTNNPLRFRLTHQTTFVRSHNSFWTRIPFF  229

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
             FY  CFFRQFFRSV +ADYL +R+GFI+ H+APGS+FDFQKYIKRSLEDDFKVVVG+ +
Sbjct  230   FYVGCFFRQFFRSVTKADYLTLRNGFITAHIAPGSQFDFQKYIKRSLEDDFKVVVGVRM  288



>ref|XP_008804588.1| PREDICTED: MLO-like protein 9 isoform X2 [Phoenix dactylifera]
Length=503

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/259 (61%), Positives = 183/259 (71%), Gaps = 37/259 (14%)
 Frame = +2

Query  443   IKGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGE  622
             I  ELM+LGFISLLLTFGQ+YI+KICIPE A +TMLPC + ++ VE              
Sbjct  8     IHAELMILGFISLLLTFGQNYISKICIPEKAADTMLPCQLDEDQVE--------------  53

Query  623   HGEHAPPEDEHQEPAEAGGEHHRRLLWSM-------RRVLS-GHAVEECKEGLIPLISLN  778
                         E AE G  HHRRLLW          R LS   +V  C +G +PLIS N
Sbjct  54    -----------AELAEGG--HHRRLLWDAIMDLYPKHRFLSEASSVSRCPQGKVPLISTN  100

Query  779   GLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKE  952
             GLHQLHIFIFFLAVFHV+  A+TMALGR KIR WKEWE  T     E  NDPSR+RLT E
Sbjct  101   GLHQLHIFIFFLAVFHVLSSAVTMALGRAKIRRWKEWEKETLSTDYEFFNDPSRFRLTHE  160

Query  953   TSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYI  1132
              SFV+++ SF  ++P+LFY+V FFRQFFRSVR+ADYLAMRHGFI+VHLAPGSKFDFQKYI
Sbjct  161   ISFVRQHASFWNRSPILFYAVSFFRQFFRSVRKADYLAMRHGFITVHLAPGSKFDFQKYI  220

Query  1133  KRSLEDDFKVVVGINLMLW  1189
             KRSLEDDFK++VGI+ +LW
Sbjct  221   KRSLEDDFKIIVGISHVLW  239



>dbj|BAJ34234.1| unnamed protein product [Thellungiella halophila]
Length=593

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 204/305 (67%), Gaps = 31/305 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELM+LGF
Sbjct  38    RALNQTPTWAVAAVCTFFIVVSVVLEKLIHKVGTVLSDRHKKALLDALEKIKSELMILGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP    +TMLPC                           P    
Sbjct  98    ISLLLTFGQNYILKICIPSHVAHTMLPC---------------------------PAPTA  130

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGH--AVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              +E  +  GE HRRLLW   R LSG     + C+EG   LIS   LHQLHI IFFLA+ H
Sbjct  131   WKEEGDEKGEGHRRLLWFEHRFLSGDEPPSKRCEEGYEQLISAKALHQLHILIFFLAILH  190

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y  +TM LGR+K+RGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P 
Sbjct  191   VLYSFLTMMLGRLKMRGWKHWEKETSSHDYEFSTDTSRFRLTHETSFVRAHTSFWTRIPF  250

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              F   CFFRQFFRSV + DYL +R+GFI+VH  PG++F+FQKYIKRSLE+DFK+VVG++ 
Sbjct  251   FFCIGCFFRQFFRSVGKTDYLTLRNGFITVHFGPGAQFNFQKYIKRSLEEDFKLVVGVSP  310

Query  1181  MLWCA  1195
             +LW +
Sbjct  311   VLWAS  315



>ref|XP_010097644.1| MLO-like protein 8 [Morus notabilis]
 gb|EXB70344.1| MLO-like protein 8 [Morus notabilis]
Length=617

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 209/333 (63%), Gaps = 60/333 (18%)
 Frame = +2

Query  266   MSgggggkgRELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKI  445
             M+     + R+LDQTPTWAVA VC  I++IS++LEK+LHK+G  F  + K +L EALEK+
Sbjct  22    MAASSDSESRKLDQTPTWAVAGVCTFIIIISIVLEKVLHKLGTWFTERHKISLFEALEKV  81

Query  446   KGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEH  625
             K ELM+LGFISLLLTF QSYIAKICIP+    TMLPC +  E                  
Sbjct  82    KAELMILGFISLLLTFSQSYIAKICIPKHIAETMLPCSLKKE------------------  123

Query  626   GEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIF  802
                A    E         EH RRLLW   R L+G      CKEG   LIS+ GLH+LHI 
Sbjct  124   ---AKKSTEE--------EHRRRLLWFEHRFLAGSGYSATCKEGKESLISVEGLHELHIL  172

Query  803   IFFLAVFHVIYGAITMALGRMKIRGWKEWEMATA--------------------QDEAAN  922
             IFFLA FHV++  ITM LGR+KIRGWK+WE  T+                    + E A+
Sbjct  173   IFFLAFFHVLFSGITMMLGRLKIRGWKKWEQETSTHNYEFSNGISLHCSKALVLKSEWAS  232

Query  923   ----------DPSRYRLTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMR  1072
                       DPSR+RLT ETSFV+ +TSF T  P  FY  CFFRQFFRSV +ADY+ +R
Sbjct  233   YAILGKSGSIDPSRFRLTHETSFVRAHTSFWTPIPFFFYVGCFFRQFFRSVSKADYMTLR  292

Query  1073  HGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVG  1171
             +GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VVG
Sbjct  293   NGFITVHLAPGSKFNFQKYIKRSLEDDFKIVVG  325



>ref|XP_006393785.1| hypothetical protein EUTSA_v10003913mg [Eutrema salsugineum]
 gb|ESQ31071.1| hypothetical protein EUTSA_v10003913mg [Eutrema salsugineum]
Length=570

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 203/303 (67%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             +EL QTPTWAVALVC   +++S++LEK LHK+      K K +L EALEKIK ELM+LGF
Sbjct  34    KELSQTPTWAVALVCTFFILVSVLLEKALHKVATWLWEKHKNSLFEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC          AP               P  D+
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC---------PAP--------------LPTHDQ  130

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              +         HRR       + +      C EG  PLIS+ GLHQLHI +FF+AVFH++
Sbjct  131   DKT--------HRR------HLAAATTSSRCDEGHEPLISVTGLHQLHILLFFMAVFHIL  176

Query  833   YGAITMALGRMKIRGWKEWEMAT-AQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T + D E + DPSR+RLT ETSFV++++SF T+ P  F
Sbjct  177   YSFITMMLGRLKIRGWKKWEQETFSHDYEFSVDPSRFRLTHETSFVRQHSSFWTKVPFFF  236

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+ CF +QFFRSV R DYL +RHGFI+ HLAPG KFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  237   YAGCFLQQFFRSVGRTDYLTLRHGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLL  296

Query  1187  WCA  1195
             W +
Sbjct  297   WAS  299



>ref|XP_010548198.1| PREDICTED: MLO-like protein 8 [Tarenaya hassleriana]
 ref|XP_010548199.1| PREDICTED: MLO-like protein 8 [Tarenaya hassleriana]
Length=586

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 207/306 (68%), Gaps = 36/306 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL QTPTWAVA VC   +V+S++LEK+LHK+G  F  ++K+AL+EALEK+K ELM+LGF
Sbjct  39    RELYQTPTWAVAAVCTFFIVVSVLLEKVLHKVGTVFWERRKKALLEALEKVKSELMILGF  98

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLL+TFGQ+ I KICIP     TMLPC   +                         ED+
Sbjct  99    ISLLITFGQNPILKICIPSKVARTMLPCRWKN-------------------------EDD  133

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS---GHAVEECKEGLIPLISLNGLHQLHIFIFFLAVF  823
             H+E      E  R+LLW   R LS   G ++    E    LIS   LHQLH+ IFFLAVF
Sbjct  134   HEE------ESRRKLLWYDHRFLSGAGGSSIRCPDEDHEHLISAEALHQLHLLIFFLAVF  187

Query  824   HVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TM LGR+KIRGWK W  E+++   E + DPSR+RLT ETSFV+ + SF T+ P
Sbjct  188   HVLYSFLTMMLGRLKIRGWKHWEQEVSSGNYEFSVDPSRFRLTHETSFVRAHASFWTRIP  247

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
               FY  CFFRQFFRSVR+ DYL +R+GFIS HLAPGS+F+FQKYIKRSLEDDFK+VVG++
Sbjct  248   FFFYVGCFFRQFFRSVRKTDYLTLRNGFISAHLAPGSQFNFQKYIKRSLEDDFKLVVGVS  307

Query  1178  LMLWCA  1195
              + W +
Sbjct  308   PVHWAS  313



>ref|XP_006409301.1| hypothetical protein EUTSA_v10022612mg [Eutrema salsugineum]
 gb|ESQ50754.1| hypothetical protein EUTSA_v10022612mg [Eutrema salsugineum]
Length=593

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 205/305 (67%), Gaps = 31/305 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA VC   +V+S++LEKL+HK+G     + K+AL++ALEKIK ELM+LGF
Sbjct  38    RALNQTPTWAVAAVCTFFIVVSVVLEKLIHKVGTVLSDRHKKALLDALEKIKSELMILGF  97

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI KICIP    +TMLPC                           P    
Sbjct  98    ISLLLTFGQNYILKICIPSHVAHTMLPC---------------------------PAPTA  130

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGH--AVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              +E  +  GE HRRLLW   R LSG     + C+EG   LIS   LHQLHI IFFLA+ H
Sbjct  131   WKEEEDEKGEGHRRLLWFEHRFLSGDEPPSKRCEEGYEQLISAKALHQLHILIFFLAILH  190

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y  +TM LGR+K+RGWK WE  T+    E + D SR+RLT ETSFV+ +TSF T+ P 
Sbjct  191   VLYSFLTMMLGRLKMRGWKHWEKETSSHDYEFSTDTSRFRLTHETSFVRAHTSFWTRIPF  250

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY  CFFRQFFRSV + DYL +R+GFI+VH  PG++F+FQKYIKRSLE+DFK+VVG++ 
Sbjct  251   FFYIGCFFRQFFRSVGKTDYLTLRNGFITVHFGPGAQFNFQKYIKRSLEEDFKLVVGVSP  310

Query  1181  MLWCA  1195
             +LW +
Sbjct  311   VLWAS  315



>ref|XP_006366656.1| PREDICTED: MLO-like protein 8-like isoform X2 [Solanum tuberosum]
Length=508

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 183/263 (70%), Gaps = 34/263 (13%)
 Frame = +2

Query  407   KKKRALVEALEKIKGELMVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQ  586
             + K+AL EALEK+K ELMVLGFISL L F Q YIA ICIP +  NT+LPC          
Sbjct  6     RHKKALFEALEKVKAELMVLGFISLTLVFSQYYIAGICIPTSVANTLLPC----------  55

Query  587   APGHGEHAPSGEHGEHAPPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPL  766
                               P    ++  E   EH RRLLW  RR+L+G A  +C +G + L
Sbjct  56    ------------------PAVNKEDKTE---EHRRRLLWHERRILAG-AEPKCDDGRVSL  93

Query  767   ISLNGLHQLHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYR  940
             IS++ LHQ+HI IFFLAVFHV+Y AITM LG++KIRGWK WE+ T+    E +NDPSR+R
Sbjct  94    ISIDALHQIHILIFFLAVFHVVYSAITMWLGKLKIRGWKCWELETSTHNYEFSNDPSRFR  153

Query  941   LTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDF  1120
             LT ETSFV+ +TSF T  P+ FY  CF RQFFRSV ++DYL +R+GFISVHLAPGSKF+F
Sbjct  154   LTHETSFVRAHTSFWTNIPIFFYIGCFLRQFFRSVNKSDYLTLRNGFISVHLAPGSKFNF  213

Query  1121  QKYIKRSLEDDFKVVVGINLMLW  1189
             QKYIKRSLEDDFKVVVG++ +LW
Sbjct  214   QKYIKRSLEDDFKVVVGVSPVLW  236



>gb|KDO71550.1| hypothetical protein CISIN_1g008408mg [Citrus sinensis]
 gb|KDO71551.1| hypothetical protein CISIN_1g008408mg [Citrus sinensis]
Length=325

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 176/249 (71%), Gaps = 28/249 (11%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             MVLGFISL+LTFGQSYI+KICIP    +TMLPC              G+H  S   G   
Sbjct  1     MVLGFISLILTFGQSYISKICIPSKVADTMLPC-----------KADGKHDASDTSG---  46

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFL  814
                DEH        EH RRLLW   R L+  A   EC++G  PLI++  LHQLHI IFFL
Sbjct  47    ---DEH--------EHRRRLLWFQHRYLAAAATSTECEKGSEPLITVEALHQLHILIFFL  95

Query  815   AVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y AITM LGR+KIRGWK+WE   +T   E +NDPSR+RLT ETSFV+ +TSF T
Sbjct  96    AVFHVLYSAITMMLGRLKIRGWKKWEEETSTHDYEFSNDPSRFRLTHETSFVRAHTSFWT  155

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
             + P  FY  CFFRQFFRSV RADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VV
Sbjct  156   RIPFFFYVGCFFRQFFRSVSRADYLTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKIVV  215

Query  1169  GINLMLWCA  1195
             G++ +LW +
Sbjct  216   GVSPVLWTS  224



>gb|KDO71549.1| hypothetical protein CISIN_1g008408mg [Citrus sinensis]
Length=336

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 176/249 (71%), Gaps = 28/249 (11%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             MVLGFISL+LTFGQSYI+KICIP    +TMLPC              G+H  S   G   
Sbjct  1     MVLGFISLILTFGQSYISKICIPSKVADTMLPC-----------KADGKHDASDTSG---  46

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFL  814
                DEH        EH RRLLW   R L+  A   EC++G  PLI++  LHQLHI IFFL
Sbjct  47    ---DEH--------EHRRRLLWFQHRYLAAAATSTECEKGSEPLITVEALHQLHILIFFL  95

Query  815   AVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y AITM LGR+KIRGWK+WE   +T   E +NDPSR+RLT ETSFV+ +TSF T
Sbjct  96    AVFHVLYSAITMMLGRLKIRGWKKWEEETSTHDYEFSNDPSRFRLTHETSFVRAHTSFWT  155

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
             + P  FY  CFFRQFFRSV RADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VV
Sbjct  156   RIPFFFYVGCFFRQFFRSVSRADYLTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKIVV  215

Query  1169  GINLMLWCA  1195
             G++ +LW +
Sbjct  216   GVSPVLWTS  224



>ref|XP_010466376.1| PREDICTED: MLO-like protein 10 [Camelina sativa]
 ref|XP_010466384.1| PREDICTED: MLO-like protein 10 [Camelina sativa]
Length=569

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 200/303 (66%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  34    KGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC                          A P   
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC--------------------------AAPSTH  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              Q+      + HR      RR+ +      CKEG   LI   GLHQLHI +FF+A FH++
Sbjct  128   DQD-----NKTHR------RRLAAASTSSRCKEGHEQLIPATGLHQLHILLFFMAAFHIL  176

Query  833   YGAITMALGRMKIRGWKEWEMAT-AQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T + D E + DPSR+RLT ETSFV++++SF T+ P  F
Sbjct  177   YSFITMMLGRLKIRGWKKWEQETFSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFF  236

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+ CF +QFFRSV R DYL +RHGFI+ HLAPG KFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  237   YAGCFLQQFFRSVGRTDYLTLRHGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLL  296

Query  1187  WCA  1195
             W +
Sbjct  297   WAS  299



>ref|NP_201398.1| MLO-like protein 10 [Arabidopsis thaliana]
 sp|Q9FKY5.1|MLO10_ARATH RecName: Full=MLO-like protein 10; Short=AtMlo10 [Arabidopsis 
thaliana]
 gb|AAK53803.1|AF369571_1 membrane protein Mlo10 [Arabidopsis thaliana]
 dbj|BAB10402.1| Mlo protein-like [Arabidopsis thaliana]
 gb|ACF06125.1| At5g65970 [Arabidopsis thaliana]
 gb|AED98133.1| MLO-like protein 10 [Arabidopsis thaliana]
Length=569

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 197/303 (65%), Gaps = 40/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  34    KGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC                           P    
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC---------------------------PAPST  126

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +      + HRR      R+ +      C EG  PLI   GLHQLHI +FF+A FH++
Sbjct  127   HDQ-----DKTHRR------RLAAATTSSRCDEGHEPLIPATGLHQLHILLFFMAAFHIL  175

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T     E + DPSR+RLT ETSFV++++SF T+ P  F
Sbjct  176   YSFITMMLGRLKIRGWKKWEQETCSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFF  235

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+ CF +QFFRSV R DYL +RHGFI+ HLAPG KFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  236   YAGCFLQQFFRSVGRTDYLTLRHGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLL  295

Query  1187  WCA  1195
             W +
Sbjct  296   WAS  298



>ref|XP_002865092.1| hypothetical protein ARALYDRAFT_497027 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41351.1| hypothetical protein ARALYDRAFT_497027 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 196/303 (65%), Gaps = 40/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  34    KGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC                           P    
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC---------------------------PAPST  126

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +      + HRR      R+ +      C EG   LI   GLHQLHI +FF+A FH++
Sbjct  127   HDQ-----DKTHRR------RLAAATTSSRCDEGHEALIPATGLHQLHILLFFMAAFHIL  175

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T     E + DPSR+RLT ETSFV++++SF T+ P  F
Sbjct  176   YSFITMMLGRLKIRGWKKWEQETCSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFF  235

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+VCF +QFFRSV R DYL +RHGFI  HLAPG KFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  236   YAVCFLQQFFRSVGRTDYLTLRHGFIDAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLL  295

Query  1187  WCA  1195
             W +
Sbjct  296   WAS  298



>gb|ACX55086.1| Mlo3 [Cucumis melo]
Length=487

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 181/250 (72%), Gaps = 33/250 (13%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             M+LGFISLLLTFGQ+YI KICIP    NTMLPC                          A
Sbjct  1     MILGFISLLLTFGQNYIIKICIPTKVANTMLPC--------------------------A  34

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLS--GHAVEECKEGLIPLISLNGLHQLHIFIFF  811
               ED+ ++  E  GEHHRRLL   RR L+  G AV  CKEG +PLIS++GLHQLH+FIFF
Sbjct  35    AKEDKLEKADE--GEHHRRLLMYERRFLAAAGGAVS-CKEGHVPLISISGLHQLHLFIFF  91

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAVFHV+Y AITM LGR+KIRGWK WE   +T   E +ND +R+RLT ETSFVK +TSF 
Sbjct  92    LAVFHVVYSAITMMLGRLKIRGWKAWEEETSTHNYEFSNDNARFRLTHETSFVKAHTSFW  151

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVV  1165
             T+ PV FY  CFFRQFF+SV +ADYLA+R+GFI+VHLAPGSKFDFQKYIKRSLEDDFK++
Sbjct  152   TKLPVFFYIGCFFRQFFKSVGKADYLALRNGFIAVHLAPGSKFDFQKYIKRSLEDDFKII  211

Query  1166  VGINLMLWCA  1195
             VG++ +LW +
Sbjct  212   VGVSPVLWTS  221



>gb|KHN33779.1| MLO-like protein 5 [Glycine soja]
Length=499

 Score =   291 bits (746),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 200/301 (66%), Gaps = 44/301 (15%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC +IV+IS++LEK++HK    FE +K+ AL+EALEKIK ELMVLGF
Sbjct  11    RQLDLTPTWAVAAVCAIIVIISILLEKIIHKFAKMFEERKQHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+K+CIP     TMLPC+  +E   H A  H E A  GE          
Sbjct  71    ISLLLTFGQNYISKMCIPSKYAKTMLPCVPPEE--RHGAGHHTEEAGGGE----------  118

Query  653   HQEPAEAGGEHHRRLLWSMRRVL-SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                 A+ GG H RRLL   RR L SG   + CK G  PLIS+ GLHQLHIFIFFLAVFHV
Sbjct  119   ----AKDGG-HRRRLLSYERRFLASGGGGQSCKPGYTPLISVTGLHQLHIFIFFLAVFHV  173

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWK WE     D +A NDP R+RLT ETSFV+++ S  T+TPV F
Sbjct  174   IYSAITMTLGRAKIRGWKAWEADHIVDQDALNDPRRFRLTHETSFVRDHNSIWTKTPVSF  233

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y                          VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  234   Y-------------------------LVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLL  268

Query  1187  W  1189
             W
Sbjct  269   W  269



>ref|XP_010484707.1| PREDICTED: MLO-like protein 10 [Camelina sativa]
Length=569

 Score =   293 bits (751),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 200/303 (66%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  34    KGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC                          A P   
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC--------------------------AAPSTH  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              Q+      + HR      RR+ S      C+EG   LI   GLHQLHI +FF+A FH++
Sbjct  128   DQD-----NKTHR------RRLASASTSSRCEEGHEQLIPATGLHQLHILLFFMAAFHIL  176

Query  833   YGAITMALGRMKIRGWKEWEMAT-AQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T + D E + DPSR+RLT ETSFV++++SF T+ P  F
Sbjct  177   YSFITMMLGRLKIRGWKKWEQETFSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFF  236

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+ CF +QFFRSV R DYL +RHGFI+ HLAPG +FDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  237   YAGCFLQQFFRSVGRTDYLTLRHGFIAAHLAPGRQFDFQKYIKRSLEDDFKVVVGISPLL  296

Query  1187  WCA  1195
             W +
Sbjct  297   WAS  299



>gb|KFK28258.1| hypothetical protein AALP_AA8G493400 [Arabis alpina]
Length=558

 Score =   293 bits (749),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 196/303 (65%), Gaps = 41/303 (14%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++L++TPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  27    KQLNETPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  86

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  TMLPC  HD+                           
Sbjct  87    ISLLLTFGEHYIVKICIPEKAAATMLPCSTHDQ---------------------------  119

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                       H RRL        S      CKEG  PL+   GLHQLHI +FFLA FH++
Sbjct  120   -------DKTHRRRL-----AAASTSTSSTCKEGHEPLVPAKGLHQLHILLFFLAAFHIL  167

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+K RGWK+WE  T     E + DPSR+RL+ ETSFV++++SF T+ P  F
Sbjct  168   YSFITMMLGRLKTRGWKKWEQETLSHDYEFSIDPSRFRLSHETSFVRQHSSFWTKIPFFF  227

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFF+QFFRSV R DYL +R GFI+ HLAPG KFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  228   YVGCFFQQFFRSVGRTDYLTLRQGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLL  287

Query  1187  WCA  1195
             W +
Sbjct  288   WAS  290



>gb|KHN20092.1| MLO-like protein 5 [Glycine soja]
Length=483

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 201/301 (67%), Gaps = 36/301 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LD TPTWAVA VC +IV+IS++LEK++HK    FE +KK AL+EALEKIK ELMVLGF
Sbjct  11    RQLDLTPTWAVAAVCAIIVIISILLEKIIHKFAKVFEERKKHALLEALEKIKAELMVLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YI+K+CIP     TMLPCL  +E        HG  AP+ EHG     E  
Sbjct  71    ISLLLTFGQNYISKMCIPAKYARTMLPCLPLEER-------HGG-APATEHGAQT-EEGG  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGH-AVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG HHRRLL   RR L+     + C  G  PLIS++GLHQLHIFIFFLAVFHV
Sbjct  122   GGGGEAEGGGHHRRLLSYERRFLAAEGGGQSCNPGYTPLISVSGLHQLHIFIFFLAVFHV  181

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             IY AITM LGR KIRGWKEWE     D +A NDP R+RLT ETSFV+++ S  T+TPV F
Sbjct  182   IYSAITMTLGRAKIRGWKEWEEDHIVDQDALNDPRRFRLTHETSFVRDHNSIWTKTPVSF  241

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y                          VHLAPGSKFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  242   Y-------------------------FVHLAPGSKFDFQKYIKRSLEDDFKVVVGISPLL  276

Query  1187  W  1189
             W
Sbjct  277   W  277



>gb|KDO71547.1| hypothetical protein CISIN_1g008408mg [Citrus sinensis]
 gb|KDO71548.1| hypothetical protein CISIN_1g008408mg [Citrus sinensis]
Length=496

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 176/249 (71%), Gaps = 28/249 (11%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             MVLGFISL+LTFGQSYI+KICIP    +TMLPC              G+H  S   G   
Sbjct  1     MVLGFISLILTFGQSYISKICIPSKVADTMLPC-----------KADGKHDASDTSG---  46

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFL  814
                DEH        EH RRLLW   R L+  A   EC++G  PLI++  LHQLHI IFFL
Sbjct  47    ---DEH--------EHRRRLLWFQHRYLAAAATSTECEKGSEPLITVEALHQLHILIFFL  95

Query  815   AVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y AITM LGR+KIRGWK+WE   +T   E +NDPSR+RLT ETSFV+ +TSF T
Sbjct  96    AVFHVLYSAITMMLGRLKIRGWKKWEEETSTHDYEFSNDPSRFRLTHETSFVRAHTSFWT  155

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
             + P  FY  CFFRQFFRSV RADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VV
Sbjct  156   RIPFFFYVGCFFRQFFRSVSRADYLTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKIVV  215

Query  1169  GINLMLWCA  1195
             G++ +LW +
Sbjct  216   GVSPVLWTS  224



>ref|NP_179335.3| MLO-like protein 7 [Arabidopsis thaliana]
 sp|O22752.3|MLO7_ARATH RecName: Full=MLO-like protein 7; Short=AtMlo7; AltName: Full=Protein 
NORTIA [Arabidopsis thaliana]
 gb|AEC06624.1| MLO-like protein 7 [Arabidopsis thaliana]
Length=542

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 201/303 (66%), Gaps = 35/303 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             +EL QTPTWAVA+VC  +++IS +LEK L ++ +   +K K +L+EALEKIK ELM+LGF
Sbjct  31    KELSQTPTWAVAVVCTFLILISHLLEKGLQRLANWLWKKHKNSLLEALEKIKAELMILGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KIC+P  A  +MLPCL  D  +  +       APS            
Sbjct  91    ISLLLTFGEPYILKICVPRKAALSMLPCLSEDTVLFQKL------APSSLS---------  135

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                         R LL       +G     CK+G  PLI+L GLHQLHI +FFLA+FH++
Sbjct  136   ------------RHLL------AAGDTSINCKQGSEPLITLKGLHQLHILLFFLAIFHIV  177

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM L R+KIRGWK+WE  T  +  E + D SR RLT ETSFV+E+TSF T TP  F
Sbjct  178   YSLITMMLSRLKIRGWKKWEQETLSNDYEFSIDHSRLRLTHETSFVREHTSFWTTTPFFF  237

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +L
Sbjct  238   YVGCFFRQFFVSVERTDYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLVVGISPVL  297

Query  1187  WCA  1195
             W +
Sbjct  298   WAS  300



>ref|XP_010500219.1| PREDICTED: MLO-like protein 9 [Camelina sativa]
Length=461

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 197/300 (66%), Gaps = 23/300 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAV+ VC VI++IS++LE ++HK+G  F +KKK+AL EALEKIK ELMVLGF
Sbjct  14    RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFVKKKKKALFEALEKIKSELMVLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFGQ+YIA IC+P   G+ M  C   D   +                        
Sbjct  74    ISLLLTFGQNYIASICVPSRYGHAMSFCGPSDGPSDDDD---------------------  112

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +      EH  R+L   RR  +      CK+  + L SLN LHQ+HIFIFFLAVFHVI
Sbjct  113   -NDKKLKNTEHAMRILSIQRRSSADAPPVNCKKDYVALRSLNALHQVHIFIFFLAVFHVI  171

Query  833   YGAITMALGRMKIRGWKEWEMATA-QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFY  1009
             Y AITM LGR KIRGWK WE     + E  NDPSR+RLT ETSFV+E+ +        FY
Sbjct  172   YSAITMMLGRAKIRGWKVWEQEIIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFY  231

Query  1010  SVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLW  1189
              +CFF Q  RSVR++DYL MRHG ISVHLAPG KFDFQKYIKRSLEDDFKVVVGI   LW
Sbjct  232   VMCFFHQILRSVRKSDYLTMRHGLISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIIPELW  291



>ref|XP_006281817.1| hypothetical protein CARUB_v10028002mg [Capsella rubella]
 gb|EOA14715.1| hypothetical protein CARUB_v10028002mg [Capsella rubella]
Length=569

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 198/303 (65%), Gaps = 40/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  34    KGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC                           P    
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC---------------------------PAPST  126

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H +      + HR      RR+ +      C EG   LI   GLHQLHI +FF+A FH++
Sbjct  127   HDQ-----DKTHR------RRLSAAATSSRCDEGHEQLIPATGLHQLHILLFFMAAFHIL  175

Query  833   YGAITMALGRMKIRGWKEWEMAT-AQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T + D E + DPSR+RLT ETSFV++++SF T+ P  F
Sbjct  176   YSFITMMLGRLKIRGWKKWEQETFSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKVPFFF  235

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+ CF +QFFRSV R DYL +RHGFI+ HLAPG KFDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  236   YAGCFLQQFFRSVGRTDYLTLRHGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLL  295

Query  1187  WCA  1195
             W +
Sbjct  296   WAS  298



>ref|XP_010550512.1| PREDICTED: MLO-like protein 10 isoform X2 [Tarenaya hassleriana]
Length=493

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 195/303 (64%), Gaps = 45/303 (15%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL Q PTWAVA+VC + + ISL+LEK L ++      K K +L+EAL+KIK ELM+LGF
Sbjct  30    RELFQIPTWAVAVVCTIFIFISLLLEKGLDRVTSWLWEKHKSSLLEALDKIKAELMILGF  89

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KICIPE A  TMLPC                 AP   H  H   ++ 
Sbjct  90    ISLLLTFGEAYILKICIPEKAAVTMLPC----------------PAPDMTHRRHLAADNT  133

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +                           CK+G  PL+S+ GLHQLHI +FFLAVFHV+
Sbjct  134   SYQ---------------------------CKKGHEPLMSVKGLHQLHILLFFLAVFHVL  166

Query  833   YGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T   +   + DPSR+RLT ETSFV+ +TSF T+ P LF
Sbjct  167   YSFITMMLGRLKIRGWKKWEKETLSHDYQFSVDPSRFRLTHETSFVRAHTSFWTRVPFLF  226

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CF RQFFRSV R DYL +RHGFI+ HL PG +FDFQKYIKRSLEDDFK+ VGI+ +L
Sbjct  227   YLGCFLRQFFRSVGRTDYLTLRHGFIATHLTPGRQFDFQKYIKRSLEDDFKIAVGISPVL  286

Query  1187  WCA  1195
             W +
Sbjct  287   WAS  289



>tpg|DAA46107.1| TPA: hypothetical protein ZEAMMB73_604520 [Zea mays]
Length=376

 Score =   285 bits (729),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 152/303 (50%), Positives = 195/303 (64%), Gaps = 36/303 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE  LH +G    +K+K+AL +ALEK+K ELM LGF
Sbjct  7     RALDQTPTWAVAAVCAVIVAASILLEGFLHHLGQLLNKKRKKALFDALEKVKSELMTLGF  66

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT    YIA+ICIPE A NTMLPC +    V  +  GHG    S            
Sbjct  67    ISLLLTVTGRYIARICIPEGAANTMLPCRLSGHSVAEEPKGHGRRHLS------------  114

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              ++P                       +  C++G++ L+S +G+HQLHIF+FFLAVFHV 
Sbjct  115   -EDPTN---------------------LFSCRKGMVSLVSADGMHQLHIFVFFLAVFHVT  152

Query  833   YGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             +   TM+LGR K R WK WE  T   Q    NDPS++RLT +TSFV+++ S  +++ +  
Sbjct  153   FSFFTMSLGRAKTRIWKVWEKETCSPQYNYLNDPSKFRLTHQTSFVRQHASCWSKSTITL  212

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y V FFRQFFRSVR+ DY  +RHGFIS HL+PG++F+F+KYIKRSLEDDFK VVGI+  L
Sbjct  213   YFVSFFRQFFRSVRKTDYFTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISPPL  272

Query  1187  WCA  1195
             W +
Sbjct  273   WAS  275



>ref|XP_009112429.1| PREDICTED: MLO-like protein 7 [Brassica rapa]
Length=538

 Score =   290 bits (741),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 196/303 (65%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVA+VC  +++IS +LEK LH++G+   +K+K +L+EALEKIK ELM+LGF
Sbjct  31    KTLSQTPTWAVAVVCTFLIIISHLLEKGLHRLGNWLWKKQKNSLLEALEKIKAELMILGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KIC+P  A  +MLPC                  PS +    AP   +
Sbjct  91    ISLLLTFGETYILKICVPSKAALSMLPC------------------PSEKTNTLAPSLSK  132

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H   A                   G     CK G  PLI+L GLHQLHI +FFLA+FHV+
Sbjct  133   HLLAA-------------------GDLSVNCKNGSEPLITLKGLHQLHILLFFLAIFHVL  173

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM L R++IRGWK+WE  T     E   D +R RLT ETSFVK +TSF T  P  F
Sbjct  174   YSLITMMLSRLQIRGWKKWEQETLSHDYELCIDQTRLRLTHETSFVKLHTSFWTAIPFFF  233

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +L
Sbjct  234   YVGCFFRQFFVSVGRTDYLTLRHGFISAHLAPGMKFNFQRYIKRSLEDDFKLVVGISPVL  293

Query  1187  WCA  1195
             W +
Sbjct  294   WAS  296



>gb|AES95366.2| seven transmembrane MLO family protein [Medicago truncatula]
Length=567

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 201/303 (66%), Gaps = 30/303 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTW VA VC V ++IS+ LEK LHK+G    +++K+AL+EALEK+K ELM+LGF
Sbjct  28    RTLDQTPTWGVAAVCTVFILISIALEKSLHKLGTWLGKREKKALLEALEKVKAELMILGF  87

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ+YI +ICI E   N MLPC                H   G   +     ++
Sbjct  88    ISLLLTIGQNYIVRICISEKIANKMLPC---------------PHKYIGGDKKSNSKVEQ  132

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             ++ P    G +      S +    GH          PL+S+NGLHQLHI IFFLAVFHV 
Sbjct  133   NRIPVSFEGRYLAADTPSFKCSRKGHE---------PLLSVNGLHQLHILIFFLAVFHVF  183

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y A+TM LGR+KIRGWKEWE  T     E AND ++ RLT ETSFV+ +TSF T+     
Sbjct  184   YSAVTMLLGRLKIRGWKEWEEETLTHGYEFANDAAKLRLTHETSFVRAHTSFWTRV----  239

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CFFRQF+RSVR+ DY  +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  240   YIGCFFRQFYRSVRKVDYQTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  299

Query  1187  WCA  1195
             W +
Sbjct  300   WAS  302



>ref|XP_004985865.1| PREDICTED: MLO protein homolog 1-like [Setaria italica]
Length=553

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 208/309 (67%), Gaps = 42/309 (14%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL +TPTWAVALVC VIV++S+ +E  LHK+GH F  ++K+A+ EALEKIK ELM++GF
Sbjct  8     RELPETPTWAVALVCAVIVLLSVAMEHGLHKLGHWFHTRQKKAMREALEKIKAELMLMGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL  GQ+ I+KICIP  AG+ MLPC                            P+D+
Sbjct  68    ISLLLAVGQTPISKICIPTKAGSVMLPC---------------------------KPKDD  100

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEE-CKE-GLIPLISLNGLHQLHIFIF  808
                  E+GG+  RRLLW      + RR L+G   E+ CKE G + LIS  G+HQLHIFIF
Sbjct  101   ----GESGGDRRRRLLWYPGEEVNHRRFLAGAVGEDYCKEKGKVSLISTTGVHQLHIFIF  156

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV+Y   TMAL R+K+R WK WE  T+  E   ANDPSR+R T +TSFVK +   
Sbjct  157   VLAVFHVVYSVATMALARLKMRRWKRWESETSSLEYQFANDPSRFRFTNQTSFVKRHLG-  215

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
             ++ TP + + V FFRQFF SV + DYL MR GFI+ HL+P +KFDFQKYIKRSLEDDFKV
Sbjct  216   VSSTPGVRWMVAFFRQFFASVTKVDYLTMRQGFINAHLSPNAKFDFQKYIKRSLEDDFKV  275

Query  1163  VVGINLMLW  1189
             VVGI+L LW
Sbjct  276   VVGISLPLW  284



>emb|CDY26808.1| BnaC09g09350D [Brassica napus]
Length=540

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 196/304 (64%), Gaps = 40/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVA+VC  +++IS  LEK LH++G+   +K+K +L+EALEKIK ELM+LGF
Sbjct  31    KTLSQTPTWAVAVVCTFLIIISHFLEKGLHRLGNCLWKKQKNSLLEALEKIKAELMILGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KIC+P  A  +MLPC                  PS +    AP   +
Sbjct  91    ISLLLTFGETYILKICVPSKAALSMLPC------------------PSEKMNTLAPSLSK  132

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H   A                   G     CK G  PLI+L GLHQLHI +FFLA+FHV+
Sbjct  133   HLLAA-------------------GDLSVNCKNGSEPLITLKGLHQLHILLFFLAIFHVL  173

Query  833   YGAITMALGRMKIRGWKEWEMATAQDE---AANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             Y  ITM L R++IRGWK+WE  T   +   +  D +R RLT ETSFVK +TSF T  P  
Sbjct  174   YSLITMMLSRLQIRGWKKWEQETLSHDYEFSVADQTRLRLTHETSFVKLHTSFWTAIPFF  233

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +
Sbjct  234   FYVGCFFRQFFVSVGRTDYLTLRHGFISAHLAPGIKFNFQRYIKRSLEDDFKLVVGISPV  293

Query  1184  LWCA  1195
             LW +
Sbjct  294   LWAS  297



>emb|CDY30365.1| BnaA09g09120D [Brassica napus]
Length=540

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 197/304 (65%), Gaps = 40/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVA+VC  +++IS +LEK LH++G+   +K+K +L+EALEKIK ELM+LGF
Sbjct  31    KTLSQTPTWAVAVVCTFLIIISHLLEKGLHRLGNWLWKKQKNSLLEALEKIKAELMILGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KIC+P  A  +MLPC                  PS +    AP   +
Sbjct  91    ISLLLTFGETYILKICVPSKAALSMLPC------------------PSEKTNTLAPSLSK  132

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             H   A                   G     CK G  PLI+L GLHQLHI +FFLA+FHV+
Sbjct  133   HLLAA-------------------GDLSVNCKNGSEPLITLKGLHQLHILLFFLAIFHVL  173

Query  833   YGAITMALGRMKIRGWKEWEMATAQDE---AANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             Y  ITM L R++IRGWK+WE  T   +   +  D +R RLT ETSFVK +TSF T  P  
Sbjct  174   YSLITMMLSRLQIRGWKKWEQETLSHDYEFSVADQTRLRLTHETSFVKLHTSFWTAIPFF  233

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +
Sbjct  234   FYVGCFFRQFFVSVGRTDYLTLRHGFISAHLAPGIKFNFQRYIKRSLEDDFKLVVGISPV  293

Query  1184  LWCA  1195
             LW +
Sbjct  294   LWAS  297



>ref|XP_010444861.1| PREDICTED: MLO-like protein 10 [Camelina sativa]
Length=559

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 199/303 (66%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVALVC   +++S++LEK LH++      K K +L+EALEKIK ELM+LGF
Sbjct  34    KGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEKIKAELMILGF  93

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG+ YI KICIPE A  +MLPC                          A P   
Sbjct  94    ISLLLTFGEQYILKICIPEKAAASMLPC--------------------------ASPSTH  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              Q+      + HR      RR+ +      C+EG   LI   GLHQLHI +FF+A FH++
Sbjct  128   DQD-----NKTHR------RRLAAASTSSRCEEGHEQLIPATGLHQLHILLFFMAAFHIL  176

Query  833   YGAITMALGRMKIRGWKEWEMAT-AQD-EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM LGR+KIRGWK+WE  T + D E +  PSR+RLT ETSFV++++SF T+ P  F
Sbjct  177   YSFITMMLGRLKIRGWKKWEQETFSHDYEFSIHPSRFRLTHETSFVRQHSSFWTKIPFFF  236

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y+ CF +QFFRSV R DYL +RHGFI+ HLAPG +FDFQKYIKRSLEDDFKVVVGI+ +L
Sbjct  237   YAGCFLQQFFRSVGRTDYLTLRHGFIAAHLAPGRQFDFQKYIKRSLEDDFKVVVGISPLL  296

Query  1187  WCA  1195
             W +
Sbjct  297   WAS  299



>ref|XP_006850616.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
 gb|ERN12197.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
Length=600

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 215/313 (69%), Gaps = 33/313 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVA+VC V+V++S+++E  +H +G    ++ KRAL EALEKIK ELM+LGF
Sbjct  8     RSLEETPTWAVAVVCFVMVLVSILIEHAIHLVGKWLTKRHKRALYEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I++ICI ++ G+++LPC  +D+ +             GEH   +  +DE
Sbjct  68    ISLLLTIGQDTISRICISKSMGDSLLPCRKNDQSIN-----------GGEHVSESGDDDE  116

Query  653   HQEPAEAGGEHHRRLLW---------SMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIF  802
                     G  +RRLLW         S+RRVL+G   ++C  +G +PLIS +G HQLHIF
Sbjct  117   --------GSSNRRLLWLDDFDQPHPSLRRVLAGSKYDKCSPQGKVPLISYDGTHQLHIF  168

Query  803   IFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENT  976
             IF LAVFHV+Y   TMALGR+K++ WK+WE  T   E   ++DP R+R  +ETSF + + 
Sbjct  169   IFVLAVFHVLYCISTMALGRLKMKRWKKWEQETKTIEYQWSHDPERFRFARETSFGRRHL  228

Query  977   SFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLED  1150
             +F T++P+L + VCFFRQF RSV + DYL +RHGFI  HLAP S  KFDF KYIKRSLE+
Sbjct  229   NFWTKSPILIWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSSTKFDFHKYIKRSLEE  288

Query  1151  DFKVVVGINLMLW  1189
             DFKVVVGI+ ++W
Sbjct  289   DFKVVVGISPIIW  301



>ref|XP_003574266.1| PREDICTED: MLO-like protein 9 [Brachypodium distachyon]
Length=561

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 200/303 (66%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE +LH +G  F ++KK+AL +ALEK+K ELM LGF
Sbjct  11    RALDQTPTWAVAAVCAVIVAASILLEGILHHLGQWFSKRKKKALFDALEKVKSELMTLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT    YI++ICIPE A +TMLPC     H E +  GHG    S E    +     
Sbjct  71    ISLLLTVTARYISRICIPEGAADTMLPCPKISRHGEQK--GHGRRHLSEEPNNFS-----  123

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                                           C +G++ L+S +GLHQLHIF+FFLA+FHV 
Sbjct  124   ------------------------------CPKGMVSLVSADGLHQLHIFVFFLALFHVA  153

Query  833   YGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             + AITM+LGR K R WKEWE  T     E ++DPS++RLT +TSFV+++ S  +++ ++ 
Sbjct  154   FSAITMSLGRAKTRIWKEWEKDTCSLTYEFSSDPSKFRLTHQTSFVRQHASCWSKSTIML  213

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y V FFRQFFRSVRR DY+ +RHGFIS HL+PG++F+F+KYIKRSLEDDFK VVGI+  L
Sbjct  214   YFVSFFRQFFRSVRRTDYMTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISPPL  273

Query  1187  WCA  1195
             W +
Sbjct  274   WAS  276



>ref|XP_003612408.1| Mlo family protein [Medicago truncatula]
Length=564

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 200/303 (66%), Gaps = 33/303 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTW VA VC V ++IS+ LEK LHK+G    +++K+AL+EALEK+K ELM+LGF
Sbjct  28    RTLDQTPTWGVAAVCTVFILISIALEKSLHKLGTWLGKREKKALLEALEKVKAELMILGF  87

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ+YI +ICI E   N MLPC                H   G   +     ++
Sbjct  88    ISLLLTIGQNYIVRICISEKIANKMLPC---------------PHKYIGGDKKSNSKVEQ  132

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
             ++ P    G +      S +    GH          PL+S+NGLHQLHI IFFLAVFHV 
Sbjct  133   NRIPVSFEGRYLAADTPSFKCSRKGHE---------PLLSVNGLHQLHILIFFLAVFHVF  183

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y A+TM LGR+KIRGWKEWE  T     E AND ++ RLT ETSFV+ +TSF T+     
Sbjct  184   YSAVTMLLGRLKIRGWKEWEEETLTHGYEFANDAAKLRLTHETSFVRAHTSFWTRG----  239

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
                CFFRQF+RSVR+ DY  +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFKVVVG++ +L
Sbjct  240   ---CFFRQFYRSVRKVDYQTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKVVVGVSPVL  296

Query  1187  WCA  1195
             W +
Sbjct  297   WAS  299



>ref|XP_008448446.1| PREDICTED: MLO-like protein 8 isoform X2 [Cucumis melo]
 ref|XP_008448447.1| PREDICTED: MLO-like protein 8 isoform X2 [Cucumis melo]
 ref|XP_008448448.1| PREDICTED: MLO-like protein 8 isoform X2 [Cucumis melo]
Length=491

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 171/249 (69%), Gaps = 29/249 (12%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             M+LGFISLLLTF Q+YI +ICIP +  N+MLPC                  P  E    +
Sbjct  1     MILGFISLLLTFAQAYIVQICIPPSIANSMLPC------------------PLKEKDASS  42

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFL  814
                DE         EHHRRL W +RR L+G H V  CK+G + LIS++GLHQLHI IFFL
Sbjct  43    STTDED--------EHHRRLQWLIRRSLAGGHNVVSCKDGKVSLISIDGLHQLHILIFFL  94

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV++  ITM LGR+KIRGWKEWE  T     E  NDP+R+RLT ETSFVK +TSF T
Sbjct  95    AVFHVLFSVITMTLGRVKIRGWKEWEQETLTHNYEFFNDPARFRLTHETSFVKAHTSFWT  154

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
             + P  FY  CFFRQF+ SV RADYL +R+GFI+VHLAPGSKF+FQ+YIKRSLEDDFKVVV
Sbjct  155   RLPFFFYISCFFRQFYGSVSRADYLTLRNGFITVHLAPGSKFNFQRYIKRSLEDDFKVVV  214

Query  1169  GINLMLWCA  1195
             G++  LW  
Sbjct  215   GVSPFLWST  223



>ref|XP_008786739.1| PREDICTED: MLO protein homolog 1 [Phoenix dactylifera]
Length=545

 Score =   286 bits (731),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 202/307 (66%), Gaps = 39/307 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+ TPTWAVALVC V+V+IS+M+E  +HK+G  F+ + K+A+ EALEKIK ELM+LGF
Sbjct  9     RSLEDTPTWAVALVCAVMVIISMMMEHAIHKLGKLFQTRHKKAMNEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ+ I+KICIP  AG+ MLPC                     +       ED 
Sbjct  69    ISLLLTIGQAPISKICIPAKAGDIMLPC---------------------KKAHDVEKED-  106

Query  653   HQEPAEAGGEHHRRLLWSMR-----RVLSGHAVEECKEG-LIPLISLNGLHQLHIFIFFL  814
                     G+  RRLLW        R+L+   V+ C     +PLIS NG+HQLHIFIF L
Sbjct  107   --------GDGRRRLLWYQEKVVWHRILAEATVDHCSNSDKVPLISQNGIHQLHIFIFVL  158

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y  +TMALG+ K++ WK WE  TA  E   +NDPSR+R T +TSFVK +   ++
Sbjct  159   AVFHVLYSILTMALGQAKMKKWKTWEAETASLEYQFSNDPSRFRFTHQTSFVKRHVG-LS  217

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
              TP + + V FFRQFFRSV + DYL MRHGFI+ HL+P SKFDF KYIKRSLEDDFKVVV
Sbjct  218   STPGIRWMVAFFRQFFRSVTKVDYLTMRHGFITAHLSPNSKFDFHKYIKRSLEDDFKVVV  277

Query  1169  GINLMLW  1189
             GI+  LW
Sbjct  278   GISSPLW  284



>ref|XP_008648416.1| PREDICTED: barley mlo defense gene homolog2 isoform X1 [Zea mays]
Length=548

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 194/305 (64%), Gaps = 40/305 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE  LH +G    +K+K+AL +ALEK+K ELM LGF
Sbjct  7     RALDQTPTWAVAAVCAVIVAASILLEGFLHHLGQLLNKKRKKALFDALEKVKSELMTLGF  66

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT    YIA+ICIPE A NTMLPC +    V  +  GHG                 
Sbjct  67    ISLLLTVTGRYIARICIPEGAANTMLPCRLSGHSVAEEPKGHG-----------------  109

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE--ECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
                                RR LS        C++G++ L+S +G+HQLHIF+FFLAVFH
Sbjct  110   -------------------RRHLSEDPTNLFSCRKGMVSLVSADGMHQLHIFVFFLAVFH  150

Query  827   VIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V +   TM+LGR K R WK WE  T   Q    NDPS++RLT +TSFV+++ S  +++ +
Sbjct  151   VTFSFFTMSLGRAKTRIWKVWEKETCSPQYNYLNDPSKFRLTHQTSFVRQHASCWSKSTI  210

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
               Y V FFRQFFRSVR+ DY  +RHGFIS HL+PG++F+F+KYIKRSLEDDFK VVGI+ 
Sbjct  211   TLYFVSFFRQFFRSVRKTDYFTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISP  270

Query  1181  MLWCA  1195
              LW +
Sbjct  271   PLWAS  275



>ref|XP_002465934.1| hypothetical protein SORBIDRAFT_01g048500 [Sorghum bicolor]
 gb|EER92932.1| hypothetical protein SORBIDRAFT_01g048500 [Sorghum bicolor]
Length=563

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 208/314 (66%), Gaps = 45/314 (14%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L  TPTWAVA+VC VIV++S+ +E  LHK+GH F  ++K+A+ EALEKIK ELM++GF
Sbjct  8     RDLPSTPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHTRQKKAMREALEKIKAELMLMGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL  GQ+ I+KICIP  AGN MLPC                             + +
Sbjct  68    ISLLLAVGQTPISKICIPTKAGNIMLPC-----------------------------KAQ  98

Query  653   HQEPAEAGGEHHRRLLWSM----------RRVLSGHAVEE--C-KEGLIPLISLNGLHQL  793
               + +E+GG+  RRLLW            RR L+G A  +  C K+G + LIS NG+HQL
Sbjct  99    KDDDSESGGDARRRLLWYSPYSGEEYGHHRRFLAGAAATDDYCDKQGKVSLISTNGVHQL  158

Query  794   HIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVK  967
             HIFIF LAVFH+ Y   TMALGR+K+R WK+WE+ T   E   ANDPSR+R T +TSFVK
Sbjct  159   HIFIFVLAVFHISYSVATMALGRLKMRKWKKWELETNSVEYQFANDPSRFRFTHQTSFVK  218

Query  968   ENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLE  1147
              +   ++ TP + + V FFRQFF SV + DYL MR GFI+ HL+P +KF+FQ+YIKRSLE
Sbjct  219   RHLG-LSSTPGVRWIVGFFRQFFASVTKVDYLTMRQGFINYHLSPNAKFNFQQYIKRSLE  277

Query  1148  DDFKVVVGINLMLW  1189
             DDFKVVVGI+L LW
Sbjct  278   DDFKVVVGISLPLW  291



>ref|XP_010918343.1| PREDICTED: MLO protein homolog 1 [Elaeis guineensis]
Length=546

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 205/307 (67%), Gaps = 40/307 (13%)
 Frame = +2

Query  296   ELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGFI  475
              L+ TPTWAVALVC ++V+IS+M+E  +HK+G  F+ ++K+A+ EALEKIK ELM+LGFI
Sbjct  10    SLEVTPTWAVALVCAIMVIISVMIEHGIHKLGKWFQTRQKKAMNEALEKIKAELMLLGFI  69

Query  476   SLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDEH  655
             SLLLT GQ+ I+KICIP  AG+ MLPC                              D  
Sbjct  70    SLLLTIGQTTISKICIPAKAGDIMLPC--------------------------KKAHDVE  103

Query  656   QEPAEAGGEHHRRLLWSMR-----RVLSGHAVEECKE--GLIPLISLNGLHQLHIFIFFL  814
             +E +++     RRLLW        R+L+G  V+ C +    +PLIS +G+HQLHIFIF L
Sbjct  104   KEDSDS----QRRLLWHQEKVVWHRILAGSTVDNCSKYKDKVPLISQSGIHQLHIFIFVL  159

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y  +TMALG+ K++ WK WE  TA  E   +NDPSR+R T +TSFVK +   ++
Sbjct  160   AVFHVLYSVLTMALGKAKMKKWKTWEAETASLEYQFSNDPSRFRFTHQTSFVKRHVG-LS  218

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
              TP + + V FFRQFFRSV + DYL MRHGFI+ HL+P SKFDF KYIKRSLEDDFKVVV
Sbjct  219   STPGIRWIVAFFRQFFRSVTKVDYLTMRHGFINAHLSPNSKFDFHKYIKRSLEDDFKVVV  278

Query  1169  GINLMLW  1189
             GI+  LW
Sbjct  279   GISFPLW  285



>ref|NP_001105168.1| barley mlo defense gene homolog2 [Zea mays]
 gb|AAK38338.1| seven transmembrane protein Mlo2 [Zea mays]
 gb|ACN28009.1| unknown [Zea mays]
 tpg|DAA46108.1| TPA: Seven transmembrane protein Mlo2 [Zea mays]
Length=565

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 194/305 (64%), Gaps = 40/305 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE  LH +G    +K+K+AL +ALEK+K ELM LGF
Sbjct  7     RALDQTPTWAVAAVCAVIVAASILLEGFLHHLGQLLNKKRKKALFDALEKVKSELMTLGF  66

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT    YIA+ICIPE A NTMLPC +    V  +  GHG                 
Sbjct  67    ISLLLTVTGRYIARICIPEGAANTMLPCRLSGHSVAEEPKGHG-----------------  109

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE--ECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
                                RR LS        C++G++ L+S +G+HQLHIF+FFLAVFH
Sbjct  110   -------------------RRHLSEDPTNLFSCRKGMVSLVSADGMHQLHIFVFFLAVFH  150

Query  827   VIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V +   TM+LGR K R WK WE  T   Q    NDPS++RLT +TSFV+++ S  +++ +
Sbjct  151   VTFSFFTMSLGRAKTRIWKVWEKETCSPQYNYLNDPSKFRLTHQTSFVRQHASCWSKSTI  210

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
               Y V FFRQFFRSVR+ DY  +RHGFIS HL+PG++F+F+KYIKRSLEDDFK VVGI+ 
Sbjct  211   TLYFVSFFRQFFRSVRKTDYFTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISP  270

Query  1181  MLWCA  1195
              LW +
Sbjct  271   PLWAS  275



>ref|XP_004159746.1| PREDICTED: MLO-like protein 8-like [Cucumis sativus]
Length=488

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 171/249 (69%), Gaps = 32/249 (13%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             M+LGFISLLLTF Q+YI +ICIP A  N+MLPC                           
Sbjct  1     MILGFISLLLTFAQAYIVQICIPPAIANSMLPC---------------------------  33

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLS-GHAVEECKEGLIPLISLNGLHQLHIFIFFL  814
                 E +  +    EHHRRL W +RR L+ GH V  C++G + LIS++GLHQLHI IFFL
Sbjct  34    --RREEKNASTDEDEHHRRLQWLIRRSLAGGHNVVSCEDGKVSLISIDGLHQLHILIFFL  91

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV++  ITM LGR+KIRGWKEWE  T+    E  NDP+R+RLT ETSFVK +TSF T
Sbjct  92    AVFHVLFSVITMTLGRIKIRGWKEWEQETSTHNYEFFNDPARFRLTHETSFVKAHTSFWT  151

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
             + P  FY  CFFRQF+ SV +ADYL +R+GFI+VHLAPGSKF+FQ+YIKRSLEDDFKVVV
Sbjct  152   RLPFFFYISCFFRQFYGSVSKADYLTLRNGFITVHLAPGSKFNFQRYIKRSLEDDFKVVV  211

Query  1169  GINLMLWCA  1195
             G++  LW +
Sbjct  212   GVSPFLWSS  220



>ref|XP_002884057.1| ATMLO7/MLO7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60316.1| ATMLO7/MLO7 [Arabidopsis lyrata subsp. lyrata]
Length=541

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 195/304 (64%), Gaps = 38/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++L QTPTWAVA+VC  +++IS +LEK L ++     +K K +L+EALEKIK ELM+LGF
Sbjct  31    KQLSQTPTWAVAVVCTFLILISHLLEKGLQRLADWLWKKHKNSLLEALEKIKAELMILGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHD-EHVEHQAPGHGEHAPSGEHGEHAPPED  649
             ISLLLTFG++YI KIC+   A  +MLPC   D E  +  AP    H  +           
Sbjct  91    ISLLLTFGETYILKICVSRKAALSMLPCSSEDTELFQKLAPSLSRHLLA-----------  139

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                                     +G     CK+G  PLI+L GLHQLHI +FFLAVFHV
Sbjct  140   ------------------------AGDISVNCKQGSEPLITLKGLHQLHILLFFLAVFHV  175

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  ITM L R+KIRGWK+WE  T     E + D SR RLT ETSFV+E+TSF T  P  
Sbjct  176   LYSLITMMLSRLKIRGWKKWEQETLSHDYEFSIDHSRLRLTHETSFVREHTSFWTTIPFF  235

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CFFRQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +
Sbjct  236   FYVGCFFRQFFVSVERTDYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLVVGISPV  295

Query  1184  LWCA  1195
             LW +
Sbjct  296   LWAS  299



>ref|XP_008349735.1| PREDICTED: MLO protein homolog 1-like [Malus domestica]
Length=559

 Score =   283 bits (725),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 204/303 (67%), Gaps = 19/303 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L QTPTWAVA+ C V +VIS+++E+ +H +G  F+++ K+A++EALEKIK ELM+LGF
Sbjct  9     RSLKQTPTWAVAIACAVFIVISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G  ++ KICI    G+TMLPC +++   ++   G  E    G        ED 
Sbjct  69    ISLLLTVGTRFLPKICISTKYGDTMLPCQLNES--KYSEGGKDEGNKGGGD------EDR  120

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++       H   ++W  RRVL+  A +   C  G +PLIS +G+HQLH+FIF LAVFH
Sbjct  121   RRKLLS----HAENMIW--RRVLASSAGDSSSCAGGKVPLISASGMHQLHVFIFVLAVFH  174

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V Y  +TMAL + K++ WK WE  T+  E    NDPSR+R T++TSFVK ++ F T  P 
Sbjct  175   VFYSVVTMALAQAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGFSTM-PG  233

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
             + + V FFRQFF SV R DYL MRHGFI+ H AP SKFDF KYIKRS+EDDFKVVVGI+L
Sbjct  234   IRWIVAFFRQFFGSVTRVDYLTMRHGFINAHFAPNSKFDFHKYIKRSMEDDFKVVVGISL  293

Query  1181  MLW  1189
              LW
Sbjct  294   PLW  296



>ref|XP_008228898.1| PREDICTED: MLO protein homolog 1-like [Prunus mume]
Length=558

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 203/303 (67%), Gaps = 11/303 (4%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+ C V ++IS+++E+ +H +G  F+++ K+A++EALEKIK ELM+LGF
Sbjct  9     RSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G  Y+ KICIPE  GNTMLPC +  ++ E            G  G+     D 
Sbjct  69    ISLLLTVGTRYLPKICIPEKYGNTMLPCELESKYKEDGGGKDDGKNKGGGGGDGGDDNDR  128

Query  653   HQEPAEAGGEHHRRLLWSMRRVL--SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
              ++  E        ++W  RRVL  SG     C E  +PLIS +G+HQLHIFIF LAVFH
Sbjct  129   RRKLLEFA----ETMIW--RRVLAPSGGDSSACSEDKVPLISPSGMHQLHIFIFVLAVFH  182

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y  ITMAL + K++ WK WE  T+  E    NDPSR+R  ++TSF+K ++ F T  P 
Sbjct  183   VVYSVITMALAQAKMKKWKAWESETSSLEYQFTNDPSRFRFIRQTSFIKRHSGFSTM-PG  241

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
             + + V FFRQFF SV R DY+ MRHGFI+ H AP SKFDF KYIKRS+EDDFKVVVGI++
Sbjct  242   IRWIVAFFRQFFGSVTRVDYMTMRHGFINAHFAPNSKFDFHKYIKRSMEDDFKVVVGISI  301

Query  1181  MLW  1189
              LW
Sbjct  302   PLW  304



>ref|XP_009603532.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 209/309 (68%), Gaps = 30/309 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA VC V+V IS+++E ++H IG  F+ KKKRAL EALEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAAVCFVLVAISIVIEHIIHLIGKWFKSKKKRALFEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ IC+ E  GN+  PC    E          E    G        ED 
Sbjct  68    ISLLLTVGQSPISNICVSEKIGNSWHPCSKQKE----------EDIIKG--------EDI  109

Query  653   HQEPAEAGGEHHRRLLW-----SMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFFL  814
             + E  ++  +H RRLL      S+RR+L+G   ++C  +G +P +S +G+HQLHIFIF L
Sbjct  110   NSE--DSSEQHRRRLLMAAAGGSVRRILAGGGEDKCAAKGKVPFVSADGIHQLHIFIFVL  167

Query  815   AVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y  +T+ALG  K+R WK W  E  TA+    +DP R+R T+ETSF + + SF T
Sbjct  168   AVFHVLYCILTLALGNAKMRSWKSWENETKTAEYHFTHDPERFRFTRETSFGRRHLSFWT  227

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKV  1162
             + PVL + +CFFRQF RSV + DYL +RHGFI+ HLAP S  KFDF+KYIKRSLE+DFKV
Sbjct  228   KNPVLLWIICFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHHKFDFRKYIKRSLEEDFKV  287

Query  1163  VVGINLMLW  1189
             VVGI+  +W
Sbjct  288   VVGISPPIW  296



>gb|AAK94907.1|AF384030_1 seven transmembrane protein MLO2 [Oryza sativa Indica Group]
 gb|EEC74442.1| hypothetical protein OsI_09833 [Oryza sativa Indica Group]
Length=555

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 206/309 (67%), Gaps = 38/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+VC VIV++S+ +E  LHK+GH F +++K+A+ EALEKIK ELM+LGF
Sbjct  8     RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q+ I+KICIPE+A N MLPC              G+    G  G+       
Sbjct  68    ISLLLTVAQTPISKICIPESAANIMLPC------------KAGQDIVKGLKGKK------  109

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIF  808
                      +H RRLLW      S RR L+G A E+   + G + L+S  G+HQLHIFIF
Sbjct  110   ---------DHRRRLLWYTGEEESHRRSLAGAAGEDYCAQSGKVALMSSGGMHQLHIFIF  160

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV Y  ITMALGR+K++ WK+WE+ T   E   ANDPSR+R T +TSFVK +   
Sbjct  161   VLAVFHVTYCVITMALGRLKMKKWKKWELETNSLEYQFANDPSRFRFTHQTSFVKRHLG-  219

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
             ++ TP L + V FFRQFF SV + DYL MR GFI+ HL+  SKFDF KYIKRSLEDDFKV
Sbjct  220   LSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSKFDFHKYIKRSLEDDFKV  279

Query  1163  VVGINLMLW  1189
             VVGI+L LW
Sbjct  280   VVGISLPLW  288



>ref|NP_001048845.1| Os03g0129100 [Oryza sativa Japonica Group]
 dbj|BAA85400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93786.1| MLO protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10759.1| Os03g0129100 [Oryza sativa Japonica Group]
 dbj|BAG93853.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58266.1| hypothetical protein OsJ_09270 [Oryza sativa Japonica Group]
Length=555

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 206/309 (67%), Gaps = 38/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+VC VIV++S+ +E  LHK+GH F +++K+A+ EALEKIK ELM+LGF
Sbjct  8     RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q+ I+KICIPE+A N MLPC              G+    G  G+       
Sbjct  68    ISLLLTVAQTPISKICIPESAANIMLPC------------KAGQDIVKGLKGKK------  109

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIF  808
                      +H RRLLW      S RR L+G A E+   + G + L+S  G+HQLHIFIF
Sbjct  110   ---------DHRRRLLWYTGEEESHRRSLAGAAGEDYCAQSGKVALMSSGGMHQLHIFIF  160

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV Y  ITMALGR+K++ WK+WE+ T   E   ANDPSR+R T +TSFVK +   
Sbjct  161   VLAVFHVTYCVITMALGRLKMKKWKKWELETNSLEYQFANDPSRFRFTHQTSFVKRHLG-  219

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
             ++ TP L + V FFRQFF SV + DYL MR GFI+ HL+  SKFDF KYIKRSLEDDFKV
Sbjct  220   LSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSKFDFHKYIKRSLEDDFKV  279

Query  1163  VVGINLMLW  1189
             VVGI+L LW
Sbjct  280   VVGISLPLW  288



>gb|AAN17391.1| Putative OsMlo-h1 [Oryza sativa Japonica Group]
Length=583

 Score =   281 bits (720),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 206/309 (67%), Gaps = 38/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+VC VIV++S+ +E  LHK+GH F +++K+A+ EALEKIK ELM+LGF
Sbjct  8     RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q+ I+KICIPE+A N MLPC              G+    G  G+       
Sbjct  68    ISLLLTVAQTPISKICIPESAANIMLPC------------KAGQDIVKGLKGKK------  109

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIF  808
                      +H RRLLW      S RR L+G A E+   + G + L+S  G+HQLHIFIF
Sbjct  110   ---------DHRRRLLWYTGEEESHRRSLAGAAGEDYCAQSGKVALMSSGGMHQLHIFIF  160

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV Y  ITMALGR+K++ WK+WE+ T   E   ANDPSR+R T +TSFVK +   
Sbjct  161   VLAVFHVTYCVITMALGRLKMKKWKKWELETNSLEYQFANDPSRFRFTHQTSFVKRHLG-  219

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
             ++ TP L + V FFRQFF SV + DYL MR GFI+ HL+  SKFDF KYIKRSLEDDFKV
Sbjct  220   LSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSKFDFHKYIKRSLEDDFKV  279

Query  1163  VVGINLMLW  1189
             VVGI+L LW
Sbjct  280   VVGISLPLW  288



>ref|XP_006299666.1| hypothetical protein CARUB_v10015854mg [Capsella rubella]
 gb|EOA32564.1| hypothetical protein CARUB_v10015854mg [Capsella rubella]
Length=529

 Score =   280 bits (716),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 154/303 (51%), Positives = 197/303 (65%), Gaps = 36/303 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             ++L QTPTWAVA+VC  +++IS +LEK L ++ +   +K+K +L+EALEK+K ELM+LGF
Sbjct  32    KQLSQTPTWAVAIVCTFLILISHLLEKGLQRLANWLWKKQKNSLLEALEKVKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KIC+   A  +MLPC   D  +          APS            
Sbjct  92    ISLLLTFGETYILKICVSRKAALSMLPCSSEDAEIFQNL------APS------------  133

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                              S+R   +G     CK+G  PLI+L GLHQLHI +FFLA+FH++
Sbjct  134   ----------------LSIRLSAAGDTPVSCKQGSDPLITLKGLHQLHILLFFLAIFHIL  177

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  IT+ L R+KIRGWK+WE  T     E + D SR RLT ETSFV+E+TSF T  P  F
Sbjct  178   YSLITVMLSRLKIRGWKKWEQETLSHDYEFSIDQSRLRLTHETSFVREHTSFWTTVPFFF  237

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CF RQFF SV R +YL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +L
Sbjct  238   YVGCFLRQFFVSVGRTEYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLVVGISPVL  297

Query  1187  WCA  1195
             W +
Sbjct  298   WAS  300



>ref|XP_008237952.1| PREDICTED: MLO protein homolog 1-like [Prunus mume]
Length=569

 Score =   281 bits (718),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 158/306 (52%), Positives = 206/306 (67%), Gaps = 17/306 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+ C V ++IS+++E+ +H +G  F+++ K+A++EALEKIK ELM+LGF
Sbjct  9     RSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G  Y+ KICIPE  GNTMLPC +  ++ +       +    G  G+    +  
Sbjct  69    ISLLLTVGTRYLPKICIPEKYGNTMLPCELESKYKDDGDGKDDDKNKGGGGGDGDDNDRR  128

Query  653   HQ--EPAEAGGEHHRRLLWSMRRVL---SGHAVEECKEGLIPLISLNGLHQLHIFIFFLA  817
              +  E AE        ++W  RRVL   SG     C EG +PLIS +G+HQLHIFIF LA
Sbjct  129   RKLLEFAET-------MIW--RRVLAAPSGGDSSACSEGKVPLISPSGMHQLHIFIFVLA  179

Query  818   VFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQ  991
             VFHV+Y  +TMAL   K++ WK WE  T+  E    NDPSR+R T++TSFVK ++ F T 
Sbjct  180   VFHVLYSVLTMALAHAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGFSTM  239

Query  992   TPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVG  1171
              P + + V FFRQFF SV + DYL MRHGFI+ H AP SKFDF KYIKRS+EDDFKVVVG
Sbjct  240   -PGIRWIVAFFRQFFGSVTKVDYLTMRHGFINAHFAPNSKFDFHKYIKRSMEDDFKVVVG  298

Query  1172  INLMLW  1189
             I++ LW
Sbjct  299   ISIPLW  304



>ref|XP_011098016.1| PREDICTED: MLO-like protein 10 isoform X2 [Sesamum indicum]
Length=499

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 171/246 (70%), Gaps = 33/246 (13%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             M+LGFISL+L F Q YIA+ICIP    +TMLPC                          A
Sbjct  1     MILGFISLILVFSQYYIAEICIPTNVADTMLPC-------------------------RA  35

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLA  817
               +D+ +E      EH RRLL   RRVL+      C EG + LIS+NGLHQ+HI IFFLA
Sbjct  36    SADDKAKE------EHRRRLLSYERRVLAAKKEPTCGEGHVALISVNGLHQIHILIFFLA  89

Query  818   VFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQ  991
             VFHVIY AITMALGR+KIRGWK+WE  T+    E +NDPSR+RLT ETSFV+ +TSF T+
Sbjct  90    VFHVIYSAITMALGRLKIRGWKQWEQETSSHNYEFSNDPSRFRLTHETSFVRAHTSFWTR  149

Query  992   TPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVG  1171
              P+ FY  CFFRQFF+SV ++DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK VVG
Sbjct  150   IPLFFYIGCFFRQFFKSVSKSDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKTVVG  209

Query  1172  INLMLW  1189
             ++ +LW
Sbjct  210   VSPVLW  215



>dbj|BAJ24150.1| seven trans-membrane protein [Triticum aestivum]
Length=560

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/303 (50%), Positives = 198/303 (65%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAV  VC VIV +S++LE +LH +G  F ++KK+AL +ALEK+K ELM LGF
Sbjct  11    RSLDQTPTWAVVAVCAVIVAVSILLEGILHHLGQWFSKRKKKALFDALEKVKSELMTLGF  70

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT    YI++ICIP  A +TMLPC +               + S EHGE       
Sbjct  71    ISLLLTVTARYISRICIPAGAAHTMLPCKL---------------SRSSEHGEGHGRRHL  115

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
              +EPA                         C +G++ L+S + LHQLHIF+FFLAVFHV 
Sbjct  116   SEEPANFS----------------------CPKGMVSLVSTDRLHQLHIFVFFLAVFHVT  153

Query  833   YGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             + AITM+LGR K R WKEWE  T+    E + DPS++RLT +TSFV+++ S  +++ ++ 
Sbjct  154   FSAITMSLGRAKTRIWKEWEKDTSSITYEFSADPSKFRLTHQTSFVRQHASCWSKSTIML  213

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y V  FRQFFRSVRR DYL +RHGFI+ HL+PG++F+F+K IKRSL+DDFK VVGI+  L
Sbjct  214   YVVSSFRQFFRSVRRTDYLTLRHGFIAAHLSPGTRFNFRKCIKRSLQDDFKTVVGISPPL  273

Query  1187  WCA  1195
             W +
Sbjct  274   WAS  276



>gb|EAY79378.1| hypothetical protein OsI_34504 [Oryza sativa Indica Group]
Length=579

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 203/304 (67%), Gaps = 37/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE LLH +G  F +++K+AL +ALEK+K ELM LGF
Sbjct  18    RALDQTPTWAVAAVCAVIVAASILLEGLLHHLGQWFSKRRKKALFDALEKVKSELMTLGF  77

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL+    YI++ICIP  A +TMLPC +     E + PG       G HG        
Sbjct  78    ISLLLSVTGRYISRICIPVGAADTMLPCSLRRSSSEQEVPG-------GGHG--------  122

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                                RR LSG     +C +G++ L+S +GLHQLHIF+FFLAVFHV
Sbjct  123   -------------------RRHLSGDPTNFKCAKGMVSLVSADGLHQLHIFVFFLAVFHV  163

Query  830   IYGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              + AITM+LGR K R WKEWE  T     E + DPS++RLT +TSFV+++ S  +++ +L
Sbjct  164   AFSAITMSLGRAKTRIWKEWEKETCSLTYEFSYDPSKFRLTHQTSFVRQHASCWSKSTIL  223

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
              Y V FFRQFFRSVRR DYL +RHGFI+ HL+PG++F+F+KYIKRSLEDDFK VVGI+  
Sbjct  224   LYFVSFFRQFFRSVRRTDYLTLRHGFIAAHLSPGTRFNFRKYIKRSLEDDFKTVVGISAP  283

Query  1184  LWCA  1195
             LW +
Sbjct  284   LWAS  287



>ref|XP_010489369.1| PREDICTED: MLO-like protein 7 [Camelina sativa]
Length=544

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 194/304 (64%), Gaps = 38/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L QTPTWAVA+VC  +++IS +LEK L ++ +   +K K +L+EALEKIK ELM+LGF
Sbjct  32    RQLSQTPTWAVAIVCTFLILISHLLEKGLQRLANWLWKKHKNSLLEALEKIKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHD-EHVEHQAPGHGEHAPSGEHGEHAPPED  649
             ISLLLTFG++YI KIC+   A  +MLPC   D E  ++ AP                   
Sbjct  92    ISLLLTFGETYILKICVSRKAALSMLPCSSEDIELFQNLAP-------------------  132

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                               S R   +G     CK+G  PLI+L GLHQLHI +FFLA+ H+
Sbjct  133   ----------------FLSTRLSAAGDTSVNCKQGSDPLITLKGLHQLHILLFFLAISHI  176

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  ITM L R+KIRGWK+WE  T     E + D SR RLT ETSFV+E+ SF T  P  
Sbjct  177   LYSLITMMLSRLKIRGWKKWEQETLSHDYEFSTDHSRLRLTHETSFVREHISFWTTIPFF  236

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CF RQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +
Sbjct  237   FYVGCFLRQFFVSVGRTDYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLVVGISPV  296

Query  1184  LWCA  1195
             LW +
Sbjct  297   LWAS  300



>ref|XP_010550511.1| PREDICTED: MLO-like protein 10 isoform X1 [Tarenaya hassleriana]
Length=523

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 194/333 (58%), Gaps = 75/333 (23%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL Q PTWAVA+VC + + ISL+LEK L ++      K K +L+EAL+KIK ELM+LGF
Sbjct  30    RELFQIPTWAVAVVCTIFIFISLLLEKGLDRVTSWLWEKHKSSLLEALDKIKAELMILGF  89

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KICIPE A  TMLPC                 AP   H  H   ++ 
Sbjct  90    ISLLLTFGEAYILKICIPEKAAVTMLPC----------------PAPDMTHRRHLAADNT  133

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
               +                           CK+G  PL+S+ GLHQLHI +FFLAVFHV+
Sbjct  134   SYQ---------------------------CKKGHEPLMSVKGLHQLHILLFFLAVFHVL  166

Query  833   YGAITMALGRMKIRGWKEWEMATAQDEAA-------------------------------  919
             Y  ITM LGR+KIRGWK+WE  T   +                                 
Sbjct  167   YSFITMMLGRLKIRGWKKWEKETLSHDYQFSVGIFIRPSCLIRWSTWSGIILSLAHSSSL  226

Query  920   -NDPSRYRLTKETSFVKENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHL  1096
               DPSR+RLT ETSFV+ +TSF T+ P LFY  CF RQFFRSV R DYL +RHGFI+ HL
Sbjct  227   RADPSRFRLTHETSFVRAHTSFWTRVPFLFYLGCFLRQFFRSVGRTDYLTLRHGFIATHL  286

Query  1097  APGSKFDFQKYIKRSLEDDFKVVVGINLMLWCA  1195
              PG +FDFQKYIKRSLEDDFK+ VGI+ +LW +
Sbjct  287   TPGRQFDFQKYIKRSLEDDFKIAVGISPVLWAS  319



>ref|XP_006649324.1| PREDICTED: MLO protein homolog 1-like [Oryza brachyantha]
Length=562

 Score =   278 bits (712),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 203/310 (65%), Gaps = 39/310 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL +TPTWAVA+VC VIV+IS+ +E  LH+IGH F +K K+AL EALEKIK ELM+LGF
Sbjct  8     RELPETPTWAVAVVCAVIVLISVAMEHGLHRIGHWFHKKDKKALAEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q+ I KICIP++A N MLPC              G+ A     G        
Sbjct  68    ISLLLTVAQTPITKICIPKSAANIMLPC------------KAGQDAIKSSKGNK------  109

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHA-VEECK--EGLIPLISLNGLHQLHIFI  805
                      +  RRLLW      S RR L+G A  + C   +G + L+S + +HQLHIFI
Sbjct  110   ---------DDRRRLLWLPVEEESHRRSLAGAAGADYCSKFDGKVALMSTSTIHQLHIFI  160

Query  806   FFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTS  979
             F LAVFHV Y  ITMALGR+K++ WK+WE+ T   E   ANDPSR+R T +TSFVK +  
Sbjct  161   FVLAVFHVTYCVITMALGRLKMKKWKKWELETNSLEYQFANDPSRFRFTHQTSFVKRHLG  220

Query  980   FMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFK  1159
              ++ TP L + V FFRQFF SV + DYL MR GFI+ HL+  SKFDF KYIKRSLEDDFK
Sbjct  221   -LSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSKFDFHKYIKRSLEDDFK  279

Query  1160  VVVGINLMLW  1189
             VVVGI+L LW
Sbjct  280   VVVGISLPLW  289



>ref|XP_010270523.1| PREDICTED: MLO-like protein 10 isoform X2 [Nelumbo nucifera]
Length=396

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 204/303 (67%), Gaps = 43/303 (14%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA+VC ++++ISL+LEK++HK+G  F  K+K+++ EALEKIK ELMVLGF
Sbjct  10    RQLDQTPTWAVAVVCAIMIIISLVLEKVIHKVGEWFTEKRKKSMFEALEKIKTELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL+F  SYI +ICIPE     MLPC                                
Sbjct  70    ISLLLSFLGSYIPRICIPENVSRAMLPC-------------------------------P  98

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGH--AVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
             + EP        R+LLW+  R+L  +     +C  G  PL+S  G+H+LHIFIFFLA+ H
Sbjct  99    YVEP-------RRKLLWNQHRLLKTNYGGQHQCNTGE-PLLSKEGVHELHIFIFFLAIIH  150

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPV  1000
                 AITM LGR+KIRGWK WE  T   +   ++DPSR+RLT ETSFVK +TS  T+ P 
Sbjct  151   AFNSAITMLLGRLKIRGWKAWEQETKSIDYQFSHDPSRFRLTHETSFVKAHTSCWTRIPF  210

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY   FF+QFF SVR+ADYLA+RHGFISVHLAPGS F+FQKYIKRSLEDDFKVVVGI+ 
Sbjct  211   FFYFASFFQQFFMSVRKADYLALRHGFISVHLAPGSNFNFQKYIKRSLEDDFKVVVGISP  270

Query  1181  MLW  1189
             +LW
Sbjct  271   LLW  273



>ref|XP_010467513.1| PREDICTED: MLO-like protein 7 [Camelina sativa]
Length=544

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 194/303 (64%), Gaps = 36/303 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L QTPTWAVA+VC  +++IS +LEK L ++ +   +K K +L+EALEKIK ELM+LGF
Sbjct  32    RQLSQTPTWAVAIVCTFLILISHLLEKSLQRLANWLWKKHKNSLLEALEKIKAELMILGF  91

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KIC+   A  +MLPC   D  +  +       APS            
Sbjct  92    ISLLLTFGETYILKICVSRKAALSMLPCSSEDTELFQKL------APS------------  133

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                              S R    G     CK+G  PLI+L GLHQLHI +FFLA+ H++
Sbjct  134   ----------------LSTRLSAVGDTSVNCKQGSDPLITLKGLHQLHILLFFLAISHIL  177

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM L R+KIRGWK+WE  T     E + D SR RLT ETSFV+E+ SF T+ P  F
Sbjct  178   YSLITMMLSRLKIRGWKKWEQETLSHDYEFSIDHSRLRLTHETSFVREHISFWTKIPFFF  237

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CF RQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK+VVGI+ +L
Sbjct  238   YVGCFLRQFFVSVGRTDYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLVVGISPVL  297

Query  1187  WCA  1195
             W +
Sbjct  298   WAS  300



>ref|XP_003558907.1| PREDICTED: protein MLO-like [Brachypodium distachyon]
Length=556

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 204/307 (66%), Gaps = 35/307 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             REL QTPTWAVA+VCLV++++SL LE  LHK+GH F++++K+A+ EALEKIK ELM++GF
Sbjct  8     RELPQTPTWAVAVVCLVMILLSLALEHALHKLGHWFQKRQKKAVAEALEKIKAELMLMGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ+ I+KICI + AG+ MLPC +                           ED 
Sbjct  68    ISLLLTVGQTPISKICISKEAGSVMLPCKL-----------------------SVAAEDA  104

Query  653   HQEPAEAGGEHHRRLLWSM----RRVLSGH-AVEEC-KEGLIPLISLNGLHQLHIFIFFL  814
               E  + G    RRLLW      RR L+    V+ C  +G + L+S + +HQLHIFIF L
Sbjct  105   DDEGKDNG---RRRLLWFQEEIHRRFLAAAPGVDPCASQGKVALMSASSMHQLHIFIFVL  161

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV Y   TMALGR+K++ WK+WE  T   E   ANDPSR+R T +TSFVK +   ++
Sbjct  162   AVFHVFYSVTTMALGRLKMKKWKKWESETTSLEYQFANDPSRFRFTHQTSFVKRHMG-LS  220

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
              TP + + V FFRQFF SV + DYL MR GFI+ HL+  SKFDF KYIKRSLEDDFKVVV
Sbjct  221   STPGVRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSKFDFHKYIKRSLEDDFKVVV  280

Query  1169  GINLMLW  1189
             GI+L LW
Sbjct  281   GISLPLW  287



>ref|XP_006409308.1| hypothetical protein EUTSA_v10023186mg [Eutrema salsugineum]
 gb|ESQ50761.1| hypothetical protein EUTSA_v10023186mg [Eutrema salsugineum]
Length=535

 Score =   277 bits (709),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 191/303 (63%), Gaps = 39/303 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVA+VC  +++IS +LEK L ++ +   +K K +L+EALEKIK ELM LGF
Sbjct  31    KTLSQTPTWAVAVVCTFLILISHLLEKGLQRLANWLWKKHKNSLLEALEKIKAELMTLGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLTFG++YI KIC+P  A  +MLPC    E+ +  AP    H               
Sbjct  91    ISLLLTFGETYILKICVPSKAALSMLPCPF--ENAKTLAPSLSRHL--------------  134

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                                  + +G     CK G  PLI+L GLHQLHI +FFLA+FH++
Sbjct  135   ---------------------LAAGDIYVNCKIGSEPLITLKGLHQLHILLFFLAIFHIL  173

Query  833   YGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  ITM L R+KIRGWK+WE  T     E + D SR RLT ETSFVK  TSF T  P  F
Sbjct  174   YSLITMMLSRLKIRGWKKWEQETLSHDYEFSIDHSRLRLTHETSFVKSYTSFWTTIPFFF  233

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y  CF RQFF SV R DYL +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK++VGI+ +L
Sbjct  234   YVGCFLRQFFVSVGRTDYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLIVGISPIL  293

Query  1187  WCA  1195
             W +
Sbjct  294   WAS  296



>ref|XP_007210822.1| hypothetical protein PRUPE_ppa020311mg [Prunus persica]
 gb|EMJ12021.1| hypothetical protein PRUPE_ppa020311mg [Prunus persica]
Length=566

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 204/304 (67%), Gaps = 16/304 (5%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+ C V ++IS+++E+ +H +G  F+++ K+A++EALEKIK ELM+LGF
Sbjct  9     RSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G  Y+ KICIPE  GNTMLPC + + +   +          G  G+      +
Sbjct  69    ISLLLTVGTRYLPKICIPEKYGNTMLPCEL-EGNGGGKDDDGKNKGGGGGDGDDNDRRRK  127

Query  653   HQEPAEAGGEHHRRLLWSMRRVL---SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVF  823
               E AE        ++W  RRVL   SG     C EG +PLIS +G+HQLHIFIF LAVF
Sbjct  128   LLEFAET-------MIW--RRVLAAPSGGDSAACSEGKVPLISPSGMHQLHIFIFVLAVF  178

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTP  997
             HV+Y  +TMAL   K++ WK WE  T+  E    NDPSR+R T++TSFVK ++ F T  P
Sbjct  179   HVMYSVLTMALAHAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGFSTM-P  237

Query  998   VLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGIN  1177
              + + V FFRQFF SV + DYL MRHGFI+ H AP SKFDF KYIKRS+EDDFKVVVGI+
Sbjct  238   GIRWIVAFFRQFFGSVTKVDYLTMRHGFINAHFAPNSKFDFHKYIKRSMEDDFKVVVGIS  297

Query  1178  LMLW  1189
             + LW
Sbjct  298   IPLW  301



>gb|KFK40130.1| hypothetical protein AALP_AA3G334400 [Arabis alpina]
Length=537

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 192/304 (63%), Gaps = 38/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L QTPTWAVA+VC  +++IS +LEK L K+ +   +K K +L+EALEKIK ELM+LGF
Sbjct  31    KTLSQTPTWAVAVVCTFLILISHLLEKGLQKLANWLWKKHKNSLLEALEKIKAELMILGF  90

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHD-EHVEHQAPGHGEHAPSGEHGEHAPPED  649
             ISLLLTFG++YI +IC+P  A  +MLPC   + E     AP    H              
Sbjct  91    ISLLLTFGETYILEICVPSKAALSMLPCSFENTETTTTLAPSRSRHL-------------  137

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                                   + +G +   CK G  PLI+L GLHQLHI +FFLA+FH+
Sbjct  138   ----------------------LAAGDSTVNCKNGYEPLITLKGLHQLHILLFFLALFHI  175

Query  830   IYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  ITM L R+KIR WK+WE  T     E + D SR RLT ETSFV+ +TSF T  P  
Sbjct  176   LYSLITMMLSRLKIRRWKKWEQETLSHDYEFSIDQSRLRLTHETSFVRSHTSFWTNIPFF  235

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
             FY  CF RQF+ SV R D+L +RHGFIS HLAPG KF+FQ+YIKRSLEDDFK++VGI+ +
Sbjct  236   FYVGCFLRQFYVSVGRTDFLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLIVGISPV  295

Query  1184  LWCA  1195
             LW +
Sbjct  296   LWAS  299



>ref|XP_009801961.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=597

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 207/309 (67%), Gaps = 30/309 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA VC V+V IS+++E ++H IG  F+ K KRAL EALEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAAVCFVLVAISIVIEHIIHLIGKWFKSKNKRALFEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ IC+ E  GN+  PC    E          E    G        ED 
Sbjct  68    ISLLLTVGQSPISNICVSEKIGNSWHPCSKKKE----------EDIIKG--------EDT  109

Query  653   HQEPAEAGGEHHRRLLWS-----MRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFFL  814
             + E  ++  +H RRLL +     +RR+L+G   ++C  +G +  +S +G+HQLHIFIF L
Sbjct  110   NSE--DSSEQHRRRLLMAAAGGGVRRILAGGGEDKCAAKGKVAFVSADGIHQLHIFIFVL  167

Query  815   AVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y  +T+ALG  K+R WK W  E  TA+    +DP R+R T+ETSF + + SF T
Sbjct  168   AVFHVLYCILTLALGNAKMRSWKSWENETKTAEYRFTHDPERFRFTRETSFGRRHLSFWT  227

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKV  1162
             + PVL + +CFFRQF RSV + DYL +RHGFI+ HLAP S  KFDF+KYIKRSLE+DFKV
Sbjct  228   KNPVLLWIICFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHHKFDFRKYIKRSLEEDFKV  287

Query  1163  VVGINLMLW  1189
             VVGI+  +W
Sbjct  288   VVGISPPIW  296



>ref|XP_006855667.1| hypothetical protein AMTR_s00044p00120330 [Amborella trichopoda]
 gb|ERN17134.1| hypothetical protein AMTR_s00044p00120330 [Amborella trichopoda]
Length=317

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 198/304 (65%), Gaps = 38/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA VC V V+IS+++E  +H +   F+ ++K+AL+EALEKIK ELM+LGF
Sbjct  8     RSLKETPTWAVAAVCAVFVIISVLIEHGIHSLAKWFQNRQKKALLEALEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             IS LLT GQ  I+ ICI + AG+TMLPC                             + E
Sbjct  68    ISFLLTIGQKPISMICINKKAGDTMLPC-----------------------------KKE  98

Query  653   HQEPAEAGGEHHRRLLWSM-----RRVL-SGHAVEECKE-GLIPLISLNGLHQLHIFIFF  811
               +   + G +HR+LLW+      RRVL +G   E C     +PLIS +G+HQLHIFIF 
Sbjct  99    KYDYGSSEGGNHRKLLWAAEELPWRRVLAAGTGDEYCTNHDKVPLISQSGVHQLHIFIFV  158

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKENTSFM  985
             LA+FHV+Y  +TMALGR K+  WK WE  T   + E ++DPSR+R T +TSFV+ + +  
Sbjct  159   LAIFHVLYSVVTMALGRAKMNRWKVWESETTSLEYEFSHDPSRFRFTHQTSFVRRHATVS  218

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVV  1165
             +  P L + VCFFRQFF+SV + DYL +RHGFI  HLAP SKF+F KY+KRSLEDDFKVV
Sbjct  219   SGKPGLKWIVCFFRQFFQSVTKVDYLTLRHGFIKAHLAPNSKFNFHKYLKRSLEDDFKVV  278

Query  1166  VGIN  1177
             VGI+
Sbjct  279   VGIS  282



>ref|XP_010270522.1| PREDICTED: MLO-like protein 9 isoform X1 [Nelumbo nucifera]
Length=531

 Score =   275 bits (703),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 204/304 (67%), Gaps = 43/304 (14%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+LDQTPTWAVA+VC ++++ISL+LEK++HK+G  F  K+K+++ EALEKIK ELMVLGF
Sbjct  10    RQLDQTPTWAVAVVCAIMIIISLVLEKVIHKVGEWFTEKRKKSMFEALEKIKTELMVLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL+F  SYI +ICIPE     MLPC                                
Sbjct  70    ISLLLSFLGSYIPRICIPENVSRAMLPC-------------------------------P  98

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGH--AVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
             + EP        R+LLW+  R+L  +     +C  G  PL+S  G+H+LHIFIFFLA+ H
Sbjct  99    YVEP-------RRKLLWNQHRLLKTNYGGQHQCNTGE-PLLSKEGVHELHIFIFFLAIIH  150

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPV  1000
                 AITM LGR+KIRGWK WE  T   +   ++DPSR+RLT ETSFVK +TS  T+ P 
Sbjct  151   AFNSAITMLLGRLKIRGWKAWEQETKSIDYQFSHDPSRFRLTHETSFVKAHTSCWTRIPF  210

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
              FY   FF+QFF SVR+ADYLA+RHGFISVHLAPGS F+FQKYIKRSLEDDFKVVVGI+ 
Sbjct  211   FFYFASFFQQFFMSVRKADYLALRHGFISVHLAPGSNFNFQKYIKRSLEDDFKVVVGISP  270

Query  1181  MLWC  1192
             +LW 
Sbjct  271   LLWA  274



>ref|XP_006662559.1| PREDICTED: MLO-like protein 9-like [Oryza brachyantha]
Length=570

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 202/304 (66%), Gaps = 38/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE LLH +G  F +++K+AL +ALEK+K ELM LGF
Sbjct  14    RALDQTPTWAVAAVCAVIVAASILLEGLLHHLGQWFSKRRKKALFDALEKVKSELMTLGF  73

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL+    YI++ICIP  A +TMLPC +                             E
Sbjct  74    ISLLLSVTGRYISRICIPVGAADTMLPCSLRRS-------------------------SE  108

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
             H++P    G          RR LSG     +C +G++ L+S +GLHQLHIF+FFLAVFHV
Sbjct  109   HEQPGVGPG----------RRHLSGDPTNFKCAKGMVSLVSADGLHQLHIFVFFLAVFHV  158

Query  830   IYGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              + AITM+LGR K R WKEWE  T     E + DPS++RLT +TSFV+++ S  +++ VL
Sbjct  159   AFSAITMSLGRAKARIWKEWEKETCSLTYEFSYDPSKFRLTHQTSFVRQHASCWSRSTVL  218

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
              Y V FFRQFFRSVRR DYL +RHGFI+ HL+PG++F+F+KYIKRSLEDDFK VVGI+  
Sbjct  219   LYFVSFFRQFFRSVRRTDYLTLRHGFIAAHLSPGTRFNFRKYIKRSLEDDFKTVVGISAP  278

Query  1184  LWCA  1195
             LW +
Sbjct  279   LWAS  282



>gb|AAK72963.1|AF388195_1 Mlo [Oryza sativa Indica Group]
Length=554

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 201/309 (65%), Gaps = 37/309 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+VC VIV++S+ +E  LHK+GH F +++K+A+ EAL KIK ELM+LGF
Sbjct  8     RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALGKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q+ I+KICIPE+A N MLPC              G+    G  G+       
Sbjct  68    ISLLLTVAQTPISKICIPESAANIMLPC------------KAGQDIVKGLKGKK------  109

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIF  808
                      +H RRLLW      S RR L+G A E+   + G + L+S  G+HQLHIFIF
Sbjct  110   ---------DHRRRLLWYTGEEESHRRSLAGAAGEDYCAQSGKVALMSSGGMHQLHIFIF  160

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV Y  ITM LGR+K++ WK+WE  T   E   A DPSR+R T +TSFVK +   
Sbjct  161   VLAVFHVTYCVITMGLGRLKMKKWKKWESQTNSLEYQFAIDPSRFRFTHQTSFVKRHLGS  220

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKV  1162
              + TP L + V FFRQFF SV + DYL MR GFI+ HL+  SKFDF KYIKRSLEDDFKV
Sbjct  221   FSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSKFDFHKYIKRSLEDDFKV  280

Query  1163  VVGINLMLW  1189
             VVGI+L LW
Sbjct  281   VVGISLPLW  289



>ref|XP_009384603.1| PREDICTED: MLO-like protein 10 [Musa acuminata subsp. malaccensis]
Length=435

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 169/255 (66%), Gaps = 37/255 (15%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             M+LGFISLLLTFGQSYIAKICIPE   NTMLPC                           
Sbjct  1     MILGFISLLLTFGQSYIAKICIPETLSNTMLPC---------------------------  33

Query  638   PPEDEHQEPAEAGGEHHRRLLWS-------MRRVLSGHAVEECKEGLIPLISLNGLHQLH  796
              P       AEAGG H R+LL +         R+L+  ++  C  G  PLIS+NGLHQLH
Sbjct  34    -PIKTDTGTAEAGGGHRRKLLTNALIRGNIQHRILAAGSIVSCPLGKGPLISMNGLHQLH  92

Query  797   IFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATA--QDEAANDPSRYRLTKETSFVKE  970
             IFIFFLAVFHV  GA+TM LGR K+R WKEWE  T+  + E +NDPSR+R   ETSFV+ 
Sbjct  93    IFIFFLAVFHVASGALTMTLGRAKMRRWKEWETETSSIEYEFSNDPSRFRFVHETSFVRR  152

Query  971   NTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLED  1150
             +T+F  +  +LFY V F +QFF SV +ADYLA+RHGFI+ HLAPGSKF+FQKYIKR+LED
Sbjct  153   HTNFWNRITILFYFVSFLKQFFSSVCKADYLALRHGFINAHLAPGSKFNFQKYIKRTLED  212

Query  1151  DFKVVVGINLMLWCA  1195
             DFK VVGI+ +LW +
Sbjct  213   DFKAVVGISPVLWAS  227



>ref|XP_006343449.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=589

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 205/310 (66%), Gaps = 36/310 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V IS+++E ++H IG   + K K AL E+LEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKNKSALYESLEKIKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ IC+ E  GN+  PC                   S E  ++   ED 
Sbjct  68    ISLLLTVGQSPISNICVSEKIGNSWHPC-------------------SKEEEDNIISEDS  108

Query  653   HQEPAEAGGEHHRRLLW-----SMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIFF  811
               E      +H RRLL       +RR+L+G   ++    +G +P +S +G+HQLHIFIF 
Sbjct  109   SSE------QHRRRLLMEAAGGGVRRILAGGGGDDKCAAKGKVPFVSADGIHQLHIFIFV  162

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAVFHV+Y   T+ALGR K+R WK WE    TA+ E ++DP R+R T+ETSF + + SF 
Sbjct  163   LAVFHVLYCITTLALGRAKMRSWKSWENETKTAEYEFSHDPERFRFTRETSFGRRHLSFW  222

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             T+ P+L + VCFFRQF RSV + DYL +RHGFI+ HLAP S  KFDF+KYIKRSLE+DFK
Sbjct  223   TKNPILLWIVCFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHQKFDFRKYIKRSLEEDFK  282

Query  1160  VVVGINLMLW  1189
             VVVGI+  +W
Sbjct  283   VVVGISPPIW  292



>ref|NP_001105660.1| barley mlo defense gene homolog1 [Zea mays]
 gb|AAK38337.2| seven transmembrane protein Mlo1 [Zea mays]
 gb|ACF81106.1| unknown [Zea mays]
 tpg|DAA43123.1| TPA: Seven transmembrane protein Mlo1 [Zea mays]
Length=563

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 202/315 (64%), Gaps = 43/315 (14%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R+L  TPTWAVALVC VIV++S+ +E  LHK+GH F  ++K+A+ EALEKIK ELM++GF
Sbjct  8     RDLPSTPTWAVALVCAVIVLVSVAMEHGLHKLGHWFHTRQKKAMREALEKIKAELMLMGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL  GQ+ I+KICIP  AG+ MLPC                           PP+  
Sbjct  68    ISLLLAVGQTPISKICIPAKAGSIMLPC--------------------------KPPKGA  101

Query  653   HQEPAEAGGEHHRRLLWSM-----------RRVLSGHAVEE---CKEGLIPLISLNGLHQ  790
                  +   +  RRLLW             RR L+G A ++     +G + LIS  G+HQ
Sbjct  102   AAAADDDKSDGRRRLLWYPPYPGYDEPGHHRRFLAGAAPDDNYCSDQGKVSLISSAGVHQ  161

Query  791   LHIFIFFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFV  964
             LHIFIF LAVFH++Y   TMALGR+K+R WK+WE  T   E   ANDPSR+R T +TSFV
Sbjct  162   LHIFIFVLAVFHIVYSVATMALGRLKMRKWKKWESETNSLEYQYANDPSRFRFTHQTSFV  221

Query  965   KENTSFMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSL  1144
             K +   ++ TP + + V FFRQFF SV + DYL MR GFI+ HL+P +KF+FQ+YIKRSL
Sbjct  222   KRHLG-LSSTPGVRWVVAFFRQFFASVTKVDYLTMRQGFINYHLSPSTKFNFQQYIKRSL  280

Query  1145  EDDFKVVVGINLMLW  1189
             EDDFKVVVGI+L LW
Sbjct  281   EDDFKVVVGISLPLW  295



>ref|XP_009372684.1| PREDICTED: MLO protein homolog 1-like [Pyrus x bretschneideri]
Length=565

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 198/303 (65%), Gaps = 18/303 (6%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA+ C V +VIS+++E+ +H +G  F+++ K+A++EALEKIK ELM+LGF
Sbjct  9     RSLKETPTWAVAIACAVFIVISVIIEQAIHALGKWFQKRNKKAMLEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G  ++ KICI    G+TMLPC +++            +   G+          
Sbjct  69    ISLLLTVGTRFLPKICISTKYGDTMLPCQLNESKYSDNGGKDKGNKGGGDDDRR------  122

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIFFLAVFH  826
                       H   ++W  RRVL+  A +   C  G +PLIS +G+HQLHIFIF LAVFH
Sbjct  123   -----RKLLSHAENVIW--RRVLAPSAGDSSSCAGGKVPLISASGMHQLHIFIFVLAVFH  175

Query  827   VIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V Y  ITMAL + K++ WK WE  T+  E    NDPSR+R T++TSFVK ++ F T  P 
Sbjct  176   VFYSVITMALAQAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGFSTM-PG  234

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINL  1180
             + + V FFRQFF SV R DYL MRHGFI+ H AP SKFDF KYIKRS+EDDFKVVVGI+L
Sbjct  235   IRWIVAFFRQFFGSVTRVDYLTMRHGFINAHFAPNSKFDFHKYIKRSMEDDFKVVVGISL  294

Query  1181  MLW  1189
              LW
Sbjct  295   PLW  297



>ref|XP_004240581.1| PREDICTED: MLO-like protein 6 [Solanum lycopersicum]
Length=591

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 202/310 (65%), Gaps = 35/310 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V IS+++E ++H IG   + K K AL EALEKIK ELM+LGF
Sbjct  9     RSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKNKSALYEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ IC+ E  GN+  PC                     E       ED 
Sbjct  69    ISLLLTVGQSPISNICVSEKLGNSWHPC------------------SKKEEDSSIISEDS  110

Query  653   HQEPAEAGGEHHRRLLWS-----MRRVLSGHAVEE--CKEGLIPLISLNGLHQLHIFIFF  811
               E      +H RRLL       +RR+L+G   ++    +G +P +S +G+HQLHIFIF 
Sbjct  111   LSE------QHRRRLLMDAAGGGVRRILAGGGGDDKCAAKGKVPFVSADGIHQLHIFIFV  164

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAVFHV+Y   T+ALGR K+R WK WE    TA+ E ++DP R+R T+ETSF + + SF 
Sbjct  165   LAVFHVLYCVTTLALGRAKMRSWKSWENETKTAEYEFSHDPERFRFTRETSFGRRHLSFW  224

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             T+ PVL + VCFFRQF RSV + DYL +RHGFI+ HLAP S  KFDF+KYIKRSLE+DFK
Sbjct  225   TKNPVLLWIVCFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHQKFDFRKYIKRSLEEDFK  284

Query  1160  VVVGINLMLW  1189
             VVVGI+  +W
Sbjct  285   VVVGISPPIW  294



>gb|EYU45068.1| hypothetical protein MIMGU_mgv1a009898mg [Erythranthe guttata]
Length=328

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 206/309 (67%), Gaps = 32/309 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V +S+++E ++H IG   + K KRAL E+LEK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVAVSILIEHIIHLIGKWLKSKHKRALYESLEKVKAELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ ICI +  G+T  PC    E         G   P       APP+++
Sbjct  68    ISLLLTVGQSPISNICISKKLGSTWHPCTKTQE---------GNKYP-------APPKED  111

Query  653   HQEPAEAGGEHHRRLL-----WSMRRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFFL  814
              +E      ++ RRLL      S RR+L+G   ++C E G +P +S +G+HQLHIFIF L
Sbjct  112   PEE------DNRRRLLSVVDGGSFRRILAGGGTDKCAEKGKVPFVSSDGIHQLHIFIFVL  165

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMT  988
             A+FHV+Y  +TMALGR K+  WK WE  T   E   ++DP R+R  +ETSF + + SF +
Sbjct  166   AIFHVLYCILTMALGRAKMGSWKGWEKETKTIEYQFSHDPERFRFARETSFGRRHLSFWS  225

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKV  1162
             +TPVL + VCFFRQF RSV + DYL +RHGFI  HLAP S   FDFQKYI RSLE+DFKV
Sbjct  226   KTPVLLWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHANFDFQKYINRSLEEDFKV  285

Query  1163  VVGINLMLW  1189
             VVGI+  +W
Sbjct  286   VVGISPPIW  294



>gb|AGV68799.1| MLO1 [Prunus armeniaca]
Length=591

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 201/311 (65%), Gaps = 36/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V++S+++E L+  +    ++K KRAL EALEK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVLVSIIIEHLIELVAKWLKKKHKRALYEALEKVKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+ ICI E  GNT  PC    E   ++   H E  PS            
Sbjct  68    ISLLLTVGQGPISNICISEKLGNTWHPCGKKQETKMNKDTEHDEETPS------------  115

Query  653   HQEPAEAGGEHHRRLL-------WSMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIFIF  808
                         RRLL         +RRVL+    ++C  +G +P IS +G+HQLHIFIF
Sbjct  116   ------------RRLLSLFNQSDVGVRRVLAAAGTDKCAPKGKVPFISADGIHQLHIFIF  163

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSF  982
              LAVFH++Y  +TMALGR K+R WK W  E  TA+ + ++DP R+R  ++TSF + + SF
Sbjct  164   VLAVFHILYCILTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSF  223

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDF  1156
              TQTP L + VCFFRQF RSV + DYL +RHGFI  HLAP S  KF+FQKYI RSLE+DF
Sbjct  224   WTQTPFLMWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQKFNFQKYINRSLEEDF  283

Query  1157  KVVVGINLMLW  1189
             KVVVGI+  +W
Sbjct  284   KVVVGISPPIW  294



>ref|XP_010104115.1| MLO-like protein 6 [Morus notabilis]
 gb|EXB98556.1| MLO-like protein 6 [Morus notabilis]
Length=585

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 204/310 (66%), Gaps = 32/310 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V IS+++E ++H IG   ++K KRAL E+LEK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVFISIVIEHIIHLIGEWLKKKHKRALFESLEKVKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ+ I+ ICI E    T  PC    E   ++                   E +
Sbjct  68    ISLLLTVGQTLISNICISEKVAATWHPCSKDQEKDLYKN------------------ETD  109

Query  653   HQEPAEAGGEHHRRLL------WSMRRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFF  811
             H+   E+ G   RRLL       S RRVL+    ++C E G +P +S +G+HQLHIFIF 
Sbjct  110   HESDHESNG---RRLLAALESGGSFRRVLASAGTDKCAEKGQVPFVSSDGIHQLHIFIFV  166

Query  812   LAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LA+FHV+Y  ITMALGR K+R WK+W  E  T + + ++DP R+R  ++TSF + + SF 
Sbjct  167   LAIFHVLYCIITMALGRAKMRRWKKWEKETRTVEYQFSHDPERFRFARDTSFGRRHLSFW  226

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             T+TP L + VCFFRQF RSV + DYL +RHGFI  HLAP S  +FDFQKYI RSLE+DFK
Sbjct  227   TKTPFLMWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQRFDFQKYINRSLEEDFK  286

Query  1160  VVVGINLMLW  1189
             VVVGI+  +W
Sbjct  287   VVVGISPPIW  296



>ref|XP_006592218.1| PREDICTED: MLO-like protein 6-like isoform X2 [Glycine max]
Length=434

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 201/311 (65%), Gaps = 37/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAV+ VC V+++IS+ +E ++H IG   ++K +RAL E+LEKIK ELM+LGF
Sbjct  8     RNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I++ICI E    T  PC   D+   H++                  E E
Sbjct  68    ISLLLTVGQGPISRICISEKVAGTWHPC---DDSSNHESDSE---------------ESE  109

Query  653   HQEPAEAGGEHHRRLLWSM--------RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIF  808
             ++        + RRLL +         RRVL+G   ++C EG +P +S +G+HQLHIFIF
Sbjct  110   NRT-------NSRRLLAAFYGSDDVNPRRVLAGGGADKCPEGKVPFVSSDGIHQLHIFIF  162

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSF  982
              LAVFHV+Y   TMALGR K++ WK W  E  T + + ++DP R+R  +ETSF + + SF
Sbjct  163   VLAVFHVLYCIFTMALGRAKMKRWKRWEEETKTTEYQFSHDPERFRFARETSFGRRHLSF  222

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPG--SKFDFQKYIKRSLEDDF  1156
              T+ PVL + VCFFRQF RSV   DYL +RHGFI  HLAP   SKFDF+KYIKRSL++DF
Sbjct  223   WTKNPVLIWIVCFFRQFVRSVPNVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDF  282

Query  1157  KVVVGINLMLW  1189
             KVVVGI+   W
Sbjct  283   KVVVGISPPFW  293



>ref|XP_010264736.1| PREDICTED: MLO-like protein 6 isoform X2 [Nelumbo nucifera]
Length=413

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 203/310 (65%), Gaps = 34/310 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVA VC V+V IS+++E ++H IG    ++ KRAL E+LEKIK ELM+LGF
Sbjct  8     RSLEETPTWAVATVCFVLVAISIIIEHIIHLIGKWLTKRHKRALYESLEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I++ICIP++ GN+  PC               E A      E   PE  
Sbjct  68    ISLLLTVGQGLISEICIPKSVGNSWHPC------------NKKEEAKLDAEKESDDPE--  113

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFF  811
                      EHHRRLL       S RRVL+    ++C  +G +P +S  G+HQLHIFIF 
Sbjct  114   ---------EHHRRLLMIADSGGSFRRVLAAGGTDKCAAKGKVPFVSSEGIHQLHIFIFV  164

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFM  985
             LAVFHV+Y  ITMALGR+K+R WK WE  T   E   ++DP R+R  +ETSF + + SF 
Sbjct  165   LAVFHVLYCIITMALGRLKMRRWKAWERETKTIEYQFSHDPERFRFARETSFGRRHLSFW  224

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             ++TP L + VCFFRQF RSV + DYL +RHGFI+ HLAP S  +FDFQKYI RSLE+DFK
Sbjct  225   SKTPALLWIVCFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHTQFDFQKYINRSLEEDFK  284

Query  1160  VVVGINLMLW  1189
             VVVGI+  +W
Sbjct  285   VVVGISPTVW  294



>ref|XP_007027290.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY07792.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=564

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 203/310 (65%), Gaps = 32/310 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA VC V+++IS+++E ++H IG   +++ KRAL EALEKIK ELM+ GF
Sbjct  8     RSLEQTPTWAVAAVCFVLILISIIIEHVIHLIGMWLKKRHKRALCEALEKIKSELMLFGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             +SLLLT GQ  ++ ICI +A G T  PC                     +  E    ED+
Sbjct  68    MSLLLTVGQGVVSDICISKALGATWHPC------------------SKNQESESDKNEDK  109

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFF  811
               +  E   +H RRLL         RRVL+    ++C  +G +P +S +G+ QLHIFIF 
Sbjct  110   SSDSDE---KHLRRLLTFQDSGGGGRRVLAAAGYDKCAAKGQVPFVSTDGIDQLHIFIFL  166

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWEMA--TAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LA+ HV+Y  IT+ALGR K+R WK WEM   T   + ++DP R+R T++T+F + + SF 
Sbjct  167   LAISHVLYCVITLALGRAKMRKWKTWEMETRTVDYQFSHDPERFRFTRDTTFGRRHLSFW  226

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             ++ PVL + VCFFRQFFRSV + DYL +R+GFI  HLAP S  KFDFQKYIKRSLE+DFK
Sbjct  227   SRAPVLLWVVCFFRQFFRSVPKVDYLTLRYGFIIAHLAPQSETKFDFQKYIKRSLEEDFK  286

Query  1160  VVVGINLMLW  1189
             VVVGIN ++W
Sbjct  287   VVVGINPIIW  296



>ref|XP_004983794.1| PREDICTED: MLO-like protein 5-like [Setaria italica]
Length=572

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 197/304 (65%), Gaps = 40/304 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE LLH +G    +K+K+AL +ALEK+K ELM LGF
Sbjct  13    RSLDQTPTWAVAAVCAVIVAASILLEGLLHHLGQLLSKKRKKALFDALEKVKSELMTLGF  72

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAP-GHGEHAPSGEHGEHAPPED  649
             ISLLLT    Y+++ICIPE A NTMLPC +   H E + P GHG                
Sbjct  73    ISLLLTVTGRYVSRICIPEGAANTMLPC-VRSGHSEAKEPSGHG----------------  115

Query  650   EHQEPAEAGGEHHRRLLWSMRRVLSGHAVE--ECKEGLIPLISLNGLHQLHIFIFFLAVF  823
                                 RR LS  + +   C +G++ L+S +G+HQLHIF+FFLAVF
Sbjct  116   --------------------RRHLSEDSTDLFSCPKGMVSLVSADGMHQLHIFVFFLAVF  155

Query  824   HVIYGAITMALGRMKIRGWKEWEMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             HV +   TM+LGR K R WK WE      E   DPS++RLT +TSFV+++ S  +++ V+
Sbjct  156   HVTFSFFTMSLGRAKTRIWKVWEKELPTYEFQYDPSKFRLTHQTSFVRQHASSWSKSAVM  215

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
              Y V FFRQFFRSVRR DY  +RHGFI+ HL+PG++F+F+KYIKRSLEDDFK VVGI+  
Sbjct  216   LYVVSFFRQFFRSVRRTDYFTLRHGFIAAHLSPGTRFNFRKYIKRSLEDDFKTVVGISPP  275

Query  1184  LWCA  1195
             LW +
Sbjct  276   LWAS  279



>ref|XP_008225371.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=591

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 200/311 (64%), Gaps = 36/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V++S+++E L+  +    ++K KRAL EA+EK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVLVSIIIEHLIELVAKWLKKKHKRALYEAVEKVKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+ ICI E  GNT  PC    E   ++   H E  PS            
Sbjct  68    ISLLLTVGQGPISNICISEKLGNTWHPCGKKQETKMNKDTEHDEETPS------------  115

Query  653   HQEPAEAGGEHHRRLL-------WSMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIFIF  808
                         RRLL         +RRVL+    + C  +G +P IS +G+HQLHIFIF
Sbjct  116   ------------RRLLSLFNQSDVGVRRVLAAAGTDNCAPKGKVPFISADGIHQLHIFIF  163

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSF  982
              LAVFH++Y  +TMALGR K+R WK W  E  TA+ + ++DP R+R  ++TSF + + SF
Sbjct  164   VLAVFHILYCILTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSF  223

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDF  1156
              TQTP L + VCFFRQF RSV + DYL +RHGFI  HL+P S  KF+FQKYI RSLE+DF
Sbjct  224   WTQTPFLMWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLSPQSHQKFNFQKYINRSLEEDF  283

Query  1157  KVVVGINLMLW  1189
             KVVVGI+  +W
Sbjct  284   KVVVGISPPIW  294



>gb|KHN05728.1| MLO-like protein 6 [Glycine soja]
Length=504

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 200/311 (64%), Gaps = 37/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAV+ VC V+++IS+ +E ++H IG   ++K +RAL E+LEKIK ELM+LGF
Sbjct  8     RNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I++ICI E    T  PC   D+   H++                  E E
Sbjct  68    ISLLLTVGQGPISRICISEKVAGTWHPC---DDSSNHESDSE---------------ESE  109

Query  653   HQEPAEAGGEHHRRLLWSM--------RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIF  808
             ++        + RRLL +         RRVL+G   ++C EG +P +S +G+HQLHIFIF
Sbjct  110   NRT-------NSRRLLAAFYGSDDVNPRRVLAGGGADKCPEGKVPFVSSDGIHQLHIFIF  162

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV+Y   TMALGR K++ WK WE  T   E   ++DP R+R  +ETSF + + SF
Sbjct  163   VLAVFHVLYCIFTMALGRAKMKRWKRWEEETKTPEYQFSHDPERFRFARETSFGRRHLSF  222

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPG--SKFDFQKYIKRSLEDDF  1156
              T+ PVL + VCFFRQF RSV   DYL +RHGFI  HLAP   SKFDF+KYIKRSL++DF
Sbjct  223   WTKNPVLIWIVCFFRQFVRSVPNVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDF  282

Query  1157  KVVVGINLMLW  1189
             KVVVGI+   W
Sbjct  283   KVVVGISPPFW  293



>ref|XP_002465008.1| hypothetical protein SORBIDRAFT_01g030400 [Sorghum bicolor]
 gb|EER92006.1| hypothetical protein SORBIDRAFT_01g030400 [Sorghum bicolor]
Length=572

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 193/303 (64%), Gaps = 35/303 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE LLH +G    +K+K AL +ALEK+K ELM LGF
Sbjct  9     RALDQTPTWAVAAVCAVIVAASILLEGLLHHLGQLLNKKRKIALFDALEKVKSELMTLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT    YIA ICIPE A NTMLPC         +  GH E     +HG     ED 
Sbjct  69    ISLLLTVTGRYIAHICIPEGAANTMLPC--------RRQSGHSEAEEPEDHGRRHLSEDP  120

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                                        +  C +G++ L+S +G+HQLHIF+FFLAVFHV 
Sbjct  121   TN-------------------------LFSCPKGMVSLVSADGMHQLHIFVFFLAVFHVT  155

Query  833   YGAITMALGRMKIRGWKEWEMATAQDEAA--NDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             +   TM+LGR K R WK WE  T   E    NDPS++RLT +TSFV+++ S  +++ +  
Sbjct  156   FSFFTMSLGRAKTRIWKVWEKETCSPEYNYLNDPSKFRLTHQTSFVRQHASCWSKSTITL  215

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             Y V FFRQFFRSVRR DYL +RHGFIS HL+PG++F+F+KYIKRSLEDDFK VVGI+  L
Sbjct  216   YFVSFFRQFFRSVRRTDYLTLRHGFISAHLSPGTRFNFRKYIKRSLEDDFKTVVGISPPL  275

Query  1187  WCA  1195
             W +
Sbjct  276   WAS  278



>ref|XP_011014774.1| PREDICTED: MLO-like protein 10 isoform X2 [Populus euphratica]
Length=496

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 168/249 (67%), Gaps = 28/249 (11%)
 Frame = +2

Query  458   MVLGFISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHA  637
             M+LGFISLLLTFGQ +IAKIC+P+    TMLPC    E V  ++        S   GE  
Sbjct  1     MILGFISLLLTFGQYHIAKICVPQDVVGTMLPC--KKEGVTDKS--------SSTKGEEE  50

Query  638   PPEDEHQEPAEAGGEHHRRLLWSMRRVLSG-HAVEECKEGLIPLISLNGLHQLHIFIFFL  814
             P                RRLLW  RR L+G  +   CK+G   LIS++GLHQLHI IFFL
Sbjct  51    P---------------RRRLLWFDRRFLAGAKSAVNCKDGYEQLISVDGLHQLHILIFFL  95

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQD--EAANDPSRYRLTKETSFVKENTSFMT  988
             A FHV++  ITM LGR+K R WK WE+ T     E +NDPSR+RLT ETSFV+ +TSF T
Sbjct  96    ACFHVLFSVITMTLGRLKTRAWKRWELETLSHDYEFSNDPSRFRLTHETSFVRSHTSFWT  155

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVV  1168
             + P  FY  CF RQFF SV R+DYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VV
Sbjct  156   RIPFFFYVGCFIRQFFISVSRSDYLTLRNGFITVHLAPGSKFNFQKYIKRSLEDDFKIVV  215

Query  1169  GINLMLWCA  1195
             G++ +LW +
Sbjct  216   GVSPVLWAS  224



>ref|XP_010473363.1| PREDICTED: MLO-like protein 6 isoform X2 [Camelina sativa]
Length=492

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 203/310 (65%), Gaps = 28/310 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L++T TWAVA+VC V+++IS+++EKL+HKIG  F+ K K+AL EALEK+K ELM++GF
Sbjct  9     KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ YI+ ICIP+    +M PC                 +PS E  ++   +  
Sbjct  69    ISLLLTIGQGYISNICIPKNIAASMHPC-----------------SPSEEARKYGKKDVP  111

Query  653   HQEPAEAGGEHHRRLLWSM------RRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFF  811
               E  E   E+ RR L  +      RR L+    ++C E G +  +S  G+HQLHIFIF 
Sbjct  112   KVEDGENDDENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFV  171

Query  812   LAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAV HVIY  +T ALG+ K+R WK W  E  T + + ++DP R+R  ++TSF + + +F 
Sbjct  172   LAVCHVIYCIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFW  231

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             ++T +  + VCFFRQFFRSV + DYL +RHGFI  HLAPGS  +FDF+KYI+RSLE+DFK
Sbjct  232   SRTTITLWIVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFK  291

Query  1160  VVVGINLMLW  1189
              +V IN ++W
Sbjct  292   TIVEINPVIW  301



>ref|XP_009411538.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
 ref|XP_009411539.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 211/305 (69%), Gaps = 22/305 (7%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+ TPTWAVA+VCLV+V+IS+++E ++  +G   +++ ++AL E+LEKIK ELM++GF
Sbjct  10    RTLEVTPTWAVAVVCLVLVLISIIIEHVIDLVGKWLKKRHRKALYESLEKIKSELMLMGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+KIC+P++ G++  PC   DE     A GH +   S   G        
Sbjct  70    ISLLLTVGQSLISKICVPKSVGDSWHPCKPGDESAATSADGHSQD--SSTTGRRL-----  122

Query  653   HQEPAEAGGEHHRRLLWSMRRVLS-GHAVEEC-KEGLIPLISLNGLHQLHIFIFFLAVFH  826
              Q+   AG           RR+L+ G   ++C  +G +PLIS +G+HQLHIFIF LAV H
Sbjct  123   LQDSVSAG---------VFRRILAGGGGSDKCAAKGKVPLISTDGIHQLHIFIFVLAVSH  173

Query  827   VIYGAITMALGRMKIRGWKEWEM--ATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             ++Y   TMALGR+K+R WK WE+   TA+ + ++DP+R+R  +ETSF + + SF +++P+
Sbjct  174   ILYCISTMALGRLKMRRWKAWELETKTAEYQFSHDPARFRFARETSFGRRHLSFWSKSPI  233

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKVVVGI  1174
             L + VCFFRQF RSV + DYL +RHGFI  HLAP S  KF+FQKYIKRSL++DFKVVVGI
Sbjct  234   LIWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSSTKFNFQKYIKRSLDEDFKVVVGI  293

Query  1175  NLMLW  1189
             +  +W
Sbjct  294   SPTIW  298



>gb|EYU18859.1| hypothetical protein MIMGU_mgv1a003503mg [Erythranthe guttata]
Length=581

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 200/304 (66%), Gaps = 26/304 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V +S+++E ++H IG   + K KRAL EALEK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVSVSIVIEYIIHLIGKWLKSKHKRALYEALEKVKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ ICI E  G T  PC    E   ++ P  G              ++ 
Sbjct  68    ISLLLTVGQSPISDICISEEVGATWHPCSKKQEKYYYKDPVLG--------------DES  113

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFFLAVFHV  829
              ++   AGG        S+RR L+    + C  +G +  +S + +HQLHIFIF LA+FHV
Sbjct  114   RRKLLTAGGG-------SLRRNLAAAGTDNCAAKGKVAFVSADAIHQLHIFIFVLAIFHV  166

Query  830   IYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  +TMALGR K+R WK W  E  TA+ + ++DP R+R  +ETSF + + SF ++TP+L
Sbjct  167   LYCILTMALGRAKMRRWKAWERETRTAEYQFSHDPERFRFARETSFGRRHLSFWSKTPIL  226

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKVVVGIN  1177
              + VCFFRQF RSV + DYL +RHGFI  HLAP S  KFDFQKYI RSLE+DFKVVVGI+
Sbjct  227   MWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGIS  286

Query  1178  LMLW  1189
               +W
Sbjct  287   PPIW  290



>ref|NP_001268013.1| MLO11 protein [Vitis vinifera]
 gb|ACF25910.1| MLO-like protein 3 [Vitis vinifera]
 emb|CBI32709.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 159/308 (52%), Positives = 204/308 (66%), Gaps = 30/308 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V+IS+++E +LH IG    ++ KRAL EALEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDE--HVEHQAPGHGEHAPSGEHGEHAPPE  646
             ISLLLT GQ  IA ICI E    T  PC    E  +V ++           ++G+     
Sbjct  68    ISLLLTVGQGTIAGICISEKIAATWHPCGKKQEIKYVSNEE----------DYGKR----  113

Query  647   DEHQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFH  826
                 E +++ G        S RRVL+    ++C EG +P +S  G+HQLHIFIF LAVFH
Sbjct  114   -RLLEISDSDG--------SNRRVLAAAGDDKCGEGKVPFVSNYGIHQLHIFIFVLAVFH  164

Query  827   VIYGAITMALGRMKIRGWKEWEMA--TAQDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             V+Y  IT+ALGR K+R WK WEM   TA+   ANDP R+R  ++TSF + +    + +PV
Sbjct  165   VLYCIITLALGRAKMRKWKAWEMETRTAEYRFANDPERFRFARDTSFGRRHLHSWSTSPV  224

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKVVVGI  1174
             L + VCFFRQF RSV + DYL +RHGFI  HLAP S  +FDFQKYIKRSLE+DFKVVVGI
Sbjct  225   LLWIVCFFRQFVRSVPKVDYLTLRHGFIIAHLAPESHTRFDFQKYIKRSLEEDFKVVVGI  284

Query  1175  NLMLW-CA  1195
             + ++W CA
Sbjct  285   SPIIWFCA  292



>ref|XP_008796803.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   268 bits (686),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 205/309 (66%), Gaps = 30/309 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVA VC V+V+IS+ +E  +H IG   +++ +RAL EALEKIK ELM++GF
Sbjct  10    RSLEETPTWAVAAVCFVLVIISIFIEHGIHLIGKWLKKRHQRALYEALEKIKSELMLMGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q  I+KIC+P++ GN+  PC   D           E A +G   + +  ED 
Sbjct  70    ISLLLTVSQGLISKICVPKSVGNSWHPCRPED-----------EAATTGTGDDDS--EDL  116

Query  653   HQEPAEAGGEHHRRLLWS-----MRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFFL  814
             H       G   RRLL +      RR+L+G   +EC  +  +P IS  G+HQLHIFIF L
Sbjct  117   H-------GTTGRRLLHTESSTIFRRILAGGGNDECAAQDKVPFISSEGIHQLHIFIFVL  169

Query  815   AVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMT  988
             AV HV+Y  ITMALGR+K+R WK WE+ T   E   ++DP R+R  ++TSF + +  F +
Sbjct  170   AVSHVLYCIITMALGRLKMRSWKGWELETKTIEYQFSHDPDRFRFARDTSFGRRHLDFWS  229

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKV  1162
             ++P+L + VCFFRQF RSV + DYL +RHGFI  HLAP S  KF+FQKYIKRSLE+DFKV
Sbjct  230   KSPILIWIVCFFRQFLRSVPKVDYLTLRHGFIMAHLAPQSSTKFNFQKYIKRSLEEDFKV  289

Query  1163  VVGINLMLW  1189
             VVGI+  +W
Sbjct  290   VVGISPTIW  298



>ref|XP_003540745.1| PREDICTED: MLO-like protein 6-like isoform X1 [Glycine max]
Length=577

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 199/311 (64%), Gaps = 37/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAV+ VC V+++IS+ +E ++H IG   ++K +RAL E+LEKIK ELM+LGF
Sbjct  8     RNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I++ICI E    T  PC   D+   H++                  + E
Sbjct  68    ISLLLTVGQGPISRICISEKVAGTWHPC---DDSSNHES------------------DSE  106

Query  653   HQEPAEAGGEHHRRLLWSM--------RRVLSGHAVEECKEGLIPLISLNGLHQLHIFIF  808
               E       + RRLL +         RRVL+G   ++C EG +P +S +G+HQLHIFIF
Sbjct  107   ESE----NRTNSRRLLAAFYGSDDVNPRRVLAGGGADKCPEGKVPFVSSDGIHQLHIFIF  162

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFHV+Y   TMALGR K++ WK WE  T   E   ++DP R+R  +ETSF + + SF
Sbjct  163   VLAVFHVLYCIFTMALGRAKMKRWKRWEEETKTTEYQFSHDPERFRFARETSFGRRHLSF  222

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPG--SKFDFQKYIKRSLEDDF  1156
              T+ PVL + VCFFRQF RSV   DYL +RHGFI  HLAP   SKFDF+KYIKRSL++DF
Sbjct  223   WTKNPVLIWIVCFFRQFVRSVPNVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDF  282

Query  1157  KVVVGINLMLW  1189
             KVVVGI+   W
Sbjct  283   KVVVGISPPFW  293



>gb|KEH25655.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=411

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/308 (48%), Positives = 201/308 (65%), Gaps = 33/308 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVA+VC V++ IS+++E ++H IG  F++K K AL EALEK+KGELM++GF
Sbjct  9     RTLEETPTWAVAVVCFVLLAISIVIEHIIHAIGKWFKKKNKNALYEALEKVKGELMLMGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT  Q YI+KICI E  G+T  PC                  P  +   +    DE
Sbjct  69    ISLLLTVFQDYISKICISEKVGSTWHPC----------------STPKTKTASN----DE  108

Query  653   HQEPAEAGGEHHRRLLWSM----RRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFFLA  817
             + E       H R+LL       RR+L+    ++C + G + L+S  G+H+LHIFIF LA
Sbjct  109   NSE----SENHDRKLLEYFDPNPRRILATKGYDQCADKGKVALVSAYGIHELHIFIFVLA  164

Query  818   VFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMTQ  991
             +FH++   IT+ALGR K+R WK+W  E  T + +  NDP R+R  ++T+F + + S  T+
Sbjct  165   IFHILQCIITLALGRFKMRRWKKWEDETRTVEYQFYNDPERFRFARDTTFGRRHLSMWTK  224

Query  992   TPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPG--SKFDFQKYIKRSLEDDFKVV  1165
             +P+  + VCFFRQFF S+ R DYLA+RHGFI  HLAPG  ++FDFQKYI RSLE DFKVV
Sbjct  225   SPISLWIVCFFRQFFGSISRVDYLALRHGFIMAHLAPGNDAEFDFQKYISRSLEKDFKVV  284

Query  1166  VGINLMLW  1189
             VGI+  +W
Sbjct  285   VGISPTIW  292



>ref|XP_011089887.1| PREDICTED: MLO-like protein 6 [Sesamum indicum]
Length=587

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 204/311 (66%), Gaps = 36/311 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V IS+++E ++H IG   + K KRAL EALEK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKHKRALYEALEKLKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+ ICI +A G T  PC    E                  G+  P E+ 
Sbjct  68    ISLLLTVGQGPISDICISKAVGATWHPCSKKQE------------------GKKYPAEE-  108

Query  653   HQEPAEAGGEHHRRLLW-------SMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIF  808
                  + G ++ R+LL        S RR+L+    ++C  +G +P +S +G+HQLHIFIF
Sbjct  109   -----DLGEDNRRKLLMVEEDGGGSFRRILAAGGTDKCAAKGKVPFVSSDGIHQLHIFIF  163

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSF  982
              LAVFHV+Y  +TMALG  K+R WK W  E  TA+ + ++DP R+R  +ETSF + + SF
Sbjct  164   VLAVFHVLYCILTMALGGAKMRKWKAWEKETRTAEYQFSHDPERFRFARETSFGRRHLSF  223

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDF  1156
              ++TP+L + VCFFRQF RSV + DYL +RHGFI  HLAP S   FDFQKYI+RSLE+DF
Sbjct  224   WSKTPLLLWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHASFDFQKYIRRSLEEDF  283

Query  1157  KVVVGINLMLW  1189
             KVVVGI+  +W
Sbjct  284   KVVVGISPPIW  294



>ref|XP_010032020.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
 gb|KCW51405.1| hypothetical protein EUGRSUZ_J00942 [Eucalyptus grandis]
Length=583

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 208/311 (67%), Gaps = 35/311 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V++S+++E ++H IG   ++K K AL EALEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVLVSIIIEHIIHLIGQWLKKKHKTALYEALEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+ ICI      T  PC    E +++++ G              PP+D+
Sbjct  68    ISLLLTVGQGLISNICISSEVAATWHPCGKSHEQMKNKSQG--------------PPDDK  113

Query  653   HQEPAEAGGEHHRRLL-------WSMRRVLSGHAVEECK-EGLIPLISLNGLHQLHIFIF  808
              ++         R+LL         +RRVL+G   ++C  +G +P +S +G+HQLHIFIF
Sbjct  114   SKD---------RKLLALSDFPGGGVRRVLAGATYDKCAAKGKVPFVSADGIHQLHIFIF  164

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSF  982
              LAVFH++Y  +TMALGR K+R WK WE  T   E   ++DP R+R  +ETSF + + SF
Sbjct  165   VLAVFHILYCILTMALGRAKMRSWKAWEKETRTTEYQFSHDPERFRFARETSFGRRHMSF  224

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDF  1156
              T+TPVL + VCFFRQF RSV + DYL +RHGFI+ HLAP S  KFDFQKYIKRSLE+DF
Sbjct  225   WTKTPVLMWIVCFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHVKFDFQKYIKRSLEEDF  284

Query  1157  KVVVGINLMLW  1189
             KVVVGI+  +W
Sbjct  285   KVVVGISPPIW  295



>ref|XP_006579025.1| PREDICTED: MLO protein homolog 1-like [Glycine max]
Length=396

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/302 (48%), Positives = 194/302 (64%), Gaps = 24/302 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWAVA VC V ++IS+++E  +H +G  F+++ K+A+ EALEKIK ELM+LGF
Sbjct  10    RSLKETPTWAVAAVCSVFIIISVLIEHGIHSLGKWFQKRHKKAMNEALEKIKSELMLLGF  69

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLL+TFG  YIAKICIP +AG+ MLPC   +               S +       E  
Sbjct  70    ISLLITFGTKYIAKICIPVSAGDIMLPCKKVEVSDSDDDSNDRRKLLSFDDN---VVEWR  126

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHVI  832
                 A +GG++                    ++G +PLIS +G+HQLHIFIF LAVFH+ 
Sbjct  127   RVLAAASGGDYC------------------SQKGKVPLISQSGVHQLHIFIFVLAVFHIF  168

Query  833   YGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFMTQTPVLF  1006
             Y  +TM L R K++ WK WE  T+  E    NDP+R+RL  +TSFV+ ++ + ++ P + 
Sbjct  169   YSVMTMVLARAKMKKWKAWEAETSSLEYQFTNDPARFRLAHQTSFVRRHSGW-SRMPGIR  227

Query  1007  YSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLML  1186
             + V FFRQFF SV + DY+ MRHGFI+ H AP SKFDFQKYIKRS+EDDFKVVVGI++ L
Sbjct  228   WIVAFFRQFFGSVTKVDYMTMRHGFINAHFAPDSKFDFQKYIKRSMEDDFKVVVGISIPL  287

Query  1187  WC  1192
             W 
Sbjct  288   WV  289



>ref|XP_002510708.1| Protein MLO, putative [Ricinus communis]
 gb|EEF52895.1| Protein MLO, putative [Ricinus communis]
Length=556

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 198/310 (64%), Gaps = 40/310 (13%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L +TPTWA+ALVC V VVIS+++E ++H +G  F++++ +A+ EALEKIK ELM+LGF
Sbjct  9     RSLQETPTWALALVCAVFVVISVLIEHVIHSLGKLFQKRRNKAMSEALEKIKAELMLLGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT G  YIAKICIP   G+ MLPC            G+ E                
Sbjct  69    ISLLLTVGTKYIAKICIPAKYGDDMLPC----------KSGYEESY--------------  104

Query  653   HQEPAEAGGEHHRRLLWSM------RRVLSGHAVEE---CKEGLIPLISLNGLHQLHIFI  805
                 ++ GG+  RR L S       RR L+  A  +    K+G IPLIS  G+HQLHIFI
Sbjct  105   ----SDKGGDDRRRKLLSFAGDVIWRRGLAAAAGGDDYCAKKGKIPLISQTGVHQLHIFI  160

Query  806   FFLAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTS  979
             F LAVFHV+Y  +T+AL + K++ WK WE  T+  E    NDPSR+RL  +TSFVK ++ 
Sbjct  161   FVLAVFHVLYSVLTIALAQAKMKKWKTWESETSSLEYQFTNDPSRFRLAHQTSFVKRHSG  220

Query  980   FMTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFK  1159
               T  P + + V FFRQFF SV + DYL MR+GFI+ H AP SKFDF KYIKR +EDDFK
Sbjct  221   IST-APGIRWIVAFFRQFFGSVTKVDYLTMRNGFINAHFAPNSKFDFHKYIKRCMEDDFK  279

Query  1160  VVVGINLMLW  1189
             VVVGI++ LW
Sbjct  280   VVVGISIPLW  289



>ref|XP_010264735.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=578

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 203/310 (65%), Gaps = 34/310 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVA VC V+V IS+++E ++H IG    ++ KRAL E+LEKIK ELM+LGF
Sbjct  8     RSLEETPTWAVATVCFVLVAISIIIEHIIHLIGKWLTKRHKRALYESLEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I++ICIP++ GN+  PC               E A      E   PE  
Sbjct  68    ISLLLTVGQGLISEICIPKSVGNSWHPC------------NKKEEAKLDAEKESDDPE--  113

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIFF  811
                      EHHRRLL       S RRVL+    ++C  +G +P +S  G+HQLHIFIF 
Sbjct  114   ---------EHHRRLLMIADSGGSFRRVLAAGGTDKCAAKGKVPFVSSEGIHQLHIFIFV  164

Query  812   LAVFHVIYGAITMALGRMKIRGWKEWEMATAQDEA--ANDPSRYRLTKETSFVKENTSFM  985
             LAVFHV+Y  ITMALGR+K+R WK WE  T   E   ++DP R+R  +ETSF + + SF 
Sbjct  165   LAVFHVLYCIITMALGRLKMRRWKAWERETKTIEYQFSHDPERFRFARETSFGRRHLSFW  224

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             ++TP L + VCFFRQF RSV + DYL +RHGFI+ HLAP S  +FDFQKYI RSLE+DFK
Sbjct  225   SKTPALLWIVCFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHTQFDFQKYINRSLEEDFK  284

Query  1160  VVVGINLMLW  1189
             VVVGI+  +W
Sbjct  285   VVVGISPTVW  294



>ref|XP_010043721.1| PREDICTED: MLO-like protein 6 isoform X2 [Eucalyptus grandis]
Length=409

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/304 (53%), Positives = 201/304 (66%), Gaps = 26/304 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V++S+++E ++H IG   ++K KRAL EALEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVLVSIIIEYIIHLIGQWLKKKHKRALYEALEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I KICIP+  G T  PC  + +  E  A    +       G   P    
Sbjct  68    ISLLLTVGQGPITKICIPQKVGATWHPC--NKKEEEEGAEEESDAGRRRLLGMMGP----  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVL-SGHAVEECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                    GG        S RR L +     +C EG +P IS +G+HQLHIFIF LAVFHV
Sbjct  122   -------GG--------SFRRALATATTTNQCAEGKVPFISADGIHQLHIFIFVLAVFHV  166

Query  830   IYGAITMALGRMKIRGWKEWEMA--TAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
             +Y  +TMALG+ K+R WK WE    TA+ + ++DP R+R T+ETSF K + +F T+TPVL
Sbjct  167   LYCILTMALGQAKMRSWKAWETETRTAEYQFSHDPHRFRFTRETSFGKRHLNFWTKTPVL  226

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKVVVGIN  1177
              + VCFFRQF RSV + DYL +RHGFI  HLAP S  KFDFQKYI RSLE+DFKVVVGI+
Sbjct  227   IWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSQTKFDFQKYINRSLEEDFKVVVGIS  286

Query  1178  LMLW  1189
               +W
Sbjct  287   PPIW  290



>ref|XP_011044385.1| PREDICTED: MLO-like protein 6 isoform X2 [Populus euphratica]
Length=611

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 209/305 (69%), Gaps = 24/305 (8%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V +S+++E ++H I     +K+KRAL EALEKIK ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKRALYEALEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQS I+ ICI + AG T  PC   +           E   +GE+ +    E+ 
Sbjct  68    ISLLLTVGQSTISNICISKKAGATWHPCNKKE-----------EAKLNGENTKETDNENS  116

Query  653   HQEPAEAGGEHHRRLLWSMRRVL-SGHAVEEC-KEGLIPLISLNGLHQLHIFIFFLAVFH  826
              +  + + GE       S+RRVL +G + ++C  +G +P +S +G+HQLHIFIF LA+FH
Sbjct  117   RKLLSISAGE-------SLRRVLAAGDSTDKCAAKGKVPFVSSDGIHQLHIFIFVLAIFH  169

Query  827   VIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPV  1000
             ++Y  +TMALGR K++ WK W  E  TA+ + ++DP R+R  +ETSF + + SF T+TPV
Sbjct  170   ILYCILTMALGRAKMKSWKRWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWTKTPV  229

Query  1001  LFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKVVVGI  1174
             L + VCFFRQF RSV + DYL +RHGFI  HLAP S  KFDFQKYI RSLE+DFKVVVGI
Sbjct  230   LIWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGI  289

Query  1175  NLMLW  1189
             +  +W
Sbjct  290   SPPIW  294



>ref|XP_002526372.1| Protein MLO, putative [Ricinus communis]
 gb|EEF36043.1| Protein MLO, putative [Ricinus communis]
Length=594

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 206/309 (67%), Gaps = 31/309 (10%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L++TPTWAVA+VC V+V+IS+++E ++H IG   ++K KRAL EALEKIK ELM+LGF
Sbjct  8     RSLEETPTWAVAIVCFVLVLISIIIEYIIHLIGKWLKKKHKRALYEALEKIKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+KICIPE+ G+T  PC   +E    ++                     
Sbjct  68    ISLLLTVGQGVISKICIPESVGSTWHPCSKKEEEEIDKS---------------------  106

Query  653   HQEPAEAGGEHHRRLLW------SMRRVLSGHAVEECKEGLIPLISLNGLHQLHIFIFFL  814
              +       E+ RRLL         RR L+G   ++C EG +P +S +G+HQLHIFIF L
Sbjct  107   EETQTSEDYENRRRLLMISDSGGRFRRFLAGETTDQCGEGKVPFMSSDGIHQLHIFIFVL  166

Query  815   AVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             AVFHV+Y  +TMALGR K+R WK W  E  TA+ + ++DP R+R  +ETSF + + SF T
Sbjct  167   AVFHVLYCVLTMALGRAKMRRWKSWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWT  226

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKV  1162
             +TPVL + VCFFRQF RSV + DYL +RHGFI  HLAP S  KFDFQKYI RSLE+DFKV
Sbjct  227   KTPVLIWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHMKFDFQKYINRSLEEDFKV  286

Query  1163  VVGINLMLW  1189
             VVGI+  +W
Sbjct  287   VVGISPPIW  295



>ref|XP_007204981.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
 gb|EMJ06180.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
Length=593

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 202/311 (65%), Gaps = 34/311 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC V+V+IS+++E L+  +    ++K KRAL EALEK+K ELM+LGF
Sbjct  8     RSLEQTPTWAVAVVCFVLVLISIIIEHLIELVAKWLKKKHKRALHEALEKVKSELMLLGF  67

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+ ICI E  GNT  PC                     E   +   + E
Sbjct  68    ISLLLTVGQGPISNICISEKLGNTWHPC-----------------GKKQETKMNKDKDTE  110

Query  653   HQEPAEAGGEHHRRLL-------WSMRRVLSGHAVEEC-KEGLIPLISLNGLHQLHIFIF  808
             H +   +     RRLL         +RRVL+    ++C  +G +P IS +G+HQLHIFIF
Sbjct  111   HDDETPS-----RRLLSLFNQSDVGVRRVLAAAGTDKCAAKGKVPFISADGIHQLHIFIF  165

Query  809   FLAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSF  982
              LAVFH++Y  +TMALGR K+R WK W  E  TA+ + ++DP R+R  ++TSF + + S+
Sbjct  166   VLAVFHILYCILTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSY  225

Query  983   MTQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDF  1156
              TQTP+L + VCFFRQF RSV + DYL +RHGFI  HLAP S  KF+FQKYI RSLE+DF
Sbjct  226   WTQTPLLMWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQKFNFQKYINRSLEEDF  285

Query  1157  KVVVGINLMLW  1189
             KVVVGI+  +W
Sbjct  286   KVVVGISPPIW  296



>gb|AAG46114.1|AC073166_12 putative Mlo (pathogen resistance) protein [Oryza sativa Japonica 
Group]
 gb|EEE51332.1| hypothetical protein OsJ_32315 [Oryza sativa Japonica Group]
Length=580

 Score =   265 bits (678),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 200/304 (66%), Gaps = 36/304 (12%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R LDQTPTWAVA VC VIV  S++LE LLH +G  F +++K+AL +ALEK+K ELM LGF
Sbjct  18    RALDQTPTWAVAAVCAVIVAASILLEGLLHHLGQWFSKRRKKALFDALEKVKSELMTLGF  77

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLL+    YI++ICIP  A +TMLPC +     E + PG G                 
Sbjct  78    ISLLLSVTGRYISRICIPVGAADTMLPCSLRRSSSEQEVPGGGG----------------  121

Query  653   HQEPAEAGGEHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHV  829
                                RR LSG     +C +G++ L+S +GLHQLHIF+FFLAVFHV
Sbjct  122   -----------------HGRRHLSGDPTNFKCAKGMVSLVSADGLHQLHIFVFFLAVFHV  164

Query  830   IYGAITMALGRMKIRGWKEWEMATAQ--DEAANDPSRYRLTKETSFVKENTSFMTQTPVL  1003
              + AITM+LGR K R WKEWE  T     E + DPS++RLT +TSFV+++ S  +++ +L
Sbjct  165   AFSAITMSLGRAKTRIWKEWEKETCSLTYEFSYDPSKFRLTHQTSFVRQHASCWSKSTIL  224

Query  1004  FYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLM  1183
              Y V FFRQFFRSVRR DYL +RHGFI+ HL+ G++F+F+KYIKRSLEDDFK VVGI+  
Sbjct  225   LYFVSFFRQFFRSVRRTDYLTLRHGFIAAHLSLGTRFNFRKYIKRSLEDDFKTVVGISAP  284

Query  1184  LWCA  1195
             LW +
Sbjct  285   LWAS  288



>ref|XP_010473362.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=596

 Score =   266 bits (679),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 203/310 (65%), Gaps = 28/310 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L++T TWAVA+VC V+++IS+++EKL+HKIG  F+ K K+AL EALEK+K ELM++GF
Sbjct  9     KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ YI+ ICIP+    +M PC                 +PS E  ++   +  
Sbjct  69    ISLLLTIGQGYISNICIPKNIAASMHPC-----------------SPSEEARKYGKKDVP  111

Query  653   HQEPAEAGGEHHRRLLWSM------RRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFF  811
               E  E   E+ RR L  +      RR L+    ++C E G +  +S  G+HQLHIFIF 
Sbjct  112   KVEDGENDDENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFV  171

Query  812   LAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAV HVIY  +T ALG+ K+R WK W  E  T + + ++DP R+R  ++TSF + + +F 
Sbjct  172   LAVCHVIYCIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFW  231

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             ++T +  + VCFFRQFFRSV + DYL +RHGFI  HLAPGS  +FDF+KYI+RSLE+DFK
Sbjct  232   SRTTITLWIVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFK  291

Query  1160  VVVGINLMLW  1189
              +V IN ++W
Sbjct  292   TIVEINPVIW  301



>ref|XP_010418123.1| PREDICTED: MLO-like protein 6 [Camelina sativa]
Length=597

 Score =   265 bits (678),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 203/310 (65%), Gaps = 28/310 (9%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             + L++T TWAVA+VC V+++IS+++EKL+HKIG  F+ K K+AL EALEK+K ELM++GF
Sbjct  9     KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  68

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ YI+ ICIP+    +M PC                 +PS E  ++   +  
Sbjct  69    ISLLLTIGQGYISNICIPKNIAASMHPC-----------------SPSEEARKYGKKDVP  111

Query  653   HQEPAEAGGEHHRRLLWSM------RRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFF  811
               E  E   E+ RR L  +      RR L+    ++C E G +  +S  G+HQLHIFIF 
Sbjct  112   KVEDGENDDENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFV  171

Query  812   LAVFHVIYGAITMALGRMKIRGWKEW--EMATAQDEAANDPSRYRLTKETSFVKENTSFM  985
             LAV HVIY  +T ALG+ K+R WK W  E  T + + ++DP R+R  ++TSF + + +F 
Sbjct  172   LAVCHVIYCIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFW  231

Query  986   TQTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFK  1159
             ++T +  + VCFFRQFFRSV + DYL +RHGFI  HLAPGS  +FDF+KYI+RSLE+DFK
Sbjct  232   SRTTITLWIVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFK  291

Query  1160  VVVGINLMLW  1189
              +V IN ++W
Sbjct  292   TIVEINPVIW  301



>gb|KDO71546.1| hypothetical protein CISIN_1g008408mg [Citrus sinensis]
Length=566

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 162/235 (69%), Gaps = 28/235 (12%)
 Frame = +2

Query  500   SYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDEHQEPAEAGG  679
             SYI+KICIP    +TMLPC              G+H  S   G      DEH        
Sbjct  85    SYISKICIPSKVADTMLPC-----------KADGKHDASDTSG------DEH--------  119

Query  680   EHHRRLLWSMRRVLSGHAVE-ECKEGLIPLISLNGLHQLHIFIFFLAVFHVIYGAITMAL  856
             EH RRLLW   R L+  A   EC++G  PLI++  LHQLHI IFFLAVFHV+Y AITM L
Sbjct  120   EHRRRLLWFQHRYLAAAATSTECEKGSEPLITVEALHQLHILIFFLAVFHVLYSAITMML  179

Query  857   GRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMTQTPVLFYSVCFFRQ  1030
             GR+KIRGWK+WE   +T   E +NDPSR+RLT ETSFV+ +TSF T+ P  FY  CFFRQ
Sbjct  180   GRLKIRGWKKWEEETSTHDYEFSNDPSRFRLTHETSFVRAHTSFWTRIPFFFYVGCFFRQ  239

Query  1031  FFRSVRRADYLAMRHGFISVHLAPGSKFDFQKYIKRSLEDDFKVVVGINLMLWCA  1195
             FFRSV RADYL +R+GFI+VHLAPGSKF+FQKYIKRSLEDDFK+VVG++ +LW +
Sbjct  240   FFRSVSRADYLTLRNGFINVHLAPGSKFNFQKYIKRSLEDDFKIVVGVSPVLWTS  294



>ref|XP_009777573.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=608

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 198/309 (64%), Gaps = 35/309 (11%)
 Frame = +2

Query  293   RELDQTPTWavalvclvivviSLMLEKLLHKIGHTFERKKKRALVEALEKIKGELMVLGF  472
             R L+QTPTWAVA+VC  +V IS+++E ++H IG   + K K AL EALEKIK ELM+LGF
Sbjct  12    RSLEQTPTWAVAVVCFALVAISIVIEFIIHLIGKWLKSKHKNALYEALEKIKSELMLLGF  71

Query  473   ISLLLTFGQSYIAKICIPEAAGNTMLPCLIHDEHVEHQAPGHGEHAPSGEHGEHAPPEDE  652
             ISLLLT GQ  I+ IC+ E   +T  PC    E                         ++
Sbjct  72    ISLLLTVGQDPISNICVSEKIASTWHPCSKQKE------------------------AEK  107

Query  653   HQEPAEAGGEHHRRLLWS-----MRRVLSGHAVEECKE-GLIPLISLNGLHQLHIFIFFL  814
             +  P EA G H RRLL +     +RR+L+    ++C + G +  +S +G+HQLHIFIF L
Sbjct  108   YNVPVEAEG-HRRRLLTAADDGGVRRILAAVGTDKCADKGKVAFVSADGIHQLHIFIFVL  166

Query  815   AVFHVIYGAITMALGRMKIRGWKEWE--MATAQDEAANDPSRYRLTKETSFVKENTSFMT  988
             A+FHV Y   T+ALGR K+  WK WE    TA+ + A+DP R+R  ++TSF + + SF T
Sbjct  167   AIFHVFYCITTLALGRAKMSRWKAWEKETRTAEYQFAHDPERFRFARDTSFGRRHLSFWT  226

Query  989   QTPVLFYSVCFFRQFFRSVRRADYLAMRHGFISVHLAPGS--KFDFQKYIKRSLEDDFKV  1162
             + PVL + VCFFRQF RSV + DYL +RHGFI  HLAP S  KFDFQKYIKRSLE+DFKV
Sbjct  227   KNPVLLWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHVKFDFQKYIKRSLEEDFKV  286

Query  1163  VVGINLMLW  1189
             VVGI+  +W
Sbjct  287   VVGISPPIW  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2965111236698