BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32300_g1_i1 len=1336 path=[1:0-1335]

Length=1336
                                                                      Score     E

emb|CDP15776.1|  unnamed protein product                                430   1e-143   
ref|XP_009614381.1|  PREDICTED: mitogen-activated protein kinase ...    421   9e-140   
ref|XP_009793037.1|  PREDICTED: mitogen-activated protein kinase ...    419   6e-139   
ref|XP_004244346.1|  PREDICTED: mitogen-activated protein kinase ...    403   3e-133   
ref|XP_006346260.1|  PREDICTED: mitogen-activated protein kinase ...    403   5e-133   
ref|XP_011095801.1|  PREDICTED: mitogen-activated protein kinase ...    397   7e-131   
ref|XP_011097967.1|  PREDICTED: mitogen-activated protein kinase ...    392   2e-128   
gb|EYU27355.1|  hypothetical protein MIMGU_mgv1a026298mg                377   1e-123   
ref|XP_007213446.1|  hypothetical protein PRUPE_ppa025047mg             367   3e-119   
ref|XP_010644538.1|  PREDICTED: mitogen-activated protein kinase ...    362   3e-117   
ref|XP_008226949.1|  PREDICTED: mitogen-activated protein kinase ...    361   3e-116   
gb|EYU33654.1|  hypothetical protein MIMGU_mgv1a021391mg                355   1e-115   
gb|EPS71117.1|  hypothetical protein M569_03641                         354   2e-115   
ref|XP_007020769.1|  Mitogen-activated protein kinase kinase kina...    354   4e-114   
ref|XP_008380362.1|  PREDICTED: mitogen-activated protein kinase ...    352   1e-113   
ref|XP_008348361.1|  PREDICTED: mitogen-activated protein kinase ...    352   1e-113   
ref|XP_009361098.1|  PREDICTED: mitogen-activated protein kinase ...    353   2e-113   
ref|XP_002529924.1|  Mitogen-activated protein kinase kinase kina...    352   4e-113   Ricinus communis
ref|XP_010536673.1|  PREDICTED: mitogen-activated protein kinase ...    350   1e-112   
ref|XP_010244478.1|  PREDICTED: mitogen-activated protein kinase ...    348   5e-112   
gb|EPS63016.1|  hypothetical protein M569_11769                         345   6e-111   
ref|XP_009132644.1|  PREDICTED: mitogen-activated protein kinase ...    346   7e-111   
emb|CAN65217.1|  hypothetical protein VITISV_024689                     345   9e-111   Vitis vinifera
ref|XP_004295838.1|  PREDICTED: mitogen-activated protein kinase ...    346   9e-111   
ref|XP_002269660.1|  PREDICTED: mitogen-activated protein kinase ...    344   1e-110   Vitis vinifera
ref|XP_008385962.1|  PREDICTED: mitogen-activated protein kinase ...    345   1e-109   
gb|KDP39158.1|  hypothetical protein JCGZ_00915                         340   3e-109   
ref|XP_010096874.1|  Mitogen-activated protein kinase kinase kina...    341   6e-109   
ref|XP_009790439.1|  PREDICTED: mitogen-activated protein kinase ...    339   7e-109   
gb|KDO62067.1|  hypothetical protein CISIN_1g045508mg                   337   3e-107   
emb|CDY36728.1|  BnaA03g11580D                                          337   3e-107   
ref|XP_006452414.1|  hypothetical protein CICLE_v10010150mg             336   6e-107   
ref|XP_010252458.1|  PREDICTED: mitogen-activated protein kinase ...    336   1e-106   
ref|XP_004170912.1|  PREDICTED: mitogen-activated protein kinase ...    332   1e-106   
ref|XP_010545229.1|  PREDICTED: mitogen-activated protein kinase ...    336   1e-106   
ref|XP_006475134.1|  PREDICTED: mitogen-activated protein kinase ...    336   1e-106   
emb|CDX89295.1|  BnaA01g15980D                                          335   2e-106   
ref|XP_010445108.1|  PREDICTED: mitogen-activated protein kinase ...    335   2e-106   
ref|XP_004139869.1|  PREDICTED: mitogen-activated protein kinase ...    332   2e-106   
ref|XP_010436369.1|  PREDICTED: mitogen-activated protein kinase ...    333   8e-106   
ref|XP_008448094.1|  PREDICTED: mitogen-activated protein kinase ...    336   1e-105   
emb|CDY19916.1|  BnaC09g31820D                                          332   1e-105   
ref|XP_006364180.1|  PREDICTED: mitogen-activated protein kinase ...    330   2e-105   
ref|XP_008229972.1|  PREDICTED: mitogen-activated protein kinase ...    332   2e-105   
ref|XP_009121273.1|  PREDICTED: mitogen-activated protein kinase ...    332   2e-105   
emb|CDY69540.1|  BnaCnng64060D                                          331   4e-105   
emb|CDY17301.1|  BnaA10g09350D                                          330   7e-105   
ref|NP_200320.1|  mitogen-activated protein kinase kinase kinase 15     330   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389580.1|  hypothetical protein POPTR_0021s00300g             326   3e-104   
ref|XP_002869589.1|  hypothetical protein ARALYDRAFT_492112             329   3e-104   
ref|XP_010451165.1|  PREDICTED: mitogen-activated protein kinase ...    329   3e-104   
ref|XP_006364160.1|  PREDICTED: mitogen-activated protein kinase ...    325   4e-104   
ref|XP_010916795.1|  PREDICTED: mitogen-activated protein kinase ...    330   4e-104   
ref|XP_010089475.1|  Mitogen-activated protein kinase kinase kina...    326   9e-104   
ref|XP_002302871.2|  hypothetical protein POPTR_0002s21350g             326   1e-103   Populus trichocarpa [western balsam poplar]
gb|KDP24854.1|  hypothetical protein JCGZ_24448                         327   1e-103   
ref|XP_006364162.1|  PREDICTED: mitogen-activated protein kinase ...    323   2e-103   
ref|XP_010926215.1|  PREDICTED: mitogen-activated protein kinase ...    328   2e-103   
ref|XP_003539499.1|  PREDICTED: mitogen-activated protein kinase ...    325   2e-103   
ref|XP_004243853.1|  PREDICTED: mitogen-activated protein kinase ...    322   3e-103   
ref|XP_004289177.1|  PREDICTED: mitogen-activated protein kinase ...    325   4e-103   
ref|XP_009144845.1|  PREDICTED: mitogen-activated protein kinase ...    326   5e-103   
ref|XP_011008032.1|  PREDICTED: mitogen-activated protein kinase ...    328   6e-103   
emb|CDX97370.1|  BnaC08g12350D                                          324   6e-103   
ref|XP_003541951.1|  PREDICTED: mitogen-activated protein kinase ...    323   1e-102   
gb|AAL87297.1|  unknown protein                                         323   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026132.1|  Mitogen-activated protein kinase kinase kina...    325   2e-102   
gb|KHN44865.1|  Mitogen-activated protein kinase kinase kinase A        322   2e-102   
ref|XP_009796297.1|  PREDICTED: mitogen-activated protein kinase ...    322   3e-102   
ref|XP_006447587.1|  hypothetical protein CICLE_v10015460mg             322   3e-102   
ref|XP_007149981.1|  hypothetical protein PHAVU_005G115900g             322   4e-102   
emb|CAB36535.1|  putative NPK1-related protein kinase                   323   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304913.2|  hypothetical protein POPTR_0004s00910g             322   5e-102   Populus trichocarpa [western balsam poplar]
ref|NP_194419.2|  mitogen-activated protein kinase kinase kinase 16     323   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321133.2|  kinase family protein                              320   6e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006283707.1|  hypothetical protein CARUB_v10004778mg             323   9e-102   
emb|CDY14295.1|  BnaA08g14260D                                          323   1e-101   
ref|XP_011006457.1|  PREDICTED: mitogen-activated protein kinase ...    321   1e-101   
dbj|BAF00528.1|  putative NPK1-related protein kinase                   322   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009616882.1|  PREDICTED: mitogen-activated protein kinase ...    318   1e-101   
ref|XP_003526335.1|  PREDICTED: mitogen-activated protein kinase ...    319   2e-101   
ref|XP_004487421.1|  PREDICTED: mitogen-activated protein kinase ...    320   2e-101   
emb|CAN66202.1|  hypothetical protein VITISV_015759                     323   2e-101   Vitis vinifera
ref|XP_004243854.1|  PREDICTED: mitogen-activated protein kinase ...    317   2e-101   
gb|KDO54709.1|  hypothetical protein CISIN_1g015500mg                   320   2e-101   
ref|XP_008379645.1|  PREDICTED: mitogen-activated protein kinase ...    320   3e-101   
ref|XP_008782219.1|  PREDICTED: serine/threonine-protein kinase 4...    324   4e-101   
ref|XP_009607835.1|  PREDICTED: mitogen-activated protein kinase ...    317   4e-101   
ref|XP_008784479.1|  PREDICTED: mitogen-activated protein kinase ...    322   4e-101   
gb|AHW50674.1|  mitogen-activated protein kinase kinase kinase a        319   5e-101   
ref|XP_004243852.1|  PREDICTED: mitogen-activated protein kinase ...    316   6e-101   
ref|XP_003539857.1|  PREDICTED: mitogen-activated protein kinase ...    317   6e-101   
ref|XP_002866074.1|  MAPKKK15                                           320   6e-101   
ref|XP_004243851.1|  PREDICTED: mitogen-activated protein kinase ...    316   7e-101   
ref|XP_009109958.1|  PREDICTED: mitogen-activated protein kinase ...    319   2e-100   
ref|XP_006364163.1|  PREDICTED: mitogen-activated protein kinase ...    315   3e-100   
ref|XP_010323839.1|  PREDICTED: mitogen-activated protein kinase ...    316   4e-100   
ref|XP_002524836.1|  Mitogen-activated protein kinase kinase kina...    317   7e-100   Ricinus communis
ref|XP_004243483.1|  PREDICTED: mitogen-activated protein kinase ...    313   1e-99    
emb|CDY20789.1|  BnaA02g09290D                                          317   2e-99    
ref|XP_011046960.1|  PREDICTED: mitogen-activated protein kinase ...    318   2e-99    
ref|XP_007132528.1|  hypothetical protein PHAVU_011G102000g             313   2e-99    
ref|XP_009127060.1|  PREDICTED: mitogen-activated protein kinase ...    317   2e-99    
ref|XP_006413128.1|  hypothetical protein EUTSA_v10027219mg             317   4e-99    
ref|XP_009347129.1|  PREDICTED: mitogen-activated protein kinase ...    315   4e-99    
gb|KDO78298.1|  hypothetical protein CISIN_1g040569mg                   313   5e-99    
ref|XP_009353299.1|  PREDICTED: mitogen-activated protein kinase ...    314   7e-99    
ref|XP_009600573.1|  PREDICTED: mitogen-activated protein kinase ...    314   9e-99    
ref|XP_010064941.1|  PREDICTED: mitogen-activated protein kinase ...    316   2e-98    
emb|CDP10763.1|  unnamed protein product                                313   4e-98    
ref|XP_006468187.1|  PREDICTED: mitogen-activated protein kinase ...    313   1e-97    
ref|XP_010482930.1|  PREDICTED: mitogen-activated protein kinase ...    311   2e-97    
ref|XP_010096875.1|  Mitogen-activated protein kinase kinase kina...    309   2e-97    
ref|XP_009394653.1|  PREDICTED: mitogen-activated protein kinase ...    309   2e-97    
ref|XP_006401496.1|  hypothetical protein EUTSA_v10015237mg             310   8e-97    
gb|KCW70203.1|  hypothetical protein EUGRSUZ_F03482                     315   9e-97    
ref|XP_010655414.1|  PREDICTED: mitogen-activated protein kinase ...    309   1e-96    
ref|XP_002518446.1|  ATP binding protein, putative                      306   1e-96    Ricinus communis
emb|CDY06612.1|  BnaC02g13360D                                          310   1e-96    
ref|XP_006364161.1|  PREDICTED: mitogen-activated protein kinase ...    305   1e-96    
ref|XP_006280356.1|  hypothetical protein CARUB_v10026284mg             310   2e-96    
ref|XP_009790438.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    304   3e-96    
ref|XP_004173671.1|  PREDICTED: mitogen-activated protein kinase ...    305   4e-96    
ref|XP_010475855.1|  PREDICTED: mitogen-activated protein kinase ...    308   9e-96    
ref|XP_004506258.1|  PREDICTED: mitogen-activated protein kinase ...    306   1e-95    
ref|XP_010655415.1|  PREDICTED: mitogen-activated protein kinase ...    306   1e-95    
ref|XP_010099184.1|  Mitogen-activated protein kinase kinase kina...    306   3e-95    
ref|XP_004486314.1|  PREDICTED: mitogen-activated protein kinase ...    305   5e-95    
ref|XP_004144594.1|  PREDICTED: mitogen-activated protein kinase ...    301   1e-94    
ref|XP_006449765.1|  hypothetical protein CICLE_v10014400mg             311   2e-94    
ref|XP_011100411.1|  PREDICTED: mitogen-activated protein kinase ...    301   2e-94    
ref|XP_004167046.1|  PREDICTED: mitogen-activated protein kinase ...    301   2e-94    
ref|XP_003605967.1|  MAP kinase kinase kinase SSK2                      302   3e-94    
ref|XP_009405196.1|  PREDICTED: mitogen-activated protein kinase ...    303   3e-94    
ref|XP_004151935.1|  PREDICTED: mitogen-activated protein kinase ...    303   3e-94    
ref|XP_009404796.1|  PREDICTED: mitogen-activated protein kinase ...    303   4e-94    
ref|XP_006418061.1|  hypothetical protein EUTSA_v10008116mg             298   7e-94    
ref|XP_010556997.1|  PREDICTED: mitogen-activated protein kinase ...    298   3e-93    
ref|XP_010475182.1|  PREDICTED: mitogen-activated protein kinase ...    297   3e-93    
ref|XP_008455899.1|  PREDICTED: mitogen-activated protein kinase ...    300   3e-93    
ref|XP_008455448.1|  PREDICTED: mitogen-activated protein kinase ...    298   4e-93    
ref|XP_010457586.1|  PREDICTED: mitogen-activated protein kinase ...    295   1e-92    
ref|XP_009396715.1|  PREDICTED: mitogen-activated protein kinase ...    302   1e-92    
ref|XP_009418854.1|  PREDICTED: mitogen-activated protein kinase ...    298   2e-92    
ref|XP_004295280.1|  PREDICTED: mitogen-activated protein kinase ...    297   2e-92    
ref|XP_009421493.1|  PREDICTED: mitogen-activated protein kinase ...    298   2e-92    
ref|XP_009352665.1|  PREDICTED: mitogen-activated protein kinase ...    299   2e-92    
ref|XP_009383559.1|  PREDICTED: mitogen-activated protein kinase ...    298   3e-92    
ref|XP_009403739.1|  PREDICTED: mitogen-activated protein kinase ...    298   4e-92    
gb|EYU34013.1|  hypothetical protein MIMGU_mgv1a020948mg                293   5e-92    
gb|EEE56860.1|  hypothetical protein OsJ_06484                          295   6e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008371167.1|  PREDICTED: mitogen-activated protein kinase ...    297   1e-91    
ref|XP_010484689.1|  PREDICTED: mitogen-activated protein kinase ...    292   2e-91    
ref|XP_002889536.1|  MAPKKK18                                           292   2e-91    
dbj|BAD15943.1|  protein kinase-like                                    296   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010543009.1|  PREDICTED: mitogen-activated protein kinase ...    292   2e-91    
gb|KEH36902.1|  MAP kinase kinase kinase                                291   3e-91    
ref|NP_001046691.2|  Os02g0322400                                       294   5e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009357591.1|  PREDICTED: mitogen-activated protein kinase ...    294   5e-91    
emb|CBI23211.3|  unnamed protein product                                309   8e-91    
gb|EEC73042.1|  hypothetical protein OsI_06987                          294   9e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_010046333.1|  PREDICTED: mitogen-activated protein kinase ...    293   9e-91    
ref|XP_009141244.1|  PREDICTED: mitogen-activated protein kinase ...    291   1e-90    
ref|XP_009394082.1|  PREDICTED: mitogen-activated protein kinase ...    292   2e-90    
ref|NP_172003.1|  mitogen-activated protein kinase kinase kinase 18     290   2e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDY19144.1|  BnaA04g18840D                                          290   3e-90    
ref|XP_006342282.1|  PREDICTED: mitogen-activated protein kinase ...    288   5e-90    
ref|XP_003596952.1|  Mitogen-activated protein kinase kinase kina...    291   5e-90    
ref|XP_007212556.1|  hypothetical protein PRUPE_ppa015439mg             288   6e-90    
ref|XP_004134977.1|  PREDICTED: mitogen-activated protein kinase ...    290   1e-89    
ref|XP_006305299.1|  hypothetical protein CARUB_v10009674mg             287   1e-89    
ref|XP_008441103.1|  PREDICTED: mitogen-activated protein kinase ...    291   1e-89    
gb|KGN49092.1|  hypothetical protein Csa_6G513560                       290   2e-89    
gb|EYU33995.1|  hypothetical protein MIMGU_mgv1a025547mg                286   3e-89    
ref|XP_007217243.1|  hypothetical protein PRUPE_ppa006485mg             288   4e-89    
ref|XP_009403738.1|  PREDICTED: mitogen-activated protein kinase ...    290   6e-89    
ref|XP_002881230.1|  MAPKKK17                                           286   1e-88    
ref|XP_003534712.1|  PREDICTED: mitogen-activated protein kinase ...    286   4e-88    
emb|CDY53387.1|  BnaAnng12350D                                          283   1e-87    
gb|AGA37258.1|  mitogen activated kinase kinase kinase 18.2             283   1e-87    
ref|XP_009119207.1|  PREDICTED: mitogen-activated protein kinase ...    282   1e-87    
ref|XP_004954858.1|  PREDICTED: serine/threonine-protein kinase D...    289   1e-87    
emb|CDY18290.1|  BnaC05g03130D                                          282   1e-87    
ref|XP_008224751.1|  PREDICTED: mitogen-activated protein kinase ...    285   2e-87    
gb|KFK40368.1|  hypothetical protein AALP_AA3G364600                    282   2e-87    
ref|XP_008384252.1|  PREDICTED: mitogen-activated protein kinase ...    285   3e-87    
ref|XP_008349313.1|  PREDICTED: mitogen-activated protein kinase ...    283   6e-87    
gb|AGA37215.1|  mitogen-activated protein kinase kinase kinase 18.1     280   7e-87    
ref|XP_010469578.1|  PREDICTED: mitogen-activated protein kinase ...    281   1e-86    
ref|XP_004170035.1|  PREDICTED: mitogen-activated protein kinase ...    278   2e-86    
ref|XP_008342026.1|  PREDICTED: mitogen-activated protein kinase ...    277   2e-86    
emb|CDY52049.1|  BnaCnng21650D                                          280   2e-86    
ref|XP_006410384.1|  hypothetical protein EUTSA_v10016838mg             280   2e-86    
emb|CDY12200.1|  BnaC04g12300D                                          279   4e-86    
ref|XP_010035556.1|  PREDICTED: mitogen-activated protein kinase ...    281   4e-86    
ref|XP_010522353.1|  PREDICTED: mitogen-activated protein kinase ...    277   2e-85    
ref|XP_010686869.1|  PREDICTED: mitogen-activated protein kinase ...    279   2e-85    
emb|CDY42094.1|  BnaA05g10920D                                          277   5e-85    
ref|XP_010236368.1|  PREDICTED: mitogen-activated protein kinase ...    279   1e-84    
ref|NP_180810.1|  mitogen-activated protein kinase kinase kinase 17     273   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413987.1|  PREDICTED: mitogen-activated protein kinase ...    272   3e-83    
gb|KCW44336.1|  hypothetical protein EUGRSUZ_L02203                     272   3e-83    
gb|KCW75260.1|  hypothetical protein EUGRSUZ_E04012                     272   7e-83    
ref|XP_007147708.1|  hypothetical protein PHAVU_006G148000g             274   8e-83    
ref|XP_009143997.1|  PREDICTED: mitogen-activated protein kinase ...    271   1e-82    
ref|XP_006646238.1|  PREDICTED: mitogen-activated protein kinase ...    271   7e-82    
ref|XP_010059586.1|  PREDICTED: mitogen-activated protein kinase ...    270   2e-81    
ref|XP_006295854.1|  hypothetical protein CARUB_v10024983mg             266   4e-81    
ref|XP_010041453.1|  PREDICTED: mitogen-activated protein kinase ...    270   5e-81    
gb|EAY98899.1|  hypothetical protein OsI_20854                          265   1e-79    Oryza sativa Indica Group [Indian rice]
ref|NP_001056212.1|  Os05g0545400                                       264   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567029.2|  PREDICTED: mitogen-activated protein kinase ...    266   2e-79    
gb|KDP20719.1|  hypothetical protein JCGZ_21190                         263   3e-79    
gb|EEE64568.1|  hypothetical protein OsJ_19420                          264   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560747.1|  PREDICTED: mitogen-activated protein kinase ...    265   1e-78    
gb|ACH99693.1|  NPKL1                                                   263   1e-78    Oryza sativa Indica Group [Indian rice]
ref|NP_001043977.1|  Os01g0699100                                       261   4e-78    Oryza sativa Japonica Group [Japonica rice]
gb|ACH99692.1|  NPKL1                                                   261   2e-77    Oryza sativa Japonica Group [Japonica rice]
gb|ACH99695.1|  NPKL2                                                   258   2e-77    Oryza sativa Indica Group [Indian rice]
gb|EAY77607.1|  hypothetical protein OsI_32649                          259   1e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_003567028.1|  PREDICTED: mitogen-activated protein kinase ...    257   5e-76    
ref|XP_004972118.1|  PREDICTED: mitogen-activated protein kinase ...    257   6e-76    
gb|ACH99694.1|  NPKL2                                                   253   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004972119.1|  PREDICTED: mitogen-activated protein kinase ...    255   2e-75    
gb|EAY75501.1|  hypothetical protein OsI_03400                          253   2e-75    Oryza sativa Indica Group [Indian rice]
ref|NP_001043978.1|  Os01g0699400                                       253   2e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ13219.1|  hypothetical protein OsJ_03139                          253   3e-75    Oryza sativa Japonica Group [Japonica rice]
gb|AAM23244.1|AC092553_10  Putative NPK1-related protein kinase         255   5e-75    Oryza sativa Japonica Group [Japonica rice]
gb|AAM23245.1|AC092553_11  Putative NPK1-related protein kinase         255   5e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004972120.1|  PREDICTED: mitogen-activated protein kinase ...    253   1e-74    
emb|CDM80579.1|  unnamed protein product                                253   2e-74    
ref|XP_011087640.1|  PREDICTED: mitogen-activated protein kinase ...    249   2e-74    
dbj|BAJ98346.1|  predicted protein                                      249   6e-74    
gb|EYU35020.1|  hypothetical protein MIMGU_mgv1a019444mg                246   9e-74    
dbj|BAJ97064.1|  predicted protein                                      249   9e-74    
emb|CDY29258.1|  BnaC01g19100D                                          246   5e-73    
dbj|BAJ85437.1|  predicted protein                                      247   5e-73    
ref|XP_011047271.1|  PREDICTED: mitogen-activated protein kinase ...    240   6e-73    
tpg|DAA57972.1|  TPA: putative MAPKKK family protein kinase             246   2e-72    
gb|EEC71339.1|  hypothetical protein OsI_03402                          244   2e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_008676309.1|  PREDICTED: mitogen-activated protein kinase ...    246   3e-72    
ref|XP_010233496.1|  PREDICTED: mitogen-activated protein kinase ...    245   3e-72    
ref|XP_003565967.1|  PREDICTED: mitogen-activated protein kinase ...    246   3e-72    
gb|EAY75499.1|  hypothetical protein OsI_03399                          241   3e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_003567030.1|  PREDICTED: mitogen-activated protein kinase ...    246   4e-72    
dbj|BAK07218.1|  predicted protein                                      244   5e-72    
gb|EAY77608.1|  hypothetical protein OsI_32650                          256   5e-72    Oryza sativa Indica Group [Indian rice]
gb|ACH99699.1|  NPKL4                                                   244   6e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_002960952.1|  hypothetical protein SELMODRAFT_74353              239   6e-72    
gb|ACH99698.1|  NPKL4                                                   243   1e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646239.1|  PREDICTED: mitogen-activated protein kinase ...    244   2e-71    
ref|NP_001043980.1|  Os01g0699600                                       243   2e-71    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92652.1|  predicted protein                                      242   3e-71    
ref|XP_002967055.1|  hypothetical protein SELMODRAFT_86715              238   3e-71    
ref|XP_008675137.1|  PREDICTED: mitogen-activated protein kinase ...    244   3e-71    
gb|EEE55249.1|  hypothetical protein OsJ_03142                          244   5e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006349303.1|  PREDICTED: mitogen-activated protein kinase ...    239   8e-71    
ref|XP_010246145.1|  PREDICTED: mitogen-activated protein kinase ...    239   1e-70    
ref|XP_004301562.1|  PREDICTED: mitogen-activated protein kinase ...    238   2e-70    
ref|NP_001043979.1|  Os01g0699500                                       239   4e-70    Oryza sativa Japonica Group [Japonica rice]
gb|ACH99697.1|  NPKL3                                                   240   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056211.1|  Os05g0545300                                       238   2e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75502.1|  hypothetical protein OsI_03401                          238   4e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_004963626.1|  PREDICTED: mitogen-activated protein kinase ...    239   4e-69    
gb|EMT09877.1|  Mitogen-activated protein kinase kinase kinase 2        236   5e-69    
gb|ACH99696.1|  NPKL3                                                   238   7e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_010233144.1|  PREDICTED: mitogen-activated protein kinase ...    238   7e-69    
ref|XP_002458365.1|  hypothetical protein SORBIDRAFT_03g032140          237   1e-68    Sorghum bicolor [broomcorn]
gb|EEC79636.1|  hypothetical protein OsI_20853                          237   3e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_008657836.1|  PREDICTED: mitogen-activated protein kinase ...    234   9e-68    
ref|XP_009623765.1|  PREDICTED: mitogen-activated protein kinase ...    230   3e-67    
ref|XP_010233142.1|  PREDICTED: mitogen-activated protein kinase ...    232   3e-67    
ref|XP_002458366.1|  hypothetical protein SORBIDRAFT_03g032150          229   4e-67    Sorghum bicolor [broomcorn]
ref|XP_009767132.1|  PREDICTED: mitogen-activated protein kinase ...    229   7e-67    
ref|XP_008675135.1|  PREDICTED: mitogen-activated protein kinase ...    229   9e-67    
ref|NP_001241003.1|  mitogen-activated protein kinase kinase kina...    228   9e-67    
ref|XP_003524649.1|  PREDICTED: mitogen-activated protein kinase ...    228   1e-66    
ref|XP_006662155.1|  PREDICTED: mitogen-activated protein kinase ...    232   2e-66    
ref|XP_010910534.1|  PREDICTED: mitogen-activated protein kinase ...    228   2e-66    
ref|XP_006847256.1|  hypothetical protein AMTR_s00015p00050440          229   3e-66    
ref|XP_008806975.1|  PREDICTED: mitogen-activated protein kinase ...    227   3e-66    
ref|XP_003565968.1|  PREDICTED: serine/threonine-protein kinase 3...    232   6e-66    
gb|EYU39328.1|  hypothetical protein MIMGU_mgv1a009594mg                226   6e-66    
ref|XP_004230432.1|  PREDICTED: mitogen-activated protein kinase ...    226   1e-65    
ref|XP_002441461.1|  hypothetical protein SORBIDRAFT_09g027260          228   2e-65    
ref|XP_006838129.1|  hypothetical protein AMTR_s00106p00073400          226   2e-65    
ref|XP_002528847.1|  ATP binding protein, putative                      225   2e-65    
ref|XP_008649957.1|  PREDICTED: mitogen-activated protein kinase ...    228   3e-65    
ref|XP_001755952.1|  predicted protein                                  222   3e-65    
ref|XP_002960951.1|  hypothetical protein SELMODRAFT_73444              221   5e-65    
gb|EEE50518.1|  hypothetical protein OsJ_30612                          228   7e-65    
gb|AFW83662.1|  putative MAPKKK family protein kinase                   227   1e-64    
ref|XP_004961334.1|  PREDICTED: mitogen-activated protein kinase ...    227   1e-64    
ref|XP_001768190.1|  predicted protein                                  220   2e-64    
ref|XP_004972121.1|  PREDICTED: mitogen-activated protein kinase ...    226   2e-64    
ref|XP_001780526.1|  predicted protein                                  219   3e-64    
gb|EMT14834.1|  hypothetical protein F775_52549                         226   6e-64    
ref|XP_001760609.1|  predicted protein                                  219   7e-64    
ref|XP_002264624.2|  PREDICTED: mitogen-activated protein kinase ...    221   7e-64    
gb|KDP42471.1|  hypothetical protein JCGZ_00268                         220   1e-63    
ref|XP_011022649.1|  PREDICTED: mitogen-activated protein kinase ...    220   2e-63    
ref|XP_009355446.1|  PREDICTED: mitogen-activated protein kinase ...    219   3e-63    
ref|XP_008356312.1|  PREDICTED: mitogen-activated protein kinase ...    223   3e-63    
dbj|BAJ97049.1|  predicted protein                                      223   4e-63    
ref|XP_007222400.1|  hypothetical protein PRUPE_ppa008119mg             219   5e-63    
ref|XP_007041162.1|  NPK1-related protein kinase 3, putative            219   5e-63    
ref|XP_008675136.1|  PREDICTED: mitogen-activated protein kinase ...    223   7e-63    
ref|XP_002304509.1|  hypothetical protein POPTR_0003s13010g             218   7e-63    
ref|XP_003517304.1|  PREDICTED: mitogen-activated protein kinase ...    218   1e-62    
ref|XP_002441462.1|  hypothetical protein SORBIDRAFT_09g027270          222   1e-62    
ref|NP_001078504.1|  mitogen-activated protein kinase kinase kina...    217   2e-62    
emb|CDP02503.1|  unnamed protein product                                218   2e-62    
emb|CDO97638.1|  unnamed protein product                                217   2e-62    
ref|XP_006836834.1|  hypothetical protein AMTR_s00099p00063540          219   3e-62    
ref|XP_007208251.1|  hypothetical protein PRUPE_ppa016693mg             217   3e-62    
ref|XP_011008530.1|  PREDICTED: mitogen-activated protein kinase ...    217   3e-62    
ref|XP_008799260.1|  PREDICTED: mitogen-activated protein kinase ...    218   4e-62    
ref|XP_009120374.1|  PREDICTED: mitogen-activated protein kinase ...    219   4e-62    
ref|XP_007156794.1|  hypothetical protein PHAVU_002G018100g             216   4e-62    
gb|KEH16527.1|  MAP3K-like kinase                                       216   5e-62    
ref|XP_008649959.1|  PREDICTED: mitogen-activated protein kinase ...    220   5e-62    
ref|XP_007204693.1|  hypothetical protein PRUPE_ppa007987mg             216   6e-62    
ref|XP_010028246.1|  PREDICTED: mitogen-activated protein kinase ...    216   6e-62    
ref|XP_003521050.1|  PREDICTED: mitogen-activated protein kinase ...    216   6e-62    
ref|XP_004972122.1|  PREDICTED: mitogen-activated protein kinase ...    219   7e-62    
ref|XP_008339420.1|  PREDICTED: mitogen-activated protein kinase ...    216   7e-62    
ref|XP_011075325.1|  PREDICTED: mitogen-activated protein kinase ...    216   8e-62    
ref|XP_008218686.1|  PREDICTED: mitogen-activated protein kinase ...    216   9e-62    
ref|XP_010028245.1|  PREDICTED: mitogen-activated protein kinase ...    216   9e-62    
ref|XP_008656783.1|  PREDICTED: mitogen-activated protein kinase ...    219   1e-61    
ref|XP_011042456.1|  PREDICTED: mitogen-activated protein kinase ...    215   1e-61    
ref|XP_002967056.1|  hypothetical protein SELMODRAFT_408419             219   2e-61    
ref|XP_002313986.2|  hypothetical protein POPTR_0009s07730g             215   3e-61    
ref|XP_008365330.1|  PREDICTED: mitogen-activated protein kinase ...    214   3e-61    
ref|XP_007016898.1|  Mitogen-activated protein kinase kinase kina...    218   4e-61    
emb|CBI21416.3|  unnamed protein product                                214   4e-61    
ref|XP_002310721.2|  hypothetical protein POPTR_0007s10930g             214   4e-61    
gb|KFK31118.1|  hypothetical protein AALP_AA6G070300                    211   4e-61    
ref|XP_009628421.1|  PREDICTED: mitogen-activated protein kinase ...    214   6e-61    
emb|CDY52115.1|  BnaA10g29440D                                          217   6e-61    
gb|EYU44409.1|  hypothetical protein MIMGU_mgv1a008588mg                214   6e-61    
ref|XP_010926984.1|  PREDICTED: mitogen-activated protein kinase ...    214   7e-61    
ref|XP_009358197.1|  PREDICTED: mitogen-activated protein kinase ...    217   1e-60    
ref|XP_002282686.1|  PREDICTED: mitogen-activated protein kinase ...    213   1e-60    
ref|XP_011003930.1|  PREDICTED: mitogen-activated protein kinase ...    216   1e-60    
emb|CAN71722.1|  hypothetical protein VITISV_012221                     215   1e-60    
ref|XP_009796739.1|  PREDICTED: mitogen-activated protein kinase ...    213   1e-60    
ref|XP_009418852.1|  PREDICTED: mitogen-activated protein kinase ...    214   1e-60    
ref|XP_010269485.1|  PREDICTED: mitogen-activated protein kinase ...    213   2e-60    
ref|XP_011043532.1|  PREDICTED: mitogen-activated protein kinase ...    211   3e-60    
ref|XP_010651429.1|  PREDICTED: mitogen-activated protein kinase ...    215   3e-60    
ref|XP_006646240.1|  PREDICTED: mitogen-activated protein kinase ...    213   3e-60    
ref|XP_010920984.1|  PREDICTED: mitogen-activated protein kinase ...    216   4e-60    
ref|XP_002298485.2|  kinase family protein                              210   4e-60    
emb|CDX80352.1|  BnaC09g33900D                                          214   5e-60    
ref|XP_003539360.1|  PREDICTED: mitogen-activated protein kinase ...    211   5e-60    
gb|AHW50675.1|  mitogen-activated protein kinase kinase kinase 3        211   6e-60    
emb|CDP09212.1|  unnamed protein product                                216   6e-60    
ref|XP_011099128.1|  PREDICTED: mitogen-activated protein kinase ...    211   6e-60    
ref|XP_010264778.1|  PREDICTED: mitogen-activated protein kinase ...    215   7e-60    
gb|KCW54938.1|  hypothetical protein EUGRSUZ_I00911                     211   7e-60    
ref|XP_010667409.1|  PREDICTED: mitogen-activated protein kinase ...    210   8e-60    
ref|XP_004511921.1|  PREDICTED: mitogen-activated protein kinase ...    211   9e-60    
ref|XP_004233627.1|  PREDICTED: mitogen-activated protein kinase ...    210   1e-59    
ref|XP_006339889.1|  PREDICTED: mitogen-activated protein kinase ...    210   1e-59    
ref|XP_008221231.1|  PREDICTED: mitogen-activated protein kinase ...    214   1e-59    
ref|XP_006488691.1|  PREDICTED: mitogen-activated protein kinase ...    213   1e-59    
ref|XP_002456207.1|  hypothetical protein SORBIDRAFT_03g032130          213   1e-59    
ref|XP_001755249.1|  predicted protein                                  207   2e-59    
ref|XP_010515391.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-59    
ref|XP_011024931.1|  PREDICTED: mitogen-activated protein kinase ...    212   2e-59    
ref|XP_004288026.1|  PREDICTED: uncharacterized protein LOC101291755    217   3e-59    
ref|XP_006425099.1|  hypothetical protein CICLE_v10028185mg             213   5e-59    
gb|KEH16420.1|  MAP3K-like kinase                                       208   6e-59    
gb|KHN08177.1|  Serine/threonine-protein kinase BCK1/SLK1/SSP31         208   6e-59    
gb|KHN08178.1|  Mitogen-activated protein kinase kinase kinase 3        207   6e-59    
ref|XP_010558598.1|  PREDICTED: mitogen-activated protein kinase ...    208   9e-59    
ref|XP_006286153.1|  hypothetical protein CARUB_v10007712mg             207   9e-59    
gb|KDP31943.1|  hypothetical protein JCGZ_12404                         207   1e-58    
ref|XP_006339888.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-58    
ref|XP_009343294.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-58    
emb|CAB16796.1|  MAP3K-like protein kinase                              216   1e-58    
ref|XP_001421079.1|  predicted protein                                  206   1e-58    
ref|XP_003548345.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-58    
ref|XP_004173609.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-58    
ref|XP_002869001.1|  hypothetical protein ARALYDRAFT_328051             215   2e-58    
ref|XP_009367209.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-58    
ref|XP_010550362.1|  PREDICTED: mitogen-activated protein kinase ...    206   3e-58    
ref|XP_009629207.1|  PREDICTED: mitogen-activated protein kinase ...    206   3e-58    
ref|XP_004295772.1|  PREDICTED: mitogen-activated protein kinase ...    210   3e-58    
ref|XP_010503702.1|  PREDICTED: mitogen-activated protein kinase ...    206   3e-58    
ref|XP_008440288.1|  PREDICTED: mitogen-activated protein kinase ...    206   3e-58    
ref|XP_009416709.1|  PREDICTED: mitogen-activated protein kinase ...    208   4e-58    
ref|XP_008241469.1|  PREDICTED: mitogen-activated protein kinase ...    206   4e-58    
ref|XP_010938267.1|  PREDICTED: mitogen-activated protein kinase ...    210   4e-58    
ref|XP_010263514.1|  PREDICTED: mitogen-activated protein kinase ...    207   4e-58    
ref|XP_010028241.1|  PREDICTED: mitogen-activated protein kinase ...    206   5e-58    
gb|KCW85421.1|  hypothetical protein EUGRSUZ_B02237                     209   5e-58    
ref|XP_009414371.1|  PREDICTED: mitogen-activated protein kinase ...    209   7e-58    
ref|XP_004512214.1|  PREDICTED: mitogen-activated protein kinase ...    204   8e-58    
gb|EPS73022.1|  hypothetical protein M569_01733                         204   1e-57    
ref|XP_010275096.1|  PREDICTED: mitogen-activated protein kinase ...    209   1e-57    
ref|XP_006575415.1|  PREDICTED: mitogen-activated protein kinase ...    207   2e-57    
gb|KEH16526.1|  MAP3K-like kinase                                       203   3e-57    
ref|XP_009628862.1|  PREDICTED: mitogen-activated protein kinase ...    204   3e-57    
ref|XP_010046376.1|  PREDICTED: mitogen-activated protein kinase ...    207   4e-57    
ref|XP_001434974.1|  hypothetical protein                               206   4e-57    
ref|XP_009396717.1|  PREDICTED: mitogen-activated protein kinase ...    206   5e-57    
ref|XP_004171178.1|  PREDICTED: mitogen-activated protein kinase ...    203   5e-57    
ref|XP_009803912.1|  PREDICTED: mitogen-activated protein kinase ...    203   5e-57    
ref|XP_007155919.1|  hypothetical protein PHAVU_003G243300g             202   6e-57    
ref|XP_006339890.1|  PREDICTED: mitogen-activated protein kinase ...    203   6e-57    
gb|ABE91852.1|  Protein kinase                                          203   7e-57    
ref|XP_003520404.1|  PREDICTED: serine/threonine-protein kinase B...    205   8e-57    
ref|XP_009758194.1|  PREDICTED: mitogen-activated protein kinase ...    202   8e-57    
ref|XP_008338323.1|  PREDICTED: mitogen-activated protein kinase ...    202   1e-56    
ref|XP_009338964.1|  PREDICTED: mitogen-activated protein kinase ...    205   1e-56    
ref|XP_004485420.1|  PREDICTED: mitogen-activated protein kinase ...    202   2e-56    
ref|XP_006591696.1|  PREDICTED: mitogen-activated protein kinase ...    204   2e-56    
ref|XP_009345960.1|  PREDICTED: mitogen-activated protein kinase ...    201   2e-56    
ref|XP_003082588.1|  putative MAP3K alpha 1 protein kinase (ISS)        208   2e-56    
ref|XP_004232023.1|  PREDICTED: mitogen-activated protein kinase ...    202   2e-56    
ref|XP_003539385.1|  PREDICTED: mitogen-activated protein kinase ...    201   2e-56    
gb|AAR87851.1|  fertilization-related kinase 2                          200   2e-56    
emb|CEG00082.1|  Serine/threonine-protein kinase, active site           208   2e-56    
ref|XP_006367881.1|  PREDICTED: mitogen-activated protein kinase ...    199   3e-56    
ref|XP_009343169.1|  PREDICTED: mitogen-activated protein kinase ...    201   3e-56    
ref|XP_003592879.1|  Mitogen-activated protein kinase kinase kinase     202   4e-56    
ref|XP_010028240.1|  PREDICTED: mitogen-activated protein kinase ...    202   4e-56    
ref|XP_006367880.1|  PREDICTED: mitogen-activated protein kinase ...    199   5e-56    
ref|XP_008789177.1|  PREDICTED: mitogen-activated protein kinase ...    203   5e-56    
ref|XP_006292547.1|  hypothetical protein CARUB_v10018782mg             200   5e-56    
ref|XP_008457561.1|  PREDICTED: mitogen-activated protein kinase ...    204   5e-56    
ref|XP_004233626.1|  PREDICTED: mitogen-activated protein kinase ...    200   5e-56    
gb|AGV06259.1|  fertilization-related kinase 3                          200   5e-56    
ref|XP_008340193.1|  PREDICTED: mitogen-activated protein kinase ...    200   7e-56    
emb|CDM83713.1|  unnamed protein product                                200   8e-56    
ref|XP_010426575.1|  PREDICTED: mitogen-activated protein kinase ...    199   9e-56    
ref|XP_010028244.1|  PREDICTED: mitogen-activated protein kinase ...    200   9e-56    
ref|XP_004153402.1|  PREDICTED: mitogen-activated protein kinase ...    203   1e-55    
ref|XP_010531244.1|  PREDICTED: mitogen-activated protein kinase ...    199   1e-55    
ref|XP_010028243.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-55    
ref|NP_201509.1|  mitogen-activated protein kinase kinase kinase 19     198   2e-55    
ref|XP_004141910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    206   2e-55    
ref|XP_002877738.1|  MAPKKK20                                           198   2e-55    
ref|XP_009369639.1|  PREDICTED: mitogen-activated protein kinase ...    201   2e-55    
ref|XP_006603129.1|  PREDICTED: mitogen-activated protein kinase ...    203   3e-55    
ref|XP_007146783.1|  hypothetical protein PHAVU_006G069600g             201   3e-55    
ref|XP_006596429.1|  PREDICTED: mitogen-activated protein kinase ...    202   3e-55    
ref|XP_006360216.1|  PREDICTED: mitogen-activated protein kinase ...    198   3e-55    
ref|XP_004145313.1|  PREDICTED: mitogen-activated protein kinase ...    202   4e-55    
ref|XP_002523600.1|  ATP binding protein, putative                      198   4e-55    
ref|XP_006466595.1|  PREDICTED: mitogen-activated protein kinase ...    198   5e-55    
ref|XP_006425909.1|  hypothetical protein CICLE_v10025910mg             198   6e-55    
emb|CDX84864.1|  BnaA03g13660D                                          201   7e-55    
ref|XP_010106871.1|  Mitogen-activated protein kinase kinase kina...    196   7e-55    
ref|XP_004233440.1|  PREDICTED: mitogen-activated protein kinase ...    197   7e-55    
ref|XP_011089517.1|  PREDICTED: mitogen-activated protein kinase ...    200   7e-55    
ref|XP_006417836.1|  hypothetical protein EUTSA_v10007482mg             200   1e-54    
ref|XP_010253855.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-54    
ref|XP_010547520.1|  PREDICTED: mitogen-activated protein kinase ...    197   1e-54    
ref|XP_009602038.1|  PREDICTED: mitogen-activated protein kinase ...    196   1e-54    
ref|XP_007142189.1|  hypothetical protein PHAVU_008G259700g             199   2e-54    
ref|XP_009409727.1|  PREDICTED: mitogen-activated protein kinase ...    199   2e-54    
ref|XP_003611723.1|  Mitogen-activated protein kinase kinase kina...    195   2e-54    
ref|XP_002306472.2|  hypothetical protein POPTR_0005s18230g             196   2e-54    
ref|XP_003611720.1|  Protein kinase-like protein                        196   2e-54    
ref|XP_007158842.1|  hypothetical protein PHAVU_002G186600g             195   3e-54    
ref|XP_010444696.1|  PREDICTED: mitogen-activated protein kinase ...    196   3e-54    
gb|KDO79193.1|  hypothetical protein CISIN_1g017746mg                   196   3e-54    
ref|XP_010446694.1|  PREDICTED: mitogen-activated protein kinase ...    195   4e-54    
gb|AAM63486.1|  protein kinase-like protein                             195   5e-54    
emb|CDX75628.1|  BnaA01g00740D                                          195   6e-54    
emb|CDY10252.1|  BnaC05g04950D                                          197   7e-54    
emb|CDY10704.1|  BnaA05g12320D                                          198   8e-54    
ref|NP_190600.1|  mitogen-activated protein kinase kinase kinase 20     194   8e-54    
emb|CDX83120.1|  BnaA01g21200D                                          194   9e-54    
ref|XP_002306473.2|  hypothetical protein POPTR_0005s18240g             194   9e-54    
ref|XP_009144336.1|  PREDICTED: mitogen-activated protein kinase ...    198   9e-54    
ref|XP_002267176.1|  PREDICTED: mitogen-activated protein kinase ...    194   1e-53    
ref|XP_010464552.1|  PREDICTED: mitogen-activated protein kinase ...    194   1e-53    
gb|EMT30948.1|  Mitogen-activated protein kinase kinase kinase A        195   1e-53    
ref|XP_009101744.1|  PREDICTED: mitogen-activated protein kinase ...    194   1e-53    
gb|AGA37217.1|  mitogen-activated protein kinase kinase kinase 20.1     194   1e-53    
ref|XP_009115702.1|  PREDICTED: mitogen-activated protein kinase ...    194   1e-53    
ref|XP_007148585.1|  hypothetical protein PHAVU_006G220800g             193   2e-53    
ref|XP_008349662.1|  PREDICTED: mitogen-activated protein kinase ...    197   2e-53    
ref|XP_008385044.1|  PREDICTED: mitogen-activated protein kinase ...    197   2e-53    
ref|XP_010028242.1|  PREDICTED: mitogen-activated protein kinase ...    195   2e-53    
emb|CDY30595.1|  BnaAnng03700D                                          193   2e-53    
emb|CDY17760.1|  BnaC08g21680D                                          193   3e-53    
ref|XP_001423551.1|  hypothetical protein                               196   4e-53    
ref|XP_007047281.1|  Mitogen-activated protein kinase kinase kina...    193   4e-53    
gb|AGA37216.1|  mitogen-activated protein kinase kinase kinase 19.1     192   4e-53    
ref|XP_001428335.1|  hypothetical protein                               196   5e-53    
emb|CDX69280.1|  BnaC01g01730D                                          192   6e-53    
ref|XP_003058436.1|  predicted protein                                  190   9e-53    
ref|XP_009138381.1|  PREDICTED: mitogen-activated protein kinase ...    192   1e-52    
ref|XP_010093628.1|  Mitogen-activated protein kinase kinase kina...    192   1e-52    
ref|XP_009801510.1|  PREDICTED: mitogen-activated protein kinase ...    190   1e-52    



>emb|CDP15776.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 235/444 (53%), Positives = 286/444 (64%), Gaps = 34/444 (8%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RGP IGRGSSATVSLAT A  SG   AVKSA LS S +LQ+E+ ++S+  SPY+VK +
Sbjct  4     WTRGPIIGRGSSATVSLATTA--SGELLAVKSADLSCSSVLQKEESLISELSSPYIVKYV  61

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             GCD++ E++  LYNL +EYVPGGTLSD  ++  G   E MIQ +AHQIL G+ +LH  G 
Sbjct  62    GCDVTTENDKPLYNLLMEYVPGGTLSDQIRKQGGPLEESMIQVFAHQILQGLDYLHLNGI  121

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEA-SSSSAFSGTPAFMAPEVAKGEEQG  590
             VHCDIKGQN+L+  D    KI DLGC + +E G   +  S   GTP FMAPEVA+GEEQG
Sbjct  122   VHCDIKGQNVLIGRD--GAKIGDLGCARVVEEGNGMAGKSVICGTPMFMAPEVARGEEQG  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             F ADIWA GCT+IEMAT + PW DM DPVSALYRI  SGDVPEFP W SD AKEFL KCL
Sbjct  180   FAADIWALGCTIIEMATANNPWPDMEDPVSALYRIGYSGDVPEFPCWLSDGAKEFLSKCL  239

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMS----QPSC  938
              RDAK RWTA ELLQHPF   +        EFVRNSPT+V+DQ  W+S+E++    Q S 
Sbjct  240   KRDAKERWTARELLQHPFFHGVGEEKEA--EFVRNSPTTVLDQGFWDSMEVAESSLQDSS  297

Query  939   NSTATAGFPANRIGRL---IIQAGERLPDWEEDGGWVTVRG------------NEEDEST  1073
             +  ++ G PA+RI  L   +  +    P+W EDG WVTVRG            NE  E  
Sbjct  298   HIVSSLGSPADRIKNLMGNLFSSNANFPNWSEDGDWVTVRGTDSQEIQPVSQQNENSEVH  357

Query  1074  DSE----PILISILCPEDLESSIVNEAPSFDSSDDEISVNDRVNPRTNLDLSCHNFTDA-  1238
             DS+    P L SI   E+LESSIV +    +   DEIS    V+   NL LSC N  +  
Sbjct  358   DSQLAMDPFLYSIDLEEELESSIVIDDLLINCLVDEISNVGNVSGGLNLTLSCDNVEETF  417

Query  1239  -FVSWIQDFDDNILKTSFSSKALI  1307
              FV+ I DFD NI+K  F   +++
Sbjct  418   NFVAKILDFDMNIMKFWFLINSIL  441



>ref|XP_009614381.1| PREDICTED: mitogen-activated protein kinase kinase kinase A {ECO:0000303|PubMed:9832508}-like 
[Nicotiana tomentosiformis]
Length=471

 Score =   421 bits (1082),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 255/346 (74%), Gaps = 11/346 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGSSATVSLAT   ++G  FAVKS  LS S MLQRE  ++SQ +SP++VK
Sbjct  1     MEWTRGPIIGRGSSATVSLAT--NSAGELFAVKSIELSCSNMLQREYSLISQLNSPFLVK  58

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             C G DI+ E N A+YN+F+EY+PGGTLSDL K+  G  +E +I+  A QIL G+ +LHS+
Sbjct  59    CFGFDITSEKNKAMYNMFMEYIPGGTLSDLIKKQGGSLNESVIKSCAQQILQGLDYLHSI  118

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKGQNIL+ +D   +KIADLGCGK L + E + +S  SGTPAFMAPEVA+GEEQ
Sbjct  119   GLVHCDIKGQNILIGQD--GIKIADLGCGKLLGD-ENAVNSGISGTPAFMAPEVARGEEQ  175

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              F ADIWAFGCT+IEMATGS PW DM DPVSALYRI  SGDVP+FP + S DA+EFL KC
Sbjct  176   KFAADIWAFGCTIIEMATGSPPWTDMKDPVSALYRIGYSGDVPQFPNYLSTDAREFLAKC  235

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-MSQPSCNS  944
             L +D K RWTA +LLQHPFLQSI SN +  +E  R SPTS++DQ  WNS E M   S  S
Sbjct  236   LKKDPKERWTAKQLLQHPFLQSIGSNCLKVEELKRGSPTSILDQGFWNSFEVMESSSLES  295

Query  945   TATAGFPANRIGRLIIQ---AGERLPDWEEDGGWVTVRGNEEDEST  1073
             + T   PA+RI RLI     +G   PDW E+  WVTVRG++ + S+
Sbjct  296   SITVDSPADRIKRLIGDEGISGFLKPDWVEEESWVTVRGSDTEGSS  341



>ref|XP_009793037.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Nicotiana 
sylvestris]
Length=489

 Score =   419 bits (1078),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 255/346 (74%), Gaps = 11/346 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGSSATVSLAT   +SG  FAVKS  LS S +LQRE  ++SQ +SP++V 
Sbjct  1     MEWTRGPIIGRGSSATVSLAT--NSSGELFAVKSTELSCSNILQREYSLISQLNSPFLVN  58

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             C G DI+ E N   YN+F+EY+PGGTLSDL K+  G  +E +I+ YA QIL G+ +LHS+
Sbjct  59    CFGFDITSEQNKTTYNMFMEYIPGGTLSDLIKKQGGSLNESVIKSYAQQILQGLDYLHSI  118

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKGQNIL+ +D   +KIADLGCGKF+ + E S++S  SGTPAFM+PEVA+GEEQ
Sbjct  119   GVVHCDIKGQNILIGQD--GIKIADLGCGKFVRD-ENSANSGISGTPAFMSPEVARGEEQ  175

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              F ADIWAFGCT+IEMATGS PW DM DPVSALYRI  SGDVP+FP   S+DA+EFL KC
Sbjct  176   RFTADIWAFGCTIIEMATGSPPWTDMKDPVSALYRIGYSGDVPQFPNSLSNDAREFLAKC  235

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-MSQPSCNS  944
             L +D K RWTA +LLQHPFLQS+ SNS   +   R+SPTSV+DQ  WNS E M   S  S
Sbjct  236   LIKDPKERWTAKQLLQHPFLQSLESNSWKVENLKRDSPTSVLDQGFWNSFEVMESSSLES  295

Query  945   TATAGFPANRIGRLIIQAG---ERLPDWEEDGGWVTVRGNEEDEST  1073
             + T   PA+RI RLI   G      PDW E+ GWVTVR ++ +ES+
Sbjct  296   SITVDSPADRITRLIGDEGISCTLKPDWVEEEGWVTVRCSDTEESS  341



>ref|XP_004244346.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum lycopersicum]
Length=437

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 235/451 (52%), Positives = 291/451 (65%), Gaps = 46/451 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRGP IGRGSSATVSLAT   +SG  FAVKS   S    LQRE  ++SQ +SP++VK
Sbjct  1     MEWIRGPIIGRGSSATVSLAT--DSSGVVFAVKSTEQSC---LQREYSLVSQLNSPFLVK  55

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             C G     E N  +YN+F+EYV GGTLSDL KR  G  +E MI+ YA QIL G+ +LHS+
Sbjct  56    CFGF----EQNEQVYNMFMEYVQGGTLSDLIKRQGGSLNECMIKLYAQQILQGLDYLHSI  111

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+KGQNIL+ E+   VKIADLGC K +++G+   +S FSGTPAFMAPEVA+ EEQ
Sbjct  112   GIVHCDVKGQNILICEN-GNVKIADLGCAKLMKDGK---NSGFSGTPAFMAPEVARSEEQ  167

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF ADIWAFGCT+IEMATG  PW ++NDPVSALYRI  SGD+P+FP   S DA EFLGKC
Sbjct  168   GFAADIWAFGCTIIEMATGLVPWCEINDPVSALYRIGYSGDMPQFPNNMSKDATEFLGKC  227

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-MSQPSCNS  944
             L +   +RWTA +LLQHPFLQS+ +NS  F+E  R+SPTS++DQ  WNS E M   S  S
Sbjct  228   LMKCPNQRWTAKQLLQHPFLQSVETNSWKFEELKRDSPTSILDQGFWNSFEVMESSSFES  287

Query  945   TATAGFPANRIGRLIIQAG---ERLPDWEEDGGWVTVRGNEEDEST-----------DSE  1082
             T T    A+RI +LI   G     +P+W ED  WVTVR NE +E +           D  
Sbjct  288   TNTIDSAADRIRQLIGTEGISCSLMPNWIEDEDWVTVRSNETEEKSIISEQNCEMIDDFG  347

Query  1083  PIL-----ISILCPED-LESSIVNEAPSFDSSDDE-ISVNDRVNPRTNLDLSCHNFTDAF  1241
              +L     +SI+ PED +  S+  EA   D  + E IS+   VN   NL +S     D F
Sbjct  348   ELLDMDTSVSIIFPEDEIVDSLNLEALLVDCINYEIISIFHTVNSSINLIISPEIVGDVF  407

Query  1242  VSWIQDFDDNILKTSFSSKALILFTPIRPKY  1334
             VS   +F+D+ +K       L  F PI   +
Sbjct  408   VS---EFNDSEMKR------LKFFGPIMYSF  429



>ref|XP_006346260.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum tuberosum]
Length=459

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 226/446 (51%), Positives = 288/446 (65%), Gaps = 42/446 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRGP IGRGSSATVSLAT   +SG  FAVKS   S    LQRE  ++SQ +SP++VK
Sbjct  10    MEWIRGPIIGRGSSATVSLAT--NSSGVLFAVKSTEQSC---LQREYSLISQLNSPFLVK  64

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             CLG DI+ E N  +YN+F+EYV GGTLSDL K+  G   E MI+ YA QIL G+ +LHS+
Sbjct  65    CLGFDIAYEQNKEVYNMFMEYVQGGTLSDLIKKQGGSLDESMIKLYAQQILQGLDYLHSI  124

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+KGQNIL+ E+   +KIADLGC K L +     +S FSGTPAFMAPEVA+GEEQ
Sbjct  125   GIVHCDVKGQNILIGEN-GDIKIADLGCAKLLRD---EKNSGFSGTPAFMAPEVARGEEQ  180

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF ADIWAFGCT+IEMATGS PW ++ DPVSAL+RI  SGD+P+FP   S+DA+EFL  C
Sbjct  181   GFAADIWAFGCTIIEMATGSVPWSEIKDPVSALFRIGYSGDLPQFPNNLSNDAREFLSNC  240

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ-PSCNS  944
             L +    RWTA +LLQHPFLQS+ SNS  F+E  R+SPTS++DQ  WNS E+++  S  S
Sbjct  241   LMKCPNERWTAKQLLQHPFLQSVESNSWNFEELKRDSPTSILDQGFWNSFEVTESSSLES  300

Query  945   TATAGFPANRIGRLIIQAG---ERLPDWEEDGGWVTVRGNEEDEST--------------  1073
             T T     +RI +LI   G     +P+W E+  WVTVR N+ +E++              
Sbjct  301   TNTVDSATDRIRQLIGNVGISCSLMPNWVEEEDWVTVRCNDTEENSIISEQNCEMIDDFG  360

Query  1074  ---DSEPILISILCPEDLESSIVNEAPSFDSSDDE-ISVNDRVNPRTNLDLSCHNFTDAF  1241
                D E  +  I   ++  +S+  EA   D  + E IS+   V+   NL +S     D F
Sbjct  361   ELLDMETSVSMIFSEDEFVASLNLEALLVDCINYEIISLFHTVSSSINLIISPEIVGDVF  420

Query  1242  VSWIQDFDDNILKTSFSSKALILFTP  1319
             VS   +F+D+ +K       L LF P
Sbjct  421   VS---EFNDSEIKR------LKLFRP  437



>ref|XP_011095801.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Sesamum 
indicum]
Length=441

 Score =   397 bits (1020),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 215/397 (54%), Positives = 265/397 (67%), Gaps = 25/397 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGPTIGRGSSA VSLAT A  +G  FAVKSA  SSS +LQ E+ ++SQ  SP+VVK
Sbjct  1     MEWRRGPTIGRGSSAVVSLATTA--AGCVFAVKSASFSSSCLLQNEQCLMSQLSSPFVVK  58

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             C G D+S E N  +YNLFLEYV GGTLSDL +   G   E +I+FY HQ+L G+ +LH  
Sbjct  59    CFGSDVSWEDNKRVYNLFLEYVAGGTLSDLIRSQGGCLDENVIRFYTHQMLQGLNYLHLK  118

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+KGQN+L+ +D   +KIAD GC K+      S+  AF+GTPA+MAPEVA+GEEQ
Sbjct  119   GVVHCDVKGQNVLIGDD--GLKIADFGCAKW----SGSAVPAFAGTPAYMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              F AD+WA GCTVIEMATGS PW +M DP SALYR+A SGDVPEFP WFSD AK+FL KC
Sbjct  173   SFAADVWAMGCTVIEMATGSNPWPEMKDPASALYRVAYSGDVPEFPIWFSDCAKDFLSKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD K RWTAAELLQHPFL S+  N    +EF R SPTSVMDQ  W+++E+   S N T
Sbjct  233   LMRDPKERWTAAELLQHPFLNSVEVNCGEIREFTRKSPTSVMDQGFWDALEVPDSSPNPT  292

Query  948   ATAGFPANRIGRLIIQAGE------RLPDWEEDGGWVTVRGNEEDEST----DSEPI---  1088
               A    +  GR+    G+       LP W+E+  W+TVR NE++E +    DSE +   
Sbjct  293   DIASSSDSPTGRIRGLVGDAFLPNLNLPVWKEEEDWMTVRANEDEEFSKIHHDSENMNQD  352

Query  1089  --LISILCPEDLESSIVNEAPSFDSSDDEISVNDRVN  1193
               +   +  E++ +    E   F+S  DEIS  D  N
Sbjct  353   YGIFPSINEEEIPTPDAVEGSFFNSFPDEISSVDVSN  389



>ref|XP_011097967.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=477

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 246/351 (70%), Gaps = 17/351 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGSSA V +AT A  SG  FAVKS  LSSS +LQRE+ ++SQ  SPYVVK
Sbjct  1     MEWTRGPMIGRGSSAVVFIATTA--SGDVFAVKSTDLSSSTLLQREERLVSQLCSPYVVK  58

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             C G +I+ E N  +YNLFLEYVPGGTLSD   +  G   E +I+FYA ++L+G+ +LH M
Sbjct  59    CFGSEITWEENKHVYNLFLEYVPGGTLSDQIGKQGGSLGESVIRFYAREMLLGLSYLHLM  118

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKGQN+L+  D   +KIAD GC K+ E+ + S    FSGTPA+MAPEVA+GEEQ
Sbjct  119   GLVHCDIKGQNVLIGSD--GLKIADFGCAKWGES-DGSGKPVFSGTPAYMAPEVARGEEQ  175

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPADIWA GCT+IEMATGS PWQ+M DP SALYRIA SGDVPEFP WFSD+AK+ L KC
Sbjct  176   SFPADIWALGCTIIEMATGSNPWQEMKDPASALYRIAFSGDVPEFPSWFSDNAKDLLAKC  235

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-MSQPSCNS  944
             L RD K RWTA ELLQHPF  S     V   EF R SPTSVMDQ  W+++E +++ S N 
Sbjct  236   LKRDPKERWTATELLQHPFFSSAEEICV---EFTRKSPTSVMDQGFWDALEILTRSSRNP  292

Query  945   TATAGFPANRIGRLIIQAGERLPD------WEEDGGWVTVRGNEEDESTDS  1079
             T  A    +  GR+    G+  P       W E+  W+TVRGNE +E +++
Sbjct  293   TDIASPSDSPAGRIRALIGDPSPSNVNSTGWTEEEDWLTVRGNEIEECSEA  343



>gb|EYU27355.1| hypothetical protein MIMGU_mgv1a026298mg [Erythranthe guttata]
Length=417

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 267/404 (66%), Gaps = 29/404 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHH---FAVKSAHLSSSGMLQREKDILSQFDSPY  224
             MEW RGP +GRGSSA VSLAT A A+      FAVKSA +S S +L+ E+ +LSQ  SP+
Sbjct  1     MEWKRGPILGRGSSAVVSLATTAAAADGGCDLFAVKSADVSCSALLENEQCLLSQLCSPF  60

Query  225   VVKCLGCDISCEHNNA-LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGF  395
             VVKC G D++CE  +  +YNLFLEYVPGGTLSDL +   G   E  IQFYA Q+L+G+ +
Sbjct  61    VVKCFGSDVTCERGDGHVYNLFLEYVPGGTLSDLIRNHGGSLEEEAIQFYARQMLLGLDY  120

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             LH  G  HCD+KGQN+L++ D   +KIAD GC K+ E G   S++ F+GTPA+MAPEVA+
Sbjct  121   LHLKGMAHCDVKGQNVLIAAD-GGLKIADFGCAKWAECG-GGSATKFAGTPAYMAPEVAR  178

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GEEQ FPADIWA GCTVIEMATGS PW +M DP SALYR+A SGD PE P WFS   K+F
Sbjct  179   GEEQSFPADIWALGCTVIEMATGSNPWPEMKDPASALYRVAYSGDTPEVPDWFSGTGKDF  238

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
             + +CL RD + RWTAAELL HPF  S+   +    EF R SPTSVMDQ  W+++E+S PS
Sbjct  239   VARCLMRDPRERWTAAELLLHPFFDSVGKKNT---EFARKSPTSVMDQGFWDAVEVSDPS  295

Query  936   CNSTATAGFPANR-IGRLIIQAGER------LPDWEEDGGWVTVRGNEEDE---STDSEP  1085
              N T  A  P N   GR++   G+        P+W ++G WVTVRG++ +E   + D + 
Sbjct  296   PNPTDFAMSPENSPAGRIMDLIGDEFSWNLNFPEWTDEGDWVTVRGDKLEEYCSTIDQQQ  355

Query  1086  ILISILCPEDL--ESSIVNEAPSFDSS------DDEISVNDRVN  1193
             I  +    E L  E  +   + + + S      +DEISVND ++
Sbjct  356   IEETNQDNESLVDEEGVTQTSIAIEDSLLISYVNDEISVNDLIS  399



>ref|XP_007213446.1| hypothetical protein PRUPE_ppa025047mg [Prunus persica]
 gb|EMJ14645.1| hypothetical protein PRUPE_ppa025047mg [Prunus persica]
Length=441

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 237/357 (66%), Gaps = 20/357 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG TIGRGS+ATVSLATAA  SG  FAVKS  LS S  LQ+E+ +LS+   P +V+ L
Sbjct  4     WTRGRTIGRGSTATVSLATAA-LSGELFAVKSTELSCSSFLQKEQCLLSKLSCPNIVEYL  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             GC++S E+N  +YNL +EYVPGGTL D  +R  GR  EP IQ Y HQI+ G+ +LH  G 
Sbjct  63    GCNVSTENNRPMYNLLMEYVPGGTLFDTIRRHGGRLEEPAIQLYTHQIVQGLEYLHVNGL  122

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLE-----NGEASSSSAFSGTPAFMAPEVAKG  578
             VHCDIK QNILV+E+C  VKIADLGC K ++        A+SS+  SGTP FMAPEVA+G
Sbjct  123   VHCDIKSQNILVAEEC--VKIADLGCAKSVQIVAGDEDSATSSTIISGTPVFMAPEVARG  180

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQGF ADIWA GCT+IEMATG  PW ++NDPVSALYRI  SGD+PE P   S+  K+FL
Sbjct  181   EEQGFEADIWALGCTIIEMATGDGPWPELNDPVSALYRIGFSGDLPEIPTRLSNKGKDFL  240

Query  759   GKCLDRDAKRRWTAAELLQHPFLQS-ISSNSVTFKE--FVRNSPTSVMDQAVWNSIEMSQ  929
              KCL RD + RWTA +LL+HPFL+  + S +   +E  F   SP SV+DQ +W+S E  +
Sbjct  241   NKCLRRDPRERWTANQLLEHPFLEECLGSKTEQVREFNFTMRSPISVLDQGLWDSHEAFE  300

Query  930   PSCNSTATAGF----PANRIGRLI---IQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                  +   G     P  RI RLI     A    P+WE D  W TVR N  +ES +S
Sbjct  301   SPKEQSVVEGVCLNSPLERIKRLIGGTCSAFSNAPNWEFDENWSTVRSNGIEESQNS  357



>ref|XP_010644538.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Vitis 
vinifera]
Length=437

 Score =   362 bits (929),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 253/378 (67%), Gaps = 25/378 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGPTIGRG+SAT+SLA  +  SG  FAVKS  LS S +LQRE+  LSQ  S  +VK
Sbjct  1     MDWTRGPTIGRGASATISLAIVS-TSGELFAVKSTELSRSKLLQREQSFLSQLSSERIVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRG-RFSEPMIQFYAHQILMGIGFLHSM  407
              LG + +CE +  LYN+F+EYVPGG LSD + +RG R  E  I+ Y  QI++G+ +L   
Sbjct  60    YLGSNTTCEGDTMLYNVFMEYVPGGALSDEIRRRGNRLDEDWIRLYTRQIVLGLEYLQFN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE-NGEASSSSAFSGTPAFMAPEVAKGEE  584
             G VHCDIK +N+L+ ED +   IADLGC K +  NG     S FSGTP FMAPEVA+GEE
Sbjct  120   GLVHCDIKSENVLIREDGAV--IADLGCAKSVHGNG---GGSVFSGTPVFMAPEVARGEE  174

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGFPAD+WA GCTVIEMATG  PW +++DPVSALYRI  SGDVPEFP W S++ ++FL K
Sbjct  175   QGFPADVWALGCTVIEMATGRNPWPEVDDPVSALYRIGFSGDVPEFPMWLSENGRDFLDK  234

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVM-DQAVWNSIEMS-QPSC  938
             CL R+ + RWTA ELL+HPFL+    NS   KEF   SPTSV+ DQ  W+S+E    PS 
Sbjct  235   CLRRNPRERWTAKELLEHPFLE---PNSKQLKEFPVKSPTSVLDDQGFWDSLEAPVTPSV  291

Query  939   --NSTATAGFPANRIGRL---IIQAGERLPDWEEDGGWVTVRGNEEDES------TDSEP  1085
               +  +++  PA RI RL    + +G  LP+W  D  WVTVR N  +ES      T +  
Sbjct  292   LMHIGSSSNSPAERIQRLNEGALSSGSNLPNWTWDEDWVTVRSNYIEESARFSDNTTTTL  351

Query  1086  ILISILCPEDLESSIVNE  1139
             ++ S +  E+ E+ ++N+
Sbjct  352   VMASFVHEEEPENLVLND  369



>ref|XP_008226949.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Prunus mume]
Length=476

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 198/392 (51%), Positives = 248/392 (63%), Gaps = 35/392 (9%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RGPTIGRGS+ATVSLATAA  SG  FAVKS  LS S  LQ+E+  LS+   P +VK L
Sbjct  4     WTRGPTIGRGSTATVSLATAA-LSGELFAVKSTELSCSSFLQKEQCFLSKLSCPNIVKYL  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             GC++S E+N  +YNL +EYVPGGTL D  +R  GR  EP IQ Y HQI+ G+ +LH  G 
Sbjct  63    GCNVSTENNRPMYNLLMEYVPGGTLFDTIRRHGGRLEEPAIQLYTHQIVQGLEYLHVNGL  122

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLEN-----GEASSSSAFSGTPAFMAPEVAKG  578
             VHCDIK QNILV E+C+  KIADLGC K ++        A+SS+  SGTP FMAPEVA+G
Sbjct  123   VHCDIKSQNILVDEECA--KIADLGCAKSVQRVAGDEDSATSSTIISGTPVFMAPEVARG  180

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQGF ADIWA GCT+IEMATG  PW ++ D VSALYRI  S D+PE P   S+  K+FL
Sbjct  181   EEQGFEADIWALGCTIIEMATGDGPWPELKDAVSALYRIGFSSDLPEIPTRLSNKGKDFL  240

Query  759   GKCLDRDAKRRWTAAELLQHPFLQS-ISSNSVTFKE--FVRNSPTSVMDQAVWNSIEM--  923
              KCL RD + RWTA +LL+HPFL+  + S +   KE  F   SP SV+DQ +W+S E   
Sbjct  241   NKCLRRDPRERWTAKQLLEHPFLEECLGSKTEQVKEFNFTMRSPISVLDQGLWDSHEAFE  300

Query  924   --SQPSCNSTATAGFPANRIGRLI---IQAGERLPDWEEDGGWVTVRGNEEDESTDS---  1079
                + S   +     P  RI RLI     A    P+WE +  W TVR N  +ES +S   
Sbjct  301   SPKEQSVVESVCLNSPLERIKRLIGGTCSAFSNAPNWEFEENWSTVRSNGIEESQNSGTS  360

Query  1080  -------EPIL-----ISILCPEDLESSIVNE  1139
                    EP+      +++   E+L+SS+ +E
Sbjct  361   NNVISVDEPVAANSPNVALTYHEELDSSLCDE  392



>gb|EYU33654.1| hypothetical protein MIMGU_mgv1a021391mg [Erythranthe guttata]
Length=343

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/339 (57%), Positives = 235/339 (69%), Gaps = 15/339 (4%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFA-VKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             W RGPTIGRGSSA+VSLAT AG  G  FA VKS  LSSS  LQ+E  ++SQ  SPY+VKC
Sbjct  5     WTRGPTIGRGSSASVSLATTAG--GEVFAAVKSTDLSSSASLQKEGILISQLSSPYIVKC  62

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG DI+CE +  +YNLFLEY+PGGTLSD  K+  G   E  I  +AH ILMG+ +LH+ G
Sbjct  63    LGSDITCEESGHVYNLFLEYLPGGTLSDRIKKQGGSLDETAIGKHAHGILMGLNYLHTKG  122

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCDIKG+NIL+ E+ S VKIAD GC K +     S  S FSGTPA+MAPE A+GEEQG
Sbjct  123   LVHCDIKGENILLGENGS-VKIADFGCAKRV----GSGGSGFSGTPAYMAPETARGEEQG  177

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             F AD+WA GCTV+EMATGS PW +M DP +ALYR+  SGDVPE P WFS  A++FL  CL
Sbjct  178   FAADVWALGCTVVEMATGSHPWPEMKDPAAALYRVGFSGDVPETPAWFSGQARDFLDNCL  237

Query  771   DRDAKRRWTAAELLQHPFLQSISS---NSVTFKEFV-RNSPTSVMDQAVWNSIEMSQPSC  938
              RD + RWTAAELL+HPF+ + S+   +     EF  R SPTSVMDQ  W+++E+ +   
Sbjct  238   TRDPRERWTAAELLRHPFMIAASAEEGSGEVIGEFAKRASPTSVMDQDFWDALEVPENPM  297

Query  939   NSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGN  1055
               ++ +  PA RI  LI   G     W E+ GW+TVRG 
Sbjct  298   EISSDSDSPAGRIMDLIGD-GLSYGGWTEEEGWLTVRGR  335



>gb|EPS71117.1| hypothetical protein M569_03641, partial [Genlisea aurea]
Length=346

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 226/343 (66%), Gaps = 16/343 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGSSATV LATA  A+G  FAVKS+ L SS  L+RE+ ++S+   P VVK
Sbjct  8     MEWKRGPAIGRGSSATVYLATAI-AAGELFAVKSSDLRSSSALRREERLISELRPPLVVK  66

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             CLG D++ E     +NLFLEYV GGTLSDL +   G   E  IQFYAHQ+ +G+  +H  
Sbjct  67    CLGSDVTDEGGRREFNLFLEYVSGGTLSDLIRNSGGSLDEKTIQFYAHQLAIGLRHIHGK  126

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+KG+NIL+ E+    KI D GC +F E G     S  SGTPA+MAPEVA+GEEQ
Sbjct  127   GIVHCDVKGKNILIGEE--GTKICDFGCARFAEPG---GGSVISGTPAYMAPEVARGEEQ  181

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPADIWA GCTVIEMATGS PW +M DP S LYR+A SGD PEFP W S  AK+F+GKC
Sbjct  182   EFPADIWALGCTVIEMATGSNPWPEMKDPASTLYRVAYSGDTPEFPDWLSTAAKDFIGKC  241

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L ++   RWTAAEL++HPFL S        +   R SPT+V+DQ  W+SIE S+      
Sbjct  242   LIKEPNERWTAAELVRHPFLAS------GMERPTRESPTTVVDQTFWDSIEDSESMSEFI  295

Query  948   ATAGFPANRIGRLIIQAGERL--PDWEEDGGWVTVRGNEEDES  1070
              +   PA+RI  LI      L  P+W+ D  W  VRG   +E+
Sbjct  296   PSTESPADRITSLIGGESNSLYSPNWDGDEDWSEVRGISTEEN  338



>ref|XP_007020769.1| Mitogen-activated protein kinase kinase kinase 18, putative [Theobroma 
cacao]
 gb|EOY12294.1| Mitogen-activated protein kinase kinase kinase 18, putative [Theobroma 
cacao]
Length=455

 Score =   354 bits (909),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 196/428 (46%), Positives = 267/428 (62%), Gaps = 33/428 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRGP IGRG++ATVSLATA   SG  FAVKS+ L  S +LQRE  +LS+   P +VK
Sbjct  1     MEWIRGPAIGRGATATVSLATAV-PSGEVFAVKSSELCHSMLLQRESYLLSKLSCPRIVK  59

Query  234   CLGCDISCE--HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
              +GC +  E   N   YNL +EYV GGTL +  +R  GR  E  ++ Y  QIL G+ +LH
Sbjct  60    YIGCGVRNETSSNKPTYNLCMEYVAGGTLFEEIQRVGGRLGEEKVRLYTRQILQGLDYLH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLEN---GEASSSSAFSGTPAFMAPEVA  572
               G VHCDIK QNIL+ E+    KIADLGC K +      +   +SAFSGTPAFMAPEVA
Sbjct  120   GNGVVHCDIKSQNILIGEE--GAKIADLGCAKLMGKVGGDDRFDTSAFSGTPAFMAPEVA  177

Query  573   KGEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKE  752
             +G+EQG+ ADIWA GCT+IEM TG++PW ++NDPVSALY+I  S DVPE P+WF +  K+
Sbjct  178   RGKEQGYGADIWALGCTIIEMGTGNSPWPELNDPVSALYKIGFSEDVPEIPKWFCEKGKD  237

Query  753   FLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP  932
             F+ KCL RDA+ RWTA ELLQHPF++ + ++    K+   +SP+SV+DQA W+S+++ + 
Sbjct  238   FVSKCLRRDARERWTAKELLQHPFVEELDTHLKEVKDSTMDSPSSVLDQAFWDSLDVVES  297

Query  933   SCN---STATAGFPANRIGRLI---IQAGERLPDWEEDGGWVTVRGNEEDESTD------  1076
               N      ++  PANRI +L+   +       +W  +  W+TVR  + +E+ D      
Sbjct  298   PKNLIPEGISSSSPANRIKKLLQATLSPASNASNWTWNEDWITVRSIDIEETKDCSGESN  357

Query  1077  ---------SEPILISILCPE-DLESSIVNEAPSFDSSDDEISVNDRVNPRTNLDLSCHN  1226
                      S P  + +   E  +ESSI++     D+S + I    R+  RT+L L   +
Sbjct  358   AILGDDSSFSTPSFLDLFQDELTIESSILDLGNLLDNSIETIIDFSRIRVRTDLILPFDS  417

Query  1227  FT-DAFVS  1247
              T D+FVS
Sbjct  418   VTDDSFVS  425



>ref|XP_008380362.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=423

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 231/344 (67%), Gaps = 16/344 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RGPT+GRGS+ATVSLA  A + G  FAVKSA LSSS +LQ+E+  LS+  SP++VK L
Sbjct  4     WTRGPTVGRGSTATVSLA--ASSDGERFAVKSAELSSSALLQKEQCFLSKLGSPHIVKYL  61

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G ++S E+N  +YNL +EYVPGGTL D  +R  GR  E +IQ Y HQI+ G+ +LH    
Sbjct  62    GYNVSIENNKPMYNLCMEYVPGGTLFDAIRRRGGRLEEAVIQLYTHQIVQGLEYLHVNKL  121

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK QNILV+ + +  KIADLGC K ++  EA ++   SGTP FMAPEVA+GEEQGF
Sbjct  122   VHCDIKSQNILVTGETA--KIADLGCAKLVQGVEACTT--ISGTPVFMAPEVARGEEQGF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              ADIWA GCT+IEMATG  PW ++NDPVSALYRI  SG++PE P   S   K+FL KCL 
Sbjct  178   EADIWALGCTIIEMATGGGPWPEINDPVSALYRIGFSGELPEIPSQLSSKGKDFLSKCLM  237

Query  774   RDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTA  950
             +D + RWTA +LL HPFL Q + S   T  E V  SP SV+DQ +W+S E S+      +
Sbjct  238   KDPRERWTAKQLLDHPFLEQHLGSKFNT--EQVMGSPISVLDQGLWDSFEASESPMELLS  295

Query  951   TAGF----PANRIGRLI-IQAGERLPDWEEDGGWVTVRGNEEDE  1067
               G     P  RI +LI       +P+WE D  W TVR N ++E
Sbjct  296   VEGVCLNSPTERIKKLIGFSTFSNVPNWEFDENWCTVRSNIDEE  339



>ref|XP_008348361.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
 ref|XP_008365626.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=423

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 231/344 (67%), Gaps = 16/344 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RGPT+GRGS+ATVSLA  A + G  FAVKSA LSSS +LQ+E+  LS+  SP++VK L
Sbjct  4     WTRGPTVGRGSTATVSLA--ASSDGERFAVKSAELSSSALLQKEQCFLSKLGSPHIVKYL  61

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G ++S E+N  +YNL +EYVPGGTL D  +R  GR  E +IQ Y HQI+ G+ +LH    
Sbjct  62    GYNVSIENNKPMYNLCMEYVPGGTLFDAIRRRGGRLEEAVIQLYTHQIVQGLEYLHVNKL  121

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK QNILV+ + +  KIADLGC K ++  EA ++   SGTP FMAPEVA+GEEQGF
Sbjct  122   VHCDIKSQNILVTGETA--KIADLGCAKLVQGVEACTT--ISGTPVFMAPEVARGEEQGF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              ADIWA GCT+IEMATG  PW ++NDPVSALYRI  SG++PE P   S   K+FL KCL 
Sbjct  178   EADIWALGCTIIEMATGGGPWPEINDPVSALYRIGFSGELPEIPSQLSSKGKDFLSKCLM  237

Query  774   RDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTA  950
             +D + RWTA +LL HPFL Q + S   T  E V  SP SV+DQ +W+S E S+      +
Sbjct  238   KDPRERWTAKQLLDHPFLEQHLGSKFNT--EQVMGSPISVLDQGLWDSFEASESPMELLS  295

Query  951   TAGF----PANRIGRLI-IQAGERLPDWEEDGGWVTVRGNEEDE  1067
               G     P  RI +LI       +P+WE D  W TVR N ++E
Sbjct  296   VEGVCLNSPTERIKKLIGFSTFSNVPNWEFDENWCTVRSNIDEE  339



>ref|XP_009361098.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Pyrus x bretschneideri]
Length=465

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 231/344 (67%), Gaps = 16/344 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RGPT+GRGS+ATVSLAT++   G  FAVKSA LSSS +LQ+E+  LS+  SP++VK L
Sbjct  4     WTRGPTVGRGSTATVSLATSS--DGERFAVKSAELSSSALLQKEQCFLSKLSSPHIVKYL  61

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G ++S E+   +YNL +EY+PGGTL D  +R  GR  E +IQ Y HQI+ G+ +LH    
Sbjct  62    GYNVSIENKKPMYNLCMEYIPGGTLFDAIRRRGGRLEEAVIQLYTHQIVQGLEYLHVNKL  121

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK QNILV+ +    KIADLGC K ++  EAS++   SGTP FMAPEVA+ EEQGF
Sbjct  122   VHCDIKSQNILVTGE--TAKIADLGCAKLVQGVEASTT--ISGTPVFMAPEVARCEEQGF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              ADIWA GCT+IEMATGS PW ++NDPVSALYRI  SG++PE P   S   K+FL KCL 
Sbjct  178   EADIWALGCTIIEMATGSGPWPEINDPVSALYRIGFSGELPEIPSQLSSKGKDFLSKCLM  237

Query  774   RDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTA  950
             +D + RWTA +LL+HPFL Q + S   T  E V  SP SV+DQ  W+S E S+      +
Sbjct  238   KDPRERWTAKQLLEHPFLEQHLGSKFNT--EQVMGSPISVLDQGPWDSFEASESPMELLS  295

Query  951   TAGF----PANRIGRLI-IQAGERLPDWEEDGGWVTVRGNEEDE  1067
               G     P  RI +LI       +P+WE D  W TVR N ++E
Sbjct  296   VEGVCLNSPTERIKKLIGFSTFSNVPNWEFDENWCTVRSNSDEE  339



>ref|XP_002529924.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
 gb|EEF32478.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
Length=449

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 207/430 (48%), Positives = 269/430 (63%), Gaps = 46/430 (11%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGS+ATVSLAT+   SG  FA+KS  LS S  LQ+E+  LS+ +SP++VK
Sbjct  1     MEWTRGPVIGRGSTATVSLATSV-FSGELFALKSTELSKSMFLQKEQSFLSKINSPHIVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-S  404
              +G DI+ E+  +LYN+ LEYVPGGTL D+  R  G+  EPMI  Y   IL G+ +LH +
Sbjct  60    YIGYDITNENTQSLYNICLEYVPGGTLHDVILRHGGQLDEPMIGSYTRNILQGLDYLHRN  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE----NGEASSSSAFSGTPAFMAPEVA  572
             +G VHCDIK +N+L+S+D    KIAD GC KF+E    NG    +SAFSGTPAFM+PEVA
Sbjct  120   IGLVHCDIKSKNVLISKD--GAKIADFGCAKFVEQVARNG-GGDASAFSGTPAFMSPEVA  176

Query  573   KGEEQGFPADIWAFGCTVIEMATGSAPWQDM---NDPVSALYRIANSGDVPEFPRWFSDD  743
             +GEEQGFPADIWA GCTVIEMATGS PW ++   +DP+S LYRI  S + PEFP W S+ 
Sbjct  177   RGEEQGFPADIWAVGCTVIEMATGSIPWAEIMKNDDPLSVLYRIGFSSEAPEFPSWLSEK  236

Query  744   AKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEF-VRNSPTSVMDQAVWNSIE  920
              K+FL KCL RD+K RWTA ELL HPFL  +    +  K+   ++SP+ V+DQ  WNS++
Sbjct  237   GKDFLSKCLRRDSKERWTAKELLDHPFLGEL---ELELKDVDYQSSPSCVLDQDFWNSMD  293

Query  921   MSQPSCNST-----ATAGFPANRIGRLIIQAG---ERLPDWEEDGGWVTVRGNEEDE---  1067
               +   + T     +    PA RI RLI         +P+W  +  W+TVR NE +E   
Sbjct  294   AFESPQDLTPERFSSLNNSPAERINRLIGSNSLLVADVPNWSLEEDWITVRSNEFEENDV  353

Query  1068  ---STDSEP----ILISILCPEDLESSIVNEAPSFD--------SSDDEISVNDRVNP--  1196
                +T S P    I  SIL  +  ESSI  E    +        SSD+++S ++  NP  
Sbjct  354   ILVNTASVPNEFLISDSILYEQQPESSIFIEDLLLEFFLENENISSDNDVSTSEGYNPVS  413

Query  1197  RTNLDLSCHN  1226
               NL+    N
Sbjct  414   EENLNFETDN  423



>ref|XP_010536673.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=444

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 199/439 (45%), Positives = 274/439 (62%), Gaps = 35/439 (8%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGPTIGRGS+A VSLA ++  SG  FAV+S  LSSS +LQRE+ +LS+  SP++V+ 
Sbjct  3     EWTRGPTIGRGSTAAVSLAVSS--SGRLFAVQSVELSSSAILQREQSLLSELSSPHIVEF  60

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G   + E++  LYN+ +EY+ GGTL DL K+  G+ SEP I+ Y  QIL G+ +LH  G
Sbjct  61    IGSVSTRENDRLLYNIVMEYLSGGTLQDLIKKHGGKLSEPAIRSYTRQILKGLSYLHGKG  120

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCD+K QN+L+ E+ +  KIADLGC   +E+G A+S   FSGTPAFMAPEVA+GEEQG
Sbjct  121   IVHCDVKSQNVLIGENAAVAKIADLGCANTVEHGGATSD--FSGTPAFMAPEVARGEEQG  178

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             F AD+WA GCTVIEMATGS+PW +++D V+A+Y+I  SG+ PE P   S+ AK+FL  CL
Sbjct  179   FAADVWALGCTVIEMATGSSPWPELDDVVAAMYKIGFSGESPEIPGGLSEKAKDFLRNCL  238

Query  771   DRDAKRRWTAAELLQHPFL--QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ-----  929
              R++K RWT  ELLQHPFL  Q  S N+++      +SP++V+DQ  W+S E S+     
Sbjct  239   RRESKERWTVQELLQHPFLDEQDESRNTMS-----SSSPSTVLDQDFWDSYETSKSQLVQ  293

Query  930   -----PSCNSTATAGFPANRIGRLIIQAGERLPDWEED-GGWVTVRGNEEDESTDSEPIL  1091
                  P  + T++ G PA++I +L       +PDW+ D   W+ VR NEE   T      
Sbjct  294   TENEDPFADHTSSWGSPADQIKKLAGDGFSGVPDWDSDEDDWIQVR-NEEIGETQKRNDE  352

Query  1092  ISILCPEDLESSIVNEAPSFDSSDDEI-----SVNDRVNPRTNLDL-----SCHNFTDAF  1241
              + +  E+     V EA S+ S  D +     S N+ ++ R+ + +      C N    F
Sbjct  353   ENEIGDEETPWETVEEAESWISDQDSVFFDHFSDNNNMSYRSTVAIDVIISDCDNVGHVF  412

Query  1242  VSWIQDFDDNILKTSFSSK  1298
             VS   DF  N  K  F S+
Sbjct  413   VSPNIDFRRNNKKKIFVSQ  431



>ref|XP_010244478.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=439

 Score =   348 bits (894),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 227/341 (67%), Gaps = 12/341 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAA-GASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVV  230
             M+W RG T+GRGSSATVSLATA        FAVKS  LS S  LQRE+ ILS      +V
Sbjct  1     MDWTRGRTLGRGSSATVSLATAVRSGETEIFAVKSVELSRSEFLQREQRILSSIRCSRIV  60

Query  231   KCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
                GCDI+ E+   LYNLF+EYVPGG+L+D  ++  GR  E  I+ +  QIL GI +LH+
Sbjct  61    GYRGCDITSENGQLLYNLFMEYVPGGSLTDAIQKQGGRLDESAIRLHLRQILGGIHYLHT  120

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G VHCDIKG+N+L+ +D    KIADLGC ++++  + S S + +GTP FMAPEVA+G+E
Sbjct  121   SGLVHCDIKGRNVLIGKD--GAKIADLGCARWVD--QVSESMSIAGTPVFMAPEVARGDE  176

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGFPAD+WA GCTVIEMATG  PW D +DPVSALYRIA + D PE P   S+ AK+FL K
Sbjct  177   QGFPADVWAIGCTVIEMATGRLPWSDASDPVSALYRIAFTEDTPELPNCLSEQAKDFLSK  236

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RD K RWT ++LL+HPF+   SS     ++    SPTS++DQA W+S+E  + +  S
Sbjct  237   CLRRDPKDRWTISQLLKHPFVDEPSSGLNQIQDSASKSPTSILDQAFWDSLEEPE-TPRS  295

Query  945   TATAGFPANRI----GRLIIQAGERLPDWEEDGGWVTVRGN  1055
               +   PA RI    G +   +  RLPDW  D  W+TVR N
Sbjct  296   LRSLNSPAERIQQLCGNISSSSSPRLPDWSWDNSWITVRSN  336



>gb|EPS63016.1| hypothetical protein M569_11769 [Genlisea aurea]
Length=407

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 188/352 (53%), Positives = 232/352 (66%), Gaps = 23/352 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGSSATV LA+        FAVKS  LSSSG L+RE+ ++S+  SPYVV+
Sbjct  1     MEWKRGPAIGRGSSATVYLASEISGV-EVFAVKSCDLSSSGSLRREERLISELCSPYVVR  59

Query  234   CLGCDISCEHNNAL--YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             CLG  ++      +  +NLFLEYV GGTLSDL +   G   E  IQ YA+Q+ +G+  +H
Sbjct  60    CLGSGVTEGGAGGIGEFNLFLEYVAGGTLSDLVRNRGGSLDEKTIQLYANQLAIGLDHIH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
               G VHCDIKGQNIL+ ++  A+KI D GCGK    G         GTPA+M+PEVA+GE
Sbjct  120   GKGIVHCDIKGQNILIGKE--ALKICDFGCGKKAGRG---GEPPIVGTPAYMSPEVARGE  174

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQ FPADIWA GCTVIEMATGS PW +MN PVSAL+R+A+SGD P  P W S+ AK+F+G
Sbjct  175   EQSFPADIWALGCTVIEMATGSNPWPEMNHPVSALFRVAHSGDTPAPPDWLSNAAKDFIG  234

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
             KCL RD ++RWTAAELL+HPFL+    N   F+   R SPTSVMDQ  W+S+E  + S  
Sbjct  235   KCLARDPRQRWTAAELLRHPFLE---ENCGAFRGPTRESPTSVMDQTFWDSVEEPEDSAE  291

Query  942   S-------TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTD  1076
             +          A  PANRI  LI   G   P+W +DG W  VRG EE+ S +
Sbjct  292   TPSPAPAPAPAADSPANRITALI---GTSPPNWSDDGSWTRVRGIEEEHSQE  340



>ref|XP_009132644.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=451

 Score =   346 bits (888),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 235/349 (67%), Gaps = 19/349 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSLA     SG  FAVKS  LSSS +LQRE+ ILS  +SPYVV  +
Sbjct  6     WIRGPIIGRGSTATVSLAITN--SGEFFAVKSTELSSSAVLQREQTILSSLNSPYVVNYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G + + E+N  +YNL +EYVPGG++ DL K   G+  EP I+FY  QIL G+ +LH  G 
Sbjct  64    GSNTTTENNKLMYNLLMEYVPGGSIHDLIKNSGGKLPEPEIRFYTRQILKGLMYLHGRGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K  N+++ E+ +  KIADLGC K   NG    S  FSGTPAFM+PEVA+GEEQGF
Sbjct  124   VHCDLKSDNVMIGEETA--KIADLGCAKMAGNG----SLEFSGTPAFMSPEVARGEEQGF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GC VIEMATGS+PW ++ND V+A+Y+I  +G+ PE P   S+  K+FL KCL 
Sbjct  178   PADVWALGCVVIEMATGSSPWPELNDVVAAIYKIGFTGESPEVPEVLSEKGKDFLRKCLV  237

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN-SPTSVMDQAVWNSIEMSQ----PSC  938
             RD K+RWTA ELLQHPFL+    +   F   ++N SP++V+DQ  WNS E S+     + 
Sbjct  238   RDPKQRWTAEELLQHPFLEEEDQSQTQFGSCLKNYSPSTVLDQGFWNSCETSRSRFIQAD  297

Query  939   NSTATAGFPANRIGRLIIQAGERLP-DWEEDGGWVTVRGNEEDESTDSE  1082
             +S+       +RI +L+   G+  P +   + GW+ VRGN E E ++ +
Sbjct  298   SSSLWESSATDRIKKLV---GDENPGETTAEDGWIEVRGNGEIEKSNED  343



>emb|CAN65217.1| hypothetical protein VITISV_024689 [Vitis vinifera]
Length=420

 Score =   345 bits (884),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 231/343 (67%), Gaps = 10/343 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+G GSSATVSLA +   SG  FAVKS  LS S  LQRE+ ILS   SPY+V 
Sbjct  1     MDWTRGHTLGSGSSATVSLANSL-RSGDVFAVKSVELSRSESLQREERILSSLRSPYIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+   +YNLF+EY+PGGTL D  +RG  +  E MI  YA QI+ G+ ++HS 
Sbjct  60    YKGCDITRENKKLMYNLFIEYMPGGTLGDAIRRGGGQLHESMIGIYARQIVQGLDYIHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKGQN+L+ ED    KIAD GC K+  NG+       +GTP FMAPEVA+GE+Q
Sbjct  120   GLVHCDIKGQNVLIGED--GAKIADFGCAKWT-NGKDDRKVQIAGTPFFMAPEVARGEDQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G+P+D+WA GCT+IEMATG APW ++ + V+ALYRI  S ++P  P + SD AK+FL KC
Sbjct  177   GYPSDVWALGCTIIEMATGGAPWPNVANAVAALYRIGFSEELPWIPSFLSDQAKDFLSKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMS--QPSCN  941
             L RD K RWTA++LL+HPF+  ++  +   +E   +SPTS++DQ  W+S+E S  Q    
Sbjct  237   LRRDPKERWTASQLLKHPFVGELNPQAKQVQESYSDSPTSILDQNFWSSLEESEAQGYLK  296

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
               + +  PA RI +L   +  R+ +W  D  WVT+RG+  +ES
Sbjct  297   QASFSNSPAERIRKLWTFS--RVENWTRDDNWVTIRGSTNEES  337



>ref|XP_004295838.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Fragaria vesca subsp. vesca]
Length=447

 Score =   346 bits (887),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 274/452 (61%), Gaps = 41/452 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIGRGS+A VSLAT A  SG  FAVKSA LS S  L++E+  LS+  SP+VV+
Sbjct  3     MEWTRGRTIGRGSTAVVSLATDA-FSGEVFAVKSAELSRSSFLRKEQCFLSKLSSPHVVR  61

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSM  407
              LGCD+S E N  +YN+F+EYVPGGTLSD  +R   +  E +IQ + HQI+ G+ +LHS 
Sbjct  62    YLGCDVSTEQNEPMYNIFMEYVPGGTLSDAVRRNGKQLEEGVIQSFTHQIVQGLEYLHSN  121

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G  HCDIK QNILV ++   +KIADLGC K +     S +SAFSGTP FMAPEVA+GEEQ
Sbjct  122   GLAHCDIKSQNILVCQESGKIKIADLGCAKLVHE---SPTSAFSGTPVFMAPEVARGEEQ  178

Query  588   GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GF ADIWA GCT+IEMATG S+PW +++DPVSALY I  S D+PE PRW S + K+FL K
Sbjct  179   GFEADIWALGCTLIEMATGGSSPWTEVSDPVSALYLIGFSSDLPELPRWLSKEGKDFLSK  238

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEM-----SQ  929
             CL +  + RWTA ELL+HPFL+  SS          +SP SV+DQ +W+S E+      +
Sbjct  239   CLMKCPRERWTAKELLEHPFLEDYSSMGSVSL---SSSPISVLDQGLWDSFEVFEDAPQK  295

Query  930   PSCNSTATAGFPANRIGRLIIQAGERLPD---WEEDGGWVTVRGNEEDES----------  1070
                 S  ++  P +RI  LI        D   WE D  W T+R N  ++S          
Sbjct  296   QVRQSICSSNSPQDRIKMLIGGTCSTFSDTTNWEIDENWCTIRSNGSEDSHALLKNNNVI  355

Query  1071  TDSEPILISILCPEDLESSIVNE---APSFDSSDDEISV------NDRVNPRTNLDLSCH  1223
               SE ++ ++    D   SI++E   +P  D  D+E++       + R+    +  +S  
Sbjct  356   AISESMVATVALDMD---SIIDEQLHSPMCDDDDEELAFEYFVESDSRIGSDGDFVISYI  412

Query  1224  NFTDAFVSWIQDFDDNILKTSFSSKALILFTP  1319
                D+FV+ I DF+ +    SF    L+ F P
Sbjct  413   VTDDSFVN-ILDFEQDTRNYSFIHSQLLFFWP  443



>ref|XP_002269660.1| PREDICTED: mitogen-activated protein kinase kinase kinase A [Vitis 
vinifera]
 emb|CBI28820.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 231/343 (67%), Gaps = 10/343 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+G GSSATVSLA +   SG  FAVKS  LS S  LQRE+ ILS   SPY+V 
Sbjct  1     MDWTRGHTLGSGSSATVSLANSL-RSGDVFAVKSVELSRSESLQREERILSSLRSPYIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+   +YNLF+EY+PGGTL D  +RG  +  E MI  YA QI+ G+ ++HS 
Sbjct  60    YKGCDITRENKKLMYNLFIEYMPGGTLGDAIRRGGGQLHESMIGIYARQIVQGLDYIHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKGQN+L+ ED    KIAD GC K+  NG+       +GTP FMAPEVA+GE+Q
Sbjct  120   GLVHCDIKGQNVLIGED--GAKIADFGCAKWT-NGKDDRKVPIAGTPFFMAPEVARGEDQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G+P+D+WA GCT+IEMATG APW ++ + V+ALYRI  S ++P  P + SD AK+FL KC
Sbjct  177   GYPSDVWALGCTIIEMATGGAPWPNVANAVAALYRIGFSEELPWIPSFLSDQAKDFLSKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMS--QPSCN  941
             L RD K RWTA++LL+HPF+  ++  +   +E   +SPTS++DQ  W+S+E S  Q    
Sbjct  237   LRRDPKERWTASQLLKHPFVGELNPQAKQVQESYSDSPTSILDQNFWSSLEESEAQGYLK  296

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
               + +  PA RI +L   +  R+ +W  D  WVT+RG+  +ES
Sbjct  297   QASFSNSPAERIRKLWTFS--RVENWTRDDNWVTIRGSTNEES  337



>ref|XP_008385962.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Malus domestica]
 ref|XP_008366461.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=494

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 225/350 (64%), Gaps = 18/350 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RGPT+GRGS+ATVSLAT+   SG  FAVKS  LSSS  LQ+E+  LS+   P++VK L
Sbjct  4     WTRGPTVGRGSTATVSLATST-ISGERFAVKSTELSSSSFLQKEQCFLSKLSCPHIVKYL  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             GC++S E+N  +YNL +EYV GGTL D  +R  G   E MIQ Y HQI+ G+ +LH    
Sbjct  63    GCNVSIENNXHMYNLCMEYVSGGTLFDAIRRRGGPLEEAMIQLYTHQIVQGLEYLHENKL  122

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLE-----NGEASSSSAFSGTPAFMAPEVAKG  578
             VHCDIK QNIL +E+  + KIADLGC K ++          +S+  SGTP FMAPEVA+G
Sbjct  123   VHCDIKSQNILXTEE--SAKIADLGCAKLVQGVAEDEYSVEASATISGTPVFMAPEVARG  180

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQGF ADIWA GCT+IEMATG  PW ++NDPVSA+YRI  SG+VPE P   S   K+FL
Sbjct  181   EEQGFGADIWALGCTIIEMATGGGPWPEINDPVSAIYRIGFSGEVPEIPSRLSSKGKDFL  240

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ--P  932
              KCL +D + RWTA +LL+HPFL+    +     E V  SP SV+DQ +W+S E S+   
Sbjct  241   SKCLMKDPRERWTAKQLLEHPFLEEHLGSKFN-TEQVMGSPISVLDQGLWDSFEGSESPT  299

Query  933   SCNSTATAGF----PANRIGRLI-IQAGERLPDWEEDGGWVTVRGNEEDE  1067
                S    G     P  RI +LI        P+WE D  W TVR N ++E
Sbjct  300   GLQSVEVEGVCLNSPTERIKKLIGFSTSSYAPNWEFDESWSTVRSNGDEE  349



>gb|KDP39158.1| hypothetical protein JCGZ_00915 [Jatropha curcas]
Length=406

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 258/409 (63%), Gaps = 23/409 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGS+ATVSLAT+  +SG  FA+KS+ LS S +LQ+E+  LS+ +SPYVVK
Sbjct  1     MEWTRGPIIGRGSTATVSLATSTASSGKLFALKSSELSKSMLLQKEQCFLSKLNSPYVVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +GCDIS E++  +YN+ +EYV GGTL ++  R  G+  E MI+ +   IL G+ +LH +
Sbjct  61    YIGCDISRENDKPMYNICMEYVSGGTLHEVILRNGGKLEEAMIRLHTRNILQGLEYLHGI  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G  HCDIK  NILVS++  A KIAD GC +F++  + S  SAF+GTPAFMAPEVA+GEEQ
Sbjct  121   GLAHCDIKSHNILVSKEGLA-KIADFGCARFIKEID-SGKSAFAGTPAFMAPEVARGEEQ  178

Query  588   GFPADIWAFGCTVIEMATGSAPW----QDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GF AD+W+ GCT+IEMATG  PW    Q+ +D +S LY+I  S D+PE P W S+  K+F
Sbjct  179   GFEADVWSVGCTIIEMATGRIPWMTLDQENDDVISVLYKIGFSSDLPEIPEWLSEKTKDF  238

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFV---RNSPTSVMDQAVWNSIEMS  926
             L KCL RD K RWT  ELL HPFL  +      F++ +    +SP+ V+DQ  W+S+E+ 
Sbjct  239   LSKCLRRDPKERWTVKELLDHPFLDELEIKK--FEDHLTSSTSSPSCVLDQDFWDSMEVL  296

Query  927   QPSCNST----ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDE---STDSEP  1085
             +   + T    + +  PANRI  LI    + LP W  +  W+TVR  + +       S  
Sbjct  297   EGPQDLTFQDISNSNSPANRIKNLIGSISD-LPSWSFEEDWITVRSRDIENIEMPLVSNT  355

Query  1086  ILI--SILCPEDLESSIVNEAPSFDSSDDEISVNDRVNPRTNLDLSCHN  1226
              LI  SI+  ++LE SI  ++    +S     +    + R + DL  HN
Sbjct  356   FLISDSIVYNQELERSIETKSIKLLNSLQLALMGPIESTRVDRDLVFHN  404



>ref|XP_010096874.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB66328.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=443

 Score =   341 bits (874),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/380 (48%), Positives = 244/380 (64%), Gaps = 17/380 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGPTIGRG++ATV LAT    SG  FAVKSA L  +  L++E+  LS+  S  +VK
Sbjct  1     MEWTRGPTIGRGATATVHLATDT-RSGEPFAVKSAELCRAVFLRKEQSFLSKLSSSRIVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
              LG D++ E++  +YNLF+EY+P GTL D   ++ GR  E +I+ Y  QIL G+  +H  
Sbjct  60    YLGFDVTTENDVPMYNLFIEYLPNGTLFDAIRSREGRLDESLIKIYTQQILQGLDHIHEN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFL---ENGEASSSSAFSGTPAFMAPEVAKG  578
             G VHCDIK QN+L+ E+   +KIADLGC KF+   E G++     FSGTPAFMAPEVA+G
Sbjct  120   GLVHCDIKSQNMLIGEE--GIKIADLGCAKFVGEAEFGDSPLVLQFSGTPAFMAPEVARG  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E+QG  AD+WA GCTVIEMATG  PW +M+DPVSALYRI  S  VPE PRWFS+  K+FL
Sbjct  178   EKQGLEADVWALGCTVIEMATGRGPWPEMDDPVSALYRIGYSDRVPEIPRWFSEKGKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC  938
              KCL RD + RWT  ELL+HPFLQ     S    +   +SP+SV+D+ +W+S E  +   
Sbjct  238   SKCLKRDWRERWTVNELLEHPFLQVSELRSEQQVKAKMSSPSSVLDKDLWDSFEAFESHQ  297

Query  939   NSTATAGFPANRIGRLIIQAG----ERLPDWE-EDGGWVTVRGNEEDESTDSEPILI-SI  1100
             +  A++   A    +++I++     + LPDW  ++  W T+R N  +E    E ++  SI
Sbjct  298   DQEASSLNSAEERIKMLIRSAFCSVQNLPDWSCDEENWFTIRSNSIEEPIHEEELVYGSI  357

Query  1101  LCPEDLESSIVNEAPSFDSS  1160
                E+L     +E  SFD S
Sbjct  358   TFDEELS---FDEELSFDRS  374



>ref|XP_009790439.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Nicotiana sylvestris]
Length=385

 Score =   339 bits (869),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/355 (48%), Positives = 232/355 (65%), Gaps = 15/355 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIG GSSA VS+A +   SG  FAVKS  LS S  LQ+E+ ILS   SPY+V 
Sbjct  1     MDWIRGATIGHGSSAAVSIAVSR-CSGEIFAVKSVELSQSECLQKEQKILSTLSSPYIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+N  + NL +EY+PGGTL+    R  GR +E +I ++  QI+ G+ +LHS 
Sbjct  60    YKGYDVTGENNEDMLNLMMEYMPGGTLTHEIGRQGGRLNEQLIGYFTKQIIQGLDYLHSK  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+NIL+ E  +  KIAD GC + ++  + +      GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKGRNILLCE--TGAKIADFGCARSVDQAKWNG-----GTPMFMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF ADIWA GCT+IEMATG++PW  +++P S LY IA SG  PE P + S   ++F+ KC
Sbjct  173   GFAADIWALGCTIIEMATGASPWTTVSNPASLLYHIAFSGQNPEIPEFLSSKTRDFVSKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD K+RW+A +LL HPFL+   SNS   +EF+ +SPTS++DQ +WNS E S+   NST
Sbjct  233   LTRDPKQRWSAKQLLSHPFLEESDSNSKVDEEFITSSPTSILDQRIWNSAEESETVNNST  292

Query  948   ATAG---FPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISIL  1103
              T      P  R+ +L  Q+G+  P+W  D  W+TVR   E+   D   ++  +L
Sbjct  293   QTISSMDSPLQRVTKLCTQSGK--PEWRWDESWITVRNCSENNRGDGGNLVSKML  345



>gb|KDO62067.1| hypothetical protein CISIN_1g045508mg [Citrus sinensis]
Length=455

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 198/460 (43%), Positives = 275/460 (60%), Gaps = 46/460 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGS+ATV LA  A +SG   AVKS  LS S  LQRE+  LS+  SPYVV 
Sbjct  1     MEWTRGPIIGRGSTATVYLANLA-SSGKFIAVKSTELSRSMFLQREQCFLSKISSPYVVD  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LG +++ E+N   YNL++EY+P GTL D  +R  GR  E MI+ YA QIL G+  LH  
Sbjct  60    YLGFNVTNENNTPTYNLYMEYMPRGTLYDEIRRHGGRLDEQMIKLYAWQILQGLNHLHMN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKF---LENGEASSSSAFSGTPAFMAPEVAKG  578
             G  HCDIK  N+L+ +D    KIADLGC K+   +++  A ++SAFSGTP FM PEVA+ 
Sbjct  120   GIAHCDIKSNNVLIGDD--GAKIADLGCAKYVGEIDSNAALATSAFSGTPVFMPPEVARR  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  ADIWA GCT++EMATG+ PW ++NDPVSALYRI  SG+ PE PRW S +AK+FL
Sbjct  178   EEQGLAADIWAVGCTIVEMATGTNPWPELNDPVSALYRIGFSGETPEIPRWLSMEAKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVT-FKEFVRNSPTSVMDQAVWNSIEMSQPS  935
              KCL +D K R TA ELL+HPF+  +  +     ++F+ +SP +V++   W+S+E ++ S
Sbjct  238   CKCLTKDPKERLTAKELLEHPFICGVEFDHFKDVEKFIMSSPCTVLNHGFWDSLEEAESS  297

Query  936   CNSTATA-------GFPANRIGRLIIQA----GERLPDWEEDGGWVTVRGNEEDE---ST  1073
              N +  A            RI +LI  A    G  +P+W  D  W+TVR N  +E    +
Sbjct  298   ENLSPKASPSTSSSNSAVKRIQQLIGCALPSLGSSVPNWSLDEDWITVRSNGIEEPKICS  357

Query  1074  DSEPILIS------------ILCPEDLESSIVN----EAPSFDSSDDEISVNDRVNPRTN  1205
             D   ++I+            ++  E++++S +     E  S DS+ D  +V+ R +    
Sbjct  358   DENDLVIAHEPSAEATLAWDLISEEEVQNSTLIEDLFEGFSIDSNSDITNVSVRRDILLP  417

Query  1206  LDL-----SCHNFTDAFVSWIQDFDDNILKTSFSSKALIL  1310
              D+     S HNF+  F+  IQ F  N  + +    +L++
Sbjct  418   FDIARDNFSKHNFSLPFL--IQSFKFNFGQRNTDHDSLLI  455



>emb|CDY36728.1| BnaA03g11580D [Brassica napus]
Length=458

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 234/356 (66%), Gaps = 26/356 (7%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSLA     SG  FAVKS  LSSS +LQRE+ ILS  +SPYVV  +
Sbjct  6     WIRGPIIGRGSTATVSLAITN--SGEFFAVKSTELSSSAVLQREQTILSSLNSPYVVNYI  63

Query  240   GCDISCEHNNA-------LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIG  392
             G + + E+N         L NL +EYVPGG++ DL K   G+  EP I+FY  QIL G+ 
Sbjct  64    GSNTTTENNKLILSIIELLNNLLMEYVPGGSIHDLIKNSGGKLPEPEIRFYTRQILKGLM  123

Query  393   FLHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVA  572
             +LH  G VHCD+K  N+++ E+ +  KIADLGC K   NG    S  FSGTPAFM+PEVA
Sbjct  124   YLHGRGIVHCDLKSDNVMIGEETA--KIADLGCAKMAGNG----SLEFSGTPAFMSPEVA  177

Query  573   KGEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKE  752
             +GEEQGFPAD+WA GC VIEMATGS+PW ++ND V+A+Y+I  +G+ PE P   S+  K+
Sbjct  178   RGEEQGFPADVWALGCVVIEMATGSSPWPELNDVVAAIYKIGFTGESPEVPEVLSEKGKD  237

Query  753   FLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN-SPTSVMDQAVWNSIEMSQ  929
             FL KCL RD K+RWTA ELLQHPFL+    +   F   ++N SP++V+DQ  WNS E S+
Sbjct  238   FLRKCLVRDPKQRWTAEELLQHPFLEEEDQSQTQFGSCLKNYSPSTVLDQGFWNSCETSR  297

Query  930   ----PSCNSTATAGFPANRIGRLIIQAGERLP-DWEEDGGWVTVRGNEEDESTDSE  1082
                  + +S+       +RI +L+   G+  P +   + GW+ VRGN E E ++ +
Sbjct  298   SRFIQADSSSLWESSATDRIKKLV---GDENPGETTAEDGWIEVRGNGEIEKSNED  350



>ref|XP_006452414.1| hypothetical protein CICLE_v10010150mg [Citrus clementina]
 gb|ESR65654.1| hypothetical protein CICLE_v10010150mg [Citrus clementina]
Length=454

 Score =   336 bits (862),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 231/355 (65%), Gaps = 20/355 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGS+ATV LA  A +SG   AVKS  LS S  LQRE+  LS+  SPYVV 
Sbjct  1     MEWTRGPIIGRGSTATVYLANLA-SSGKFIAVKSTELSQSMFLQREQCFLSKISSPYVVD  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LG +++ E+N   YNL++EY+P GTL D  +R  GR  E MI+ YA QIL G+  LH  
Sbjct  60    YLGFNVTNENNTPTYNLYMEYMPRGTLYDEIRRHGGRLDEQMIKLYAWQILQGLNHLHMN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKF---LENGEASSSSAFSGTPAFMAPEVAKG  578
             G  HCDIK  N+L+ +D    KIADLGC K+   +++  A ++SAFSGTP FMAPEVA+ 
Sbjct  120   GIAHCDIKSNNVLIGDD--GAKIADLGCAKYVGEIDSNAALATSAFSGTPVFMAPEVARR  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  ADIWA GCT++EMATG+ PW ++NDPVSALYRI  SG+ PE PRW S +AK+FL
Sbjct  178   EEQGLAADIWAVGCTIVEMATGTNPWPELNDPVSALYRIGFSGETPEIPRWLSMEAKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVT-FKEFVRNSPTSVMDQAVWNSIEMSQPS  935
              KCL +D K R TA ELL+HPF+  +  +     ++F+ +SP +V++   W+S+E ++ S
Sbjct  238   CKCLTKDPKERLTAKELLEHPFICGVEFDHFKDVEKFIMSSPCTVLNHGFWDSLEEAESS  297

Query  936   CNSTATA-------GFPANRIGRLIIQA----GERLPDWEEDGGWVTVRGNEEDE  1067
              N +  A            RI +LI  A    G  +P+W  D  W+TVR N  +E
Sbjct  298   ENLSPKASPSTSSSNSAVKRIQQLIGCALPSLGSSVPNWSLDEDWITVRSNGIEE  352



>ref|XP_010252458.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=476

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 232/348 (67%), Gaps = 15/348 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG T+GRGSSATVSLA+A   SG  FAVKS  LS S  L+RE+ ILS      VV 
Sbjct  34    MDWIRGRTLGRGSSATVSLASAV-QSGEAFAVKSIQLSRSECLKREQRILSCIGCSQVVG  92

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCD++ E+   +YNLF+EYVPGGTL+D  ++  G+  E  I+ +  +IL G+ +LH+ 
Sbjct  93    YKGCDVTSENGQLVYNLFMEYVPGGTLTDAIQKQGGQLDESAIRSHCREILRGLHYLHTN  152

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+N+L+ +D    KIADLGC ++++       + F+GTP FMAPEVA+G+EQ
Sbjct  153   GIVHCDIKGRNVLIGKD--GAKIADLGCARWVD-----EVTPFAGTPVFMAPEVARGDEQ  205

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G PAD+W+ GCTVIEMATG  PW ++ DPVSALYRIA S D PE P   S+ A++FL KC
Sbjct  206   GIPADVWSVGCTVIEMATGRPPWPEVADPVSALYRIAFSKDTPELPNCLSEQARDFLSKC  265

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L R+ K RWT A+LL+HPFL   +S+    +    +SPTS++DQ  W+S+E S+   N  
Sbjct  266   LMRNPKERWTTAQLLKHPFLGESNSHFKQIQGADSDSPTSILDQGFWDSLEESETHINFN  325

Query  948   ATAGFPANRIGRL---IIQAGERLPDWEEDGGWVTVRGNEEDESTDSE  1082
             +    PA RI RL   I  +  RLPDW  D  WVTVR +  + S D E
Sbjct  326   SLNS-PAERIRRLCGGISSSSPRLPDWTWDENWVTVR-SSTNNSNDGE  371



>ref|XP_004170912.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like, 
partial [Cucumis sativus]
Length=352

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 226/342 (66%), Gaps = 13/342 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGP +GRGSSATV +AT   +SG  FAVKS   +SS +LQ+E  +LS   SPY++K
Sbjct  1     MDWTRGPPVGRGSSATVYMATI-NSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIK  59

Query  234   CLGCDISCE-HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
              LG D+  +  N  ++NLF+EY+P GTL D  +   GR  E MI+ ++ QIL G+ +LH+
Sbjct  60    SLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHA  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCDIK +N+L+S+    +KIADLGC KF++    +   AFSG+PAFMAPEVA+GEE
Sbjct  120   NGLAHCDIKSRNLLLSD--GDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGFPAD+WAFGCTVIEMATG  PW ++ DPVSALYRI  SG++PE PRW S+ A++F+ K
Sbjct  178   QGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNS----VTFKEFVRNSPTSVMDQAVWNSIEMSQP  932
             CL +D+K RW+   LL+HPFLQ + S S       K    +SP+ V+DQ  W+S+E  + 
Sbjct  238   CLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPSCVLDQRFWDSMEDLET  297

Query  933   SCNSTATAGF---PANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
                 T  A     PA RI RL       L    +DG WV +R
Sbjct  298   PWKVTQQASLVDCPAERIRRLADNFSCDLELEWDDGDWVLIR  339



>ref|XP_010545229.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=471

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 231/349 (66%), Gaps = 20/349 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGPTIGRGS+ATVS+A A+  SG  FAVK+  LSSS +LQRE+ +LS+  SP+VVK 
Sbjct  31    EWTRGPTIGRGSTATVSIAVAS--SGRIFAVKTVELSSSAILQREQSLLSELSSPHVVKF  88

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G   + E+N  LYN+ +EYV GGTL DL K+  G+  EP I+ +  QIL G+ +LHS G
Sbjct  89    IGSVSTRENNIFLYNILMEYVGGGTLHDLIKKRGGKLPEPEIRSFTRQILKGLSYLHSRG  148

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCD+K QN+L+ E+    KI+DLGC K +ENG  +S   FSGTPAFMAPEVA+GEEQG
Sbjct  149   IVHCDVKSQNVLIGENGVVAKISDLGCAKTVENGGVTSE--FSGTPAFMAPEVARGEEQG  206

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             F AD+WA GCTVIEMATGS+PW  +ND V+A+Y+I  SG+ PE P W S+ AK+FL  CL
Sbjct  207   FAADVWALGCTVIEMATGSSPWPGLNDVVAAMYKIGFSGESPEIPGWLSEKAKDFLRNCL  266

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSV---TFKEFVRNSPTSVMDQAVWNSIEMSQ----  929
              R+A  RW   E LQHPFL     +     T      +SP++V+DQ  W+S E+S+    
Sbjct  267   RREASERWAVHEFLQHPFLDEQDESRTCLNTRMTTSSSSPSTVLDQYFWDSFELSKSLLI  326

Query  930   ------PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNE  1058
                   P  + ++    PA+RI +L       +PDW+ D  W+ +R NE
Sbjct  327   QTEHEDPFPDPSSYRDSPADRIKKLAGDGFSGVPDWDTD-DWIQLRNNE  374



>ref|XP_006475134.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Citrus sinensis]
Length=481

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 195/442 (44%), Positives = 267/442 (60%), Gaps = 43/442 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RGP IGRGS+ATV LA  A +SG   AVKS  LS S  LQRE+  LS+  SPYVV 
Sbjct  1     MEWTRGPIIGRGSTATVYLANLA-SSGKFIAVKSTELSRSMFLQREQCFLSKISSPYVVD  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LG +++ E+N   YNL++EY+P GTL D  +R  GR  E MI+ YA QIL G+  LH  
Sbjct  60    YLGFNVTNENNTPTYNLYMEYMPRGTLYDEIRRHGGRLDEQMIKLYAWQILQGLNHLHMN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKF---LENGEASSSSAFSGTPAFMAPEVAKG  578
             G  HCDIK  N+L+ +D    KIADLGC K+   +++  A ++SAFSGTP FM PEVA+ 
Sbjct  120   GIAHCDIKSNNVLIGDD--GAKIADLGCAKYVGEIDSNAALATSAFSGTPVFMPPEVARR  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  ADIWA GCT++EMATG+ PW ++NDPVSALYRI  SG+ PE PRW S +AK+FL
Sbjct  178   EEQGLAADIWAVGCTIVEMATGTNPWPELNDPVSALYRIGFSGETPEIPRWLSMEAKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVT-FKEFVRNSPTSVMDQAVWNSIEMSQPS  935
              KCL +D K R TA ELL+HPF+  +  +     ++F+ +SP +V++   W+S+E ++ S
Sbjct  238   CKCLTKDPKERLTAKELLEHPFICGVEFDHFKDVEKFIMSSPCTVLNHGFWDSLEEAESS  297

Query  936   CNSTATA-------GFPANRIGRLIIQA----GERLPDWEEDGGWVTVRGNEEDE---ST  1073
              N +  A            RI +LI  A    G  +P+W  D  W+TVR N  +E    +
Sbjct  298   ENLSPKASPSTSSSNSAVKRIQQLIGCALPSLGSSVPNWSLDEDWITVRSNGIEEPKICS  357

Query  1074  DSEPILIS------------ILCPEDLESSI----VNEAPSFDSSDDEISVNDRVNPRTN  1205
             D   ++I+            ++  E++++S     + E  S DS+ D  +V+ R +    
Sbjct  358   DENDLVIAHEPSAEATLAWDLISEEEVQNSTLIEDLFEGFSIDSNSDITNVSVRRDILLP  417

Query  1206  LDLSCHNFTDAFVSWIQDFDDN  1271
              D++     D FVS   DF+ N
Sbjct  418   FDIA----RDNFVSENLDFETN  435



>emb|CDX89295.1| BnaA01g15980D [Brassica napus]
Length=458

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 225/353 (64%), Gaps = 28/353 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ATVS  TA   SG  FAVKSA  SSS +LQ E+ +LS   SP++VK
Sbjct  3     ITWTRGPVIGRGSTATVS--TAISNSGEMFAVKSADFSSSAILQNEQSVLSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSM  407
              +G D++ E    +YNL +EYV GG+L DL K    +  EP+I+ Y  QIL G+ +LH  
Sbjct  61    YIGSDVTPEKEGLVYNLLMEYVSGGSLHDLIKNSGRKLPEPVIRSYTRQILRGLSYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+    KIAD+GC K +        S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVEENGVVCKIADMGCAKPV------LKSGFSGTPAFMAPEVARGEEQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTVIEM TGS+PW ++ND V+A+Y+I  SG+ PE P W S+  K+FL  C
Sbjct  175   RFPADVWALGCTVIEMVTGSSPWPELNDVVAAMYKIGYSGESPEVPEWISEKGKDFLMSC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ------  929
             L+ D K+RWT  ELL+HPFL   S   +T      +SP++V+DQ  WNS E S+      
Sbjct  235   LENDPKQRWTVEELLKHPFLDEESHLRIT------SSPSTVLDQRFWNSCEASESHSLSM  288

Query  930   ----PSCNSTATAGFPANRIGRLIIQAGERLPDWEE--DGGWVTVRGNEEDES  1070
                 P  +   +   PA+RI +L       +PDW+   DG W+ VRG+  +E+
Sbjct  289   DHEDPFADYLESWDLPADRIEQLAGDEFSSVPDWDTVGDGEWIQVRGDVLEET  341



>ref|XP_010445108.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Camelina 
sativa]
Length=442

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 248/399 (62%), Gaps = 30/399 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGP IGRGS+ATVS+A +   SG  FAVKSA LSSS  LQ+E+ ILS   SP++VK
Sbjct  3     MNWTRGPIIGRGSTATVSIAISN--SGEIFAVKSAELSSSTFLQKEESILSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E++ ++YN+ +EYV GG+L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGSGLTRENDESVYNILMEYVSGGSLHDLIKNTGGKLPEPAIRSYTRQILNGLMYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+   +KIAD+GC K +  GE    S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVEEN-GVLKIADMGCAKKV--GE----SEFSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+W  GCTVIEM TGS+PW ++ND V+A+Y+I  SG+ PE P   S+ AK+FL  C
Sbjct  174   RFPADVWGLGCTVIEMMTGSSPWPELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFLMNC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE---------  920
               +D K+RWT  ELL+HPFL    S S        +SP++V+DQ  W+S E         
Sbjct  234   FKKDTKQRWTVHELLKHPFLDDEESQSSECLNKKTSSPSTVLDQRFWDSCEEVSKSHLIS  293

Query  921   --MSQPSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRGNEEDESTDSEPI  1088
                  P    T +   PA+RI +L       LPDW  E+DGGW  VRG+E +E+ + +  
Sbjct  294   MDHEDPFAGYTESWDSPADRIKKLAGDEFLSLPDWDREDDGGWCQVRGDEHEETEECDGD  353

Query  1089  LISILCPEDLESSIVNEAPSFDSSDD----EISVNDRVN  1193
                ++C E   SS   E    +S+ D    E S +D +N
Sbjct  354   Q-DVICVEATSSS-TEEVGDLNSNQDSLFLEYSSDDIIN  390



>ref|XP_004139869.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
Length=362

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 226/342 (66%), Gaps = 13/342 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGP +GRGSSATV +AT   +SG  FAVKS   +SS +LQ+E  +LS   SPY++K
Sbjct  1     MDWTRGPPVGRGSSATVYMATI-NSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIK  59

Query  234   CLGCDISCE-HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
              LG D+  +  N  ++NLF+EY+P GTL D  +   GR  E MI+ ++ QIL G+ +LH+
Sbjct  60    SLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHA  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCDIK +N+L+S+    +KIADLGC KF++    +   AFSG+PAFMAPEVA+GEE
Sbjct  120   NGLAHCDIKSRNLLLSD--GDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGFPAD+WAFGCTVIEMATG  PW ++ DPVSALYRI  SG++PE PRW S+ A++F+ K
Sbjct  178   QGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNS----VTFKEFVRNSPTSVMDQAVWNSIEMSQP  932
             CL +D+K RW+   LL+HPFLQ + S S       K    +SP+ V+DQ  W+S+E  + 
Sbjct  238   CLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPSCVLDQRFWDSMEDLET  297

Query  933   SCNSTATAGF---PANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
                 T  A     PA RI RL       L    +DG WV +R
Sbjct  298   PWKVTQQASLVDCPAERIRRLADNFSCDLELEWDDGDWVLIR  339



>ref|XP_010436369.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=437

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 192/440 (44%), Positives = 274/440 (62%), Gaps = 40/440 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGP IGRGS+ATVS+A +   SG  FAVKSA LSSS  LQ+E+ ILS   SP++VK
Sbjct  3     MNWTRGPIIGRGSTATVSIAISN--SGEIFAVKSAELSSSTFLQKEESILSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E++  +YN+ +EYV GG+L DL K+  G+  EP I+ Y  QIL G+ ++H  
Sbjct  61    YIGSGLTRENDRLVYNILMEYVSGGSLHDLIKKSGGKLPEPAIRSYTRQILNGLMYIHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+   +KIAD+GC K +  GE    S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNLLVEEN-GVLKIADMGCAKTV--GE----SEFSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTV+EM TGS+PW ++ND V+A+Y+I  SG+ PE P   S+ AK+FL  C
Sbjct  174   RFPADVWALGCTVMEMMTGSSPWPELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFLMSC  233

Query  768   LDRDAKRRWTAAELLQHPFL------QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ  929
               +D K+RWT  ELL+HPFL      +S SS  +   +   +SP++V+D+  W+S E+S+
Sbjct  234   FKKDTKQRWTVHELLKHPFLDNDDDKESQSSECLCLNK--TSSPSTVLDKHFWDSCEVSK  291

Query  930   ----------PSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRGNEEDEST  1073
                       P    + +   PA+RI +L       LPDW  E+DGGW  VRG+E +E T
Sbjct  292   CHLISMDHDNPFAGYSESCDSPADRIEKLAGDDNSSLPDWDTEDDGGWYKVRGDEHEE-T  350

Query  1074  DSEPILISILCPEDLESSIVNEAPSFDSSDD----EISVNDRVNP-RTNLDLSCHNFTDA  1238
             +       ++C E   +S   E   ++S+ D    E S +D +N   +N+ +   NF   
Sbjct  351   EERNGDQDVICVE--ATSSTEEVGDWNSNQDSLFLEYSSDDIINNFYSNVAIQ-GNFIAF  407

Query  1239  FVSWIQDFDDNILKTSFSSK  1298
             +   ++D   N+ +T+ +++
Sbjct  408   YYFCLEDKIKNVFRTTTTNE  427



>ref|XP_008448094.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Cucumis 
melo]
Length=555

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 225/342 (66%), Gaps = 13/342 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGP +GRGSSATV +AT   +SG  FAVKS +L+SS +L +E  +LS   SPY++K
Sbjct  1     MDWTRGPPVGRGSSATVYMATL-NSSGQQFAVKSTNLASSALLHKEHALLSNLSSPYLIK  59

Query  234   CLGCDISCE-HNNALYNLFLEYVPGGTLSDLAK--RGRFSEPMIQFYAHQILMGIGFLHS  404
             CLG D+  +  N  ++NLF+EY P GTL D  +   GR  E MI  ++ QIL G+ +LH+
Sbjct  60    CLGFDVETQPLNPPVFNLFMEYFPEGTLWDAIQINGGRIEESMIGVFSRQILKGLEYLHA  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCDIK +N+L+S++   +KIADLGC KF++    +   AFSG+PAFMAPEVA+GEE
Sbjct  120   NGLAHCDIKSRNLLLSDE--GLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGFPAD+WAFGCTVIEMATG  PW ++ DPVSALYRI  SG+VPE PRW S+ AK+F+ K
Sbjct  178   QGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGEVPEIPRWLSESAKDFVAK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVT----FKEFVRNSPTSVMDQAVWNSIEMSQP  932
             CL +D K RW+   LL+HPFL+   S S       K    +SP+ V+DQ  W+S+E  + 
Sbjct  238   CLIKDPKERWSVKRLLEHPFLEGFDSESEIEGSRMKTVNSSSPSCVLDQRFWDSMEDLES  297

Query  933   SCNSTATAGF---PANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
                 T  A     PA RI RL       L    +DG WV +R
Sbjct  298   PSKVTQQASLVDCPAERIRRLADNLSCDLELEWDDGDWVLIR  339



>emb|CDY19916.1| BnaC09g31820D [Brassica napus]
Length=446

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/339 (52%), Positives = 221/339 (65%), Gaps = 17/339 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGPTIGRGS+ATVSLA     SG  FAVKSA LSSS +LQRE+  LS+  SPYVVK +
Sbjct  6     WIRGPTIGRGSTATVSLAITN--SGELFAVKSAELSSSAVLQREQSGLSKLSSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G  ++ E+   +YNL +EYV GG++ DL KR  G+  EP I+ Y  QIL G+ +LH  G 
Sbjct  64    GSSVTTENGKPMYNLLMEYVSGGSIHDLIKRSGGKLPEPEIRSYTRQILKGLMYLHDQGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN++V ED +  KIADLGC K   NG    S  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDLKSQNVMVGEDTA--KIADLGCSKMAGNG----SLEFSGTPAFMSPEVARGEEQSF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GC VIEMATG +PW ++ND V A+Y+I  +G+ PE P   S+  K+FL  CL 
Sbjct  178   PADVWALGCMVIEMATGLSPWPELNDVVGAIYKIGFTGESPEIPECLSEKGKDFLRNCLR  237

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN--SPTSVMDQAVWNSIEMSQPSCNST  947
             RD K+RW   ELLQHPFL  +   S        N  SP++V+DQ  W+S   +       
Sbjct  238   RDPKQRWAVEELLQHPFL-DVEDKSQILSRCCLNSSSPSTVLDQGFWDSYPFANSYDLWD  296

Query  948   ATAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEE  1061
             ++A   A+RI +L+       P+W   D GW+ VRGNEE
Sbjct  297   SSA---ADRINKLVGDENSGEPEWLTADDGWIEVRGNEE  332



>ref|XP_006364180.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=379

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 229/343 (67%), Gaps = 21/343 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIG GSSA VS+A +   S   FAVKS  LS S +LQ+E+ ILSQ  SPY+V 
Sbjct  1     MDWIRGHTIGHGSSAAVSVAKSR-FSDEVFAVKSVELSKSQLLQKEQKILSQLSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+N  ++NL +EY+P GT+SD  ++  GR +EP+I +Y  QIL G+ +LHS 
Sbjct  60    YKGYDVTKENNKIMFNLMMEYMPDGTISDEIRKQGGRMNEPLIGYYTKQILQGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               +HCD+KGQNILV +  +  KIAD GC  + +NG    +    GTP FMAPEVA+GEEQ
Sbjct  120   SIIHCDMKGQNILVGK--TGAKIADFGCANWRDNG----TVPIGGTPMFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G PADIW  GCT+IEMATG +PW ++ +  S LYRIA SG  P  P++ S  AK+FL KC
Sbjct  174   GCPADIWGLGCTIIEMATGGSPWTNVTNAASLLYRIAFSGQSPVIPKFLSLQAKDFLNKC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD+K RWTA +LL+HPFL++I       ++FV +SPTS++DQ +WNS+E S+ +   T
Sbjct  234   LRRDSKERWTAKQLLKHPFLEAI-------QDFVTDSPTSILDQDIWNSVEESETTILQT  286

Query  948   ATAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEEDEST  1073
              ++  P  R+  L  ++G+  P+W   D  W TVR   E + T
Sbjct  287   VSS--PLQRVRELSQKSGK--PNWCWADEIWTTVRKTSEGDCT  325



>ref|XP_008229972.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Prunus 
mume]
Length=442

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 231/351 (66%), Gaps = 18/351 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSATVSLAT+   SG+ FAVKSA +S S  LQRE+ ILS   SP++V 
Sbjct  1     MDWTRGHTIGHGSSATVSLATSC-FSGNLFAVKSAEMSQSEFLQREQKILSALSSPHIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD--LAKRGRFSEPMIQFYAHQILMGIGFLHSM  407
              +G D++ E N  +YNLF+EY+P GT+ D      G+  E +I+ Y   I+ G+ +LHS 
Sbjct  60    YMGHDMTSESNKLMYNLFMEYMPRGTIIDEICNHGGQIDESLIRDYTRDIVKGLEYLHSH  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+NILV +D    KIAD GC ++  N     +    GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKGRNILVGDD--GPKIADFGCARW-ANPAGEVAVPIGGTPMFMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GFP D+WA GCT+IEMATG S PW +  +PVS LY+IA SG++PE P + SD AKEFLGK
Sbjct  177   GFPCDVWALGCTIIEMATGGSVPWPNAANPVSVLYQIAYSGELPEIPSFLSDQAKEFLGK  236

Query  765   CLDRDAKRRWTAAELLQHPFLQS-----ISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ  929
             CL RD   RWTA++LL+H FL+      I+S++   +E    SPTS++DQ +WNS+E S+
Sbjct  237   CLRRDPTERWTASQLLKHSFLEEKEELIITSSAKQAQESTSFSPTSILDQGIWNSLEESE  296

Query  930   PSCNSTATAGFPA----NRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
                N      F      +RI RL + +G   P W  D  W+TVRGN+ +ES
Sbjct  297   TLGNLVQFPSFENSSSDHRIRRLSLSSGN--PRWALDETWITVRGNDCEES  345



>ref|XP_009121273.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Brassica rapa]
Length=441

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 228/347 (66%), Gaps = 19/347 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGPTIGRGS+ATVSLA     SG  FAVKSA LSSS +LQRE+ +LS+  SPYVVK +
Sbjct  6     WIRGPTIGRGSTATVSLAITN--SGELFAVKSAELSSSAVLQREQSVLSKLSSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G +++ E+   +YNL +EYV GG++ DL K+  G+  EP I+FY  QIL G+ +LH  G 
Sbjct  64    GSNVTTENGQPMYNLLMEYVSGGSIHDLIKKSGGKLPEPEIRFYTRQILKGLMYLHGQGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN++V  + +  KIADLGC K   N     S  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDLKSQNVMVGGETA--KIADLGCAKMAGN----ESLEFSGTPAFMSPEVARGEEQSF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GC VIEMATG +PW ++ND V A+Y+I  +G+ PE P   S+  K+FL  CL 
Sbjct  178   PADVWALGCMVIEMATGLSPWPELNDVVGAIYKIGFTGESPEIPECLSEKGKDFLTNCLR  237

Query  774   RDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ------P  932
             RD K+RW   ELLQHPFL +   +  ++      +SP++V+DQ  W+S E S+      P
Sbjct  238   RDPKQRWAVEELLQHPFLDEEDKTQILSCCCLNSSSPSTVLDQGFWDSCETSRSRLIQDP  297

Query  933   SCNS-TATAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEEDE  1067
               NS        A+RI +L+      +P+W   + GW+ VRGNEE E
Sbjct  298   FANSFNMWDSSAADRIKKLVGDENSGVPEWLTAEDGWIEVRGNEEIE  344



>emb|CDY69540.1| BnaCnng64060D [Brassica napus]
Length=451

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 226/346 (65%), Gaps = 17/346 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSLA     SG  FAVKSA LSSS  LQRE+ ILS  +SPYVVK +
Sbjct  6     WIRGPIIGRGSTATVSLAITN--SGEFFAVKSAELSSSAFLQREQTILSSLNSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G + + E+N  +YNL +EY+PGG++ DL K   G+  EP I+FY  QIL G+ +L   G 
Sbjct  64    GFNTTTENNKLMYNLLMEYIPGGSIHDLIKNSGGKLPEPEIRFYTRQILKGLMYLQEQGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K  N+++ E+ +  KIADLGC K   NG    S  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDLKSDNVMIGEETA--KIADLGCAKMAGNG----SLEFSGTPAFMSPEVARGEEQSF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GC VIEMATGS+PW ++ND V+A+Y+I  +G+ PE P   S+  ++FL KC+ 
Sbjct  178   QADVWALGCVVIEMATGSSPWPELNDVVAAIYKIGFTGESPEIPEVLSEKGRDFLRKCMV  237

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN-SPTSVMDQAVWNSIEMSQPSCNSTA  950
             RD K+RW   ELLQHPFL+    +   F   ++N SP++V+DQ  W+S E S+       
Sbjct  238   RDPKQRWDVEELLQHPFLEEEDQSQTQFGCGLKNYSPSTVLDQGFWDSCETSRTRLIQAD  297

Query  951   TAGF----PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTD  1076
             ++        +RI +L+    E   +   + GW+ VRGN E E ++
Sbjct  298   SSSLWESSATDRIKKLV--GDENPGETTAEDGWIEVRGNGEIEKSN  341



>emb|CDY17301.1| BnaA10g09350D [Brassica napus]
Length=431

 Score =   330 bits (846),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 226/340 (66%), Gaps = 15/340 (4%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGPTIGRGS+ATVSLA     SG  FAVKSA LSSS +LQRE+ +LS+  SPYVVK +
Sbjct  6     WIRGPTIGRGSTATVSLAITN--SGELFAVKSAELSSSAVLQREQSVLSKLSSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G +++ E+   +YNL +EYV GG++ DL K+  G+  EP I+FY  QIL G+ +LH  G 
Sbjct  64    GSNVTTENGQPMYNLLMEYVSGGSIHDLIKKSGGKLPEPEIRFYTRQILKGLMYLHGQGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN++V  + +  KIADLGC K   N     S  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDLKSQNVMVGGETA--KIADLGCAKMAGN----ESLEFSGTPAFMSPEVARGEEQSF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GC VIEMATG +PW ++ND V A+Y+I  +G+ PE P   S+  K+FL  CL 
Sbjct  178   PADVWALGCMVIEMATGLSPWPELNDVVGAIYKIGFTGESPEIPECLSEKGKDFLTNCLR  237

Query  774   RDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTA  950
             RD K+RW   ELLQHPFL +   +  ++      +SP++V+DQ  W+S   +       +
Sbjct  238   RDPKQRWAVEELLQHPFLDEEDKTQILSCCCLNSSSPSTVLDQGFWDSYPFANSFNMWDS  297

Query  951   TAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEEDE  1067
             +A   A+RI +L+      +P+W   + GW+ VRGNEE E
Sbjct  298   SA---ADRIKKLVGDENSGVPEWLTAEDGWIEVRGNEEIE  334



>ref|NP_200320.1| mitogen-activated protein kinase kinase kinase 15 [Arabidopsis 
thaliana]
 dbj|BAB08578.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96579.1| mitogen-activated protein kinase kinase kinase 15 [Arabidopsis 
thaliana]
Length=448

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 230/360 (64%), Gaps = 31/360 (9%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSL      SG  FAVKSA  SSS  LQRE+ ILS+  SPY+VK +
Sbjct  6     WIRGPIIGRGSTATVSLGITN--SGDFFAVKSAEFSSSAFLQREQSILSKLSSPYIVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G +++ E++  +YNL +EYV GG+L DL K   G+  EP+I+ Y  QIL G+ +LH  G 
Sbjct  64    GSNVTKENDKLMYNLLMEYVSGGSLHDLIKNSGGKLPEPLIRSYTRQILKGLMYLHDQGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN+++  + +  KI DLGC K +E  E   +  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDVKSQNVMIGGEIA--KIVDLGCAKTVEENE---NLEFSGTPAFMSPEVARGEEQSF  178

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GCTVIEMATGS+PW ++ND V+A+Y+I  +G+ P  P W S+  ++FL KCL 
Sbjct  179   PADVWALGCTVIEMATGSSPWPELNDVVAAIYKIGFTGESPVIPVWLSEKGQDFLRKCLR  238

Query  774   RDAKRRWTAAELLQHPFLQSISSNS-VTFKEFVRNSPTSVMDQAVWNSIEMSQ-------  929
             +D K+RWT  ELLQHPFL    ++S  T      +SP++V+DQ  W+  E S+       
Sbjct  239   KDPKQRWTVEELLQHPFLDEEDNDSDQTGNCLNSSSPSTVLDQRFWDLCETSRSRFIKED  298

Query  930   ---PSCNSTA----TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRG------NEEDES  1070
                P  NST         P +RI +L        PDWE + GW+ VRG       EEDE+
Sbjct  299   HEDPFANSTNFLWDDDSLPGDRIKKLAGDESSGEPDWETN-GWIEVRGEIEKRNEEEDEN  357



>ref|XP_006389580.1| hypothetical protein POPTR_0021s00300g, partial [Populus trichocarpa]
 gb|ERP48494.1| hypothetical protein POPTR_0021s00300g, partial [Populus trichocarpa]
Length=364

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 229/349 (66%), Gaps = 18/349 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSATVS+A  A  SG  FAVKSA L  S  LQRE+ ILS    P +V 
Sbjct  1     MDWTRGQTIGHGSSATVSMA-KANRSGQVFAVKSAELLKSESLQREQSILSTLKCPQIVV  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR--FSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+    YNLFLEY+ GGTL D  + G     E MI+ YA  IL+G+ +LH  
Sbjct  60    YKGCDITNENGKLFYNLFLEYISGGTLIDAIREGGGCLDEAMIRLYARTILLGLEYLHCN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE---NGEASSSSA-FSGTPAFMAPEVAK  575
             G VHCDIKG NILV+ D    KIADLGC K ++    G A  ++A  +GTP +MAPEVA+
Sbjct  120   GIVHCDIKGHNILVTGD--GAKIADLGCAKRVDEVSGGTALKTTAPIAGTPLYMAPEVAR  177

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GE QGFPADIW+ GCTV+EMATG APW +++DPVSALY+I  SG+VPE P + S  AK+F
Sbjct  178   GEHQGFPADIWSVGCTVVEMATGQAPWVNVSDPVSALYQIGFSGNVPEIPSFMSKQAKDF  237

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR----NSPTSVMDQAVWNSIEM  923
             L KCL RD   RW+A+ELL+H F+    +++   KE +     ++PT V+DQ +W+SIE 
Sbjct  238   LSKCLKRDPGERWSASELLKHDFITEEPNSA--LKEIISSTNVDTPTCVLDQVLWDSIEE  295

Query  924   SQPS--CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEED  1064
              + +   +  + +  P  RI +L    GE +P+W  D  W+TVR NE++
Sbjct  296   LETTWDLSQESHSVSPVERIKQLTEGHGE-VPNWSWDDTWITVRSNEQE  343



>ref|XP_002869589.1| hypothetical protein ARALYDRAFT_492112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45848.1| hypothetical protein ARALYDRAFT_492112 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 233/357 (65%), Gaps = 30/357 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RG  IGRGS+ATVS+A ++  SG  FAVKSA LSSS  LQ+E+  LS   SP++VK
Sbjct  3     INWKRGQIIGRGSTATVSVAISS--SGEIFAVKSADLSSSSFLQKEQSFLSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E++  +YN+ +EYV GG+L DL K   G+  EP I+ +  QIL G+ +LH  
Sbjct  61    YIGSGLTYENDRLVYNILMEYVSGGSLHDLIKNSGGKLPEPEIRSHTRQILNGLVYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+   +KIAD+GC K      +   S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVEEN-GVLKIADMGCAK------SVGKSGFSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTVIEM TGS PW ++ND V+A+Y+I  SG+ PE P W S+ AK+FL  C
Sbjct  174   RFPADVWALGCTVIEMMTGSNPWPELNDVVAAMYKIGFSGESPEIPGWISEKAKDFLNNC  233

Query  768   LDRDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ--  929
             L  D K+RWT  ELL+H FL    +S +S+ +  K    +SP++V+DQ  W+S E S+  
Sbjct  234   LKEDPKQRWTVEELLKHSFLNDEEESQTSDCLKNK---TSSPSTVLDQRFWDSCETSKTH  290

Query  930   --------PSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRGNEEDES  1070
                     P  + + + G PA RI +L       LPDW  EED GW+ VRG+E +E+
Sbjct  291   LISMDHEDPFADYSESWGSPAKRIEKLAGDEFLSLPDWVTEEDDGWIQVRGDEYEET  347



>ref|XP_010451165.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=447

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 184/399 (46%), Positives = 250/399 (63%), Gaps = 32/399 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGP IGRGS+ATVS+A +   SG  FAVKS+ LSSS  LQ+E+ ILS   SP++VK
Sbjct  3     MNWTRGPIIGRGSTATVSIAISN--SGEIFAVKSSELSSSTFLQKEQSILSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E +  +YN+ +EYV GG+L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGSGLTREKDGLVYNILMEYVSGGSLHDLIKNSGGKLPEPAIRSYTRQILNGLMYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+   +KIAD+GC K +  GE    S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVEEN-GVLKIADMGCAKTV-GGE----SEFSGTPAFMAPEVARGEEQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+W  GCTV+EM TGS+PW ++ND V+A+Y+I  SG+ PE P   S+ AK+FL  C
Sbjct  175   RFPADVWGLGCTVMEMMTGSSPWPELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFLVSC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE---------  920
              ++D K+RWT  ELL+HPFL + SS  +  K    +SP++V+DQ  W+S E         
Sbjct  235   FEKDPKQRWTVQELLKHPFLDNESSECLNKK---TSSPSTVLDQHFWDSCEEVSKSHLIS  291

Query  921   --MSQPSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRGNEEDESTDSEPI  1088
                  P    + +   PA+RI +L       L DW  E+DGGW  VRG+E +E+ + +  
Sbjct  292   MDHEDPFAGYSESWDSPADRIKKLAGDDNSSLLDWDREDDGGWCQVRGDEHEETEEGDGD  351

Query  1089  LISILCPEDLESSIVNEAPSFDSSDD----EISVNDRVN  1193
                ++C E   SS   E   ++S+ D    E S +D +N
Sbjct  352   Q-DVICVEATSSS-TEEVGDWNSNQDSLFLEYSSDDIIN  388



>ref|XP_006364160.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=334

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 222/335 (66%), Gaps = 8/335 (2%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GS+A VS+A +   S   FAVKS  LS S +LQ+E+ ILSQ  S YVV 
Sbjct  1     MDWTRGQTIGHGSTAAVSVAKSR-FSDEVFAVKSVELSQSQLLQKEQKILSQLSSSYVVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E++  ++NL +EY+P GTLSD  ++  GR +EP+I +Y  QIL G+ +LHS 
Sbjct  60    YKGYDVTKENDKLMFNLMMEYMPDGTLSDEIRKQGGRINEPLIGYYTKQILKGLEYLHSG  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEA-SSSSAFSGTPAFMAPEVAKGEE  584
             G  HCDIKGQNIL+ +  +  KIAD GC ++++  E    +    GTP FMAPEVA+GEE
Sbjct  120   GIAHCDIKGQNILLGK--TGAKIADFGCARWIDPAERDGGAEPIGGTPMFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG PADIW  GCT+IEM TG +PW ++ +  S LY+IA SG  PE P++ S  A++FL K
Sbjct  178   QGCPADIWGLGCTIIEMVTGGSPWTNVTNAASLLYKIAFSGQSPEIPKFLSLQARDFLSK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RD K RW A +LL+H FL+  + NS + + FV +SPTS++DQ +WNS+E S+ +   
Sbjct  238   CLRRDPKERWIAKQLLKHTFLEEFNLNSNSNQNFVTSSPTSILDQDIWNSVEESETTILQ  297

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
             T ++  P  R+  L   +GE    W +D  W+T+R
Sbjct  298   TGSS--PLQRVRELCSNSGELNWRWNDDERWITIR  330



>ref|XP_010916795.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Elaeis guineensis]
Length=508

 Score =   330 bits (847),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 224/343 (65%), Gaps = 14/343 (4%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RG TIGRGSSATVSLAT + ASG  FAVKSA LS +G+LQRE+ IL+   SP+VV  
Sbjct  5     EWYRGRTIGRGSSATVSLATTS-ASGEVFAVKSAELSRAGLLQREQRILANLSSPHVVSY  63

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG DI+ E N   YNLF+EY   G+LSD  K+  GR  E  I+ Y+ QIL G+ +LHS  
Sbjct  64    LGFDITSETNGVYYNLFMEYAARGSLSDEIKKEGGRLDELAIRSYSCQILHGLAYLHSNS  123

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
               HCD+KGQN+L+  D  A+ IADLGC +++ +  +       GTP +MAPE A+GEEQG
Sbjct  124   IAHCDVKGQNVLIGSDGRAM-IADLGCARWMADDHSRDCLQLRGTPMYMAPEAARGEEQG  182

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
              PAD+WA GCTV+EMATG APW +++DP++AL+RIA S DVPE P W SD+ K+FL KC 
Sbjct  183   TPADVWALGCTVVEMATGRAPWPEVSDPIAALHRIAFSTDVPELPSWISDEGKDFLDKCF  242

Query  771   DRDAKRRWTAAELLQHPFLQSIS---SNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
              RD   RW+A +LL+HPF+ S +   SNS + ++++  SP S +DQA W SI   +    
Sbjct  243   RRDPDERWSAEQLLKHPFVASSANCLSNSNSTEKWI--SPKSTLDQAFWESISDEEEEDE  300

Query  942   STATAGF-----PANRIGRLIIQAGERLPDWEEDGGWVTVRGN  1055
                         P+ RI  L   AG  +PDW  D  W+T+R +
Sbjct  301   EELDKLENPSNDPSQRIQLLAAAAGVDVPDWTWDDSWMTIRAD  343



>ref|XP_010089475.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB37868.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=406

 Score =   326 bits (836),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 236/345 (68%), Gaps = 11/345 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IGRGSSATVS+AT++  SG  FAVKSA LS S  LQRE+ ILS  +SP+VV 
Sbjct  1     MDWNRGQIIGRGSSATVSVATSS-ISGEIFAVKSAELSQSEALQREQKILSSLNSPHVVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRGRFSEPMIQFYAHQILMGIGFLHSMG  410
              +G D++ E+++ +YNL +EYVPGGTL+D L ++ R  E  I  Y  +I+ G+ +LHS+G
Sbjct  60    YIGHDVTRENSHLVYNLLIEYVPGGTLNDALRRKKRPDEAAIGRYTRKIVQGLEYLHSLG  119

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCDIKG NIL++E  +  KIAD GC ++  +G+       SGTP FMAPE A+GE QG
Sbjct  120   LVHCDIKGANILMAE--TGPKIADFGCARWANSGD--EERPISGTPTFMAPEAARGEHQG  175

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
                D+W+ GCT+IEMA+G++PW +  DPVS LYR+A SG+ PEFP + S+ A++FLGKCL
Sbjct  176   CAGDVWSLGCTIIEMASGNSPWSNSGDPVSVLYRVAYSGETPEFPSFLSEKAEDFLGKCL  235

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-MSQPSCNST  947
              R+ + RWTA++LL+HPFL+ +S   V   +    SPTS++DQ +WN +E  +  S   T
Sbjct  236   RRNPEERWTASQLLKHPFLEELSLTEVKESD-SSCSPTSILDQGIWNCLEDHTSESFGGT  294

Query  948   ATAGFPANRIGRLIIQAGERLPDWEE-DGGWVTVRGNEEDESTDS  1079
              +  +  +RIG+L + +GE    W   D  WVT+R + ++++  S
Sbjct  295   RSGNWAVDRIGKLALFSGE--VTWTSGDQSWVTIRSDNDEQNNSS  337



>ref|XP_002302871.2| hypothetical protein POPTR_0002s21350g [Populus trichocarpa]
 gb|EEE82144.2| hypothetical protein POPTR_0002s21350g [Populus trichocarpa]
Length=409

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/393 (46%), Positives = 245/393 (62%), Gaps = 34/393 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG +IG GS+ATVSLAT+   SG  FAVKS  L  SG LQRE+ ILS   SP++V 
Sbjct  1     MDWTRGHSIGHGSTATVSLATSI-QSGDVFAVKSVELFQSGFLQREQQILSSLTSPFIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E++  +YNLFLEY+P GTLS+   A  GR  EP+I+ Y  Q+L G+ ++H  
Sbjct  60    YRGCDITRENSKVMYNLFLEYMPNGTLSNAIHAHGGRLDEPLIRNYTSQVLQGLDYIHLN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK  NILV    S  KIAD GC K +E          +GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKSSNILVGP--SGAKIADFGCAKRVEQ-----VGQIAGTPMFMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF +DIWA GC +IEMA+GS PW ++NDPVS +YR+  SG +P+FP   S+ A++ L KC
Sbjct  173   GFASDIWALGCAIIEMASGSTPWHNVNDPVSIIYRVGYSGHLPDFPCCLSEQARDLLDKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEF-----VRNSPTSVMDQAVWNSIEMSQ-  929
             L RD + RWTA++LL+HPFL   S++    K+        NSPTS++DQ  WNS+++S+ 
Sbjct  233   LRRDPRERWTASQLLKHPFLVGESNSHHVAKQIQESNSSSNSPTSILDQCFWNSLDLSES  292

Query  930   --------PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEP  1085
                     PS  S+A       RI  L + +G  +P W+ D  W T+RG+  +E    + 
Sbjct  293   LNNLVSVPPSRESSA-----GERIRGLSLLSG--MPRWDWDESWTTIRGDSREE---RDA  342

Query  1086  ILISILCPEDLESSIVNEAPSFDSSDDEISVND  1184
             I+  I   +D+ S  + E  S+  S + +++ D
Sbjct  343   IMDCIEVKDDIVSCGLGEQKSYGGSKELLNLLD  375



>gb|KDP24854.1| hypothetical protein JCGZ_24448 [Jatropha curcas]
Length=421

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 231/355 (65%), Gaps = 19/355 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GS+ATVSLAT+   SG+ FAVKSA L  S  LQRE+ ILS  +SPY+V 
Sbjct  1     MDWTRGHTIGHGSTATVSLATSL-QSGNVFAVKSAELFQSEFLQREQKILSSLNSPYIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG------RFSEPMIQFYAHQILMGIGF  395
               GC+I+ EHN  +YNL LEY+ GGTL D  K        R  E +I +Y  QI+ G+ +
Sbjct  60    YRGCEITKEHNKVMYNLLLEYMSGGTLIDAVKAHGGGDGRRIEESVIGYYTCQIVKGLDY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             LHS G VHCDIKG+NILV E     KIAD GC K ++  E +   +  GTP FMAPEVA+
Sbjct  120   LHSSGLVHCDIKGRNILVGE--KGAKIADFGCAKRIDPVEPADKIS-GGTPMFMAPEVAR  176

Query  576   GEEQGFPADIWAFGCTVIEMATGS-APWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKE  752
             G+EQ F +DIWA GCT+IEMATG  APW ++ND VS +YRI  S ++PEFP W S+  K+
Sbjct  177   GDEQSFASDIWALGCTIIEMATGGGAPWVNVNDAVSVIYRIGFSDELPEFPCWLSEQGKD  236

Query  753   FLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKE--FVRNSPTSVMDQAVWNSIEMS  926
             FL KCL RD K RWTA +LL HPFL+S +SN    +E     NSPTS++DQ  WNS++  
Sbjct  237   FLDKCLRRDPKERWTAKQLLTHPFLESFNSNVKQIQESNSSSNSPTSILDQGFWNSLDEL  296

Query  927   QPSCNSTATAGFPAN---RIGRLIIQAGERLPDWEEDG--GWVTVRGNEEDESTD  1076
             +P   ++      ++   RI RL + + E  P +++D    W+++RGN + E  D
Sbjct  297   EPESETSENLDHKSSASERIRRLCLVSSEG-PSYDDDDDENWISIRGNCKIEDKD  350



>ref|XP_006364162.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=336

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 221/336 (66%), Gaps = 9/336 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIG GSSA V  A  +  SG  FAVKS  LS S +LQ+E+ ILS+  SPY+V 
Sbjct  1     MDWIRGHTIGHGSSAAV-WAAKSRFSGEVFAVKSVELSKSQLLQKEQKILSELSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E    ++NL +EY+P GTLSD  ++  G  +EP+I +Y  QI+ G+ +LHS 
Sbjct  60    YKGYDVTKEKEKLMFNLMMEYMPDGTLSDEIRKQDGWVNEPLIGYYTKQIVQGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEA-SSSSAFSGTPAFMAPEVAKGEE  584
             G  HCDIKGQNIL+S+  +  KI D GC ++++       ++   GTP FMAPEVA+GEE
Sbjct  120   GIAHCDIKGQNILLSK--TGAKITDFGCSRWVDPANMDGGANPIGGTPMFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG PADIW  GCT+IEMATG +PW ++ +  S LY+IA SG  PE P+  S  A++FL K
Sbjct  178   QGCPADIWGLGCTIIEMATGGSPWTNVTNSASLLYKIAFSGQSPEIPKILSLQARDFLNK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSV-TFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
             CL RD + RWTA ELL+HPFL+  + NS  T + FV  SPTS++DQ +WNS+E S+ +  
Sbjct  238   CLIRDPRERWTAKELLKHPFLEESNLNSTSTNQNFVTRSPTSILDQDIWNSVEESETTIL  297

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
              T ++  P  R+  L   +GE    W +D  W+TVR
Sbjct  298   QTVSS--PLRRLRDLSSNSGELNWRWNDDQMWITVR  331



>ref|XP_010926215.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Elaeis guineensis]
Length=503

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 230/344 (67%), Gaps = 17/344 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W RG TIGRGSSATVSLAT    SG  FAVKSA LS +G+LQRE+ ILS  +SP+VV  
Sbjct  5     QWCRGRTIGRGSSATVSLATVP-VSGEVFAVKSAELSRAGLLQREQRILSNLNSPHVVSY  63

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG D++ E N   YNLF+EY   G+LSD  K+  GR  EP I+ Y++QIL+G+ +LHS  
Sbjct  64    LGFDVTSEKNGLYYNLFMEYAARGSLSDEIKKQGGRLDEPTIRSYSYQILLGLDYLHSSR  123

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFL----ENGEASSSSAFSGTPAFMAPEVAKG  578
               HCD+KGQN+L+  D  A+ IADLGC +++    +  +  +     GTP FMAPEVA+G
Sbjct  124   IAHCDVKGQNVLIGSDGRAM-IADLGCARWVAGDKDGYDDDNGLQLRGTPMFMAPEVARG  182

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG PADIWA GCT++EMATG APW +++DP++AL+RIA S DVPE P W SD+ K+FL
Sbjct  183   EEQGIPADIWALGCTIVEMATGQAPWPEVSDPIAALHRIAFSSDVPELPSWISDEGKDFL  242

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN--SPTSVMDQAVWNSIE---M  923
              +CL RD K RWTA +LL+HPF+ S S+N ++  +  R   SP S +DQA W S      
Sbjct  243   DRCLRRDPKERWTAEQLLKHPFVAS-SANCLSNSDSTRKWISPKSTLDQAFWESFSDEYE  301

Query  924   SQPSCNSTATAGFPANRIGRLIIQAGERL--PDWEEDGGWVTVR  1049
              +       ++  P +RI +L++  G  +  P+W  D  W+T+R
Sbjct  302   EEEEEEEGNSSNDPLDRI-QLLVGGGGTVSGPNWTWDDTWMTIR  344



>ref|XP_003539499.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=396

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 232/361 (64%), Gaps = 20/361 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHL--SSSGMLQREKDILSQFDSPYV  227
             MEW RG  IGRGSSATV  AT++ +S    AVKSA L  S+S  LQRE+ ILS   SP++
Sbjct  1     MEWTRGFIIGRGSSATVYTATSSHSSTVA-AVKSAELTLSNSEQLQREQRILSSLFSPHI  59

Query  228   VKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             V   GC+I+ ++N   +NLF+EY+P GTLS  + R  GR SEP   +Y  Q+L G+ +LH
Sbjct  60    VTYKGCNITEDNNTLWFNLFMEYMPFGTLSQESHRHGGRLSEPATVYYTRQVLQGLQYLH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             + G VHCDIKG NIL+ ED    KI D GC KF  +    SS+   GTP FMAPEVA+GE
Sbjct  120   NKGVVHCDIKGGNILIGED--GAKIGDFGCAKFAND----SSAVIGGTPMFMAPEVARGE  173

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQG+PAD+WA GCTV+EMATG APW ++ DPV+ LYR+A S DVPE P + S++AK+FLG
Sbjct  174   EQGYPADVWALGCTVLEMATGFAPWPNVEDPVTVLYRVAYSDDVPEIPCFLSEEAKDFLG  233

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC-  938
             KC  R+ K RW+  +LL+HP L   SSN    +E    SPTS+++Q  WNS+E ++  C 
Sbjct  234   KCFRRNPKERWSCGQLLKHPLLGEFSSNDKKIQESNSCSPTSILEQGFWNSMEEAEVECV  293

Query  939   ----NSTATAGF---PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILIS  1097
                 N      F   P  RI RL   +G+ + +  +D  W+T RG+E   S+  + + + 
Sbjct  294   SASANVVQVKSFEDSPRGRIRRLASCSGDPIGEL-DDENWITARGSEMGASSSCDGLDLD  352

Query  1098  I  1100
             +
Sbjct  353   V  353



>ref|XP_004243853.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=326

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 221/335 (66%), Gaps = 15/335 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIG GS+A VS A  +  SG  FAVKS  LS S +LQ+E+ ILS+  SPY+V+
Sbjct  1     MDWIRGNTIGHGSTAAVS-AAKSRFSGEVFAVKSVELSKSQLLQKEQKILSELISPYIVR  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E +  ++NL +EY+P GTLS+  ++  GR +EP+I +Y  QI+ G+ +LHS 
Sbjct  60    YKGYDVTKEKDKLMFNLRMEYMPDGTLSNEIRKQGGRMNEPLIGYYTKQIVQGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEA-SSSSAFSGTPAFMAPEVAKGEE  584
             G  HCDIKGQNIL+ E  +  K+AD GC ++++  E    +++  GTP FMAPEVA+GEE
Sbjct  120   GVAHCDIKGQNILLGE--TGAKLADFGCSRWIDPAERDGGANSIGGTPMFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGF ADIW  GCT+IEMATG +PW ++ +  S LY+IA S   PE P++ S  A++FL K
Sbjct  178   QGFAADIWGVGCTMIEMATGGSPWNNVTNAASLLYKIAFSEQSPEIPKFLSSQARDFLNK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RD + RWTA +LL+HPFL+   SNS   + FV +SPTS++DQ +WNS          
Sbjct  238   CLRRDCEERWTAKQLLKHPFLE---SNSTIIQNFVTSSPTSILDQDIWNS------ETTI  288

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
               T   P  R+  LI  +GE    W +D  W+TVR
Sbjct  289   LETVICPVQRVRELISDSGELNCRWTDDERWMTVR  323



>ref|XP_004289177.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Fragaria vesca subsp. vesca]
Length=415

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 234/354 (66%), Gaps = 23/354 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGSSA VSLAT  G+    FAVKSA LS S  LQRE+ ILS    P+VV 
Sbjct  1     MDWTRGQTIGRGSSAVVSLAT--GSCSKVFAVKSAELSQSEFLQREQKILSTLSCPHVVS  58

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LG DI+ E+N  +YN+F+EYV GGT+ D  +   G+  E  ++FY  +I  G+ +LHS+
Sbjct  59    YLGHDITRENNKLMYNIFMEYVAGGTIIDAIRNCGGQLEESAVRFYTREIAKGLAYLHSV  118

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+NILV E+   +KIAD GC ++ +   A+ +    GTP FM+PEVA+GEEQ
Sbjct  119   GLVHCDIKGRNILVGEE--GLKIADFGCARWAD--PAAEAVPIGGTPMFMSPEVARGEEQ  174

Query  588   GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GFP D+WA GCTVIEMATG S PW +  DPV+ LYRIA SG+ PE P + SD A++FLGK
Sbjct  175   GFPCDVWALGCTVIEMATGGSVPWPNAADPVTLLYRIAYSGESPEIPSFLSDQARDFLGK  234

Query  765   CLDRDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRN------SPTSVMDQAVWNSIEM  923
             C  RD K RWT  +LL+HPFL +++  NS +  + V+       SPTS++DQ +WNS++ 
Sbjct  235   CFMRDPKERWTVTQLLKHPFLAETMIINSASTTKQVQESTSTSFSPTSILDQGIWNSLQE  294

Query  924   SQPSCN----STATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVRGNEEDES  1070
             SQ   N     +     P +RI RL + +G  +P W  D G W+ VRGN+  ES
Sbjct  295   SQTLGNLVDHPSVENSCPDDRIRRLSLFSG--MPRWSSDEGYWIAVRGNDCGES  346



>ref|XP_009144845.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1 
[Brassica rapa]
Length=458

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 223/348 (64%), Gaps = 25/348 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ATVS  TA   SG  FAVKSA  SSS +LQ E+ +LS   SP++VK
Sbjct  3     ITWTRGPVIGRGSTATVS--TAISNSGEMFAVKSADFSSSAILQNEQSVLSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G D++ E +  +YNL +EYV GG+L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGSDVTPEKDGLVYNLLMEYVSGGSLHDLIKNAGGKLPEPAIRSYTRQILRGLSYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+    KIAD+GC K + N      S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVEENGVVCKIADMGCAKPVLN------SGFSGTPAFMAPEVARGEEQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTVIEM TGS+PWQ++ND V+A+Y+I  SG+ PE P + S+  K+FL  C
Sbjct  175   RFPADVWALGCTVIEMMTGSSPWQELNDVVAAMYKIGFSGESPEIPEFISEKGKDFLMNC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ------  929
             L+ D K+RWT  ELL+HPFL       V       +SP++V+DQ  WNS E S+      
Sbjct  235   LENDPKQRWTVEELLKHPFLD---DEDVESHLQSSSSPSTVLDQRFWNSGEASKSHLLSM  291

Query  930   ----PSCNSTATAGFPANRIGRLIIQAGERLPDWEE--DGGWVTVRGN  1055
                 P  + +     PA+RI +L       +PDW+   DG W+ VRG+
Sbjct  292   DHEDPFADYSGAWDSPADRIEQLAGDEFSSVPDWDTVGDGEWIQVRGD  339



>ref|XP_011008032.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Populus euphratica]
Length=539

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 233/354 (66%), Gaps = 17/354 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSATVS+A A+  SG  FAVKSA L  S  LQRE+ ILS    P +V 
Sbjct  1     MDWTRGQTIGHGSSATVSMAKAS-QSGQVFAVKSAELLKSESLQREQSILSTLKCPQIVV  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR--FSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+    YNLFLEY+ GGTL D  + G     E MI+ YA  IL+G+ +LH  
Sbjct  60    YKGCDITNENGKLFYNLFLEYISGGTLIDAIREGGGCLDEAMIRLYARTILLGLEYLHCN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE---NGEASSSSAFSGTPAFMAPEVAKG  578
             G VHCDIKG NILV+ D    KIADLGC K ++     + ++++  +GTP +MAPEVA+G
Sbjct  120   GIVHCDIKGHNILVTGD--GAKIADLGCAKRVDEVSGDDLNTTAPIAGTPLYMAPEVARG  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QGFPADIW+ GCTV+EMATG APW D++DPVSALY+I  SG+VPE P + S  AK+FL
Sbjct  178   EHQGFPADIWSVGCTVVEMATGQAPWVDVSDPVSALYQIGFSGNVPEIPSFMSKQAKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR----NSPTSVMDQAVWNSIEMS  926
              KCL RD   RW+A+ELL+H F+    +++  FKE +     ++PT V+DQ +W+SIE  
Sbjct  238   SKCLKRDPGERWSASELLKHDFITEEPNSA--FKEIISSTNLDTPTCVLDQVLWDSIEEL  295

Query  927   QPS--CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSE  1082
             + +   +  + +  P  RI +L    GE +P+W  D  W+TVR NE++    SE
Sbjct  296   ETTWDLSHESPSVSPVERIKQLTEGNGE-VPNWSWDDNWITVRSNEQETVPCSE  348



>emb|CDX97370.1| BnaC08g12350D [Brassica napus]
Length=403

 Score =   324 bits (830),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 226/348 (65%), Gaps = 23/348 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGPTIGRGS+ATVS+AT+   SG  FAVKSA +SSS  LQ+E+ ILS   SP++VK
Sbjct  3     VTWTRGPTIGRGSTATVSIATSN--SGEIFAVKSADISSSAFLQKEQSILSTLSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++CE++  +YN+ +EYV GG+L  L K   G+  EP I+ +  QIL G+ +LH  
Sbjct  61    YIGSSLTCENDRLVYNILVEYVSGGSLHSLIKNSGGKLPEPAIRSHTRQILKGLKYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+    KIADLGC K + N      S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDVKSQNVLVGENGVVSKIADLGCAKPVFN------SGFSGTPAFMAPEVARGEEQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTVIEM TGS+PW ++ + V+ +Y+I  SG+ PE P   S+  K+F  +C
Sbjct  175   RFPADVWALGCTVIEMMTGSSPWPELTEAVAGIYKIGFSGESPEIPEGISEKGKDFGMRC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L  D K+RWT  ELL+HPFL    S S+ + +   +SP++V+DQ  W+S E S+    S 
Sbjct  235   LKVDPKQRWTVEELLKHPFLDDEESQSIGYLQNT-SSPSTVLDQRFWSSCEASKDHSFSM  293

Query  948   ----ATAGF------PANRIGRLIIQAGERLPDWE--EDGGWVTVRGN  1055
                   AG+      PA+RI RL        P W+  +DG W+ VRGN
Sbjct  294   DHEDPFAGYSDPWRSPADRIERLAGDEVTTAPIWDPADDGEWIQVRGN  341



>ref|XP_003541951.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=398

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 229/355 (65%), Gaps = 24/355 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHL--SSSGMLQREKDILSQFDSPYV  227
             MEW RG  IGRGSSATV   T++ +S    AVKSA L  S+S  LQRE+ ILS   SP++
Sbjct  1     MEWTRGFIIGRGSSATVYTVTSSHSSTVA-AVKSAELTLSNSEQLQREQRILSCLFSPHI  59

Query  228   VKCLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGF  395
             V   GC+I+ + NN L +NLF+EY+P GTLS    R   GR SEP    Y  Q+L G+ +
Sbjct  60    VTYKGCNITEDKNNTLWFNLFMEYMPFGTLSQEIHRRGGGRLSEPATVHYTRQVLQGLEY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             LH+ G VHCDIKG NIL+ ED    KI D GC KF  +    SS+   GTP FMAPEVA+
Sbjct  120   LHNNGVVHCDIKGGNILIGED--GAKIGDFGCAKFAND----SSAVIGGTPMFMAPEVAR  173

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GEEQG+PAD+WA GCTV+EMATG APW ++ DPV+ LY +A S DVPE P + S++AK+F
Sbjct  174   GEEQGYPADVWALGCTVLEMATGFAPWPNVEDPVTVLYHVAYSDDVPEIPCFLSEEAKDF  233

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
             LGKC  R+ K RW+ ++LL+HPFL   SSN    +E    SPTS+++Q  WNS+E ++  
Sbjct  234   LGKCFRRNPKERWSCSQLLKHPFLGEFSSNDKEIQESNSCSPTSILEQRFWNSVEEAEAE  293

Query  936   C-----NSTATAGF---PANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDEST  1073
             C     N      F   P +R+  L + +G+  P WE +D  W+T RG+E   S+
Sbjct  294   CVSVSGNVVQIKSFEDSPMDRVRSLALSSGD--PFWELDDENWITTRGSEAGASS  346



>gb|AAL87297.1| unknown protein [Arabidopsis thaliana]
Length=394

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 252/402 (63%), Gaps = 40/402 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ATVS+A ++  SG  FAVKSA LSSS +LQ+E+ ILS   SP++VK
Sbjct  3     INWTRGPIIGRGSTATVSIAISS--SGELFAVKSADLSSSSLLQKEQSILSTLSSPHMVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E N  +YN+ +EYV GG L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGTGLTRESNGLVYNILMEYVSGGNLHDLIKNSGGKLPEPEIRSYTRQILNGLVYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K  N+LV E+   +KIAD+GC K ++  E      FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSHNVLVEEN-GVLKIADMGCAKSVDKSE------FSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCT+IEM TGS+PW ++ND V+A+Y+I  SG+ P  P W SD AK+FL  C
Sbjct  174   RFPADVWALGCTMIEMMTGSSPWPELNDVVAAMYKIGFSGESPAIPAWISDKAKDFLKNC  233

Query  768   LDRDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ--  929
             L  D K+RWT  ELL+HPFL    +S +S+ +  K    +SP++V+DQ  W+S E S+  
Sbjct  234   LKEDQKQRWTVEELLKHPFLDDDEESQTSDCLKNK---TSSPSTVLDQRFWDSCESSKSH  290

Query  930   --------PSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRG--NEEDEST  1073
                     P    + +   PA+RI +L       L DW  E+DGGW+ VRG  ++E E  
Sbjct  291   LVSIDHEDPFAEYSESLDSPADRIEKLAGDEFSSLLDWDTEDDGGWIQVRGEKHKETEKR  350

Query  1074  DSEPILISILCP------EDLESSIVNEAPSFD--SSDDEIS  1175
             D +  +I +         E++E  I N+   F   SSDD I+
Sbjct  351   DGDEDVICVEATSSSQTIEEVEDWISNQDSLFSEYSSDDIIN  392



>ref|XP_007026132.1| Mitogen-activated protein kinase kinase kinase 15, putative [Theobroma 
cacao]
 gb|EOY28754.1| Mitogen-activated protein kinase kinase kinase 15, putative [Theobroma 
cacao]
Length=482

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 227/350 (65%), Gaps = 27/350 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIGRGS+ATVS+ATA   SG  FAVKS  LS S  L+RE+ ILS    P V+ 
Sbjct  1     MEWTRGRTIGRGSTATVSIATA-DQSGDVFAVKSCELSQSESLRREQRILSTLSCPRVLA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             C GCDIS E+   +YNL LEY PGGT++D  ++  GR  E M++ Y   IL G+ FLHS 
Sbjct  60    CKGCDISSENGMLVYNLLLEYAPGGTITDAIQKQGGRLDEAMVRSYTRGILQGLEFLHSS  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+N+LV++D   VKIADLGC +  +    ++ S  +GTP +MAPEVA+GE+Q
Sbjct  120   GIVHCDIKGRNVLVTDD--GVKIADLGCARRADVVPGAAWSV-AGTPVYMAPEVARGEQQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GFPAD+WA GCTVIEMATG APW D+ DPVSALYRI  S D+PE P   S  AK+FL KC
Sbjct  177   GFPADVWALGCTVIEMATGRAPWPDVGDPVSALYRIGFSRDMPEIPSDLSKQAKDFLSKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNS  944
             L RD   RWTA +LL H F++ + +  +   +    ++PT+V++  +W+S+E        
Sbjct  237   LRRDPVERWTATQLLAHDFVKEMKAPPIKGTDGSELSTPTTVLNLQLWDSME-------E  289

Query  945   TATAGFPA--NRIGRLII----QAGE-------RLPDWEEDGGWVTVRGN  1055
               T   P+  NR+ ++I+    Q GE        +P WE D  WVTVR N
Sbjct  290   LETIHIPSRKNRLSKIIMERIQQLGETNLVSSSEMPVWEWDENWVTVRSN  339



>gb|KHN44865.1| Mitogen-activated protein kinase kinase kinase A [Glycine soja]
Length=393

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 227/359 (63%), Gaps = 19/359 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  IGRGSSATV  AT++ +S    A     LS+S  LQRE+ ILS   SP++V 
Sbjct  1     MEWTRGFIIGRGSSATVYTATSSHSS--TVAAAELTLSNSEQLQREQRILSSLFSPHIVT  58

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GC+I+ ++N   +NLF+EY+P GTLS    R  GR SEP   +Y  Q+L G+ +LH+ 
Sbjct  59    YKGCNITEDNNTLWFNLFMEYMPFGTLSQEIHRHGGRLSEPATVYYTRQVLQGLEYLHNN  118

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NIL+ ED    KI D GC KF  +    SS+   GTP FMAPEVA+GEEQ
Sbjct  119   GVVHCDIKGGNILIGED--GAKIGDFGCAKFAND----SSAVIGGTPMFMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G+PAD+WA GCTV+EMATG APW ++ DPV+ LYR+A S DVPE P + S++AK+FLGKC
Sbjct  173   GYPADVWALGCTVLEMATGFAPWPNVEDPVTVLYRVAYSDDVPEIPCFLSEEAKDFLGKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC---  938
               R+ K RW+  +LL+HP L   SSN    +E    SPTS+++Q  WNS+E ++  C   
Sbjct  233   FRRNPKERWSCGQLLKHPLLGEFSSNDKKIQESNSCSPTSILEQGFWNSMEEAEVECVSA  292

Query  939   --NSTATAGF---PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISI  1100
               N      F   P  RI RL   +G+ + +  +D  W+T RG+E   S+  + + + +
Sbjct  293   SANVVQVKSFEDSPRGRIRRLASCSGDPIGEL-DDENWITARGSETGASSSCDGLDLDV  350



>ref|XP_009796297.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Nicotiana sylvestris]
Length=412

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 178/414 (43%), Positives = 254/414 (61%), Gaps = 26/414 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GSSA VS+A +  +S   FAVKS  LS S  LQ+E+ +LS   SPY+V 
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSRWSS-EIFAVKSVELSQSQFLQKEQKVLSALSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+N  ++NL +EY+  GT++D  ++  GR +EP+I +Y  QIL+G+ +LHS 
Sbjct  60    YKGYDVTKENNTVMFNLMMEYMSEGTIADEIRKNGGRINEPVIGYYTKQILLGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE---ASSSSAFSGTPAFMAPEVAKG  578
             G VHCDIKGQNIL+ +  +  KIAD GC ++++  E    +S+    GTP +MAPEVA+G
Sbjct  120   GVVHCDIKGQNILLGK--TGAKIADFGCARWVDTAERDGGASAQPIGGTPMYMAPEVARG  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQGF ADIW  GCT+IEMATG +PW ++ +  S LY+IA SG  PE P++ S  AK+FL
Sbjct  178   EEQGFAADIWGLGCTIIEMATGGSPWTNVTNSASLLYKIAFSGQSPEIPKFLSLQAKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEF---VRNSPTSVMDQAVWNSIEMSQ  929
              KC  RD K RWTA +LL+HPFL+ IS+    FKE    + +SPTS++DQ +WNS+E ++
Sbjct  238   SKCFRRDQKERWTAKQLLKHPFLEEISN----FKEIQDSITSSPTSILDQDIWNSVEETE  293

Query  930   PSCNST----ATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDESTDSEPILI  1094
                ++T     +   P  R+ +L + +  R P+W  +D  W TVR N +    D +  + 
Sbjct  294   TMDSTTIQLETSIDSPLQRVRKLGLNS--RKPNWRWDDEIWTTVRLNSKQNEGDDDLEVC  351

Query  1095  SILCPEDLESSIVNEAPSFDSSDDEISVNDRV---NPRTNLDLSCHNFTDAFVS  1247
               +        I  E+  F S + EIS  D +   N + +  +   NFT  F S
Sbjct  352   GTVTAFSGSREIELES-CFGSDESEISCLDNIFCCNIQKSSVVRSLNFTRHFTS  404



>ref|XP_006447587.1| hypothetical protein CICLE_v10015460mg [Citrus clementina]
 ref|XP_006469664.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Citrus sinensis]
 gb|ESR60827.1| hypothetical protein CICLE_v10015460mg [Citrus clementina]
Length=405

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 220/344 (64%), Gaps = 17/344 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG+GSSATVSLAT+   SG  FA KS  L  S  LQRE+  LS  +SP++V 
Sbjct  1     MDWTRGHTIGQGSSATVSLATSL-RSGDVFAAKSTELPKSEFLQREQKFLSSLNSPHIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCD++ E N  +YNLF+EY PGGTL+D   R  GR  E +I  Y  QIL G+ +LHS 
Sbjct  60    YKGCDVTSEDNKLMYNLFMEYAPGGTLNDEIHRNGGRLDESLIVSYTRQILQGLEYLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VHCDIK +NIL++E  S  KIAD GC K+      S +    GTP FMAPEVA+GE Q
Sbjct  120   RVVHCDIKSRNILMAE--SGAKIADFGCAKW-----ESEALQRGGTPMFMAPEVARGEHQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF +DIWA GCTVIEMA+G APW +  DP++ LY+IA S ++PE P + S  A +FL  C
Sbjct  173   GFASDIWAVGCTVIEMASGGAPWPNAADPMTILYKIAYSRELPEVPAFLSKQANDFLSNC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS-  944
             L RD K RW A++LL+HPFL+  SS +   +E    SPTS++DQ +WNS+E ++ S  + 
Sbjct  233   LRRDPKERWAASQLLKHPFLEEFSSCTKQIQE-SNYSPTSILDQGIWNSVEETEESLGNL  291

Query  945   --TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
               +++      RI RL    G   P W  D  W+T+R N  +ES
Sbjct  292   IHSSSKTSARERIERLSCSQG---PSWGWDESWITIRENNNEES  332



>ref|XP_007149981.1| hypothetical protein PHAVU_005G115900g [Phaseolus vulgaris]
 gb|ESW21975.1| hypothetical protein PHAVU_005G115900g [Phaseolus vulgaris]
Length=399

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 221/350 (63%), Gaps = 23/350 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG--MLQREKDILSQFDSPYV  227
             MEW RG  IGRGSSATV  AT+A +S    AVK+A LS S    LQRE+ ILS   SP++
Sbjct  1     MEWTRGFIIGRGSSATVYTATSAHSSTVS-AVKTAELSPSNSEKLQREQRILSSLFSPHI  59

Query  228   VKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             V   GC+ + E N   +NL++EY+P GTLS    R  GR S P I  Y  Q+L G+ +LH
Sbjct  60    VTYKGCNTTEESNTLWFNLYMEYMPFGTLSQEIHRQGGRLSAPTIVHYVRQVLQGLEYLH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             + G VHCDIKG NIL+ ED    KI D GC K L     S  +A  GTP FMAPEVA+GE
Sbjct  120   NKGVVHCDIKGSNILIGED--GAKIGDFGCAKLLNE---SPVAAIGGTPMFMAPEVARGE  174

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQG+PADIWA GCTV+EMATG APW ++ DPV+ LYR+A S +VPE P + S++AK+FLG
Sbjct  175   EQGYPADIWALGCTVVEMATGFAPWPNLEDPVTVLYRVAYSNEVPEIPSFLSEEAKDFLG  234

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
             KC  R+ K RW+ +ELL+HPFL   SSN    ++    SPTS+++Q  WNS+E ++    
Sbjct  235   KCFRRNPKERWSCSELLKHPFLGEFSSNDKEIQQSNSCSPTSILEQGFWNSVEEAESEAG  294

Query  942   STATAG----------FPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNE  1058
               +  G           P  RI RL + + +  P WE  D  W+T RG+E
Sbjct  295   CASEPGNVVQIRSSDESPKGRIRRLALCSED--PIWELGDENWITTRGSE  342



>emb|CAB36535.1| putative NPK1-related protein kinase [Arabidopsis thaliana]
 emb|CAB79544.1| putative NPK1-related protein kinase [Arabidopsis thaliana]
Length=444

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 252/402 (63%), Gaps = 40/402 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ATVS+A ++  SG  FAVKSA LSSS +LQ+E+ ILS   SP++VK
Sbjct  3     INWTRGPIIGRGSTATVSIAISS--SGELFAVKSADLSSSSLLQKEQSILSTLSSPHMVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E N  +YN+ +EYV GG L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGTGLTRESNGLVYNILMEYVSGGNLHDLIKNSGGKLPEPEIRSYTRQILNGLVYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K  N+LV E+   +KIAD+GC K ++  E      FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSHNVLVEEN-GVLKIADMGCAKSVDKSE------FSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCT+IEM TGS+PW ++ND V+A+Y+I  SG+ P  P W SD AK+FL  C
Sbjct  174   RFPADVWALGCTMIEMMTGSSPWPELNDVVAAMYKIGFSGESPAIPAWISDKAKDFLKNC  233

Query  768   LDRDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ--  929
             L  D K+RWT  ELL+HPFL    +S +S+ +  K    +SP++V+DQ  W+S E S+  
Sbjct  234   LKEDQKQRWTVEELLKHPFLDDDEESQTSDCLKNK---TSSPSTVLDQRFWDSCESSKSH  290

Query  930   --------PSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRG--NEEDEST  1073
                     P    + +   PA+RI +L       L DW  E+DGGW+ VRG  ++E E  
Sbjct  291   LVSIDHEDPFAEYSESLDSPADRIEKLAGDEFSSLLDWDTEDDGGWIQVRGEKHKETEKR  350

Query  1074  DSEPILISILCP------EDLESSIVNEAPSFD--SSDDEIS  1175
             D +  +I +         E++E  I N+   F   SSDD I+
Sbjct  351   DGDEDVICVEATSSSQTIEEVEDWISNQDSLFSEYSSDDIIN  392



>ref|XP_002304913.2| hypothetical protein POPTR_0004s00910g, partial [Populus trichocarpa]
 gb|EEE85424.2| hypothetical protein POPTR_0004s00910g, partial [Populus trichocarpa]
Length=400

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/385 (48%), Positives = 240/385 (62%), Gaps = 25/385 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGSSATVS+A A   SG  FAVKSA LS S  LQ+E+ +LS    P +V 
Sbjct  1     MDWTRGQTIGRGSSATVSMARA-NQSGKVFAVKSAELSKSESLQKEQIVLSTLRCPQIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR--FSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+   LYNLFLEY  GGTL D  + G     E MI+ YA  IL+G+ +LH  
Sbjct  60    YKGCDITNENGKVLYNLFLEYASGGTLIDAIREGGGCLDEDMIRLYARTILLGLEYLHCN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFL-ENGEA--SSSSAFSGTPAFMAPEVAKG  578
             G VHCDIKG NILV+ D    KIADLGC K + E  EA   +++  +GTP +MAPEVA+ 
Sbjct  120   GIVHCDIKGHNILVTSD--GAKIADLGCAKRVDEVSEADWGTTTTIAGTPLYMAPEVARA  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QGFPADIWA GCT++EMATG APW +++DPVSALY+I  SG+ PE P + S  A++FL
Sbjct  178   EHQGFPADIWAVGCTIVEMATGQAPWVNVSDPVSALYQIGFSGNAPEIPSFMSKQARDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKE---FVRNSPTSVMDQAVWNSIEMSQ  929
              KCL RD   RW+A+ELL+H F+  I   ++  KE      ++PT V+DQ +W+S+E  +
Sbjct  238   SKCLKRDPMERWSASELLKHDFI--IEEPNLILKENNSSKADTPTCVLDQVLWDSMEKLE  295

Query  930   PSCNSTATAGF--PANRIGRLIIQAGERLPDWEEDG-GWVTVRGNEEDESTDSEPILISI  1100
              + +ST       P  RI +L  +   +   W   G  WVT+R NE    +  E  ++S 
Sbjct  296   TTWDSTQNTSLVSPIERIKQL-TEGNGKAHSWSTWGDAWVTIRSNE----SSKEQEMVS-  349

Query  1101  LCPEDLESSIVNEAPSFDSSDDEIS  1175
              C ED   +  N   S ++S  EI+
Sbjct  350   -CSEDYNMAYAN--GSIENSGAEIA  371



>ref|NP_194419.2| mitogen-activated protein kinase kinase kinase 16 [Arabidopsis 
thaliana]
 gb|AEE85265.1| mitogen-activated protein kinase kinase kinase 16 [Arabidopsis 
thaliana]
Length=444

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 252/402 (63%), Gaps = 40/402 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ATVS+A ++  SG  FAVKSA LSSS +LQ+E+ ILS   SP++VK
Sbjct  3     INWTRGPIIGRGSTATVSIAISS--SGELFAVKSADLSSSSLLQKEQSILSTLSSPHMVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E N  +YN+ +EYV GG L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGTGLTRESNGLVYNILMEYVSGGNLHDLIKNSGGKLPEPEIRSYTRQILNGLVYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K  N+LV E+   +KIAD+GC K ++  E      FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSHNVLVEEN-GVLKIADMGCAKSVDKSE------FSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCT+IEM TGS+PW ++ND V+A+Y+I  SG+ P  P W SD AK+FL  C
Sbjct  174   RFPADVWALGCTMIEMMTGSSPWPELNDVVAAMYKIGFSGESPAIPAWISDKAKDFLKNC  233

Query  768   LDRDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ--  929
             L  D K+RWT  ELL+HPFL    +S +S+ +  K    +SP++V+DQ  W+S E S+  
Sbjct  234   LKEDQKQRWTVEELLKHPFLDDDEESQTSDCLKNK---TSSPSTVLDQRFWDSCESSKSH  290

Query  930   --------PSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRG--NEEDEST  1073
                     P    + +   PA+RI +L       L DW  E+DGGW+ VRG  ++E E  
Sbjct  291   LVSIDHEDPFAEYSESLDSPADRIEKLAGDEFSSLLDWDTEDDGGWIQVRGEKHKETEKR  350

Query  1074  DSEPILISILCP------EDLESSIVNEAPSFD--SSDDEIS  1175
             D +  +I +         E++E  I N+   F   SSDD I+
Sbjct  351   DGDEDVICVEATSSSQTIEEVEDWISNQDSLFSEYSSDDIIN  392



>ref|XP_002321133.2| kinase family protein [Populus trichocarpa]
 gb|EEE99448.2| kinase family protein [Populus trichocarpa]
Length=348

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 229/356 (64%), Gaps = 29/356 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGS+ATVS+AT+   SG  FAVKS  LS SG LQRE+ ILS   SP++V 
Sbjct  1     MDWTRGHTIGRGSTATVSVATSI-QSGDVFAVKSVELSQSGFLQREQKILSSIISPFIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLHS  404
               GCD++ ++N  +YNLFLEY+P G+LS+       GR  E +I+ + +QIL G+ +LH 
Sbjct  60    YKGCDVTRKNNKVMYNLFLEYMPNGSLSNAIHAHDGGRLDESLIRIFTYQILQGLDYLHL  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G VHCDIK  NILV++  S  KIAD GC K +E          +GTP FMAPEVA+GEE
Sbjct  120   NGLVHCDIKSSNILVAQ--SGAKIADFGCAKRVEQ-----QGPIAGTPMFMAPEVARGEE  172

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGF +DIWA GCT+IEMA+G  PW +++DPVS +YR   SG +PEFP   S+ A++FL K
Sbjct  173   QGFASDIWALGCTIIEMASGGTPWHNVSDPVSIIYRAGYSGHLPEFPCCLSEQARDFLDK  232

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ-----  929
             CL RD K RWTA++LL+HPFL    +  +        SPTS++DQ +WNS++ S+     
Sbjct  233   CLRRDPKERWTASQLLEHPFLVGELNKQIEESNPTSTSPTSILDQGIWNSLDESESLESL  292

Query  930   ---PSCNSTATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVR--GNEE-DESTD  1076
                PS + ++     + RI  L + +G   P W+ +D  W+T R  G EE D  TD
Sbjct  293   VLVPSGSESSA----SERIRGLSLLSGA--PSWDCDDQNWITAREDGCEEGDTVTD  342



>ref|XP_006283707.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
 gb|EOA16605.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
Length=454

 Score =   323 bits (827),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 226/353 (64%), Gaps = 24/353 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGP IGRGS+ATVSLA +    G  FAVKSA LSSS  LQ+E+ ILS   SP+++K
Sbjct  3     MNWTRGPIIGRGSTATVSLAISY--FGEIFAVKSAELSSSTFLQKEQSILSTLSSPHILK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E    LYN+ +EYV GG+L DL K   G+  EP I  Y  QIL G+ +LH  
Sbjct  61    YIGSGLTLESGVMLYNILMEYVSGGSLHDLIKSSGGKLPEPEISSYTRQILNGLVYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+   +KIAD GC K      + + S F+GTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVEEN-GVLKIADFGCAK------SVAKSDFAGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTVIEM TGS+PW  +ND V+A+Y+I  SG+ PE P   S+ AK+FL  C
Sbjct  174   SFPADVWALGCTVIEMMTGSSPWPGLNDVVAAMYKIGLSGESPEIPVKISEKAKDFLMNC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ----PS  935
               +D K+RWT  ELL+HPFL    S          +SP++V+DQ  W+S E+S+    P 
Sbjct  234   FKKDPKQRWTVQELLKHPFLDDDGSQPSECLSKT-SSPSTVLDQRFWDSCEVSKSHLIPM  292

Query  936   CNSTATAGF------PANRIGRLIIQAGERLPDW--EEDGGWVTVRGNEEDES  1070
              +  + A +      PA+R+ +L       LP W  E+DGGW  VRG+EE+++
Sbjct  293   DHEDSFADYSKSWDSPADRVEKLAGDDKSSLPAWNTEDDGGWYQVRGDEEEDA  345



>emb|CDY14295.1| BnaA08g14260D [Brassica napus]
Length=471

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 229/344 (67%), Gaps = 18/344 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGPTIGRGS+ATVS+AT+   +G  FAVKSA+ SSS  LQRE+ ILS   SP++VK
Sbjct  3     IAWTRGPTIGRGSTATVSIATSN--TGEIFAVKSANFSSSAFLQREQSILSTSSSPHIVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++CE++  +YN+ +EYV GG+L  L K   G+  EP I+ +  QIL G+ +LH  
Sbjct  61    YIGSSLTCENDRLVYNILMEYVSGGSLHGLIKNSGGKLPEPAIRSHTRQILKGLKYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+LV E+    KIADLGC K + N      S FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSQNVLVGENGVVSKIADLGCAKPVFN------SGFSGTPAFMAPEVARGEEQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+W  GCTVIEM TGS+PW ++ND V+ +Y+I  SG+ PE P   S+  ++F+ +C
Sbjct  175   RFPADVWTLGCTVIEMVTGSSPWPELNDAVARMYKIGYSGESPEIPEGTSEKGRDFVMRC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVT-FKEFVR--NSPTSVMDQAVWNSIEMSQ---  929
             L  D K+RWT  ELL+HPFL     +  +   +++R  +SP++V+DQ  WNS E S+   
Sbjct  235   LRVDPKQRWTVEELLKHPFLDDDEEDEESQCIDYLRSTSSPSTVLDQRFWNSCEDSETED  294

Query  930   PSCNSTATAGFPANRIGRLIIQAGERLPDWE--EDGGWVTVRGN  1055
             P  + + +   PA+RI +L       +P W+  +DG W+ VRG+
Sbjct  295   PFADYSDSWRSPADRIEQLAGDEVTSVPSWDTVDDGEWIQVRGD  338



>ref|XP_011006457.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Populus euphratica]
Length=408

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/388 (46%), Positives = 241/388 (62%), Gaps = 25/388 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG +IG GS+ATVSLAT+   SG  FAVKS  L  S  LQRE+ ILS   SP++V 
Sbjct  1     MDWTRGHSIGHGSTATVSLATSI-QSGDIFAVKSVELCQSEFLQREQQILSSLTSPFIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E++  +YNLFLEY+P GTLS+   A  GR  E +I+ Y  Q+L G+ ++H  
Sbjct  60    YRGCDITRENSKVMYNLFLEYMPNGTLSNAIHAHGGRLDESLIRNYTSQVLQGLDYIHLN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK  NILV    S  KIAD GC K ++          +GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKSSNILVGP--SGAKIADFGCAKRVDQ-----VGQIAGTPMFMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF +DIWA GC +IEMA+GS PW ++NDPVS +YR+  SG +P+FP   S+ A++ L KC
Sbjct  173   GFASDIWALGCAIIEMASGSTPWHNVNDPVSIIYRVGYSGHLPDFPCCLSEQARDLLDKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEF-----VRNSPTSVMDQAVWNSIEMSQP  932
             L RD + RWTA++LL+HPFL    SNS   K+        NSPTS++DQ  WNS+++S+ 
Sbjct  233   LRRDPRERWTASQLLKHPFLVG-ESNSHVAKQIQESNSSSNSPTSILDQCFWNSLDLSES  291

Query  933   SCNSTAT----AGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISI  1100
               N  +      G    RI  L + +G  +P W+ D  W T+RG+  +E    + I+  I
Sbjct  292   LHNLVSVPPGREGSAGERIRGLSLLSG--MPKWDWDESWTTIRGDSREE---RDAIMDCI  346

Query  1101  LCPEDLESSIVNEAPSFDSSDDEISVND  1184
                +D+ S  + E  S+  S++ ++  D
Sbjct  347   GVKDDIVSCGLGEQKSYGGSEELLNFLD  374



>dbj|BAF00528.1| putative NPK1-related protein kinase [Arabidopsis thaliana]
Length=432

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 251/402 (62%), Gaps = 40/402 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ATVS+A +   SG  FAVKSA LSSS +LQ+E+ ILS   SP++VK
Sbjct  3     INWTRGPIIGRGSTATVSIAISN--SGELFAVKSADLSSSSLLQKEQSILSTLSSPHMVK  60

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E N  +YN+ +EYV GG L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  61    YIGTGLTRESNGLVYNILMEYVSGGNLHDLIKNSGGKLPEPEIRSYTRQILNGLVYLHER  120

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K  N+LV E+   +KIAD+GC K ++  E      FSGTPAFMAPEVA+GEEQ
Sbjct  121   GIVHCDLKSHNVLVEEN-GVLKIADMGCAKSVDKSE------FSGTPAFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCT+IEM TGS+PW ++ND V+A+Y+I  SG+ P  P W SD AK+FL  C
Sbjct  174   RFPADVWALGCTMIEMMTGSSPWPELNDVVAAMYKIGFSGESPAIPAWISDKAKDFLKNC  233

Query  768   LDRDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ--  929
             L  D K+RWT  ELL+HPFL    +S +S+ +  K    +SP++V+DQ  W+S E S+  
Sbjct  234   LKEDQKQRWTVEELLKHPFLDDDEESQTSDCLKNK---TSSPSTVLDQRFWDSCESSKSH  290

Query  930   --------PSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRG--NEEDEST  1073
                     P    + +   PA+RI +L       L DW  E+DGGW+ VRG  ++E E  
Sbjct  291   LVSIDHEDPFAEYSESLDSPADRIEKLAGDEFSSLLDWDTEDDGGWIQVRGEKHKETEKR  350

Query  1074  DSEPILISILCP------EDLESSIVNEAPSFD--SSDDEIS  1175
             D +  +I +         E++E  I N+   F   SSDD I+
Sbjct  351   DGDEDVICVEATSSSQTIEEVEDWISNQDSLFSEYSSDDIIN  392



>ref|XP_009616882.1| PREDICTED: mitogen-activated protein kinase kinase kinase A {ECO:0000303|PubMed:9832508}-like 
[Nicotiana tomentosiformis]
Length=329

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSA VS+A +   SG  FAVKS  LS S  LQ+E+ ILS   SPY+V 
Sbjct  1     MDWTRGATIGHGSSAAVSIAMSR-CSGEIFAVKSVELSQSEFLQKEQKILSTLSSPYIVC  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               G D++ E+N  ++NL +EY+P GTL+D  + G  +E +I++Y  QI+ G+ +LHS G 
Sbjct  60    YKGYDVTRENNKDMFNLMMEYMPDGTLTDEIQGGPLNEQLIRYYTKQIIHGLNYLHSKGI  119

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIKG NIL+ +  +  KIAD GC + ++  + +      GTP FMAPEVA+GEEQ F
Sbjct  120   VHCDIKGHNILLYK--TGAKIADFGCARSVDQAKWN-----GGTPMFMAPEVARGEEQWF  172

Query  594   PADIWAFGCTVIEMATGSAPWQDMN-DPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
              ADIWA GCT+IEMATG++PW  +N  P S L  IA SG +PE P++ S  A++FL +CL
Sbjct  173   AADIWALGCTIIEMATGASPWTTVNHSPASLLCHIAFSGQIPEIPKFLSSQARDFLSECL  232

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP---SCN  941
              RD K+RW+A +LL HPFL+   SNS   ++F+ +SPTS++DQ +WNS+E S+    S  
Sbjct  233   RRDPKQRWSAKQLLNHPFLEQSDSNSKINEDFITSSPTSILDQRIWNSVEESETVEDSRQ  292

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
             + ++   P  R+ +L  ++G+   +W  D  W TVR
Sbjct  293   TISSMDSPLQRVTKLCTESGKL--EWRWDESWSTVR  326



>ref|XP_003526335.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=357

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 223/346 (64%), Gaps = 23/346 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIG+GSSATVS AT  G     FAVKS  L  S  L+RE+ ILS   SPYVV 
Sbjct  1     MEWHRGHTIGQGSSATVSTATCRGGV---FAVKSTELPQSEPLKREQKILSSLSSPYVVA  57

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR---GR-FSEPMIQFYAHQILMGIGFLH  401
               GCDI+ E+N  L+NLF+EY+P GTL+  A R   GR F E +I  Y  QI+ G+ +LH
Sbjct  58    YKGCDITMENNKLLFNLFMEYMPFGTLAQAATRRCAGRLFEESVIARYTRQIVQGLDYLH  117

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S G VHCDIKG NIL+ ED    KI DLGC K +    A S++A  GTP F+APEVA+GE
Sbjct  118   SKGLVHCDIKGANILIGED--GAKIGDLGCAKSV----ADSTAAIGGTPMFLAPEVARGE  171

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQG  +DIW+ GCTVIEM TG APW ++ DP SALY IA S +VPE P + S++AK+FLG
Sbjct  172   EQGCASDIWSLGCTVIEMVTGGAPWPNVEDPFSALYHIAYSSEVPEIPCFLSNEAKDFLG  231

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
             KCL R+ + RW A+ELL+HPF++     +    E   +SPTSV++Q  W+S+E S+   N
Sbjct  232   KCLRRNPQERWKASELLKHPFIEKTLCFNKEVLESNSSSPTSVLEQGYWSSMEESKSLGN  291

Query  942   ----STATAGFPANRIGRLIIQAGERLPDW----EEDGGWVTVRGN  1055
                 +       A R+  L + +G  +P W    ++D  W+T RGN
Sbjct  292   LIHKTRKFEALAAGRVRMLALSSG--VPCWARHDDDDENWITARGN  335



>ref|XP_004487421.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=404

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 180/410 (44%), Positives = 242/410 (59%), Gaps = 32/410 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAH--LSSSGMLQREKDILSQFDSPYV  227
             MEW RG  IG GSSATV LAT+  +S    AVKSA   LS S  L+RE+ ILS   SPY+
Sbjct  3     MEWTRGNIIGHGSSATVYLATSPSSSDVS-AVKSAETSLSYSKHLEREQRILSSLYSPYI  61

Query  228   VKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFL  398
             V   GC+ + E+N  L+NLF+EY+P G LS   +R   GR +EP I  +  QIL G+ +L
Sbjct  62    VSYKGCNFTNENNKNLFNLFMEYMPLGNLSQATRRNDGGRLNEPAIAHFTRQILQGLEYL  121

Query  399   HSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKG  578
             H+ G VHCDIKG NILV E    VKI D GC K ++      +   +GTP FM+PEVA+G
Sbjct  122   HTKGIVHCDIKGSNILVCE--KGVKIGDFGCAKMVD-----ETVPIAGTPMFMSPEVARG  174

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG+P D+W+ GCT++EMATG +PW ++ DPV+ LYRIA S DVPE P + S+ AK+FL
Sbjct  175   EEQGYPCDVWSLGCTIVEMATGFSPWTNVEDPVTVLYRIAYSNDVPEIPCFLSEQAKDFL  234

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP--  932
              KC  RD+K RW  ++LL+HPFL+   S+ V   EF  +SPTS+++Q  WN +E S+   
Sbjct  235   EKCFRRDSKERWNCSQLLKHPFLEEFDSSVVKSDEFDSSSPTSILEQGFWNCVEESESLF  294

Query  933   --SCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEED--ESTDSEPILISI  1100
                   T        RI +L + + E   +W  D  W+++RGN+ D   ST  +      
Sbjct  295   FGDLGKTNFENCCVGRIKKLALCSREPFWNW-GDENWISIRGNDSDAVASTSDDDFDFDE  353

Query  1101  LCPEDLESSIVN----EAPSFDSSDDEISVN--------DRVNPRTNLDL  1214
             L   D+   I      E  +F +SD    VN        +R+ P + LD 
Sbjct  354   LVKSDVNGGISGYNFCEDYNFRNSDVSFVVNSFNFESGIERLQPYSTLDF  403



>emb|CAN66202.1| hypothetical protein VITISV_015759 [Vitis vinifera]
Length=477

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 239/377 (63%), Gaps = 32/377 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGPTIG G+SAT+SLA  +  SG  FAVKS  LS S +LQRE+  LSQ  S  +VK
Sbjct  1     MDWTRGPTIGXGASATISLAIXS-TSGELFAVKSTELSRSKLLQREQSFLSQLSSERIVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRG-RFSEPMIQFYAHQILMGIGFLHSM  407
              LG + +CE +  LYN+F+EYVPGG LSD + +RG R  E  I+ Y  QI++G+ +L   
Sbjct  60    YLGSNTTCEGDTMLYNVFMEYVPGGALSDEIRRRGNRLDEDWIRLYTRQIVLGLEYLQFN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK +N+L+ ED +   IADLGC K +        S FSGTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKSENVLIREDGAV--IADLGCAKSVHGN--GGGSVFSGTPVFMAPEVARGEEQ  175

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GFPAD+WA GCTVIEMATG  PW + N  + A++        PEFP W S + ++FL KC
Sbjct  176   GFPADVWALGCTVIEMATGRNPWPE-NWVLPAMF--------PEFPMWLSXNGRDFLDKC  226

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVM-DQAVWNSIEMS-QPSC-  938
             L R+ + RWTA ELL+HPFL+    NS   KEF   SPTSV+ DQ  W+S+E    PS  
Sbjct  227   LRRNPRERWTAKELLEHPFLE---PNSKQLKEFPVKSPTSVLDDQGFWDSLEAPVTPSVL  283

Query  939   -NSTATAGFPANRIGRL---IIQAGERLPDWEEDGGWVTVRGNEEDES------TDSEPI  1088
              +  +++  PA RI RL    + +G  LP+W  D  WVTVR N  +ES      T +  +
Sbjct  284   MHIGSSSNSPAERIQRLNEGALSSGSNLPNWTWDEDWVTVRSNYIEESARFSDNTTTTLV  343

Query  1089  LISILCPEDLESSIVNE  1139
             + S +  E+ E+ ++N+
Sbjct  344   MASFVHEEEPENLVLND  360



>ref|XP_004243854.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum lycopersicum]
Length=326

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 220/335 (66%), Gaps = 15/335 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIG GSSA VS A +   SG  FAVKS  LS S +LQ+E+ ILSQ  SPY+V+
Sbjct  1     MDWIRGHTIGHGSSAAVSAAKSI-LSGEVFAVKSVELSKSQLLQKEQKILSQLSSPYIVR  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E +  ++N+ +EY+P GTLSD  ++  GR +EP+I +Y  Q++ G+ +LHS 
Sbjct  60    YKGYDVTKEKDKLMFNIRMEYMPDGTLSDEIRKQSGRMNEPLIGYYTKQMVQGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASS-SSAFSGTPAFMAPEVAKGEE  584
             G  HCDIKGQNIL+ E  +  K+AD GC ++++  E    + A  GTP FMAPEVA+GEE
Sbjct  120   GVAHCDIKGQNILLGE--TGAKLADFGCARWIDPAEREGDAEAIGGTPMFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG  ADIW  GCT+IEMATG +PW ++ + VS LY+IA S   PE P++ S  A++FL K
Sbjct  178   QGCAADIWGLGCTMIEMATGGSPWNNVTNAVSLLYKIAFSKQSPEIPKFLSSQARDFLNK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RD   RWTA +LL+HPFL+   SNS   ++FV +SPTS++DQ +WNS          
Sbjct  238   CLRRDGNERWTAKQLLKHPFLE---SNSTIIQDFVTSSPTSILDQDIWNS------ESTI  288

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
               T   P  R+  LI  +GE    W +D  W+TVR
Sbjct  289   LETVSCPVERVRELISNSGELNCRWNDDEKWMTVR  323



>gb|KDO54709.1| hypothetical protein CISIN_1g015500mg [Citrus sinensis]
Length=405

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 219/344 (64%), Gaps = 17/344 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG+GSSATVSLAT+   SG  FA KS  L  S  LQRE+  LS  +SP++V 
Sbjct  1     MDWTRGHTIGQGSSATVSLATSL-RSGDVFAAKSTELPKSEFLQREQKFLSSLNSPHIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCD++ E N  +YNLF+EY PGGTL+D   R  GR  E +I  Y  QIL G+ +LHS 
Sbjct  60    YKGCDVTSEDNKLMYNLFMEYAPGGTLNDEIHRNGGRLDESLIVSYTRQILQGLEYLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VHCDIK +NIL++E  S  KIAD GC K+    EA  S    GTP FMAPEVA+GE Q
Sbjct  120   RVVHCDIKSRNILMAE--SGAKIADFGCAKW--ESEALQSG---GTPMFMAPEVARGEHQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF +DIWA GCTVIEMA+G APW +  DP++ LY+IA S ++PE P + S  A +FL  C
Sbjct  173   GFASDIWAVGCTVIEMASGGAPWPNAADPMTVLYKIAYSRELPEVPAFLSKQANDFLSNC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS-  944
             L RD K RW A++LL+HPFL+   S +   +E    SPTS++DQ +WNS+E ++ S  + 
Sbjct  233   LRRDPKERWAASQLLKHPFLEEFCSCTKQIQE-SNCSPTSILDQGIWNSVEETEESLGNL  291

Query  945   --TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
               + +      RI RL    G   P W  D  W+T+R N  +ES
Sbjct  292   IHSTSKTSARERIERLSCSQG---PSWGWDESWITIRENNNEES  332



>ref|XP_008379645.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Malus domestica]
Length=424

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 180/373 (48%), Positives = 239/373 (64%), Gaps = 23/373 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG+GSSATVSLAT+   SG  FAVKSA +S S  LQRE+ I S   SP++V 
Sbjct  1     MDWTRGCTIGQGSSATVSLATSR-HSGDKFAVKSAEMSHSQFLQREQKIFSVLSSPHIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
              +G DI+ E+N  +YNL +EYVPGGT+ D   ++ G+  E +I+ Y   ++ G+ +LHS+
Sbjct  60    YMGHDITNENNKLVYNLLMEYVPGGTIIDAIRSRGGQVDESIIRNYTRGMVKGLDYLHSL  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+NILV ED    KIAD GC ++  N  A+S +   GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKGRNILVGED--GPKIADFGCARW-ANPAAASVATIGGTPMFMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GF  D+WA GCT+IEMATG SAPW +  DPV+ LY+IA S ++PE P + SD AK FL +
Sbjct  177   GFACDVWALGCTIIEMATGGSAPWPNAADPVTVLYQIAYSNELPEIPSFLSDQAKHFLER  236

Query  765   CLDRDAKRRWTAAELLQHPFLQ---------SISSNSVTFKEFVRNSPTSVMDQAVWNSI  917
             CL RD   RWTA++LL+H FL          + SS++   +     SPTS++DQ VWNS 
Sbjct  237   CLRRDPTDRWTASQLLKHSFLGEEEEEKVLINFSSSTKQVQGSTSFSPTSILDQDVWNSF  296

Query  918   EMSQPSCNSTATAGFPAN----RIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDESTDSE  1082
               S+ S +      F  +    RI RL + +G+  P W  +D  W+ VRGN+ DES   E
Sbjct  297   GESENSGSLDQNPSFENSSDDQRIRRLSLFSGD--PKWSWDDETWIAVRGNDCDESNSIE  354

Query  1083  PILISILCPEDLE  1121
                 ++   EDL+
Sbjct  355   DDAEAVGSEEDLD  367



>ref|XP_008782219.1| PREDICTED: serine/threonine-protein kinase 4-like [Phoenix dactylifera]
Length=551

 Score =   324 bits (831),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 224/346 (65%), Gaps = 22/346 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             +EW RG TIGRGSSATVSLAT   ASG  FAVKSA ++ +G+LQRE+ ILS  +SP+VV 
Sbjct  4     VEWCRGRTIGRGSSATVSLATVP-ASGEVFAVKSAEIARAGLLQREQRILSNLNSPHVVS  62

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LGCD++ E N   YNLF EY   G+LSD  K+  G   EP I+ Y++ IL G+ +LHS 
Sbjct  63    YLGCDVTSEKNGVYYNLFTEYAARGSLSDEIKKQGGCLDEPTIRSYSYHILRGLAYLHSS  122

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSA----FSGTPAFMAPEVAK  575
                HCD+KGQN+L+  D  A+ IADLGC + +   E            GTP FMAPEVA+
Sbjct  123   RIAHCDVKGQNVLIGSDGRAI-IADLGCARRVAGDEDDYDDDDGLQLRGTPMFMAPEVAR  181

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GEEQG PADIWA GCT++EMATG APW +++DP++AL+RIA S DVPE P W SD+ K+F
Sbjct  182   GEEQGIPADIWALGCTIVEMATGHAPWPEVSDPIAALHRIAFSSDVPELPSWISDEGKDF  241

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
               KCL RD K RWTA +LL HPF+ S S+NS+      R SP S +DQA W+S+      
Sbjct  242   SDKCLRRDPKERWTAEQLLNHPFVAS-SANSI----HKRISPKSTLDQAFWDSLSDEYEE  296

Query  936   CNSTA------TAGFPANRIGRLIIQAGERL--PDWEEDGGWVTVR  1049
                        ++  P+ RI +L++  G  +  P+W  D  W+T+R
Sbjct  297   EEEEDEEEDGNSSDDPSKRI-QLLVGGGTVVGSPNWTWDDSWMTIR  341



>ref|XP_009607835.1| PREDICTED: mitogen-activated protein kinase kinase kinase A {ECO:0000303|PubMed:9832508}-like 
[Nicotiana tomentosiformis]
Length=345

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/350 (47%), Positives = 232/350 (66%), Gaps = 19/350 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSA V +A +   S   FAVKS  LS S +LQ+E+ ILS+  S Y+V 
Sbjct  1     MDWTRGQTIGHGSSAAVFVAKSHW-SNEIFAVKSVELSKSQLLQKEQKILSELSSHYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E +  ++NL +E +P GTL+D  ++  GR +EP+I +Y  QIL G+ +L+SM
Sbjct  60    YKGYDVTKEKDKFMFNLMMENMPEGTLTDEIRKQGGRINEPLIGYYTRQILQGLEYLYSM  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE------ASSSSAFSGTPAFMAPEV  569
             G VHCDIKGQNIL+ +  +  KIAD GC ++++  E      A+S+    GTP +MAPEV
Sbjct  120   GIVHCDIKGQNILLGK--TGAKIADFGCARWVDPAERDGGAAAASAQPIGGTPMYMAPEV  177

Query  570   AKGEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
             A+GEEQGF ADIWA GCT+IEMATG +PW ++ +  S LY+IA SG  P+ P++ S  AK
Sbjct  178   ARGEEQGFAADIWALGCTIIEMATGGSPWTNVANSASLLYKIAFSGQSPQIPKFLSLQAK  237

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQSIS-SNSVTFKEFVRNSPTSVMDQAVWNSIEMS  926
             +FL KCL R+ K RWTA ELL+H FL+ IS SN    ++ + +SPTS++DQ +WNS+E +
Sbjct  238   DFLSKCLRRNPKERWTAKELLKHQFLEEISNSNFKVIQDSITSSPTSILDQDIWNSVEET  297

Query  927   QP----SCNSTATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEE  1061
             +     S  + ++   P  R+  L + +GE  P+W  +D  W+T+R + E
Sbjct  298   ETMDFCSIQTVSSMDSPLKRVRELGLNSGE--PNWRWDDESWITLRRSSE  345



>ref|XP_008784479.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Phoenix dactylifera]
Length=498

 Score =   322 bits (826),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 221/339 (65%), Gaps = 13/339 (4%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RG TIGRGSSATVSLAT   ASG  FAVKSA LS +G+L+RE+ IL+    P+VV  
Sbjct  5     EWYRGRTIGRGSSATVSLATIT-ASGEVFAVKSAELSRAGLLRREQRILANLSYPHVVSY  63

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG DI+ E N   YNLF+EY   G+LSD  ++  GR  EP I+ Y+ QIL G+ +LHS  
Sbjct  64    LGFDITSETNGVYYNLFMEYAARGSLSDEIEKQGGRLDEPTIRSYSCQILRGLAYLHSNS  123

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
               HCD+KG+N+L+  D  A+ IADLGC +++ + +        GTP +MAPE A+GEEQG
Sbjct  124   IAHCDVKGRNVLIGSDGRAM-IADLGCARWMADEDGRGCLQLRGTPMYMAPEAARGEEQG  182

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
              PAD+WA GCTV+EMATG APW + +DP++AL+RIA S DVPE P W SD+ K+FL +CL
Sbjct  183   TPADVWALGCTVVEMATGRAPWPEFSDPIAALHRIAFSTDVPELPSWISDEGKDFLDRCL  242

Query  771   DRDAKRRWTAAELLQHPFLQS----ISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC  938
              RD   RWTA +LL+HPF+ S    + S++ T K     SP S +DQA W SI   +   
Sbjct  243   RRDPNERWTAEQLLKHPFVASSANCLPSSNSTPKWI---SPKSTLDQAFWESISDEEEEV  299

Query  939   NSTA-TAGFPANRIGRLIIQAG-ERLPDWEEDGGWVTVR  1049
             +    ++  P+ RI  L   A    +PDW  D  W+T+R
Sbjct  300   DKVENSSNDPSQRIQHLATAAAVVGVPDWTWDDSWMTIR  338



>gb|AHW50674.1| mitogen-activated protein kinase kinase kinase a [Nicotiana tabacum]
Length=399

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 230/353 (65%), Gaps = 16/353 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GSSA VS+A +  +S   FAVKS  LS S  LQ+E+ +LS   SPY+V 
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSRWSS-EIFAVKSVELSQSQFLQKEQKVLSALSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+N  ++NL +EY+  GT++D  ++  GR +EP+I +Y  QIL+G+ +LHS 
Sbjct  60    YKGYDVTKENNTVMFNLMMEYMSEGTIADEIRKNGGRINEPVIGYYTKQILLGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE---ASSSSAFSGTPAFMAPEVAKG  578
             G VHCDIKGQNIL  +  +  KIAD GC ++++  E    +S+    GTP +MAPEVA+G
Sbjct  120   GVVHCDIKGQNILFGK--TGAKIADFGCARWVDTAERDGGASAQPIGGTPMYMAPEVARG  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQGF ADIW  GCT+IEMATG +PW ++ +  S LY+IA SG  PE P++ S  AK+FL
Sbjct  178   EEQGFAADIWGLGCTIIEMATGGSPWTNVTNSASLLYKIAFSGQSPEIPKFLSLQAKDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC  938
              KC  RD K RWTA +LL+HPFL+ I SN    ++ + +SPTS++DQ +WNS+E ++   
Sbjct  238   SKCFRRDQKERWTAKQLLKHPFLEEI-SNFKEIQDSITSSPTSILDQDIWNSVEETETMD  296

Query  939   NST----ATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDESTDSE  1082
             ++T     +   P  R+ +L + +  R P+W  +D  W TVR N +    D +
Sbjct  297   STTIQLETSIDSPLQRVRKLGLNS--RKPNWRWDDEIWTTVRLNSKQNEGDDD  347



>ref|XP_004243852.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=329

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 220/334 (66%), Gaps = 12/334 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIGRGSSA VS A +   SG  FAVKS  LS S +LQ+E+ ILSQ  SPYVV+
Sbjct  1     MDWIRGHTIGRGSSAAVSAAKSI-LSGEVFAVKSVELSKSQLLQKEQKILSQLSSPYVVR  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G D++ E +  ++N+ +EY+P GTLSD  ++  GR +E +I +Y  Q++ G+ +LHS 
Sbjct  60    YMGYDVTKEKDKLMFNVRMEYMPDGTLSDEIRKQSGRMNERLIGYYTKQMVQGLDYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G  HCDIKGQNIL+ E  S  KIAD GC +++   E        GTP FMAPEVA+G EQ
Sbjct  120   GIAHCDIKGQNILLGE--SGAKIADFGCARWIHPAEP-----IGGTPMFMAPEVARGAEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  ADIW  GCT+IEMATG +PW ++ +  S LY+IA S   PE P++ S  A +FL KC
Sbjct  173   GCAADIWGLGCTIIEMATGGSPWTNVTNAASLLYKIAFSEQSPEIPKFLSLQATDFLNKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD K RWTA +LL+HPFL+  + NS + + F  +SPTS++DQ +WNS+E S+ +   T
Sbjct  233   LTRDPKERWTAKQLLKHPFLEESNLNSTSIQHFATSSPTSILDQDIWNSVEESESTTLQT  292

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
              ++  P  R+  L   + E    W +D  W+T+R
Sbjct  293   VSS--PLQRVRELGSNSSELERIWNDDERWITIR  324



>ref|XP_003539857.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=352

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 217/342 (63%), Gaps = 20/342 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIG+GSSATVS AT  G      AVKS+ L  S  L++E+ ILS   SPYVV 
Sbjct  1     MEWHRGHTIGQGSSATVSTATCCGGV---LAVKSSELPQSEPLKKEQKILSSLSSPYVVA  57

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+N  L+NLF+EY+P GTL+   +R  GR  EP I  Y  QI+ G+ +LHS 
Sbjct  58    YKGCDITMENNKLLFNLFMEYMPFGTLAQATRRCDGRLQEPAIACYTRQIVQGLEYLHSK  117

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NIL+ E+    KI DLGC K      A S+ A  GTP FMAPEVA+GEEQ
Sbjct  118   GLVHCDIKGANILIGEN--GAKIGDLGCAK----SAADSTGAIGGTPMFMAPEVARGEEQ  171

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  +DIW+ GCTVIEM TG APW ++ DP S LY IA S +VPE P + S +AK+FLGKC
Sbjct  172   GCASDIWSLGCTVIEMVTGGAPWPNVEDPFSVLYHIAYSSEVPEIPCFLSKEAKDFLGKC  231

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN--  941
             L R+ + RW A+ELL+HPF++ +  N     E   +SPTSV++Q  W+ +E S+   +  
Sbjct  232   LRRNPQERWKASELLKHPFIEKLCFNKEVL-ESNTSSPTSVLEQGYWSCVEESESLGDLI  290

Query  942   --STATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRGN  1055
               +       A R+  L + +G  +P W   +D  W+T RGN
Sbjct  291   HKTRKFETLAAGRVRMLALSSG--VPYWARHDDENWITARGN  330



>ref|XP_002866074.1| MAPKKK15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42333.1| MAPKKK15 [Arabidopsis lyrata subsp. lyrata]
Length=441

 Score =   320 bits (820),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 168/360 (47%), Positives = 225/360 (63%), Gaps = 30/360 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + WIRGP IGRGS+ATVSLA     SG  FAVKS   SSS  LQRE+ ILS   SPY+VK
Sbjct  4     LNWIRGPIIGRGSTATVSLAITN--SGDFFAVKSTEFSSSAFLQREQSILSNLSSPYIVK  61

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G +++ E++  +YNL LEYV GG++ DL K   G+  EP+I+ Y  QIL G+ +LH  
Sbjct  62    YIGSNVTTENDKLMYNLLLEYVSGGSMHDLMKNSGGKLPEPVIRSYTRQILKGLMYLHDQ  121

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K QN+++  + +  KI DLGC K +   E   +  FSGTPAFM+PEVA+GEEQ
Sbjct  122   GIVHCDLKSQNVMIGGEIA--KIVDLGCAKTVVEDE---NLEFSGTPAFMSPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GC VIEMATG++PW ++ND V+A+Y+I  +G+ PE P W S+  ++FL KC
Sbjct  177   SFPADVWALGCLVIEMATGTSPWPELNDVVAAIYKIGFTGESPEIPVWLSEKGQDFLKKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ------  929
             L +D+K RW+  ELLQHPFL     +         +SP++V+DQ  W+  E S+      
Sbjct  237   LRKDSKERWSVQELLQHPFLDEEDDDEAR-NCLNSSSPSTVLDQGFWDLCETSRSRFIKA  295

Query  930   ----PSCNSTA---TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRG------NEEDES  1070
                 P  NST        P +RI +L         +WE + GW+ VRG       EEDE+
Sbjct  296   DHEDPFANSTNFLWDDSLPGDRIKKLAGDENSGELEWETN-GWIEVRGEIEKRNEEEDEN  354



>ref|XP_004243851.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=322

 Score =   316 bits (809),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 217/334 (65%), Gaps = 19/334 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GS+A V +A +   S   FAVKS  LS S +LQ+E+ ILSQ  SPY+V+
Sbjct  1     MDWTRGRTIGHGSTAAVFVAKSR-FSDEVFAVKSVELSKSQLLQKEQKILSQLISPYIVR  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E++  ++NL +EY+P GTLSD  ++  GR +EP+I +Y  Q++ G+ FLHS 
Sbjct  60    YKGYDVTKENDKLIFNLMMEYMPDGTLSDEIRKQGGRMNEPLIGYYTKQMVKGLEFLHSG  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G  HCDIKGQNIL+ +  S   IAD GC ++++  E        GTP FMAPEVA+GEEQ
Sbjct  120   GLAHCDIKGQNILLGK--SGATIADFGCARWIDPAEP-----IGGTPMFMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G PADIW  GCT+IEMATG +PW ++ +  S LY+IA S   P+ P++ S  A++FL KC
Sbjct  173   GCPADIWGLGCTMIEMATGGSPWNNVTNAASLLYKIAFSEQSPKIPKFLSLQARDFLSKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD K RWTA +LL+HPFL+   SN+ T ++FV +SPTS++DQ +WNS          +
Sbjct  233   LRRDPKERWTAKQLLKHPFLE---SNTTTIQDFVTSSPTSILDQDIWNS------ESTIS  283

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
              T   P  R+  L    GE    W +D  W+TVR
Sbjct  284   QTVSSPLQRVRELGSNLGESNCRWNDDERWITVR  317



>ref|XP_009109958.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Brassica rapa]
Length=431

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 228/345 (66%), Gaps = 19/345 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSA-HLSSSGMLQREKDILSQFDSPYVV  230
             + W RGPTIGRGS+ATVS+AT+   +G  FAVKSA  LSSS  LQRE+ ILS   SP++V
Sbjct  3     IAWTRGPTIGRGSTATVSIATSN--TGEIFAVKSADFLSSSAFLQREQSILSTLSSPHIV  60

Query  231   KCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
             K +G  ++CE +  +YN+ +EYV GG+L  L K   G+  EP I+ +  QIL G+ +LH 
Sbjct  61    KYIGSCLTCEKDRLVYNILMEYVSGGSLHGLIKNSGGKLPEPAIRSHTRQILKGLKYLHE  120

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G VHCD+K QN+LV E+    KIADLGC K + N      S FSGTPAFMAPEVA+GEE
Sbjct  121   RGIVHCDLKSQNVLVGENGVVSKIADLGCAKPVFN------SGFSGTPAFMAPEVARGEE  174

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             Q FPAD+W  GCTVIEM TGS+PW ++ND V+ +Y+I  SG+ PE P   S+  ++F+ +
Sbjct  175   QRFPADVWTLGCTVIEMVTGSSPWPELNDAVARMYKIGYSGESPEIPEGTSEKGRDFVMR  234

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVT-FKEFVR--NSPTSVMDQAVWNSIEMSQ--  929
             CL  D K+RWT  ELL+HPFL     +  +   +++R  +SP++V+DQ  WNS E S+  
Sbjct  235   CLRVDPKQRWTVEELLKHPFLDDDEEDEESQCIDYLRSTSSPSTVLDQRFWNSCEDSETE  294

Query  930   -PSCNSTATAGFPANRIGRLIIQAGERLPDWE--EDGGWVTVRGN  1055
              P  + + +   PA+RI +L       +P W+  +DG W+ VRG+
Sbjct  295   DPFADYSESWRSPADRIEQLAGDEVTSVPSWDTVDDGEWIQVRGD  339



>ref|XP_006364163.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=334

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 221/339 (65%), Gaps = 8/339 (2%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GS+A V  A  +  SG  FAVKS  LS S +LQ+E+  LS+  SPY+V 
Sbjct  1     MDWTRGHIIGHGSTAAV-WAAKSRFSGEVFAVKSVELSKSQLLQKEQKTLSELSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G DI+ E++  ++NL +EY+P GTL D  ++  GR +EP+I +Y  QI+ G+ ++HS 
Sbjct  60    YKGYDITKENDKLMFNLMMEYMPDGTLIDENRKQGGRINEPLIGYYTKQIVQGLEYVHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE-ASSSSAFSGTPAFMAPEVAKGEE  584
                HCDIKGQNIL+ +  +  KIAD GC ++++  +    + +  GTP FMAPEVA+GEE
Sbjct  120   SIAHCDIKGQNILLGK--TGAKIADFGCARWIDPADRGGDAKSMGGTPMFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
              G  ADIW  GCT+IEMATG +PW ++ +  S LY+IA SG  PE P++ S  A++FL K
Sbjct  178   HGCSADIWGLGCTIIEMATGGSPWTNVTNAASLLYKIAFSGKSPEIPKFLSLQARDFLSK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RDAK RW+A +LL+HPFL+    NS   ++FV +SPTS++DQ +WNS+E S+ +   
Sbjct  238   CLIRDAKERWSAKQLLKHPFLEESDLNSAANQDFVTSSPTSILDQDIWNSVEESETTILQ  297

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEE  1061
             T ++  P  R+  L   + E    W +D  W+TVR + E
Sbjct  298   TVSS--PLQRVRELGSNSRELNWRWNDDHRWITVRRSNE  334



>ref|XP_010323839.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=370

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 223/335 (67%), Gaps = 13/335 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIG GSSA VS+A +   S   FAVKS  LS S +LQ+E+ ILS+  SPYV+ 
Sbjct  1     MDWIRGHTIGHGSSAAVSVAKSR-FSDEVFAVKSVELSESQLLQKEQKILSELSSPYVLS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCD++ E +  ++N+ +EY+P GTLSD  ++  GR +EP+I +Y  Q++ G+ +LHS 
Sbjct  60    YKGCDVTKEKDKLMFNIRMEYMPDGTLSDEIRKQSGRMNEPLIGYYTKQMVQGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEA-SSSSAFSGTPAFMAPEVAKGEE  584
             G  HCDIKGQNIL+ +  S  KIAD GC K+++       +++  GTP FMAPEVA+GEE
Sbjct  120   GIAHCDIKGQNILLGK--SGAKIADFGCAKWIDPANRDGGANSIGGTPMFMAPEVARGEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG  ADIW  GCT+IEMATG +PW ++ +  S L++IA S   PE P + S  AK+FL K
Sbjct  178   QGCAADIWGLGCTMIEMATGGSPWNNVTNAASLLHKIAFSEQSPEIPTFLSLQAKDFLNK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RD+K RWTA +LL+HPFL+   SNS T ++FV +SPTS++DQ +WNS         +
Sbjct  238   CLRRDSKERWTAKQLLKHPFLE---SNSTTIQDFVTSSPTSILDQDIWNS---ETTILQT  291

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
              ++   P  R+ +L  ++G++   W  D  W TVR
Sbjct  292   VSSMDCPVERVSKLSQESGKQNWCW-VDEIWTTVR  325



>ref|XP_002524836.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
 gb|EEF37556.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
Length=436

 Score =   317 bits (813),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 223/351 (64%), Gaps = 22/351 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRG ++G GS+ATVSLAT+   S   FAVKSA LS S  LQRE+ ILS   SP++V   
Sbjct  4     WIRGNSVGHGSTATVSLATSF-HSAEIFAVKSAELSLSEFLQREQKILSSVASPHIVSYR  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
             GCDI+ E+N  +YNLFLEY+ GG+L D   A  GR  E MI +Y  QI+ G+ +LHS G 
Sbjct  63    GCDITRENNKVMYNLFLEYMSGGSLVDTIQAHGGRLGESMIGYYTCQIVQGLDYLHSNGL  122

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK  NIL+ +  +  KIAD GC K +       +    GTP FMAPEVA+G EQGF
Sbjct  123   VHCDIKSSNILIGD--AGAKIADFGCAKRVV-ATVDVAETIGGTPMFMAPEVARGAEQGF  179

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              +DIWA GCT+IEMATG APW + NDPVS +YRI     +PEFP   S+ AK+FL KCL 
Sbjct  180   ASDIWALGCTIIEMATGCAPWPNANDPVSVMYRIGFMDQLPEFPCCLSEQAKDFLEKCLR  239

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN----SPTSVMDQAVWNSIEMSQPSCN  941
             RD K+RWTA +LL+HPFL+   S+    +E   +    SPTS++DQ +WNS++    + +
Sbjct  240   RDPKQRWTANQLLKHPFLEKFISHGKQIQEPNNSGSSYSPTSILDQHIWNSVDDESENLD  299

Query  942   STA--------TAGFPANRIGRL-IIQAGERLPDWEEDGGWVTVRGNEEDE  1067
             + A        ++   + RI RL ++  G   P WE D  W+ VRGN  +E
Sbjct  300   NLAHSCHHDHESSPSASERIRRLCLVSEG---PSWELDENWIPVRGNCSEE  347



>ref|XP_004243483.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=329

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 219/335 (65%), Gaps = 14/335 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIGRGSSA VS A +   SG  FAVKS  LS S +LQ+E+ ILSQ  SPYVVK
Sbjct  1     MDWIRGHTIGRGSSAAVSAAKSI-LSGEVFAVKSVELSKSQLLQKEQKILSQLSSPYVVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G D++ E +  ++N+ +EY+P GTLSD  ++  GR +E +I +Y  Q++ G+ +LHS 
Sbjct  60    YMGYDVTKEKDKLMFNVRMEYMPDGTLSDEIRKQSGRMNERLIGYYTKQMVQGLDYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G  HCDIKGQNIL+ E  S  KIAD GC +++   E        GTP FMAPEVA+GEEQ
Sbjct  120   GIAHCDIKGQNILLGE--SGAKIADFGCARWIHPAEP-----IGGTPMFMAPEVARGEEQ  172

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  ADIW  GCT+IEMATG +PW ++ +  S LY+IA S   PE P++ S  A++FL KC
Sbjct  173   GCAADIWGLGCTIIEMATGGSPWNNVTNAASLLYKIAFSEQSPEIPKFLSLQARDFLSKC  232

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSV-TFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             L RD K RWTA +LL+HPFL+ ++ NS  T + FV  SPTS++DQ +WNS  M       
Sbjct  233   LTRDPKERWTAKQLLKHPFLEELNLNSTSTNQNFVTKSPTSILDQDIWNSETMYSTILQE  292

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
              ++   P  R+  L   +GE    W +D  W+TVR
Sbjct  293   VSS---PLQRLRDLSSNSGECNWRWNDDEMWITVR  324



>emb|CDY20789.1| BnaA02g09290D [Brassica napus]
Length=453

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 227/361 (63%), Gaps = 26/361 (7%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IG+GS+ATVSLA     SG  +AVKSA  SSS  LQRE+ ILS   SPYVVK +
Sbjct  6     WIRGPIIGQGSTATVSLAITN--SGEFYAVKSAEFSSSAFLQREESILSSLSSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G + + E++   YNL +EYVPGG++ DL K   G+  EP I+ Y  QIL G+ +LH +G 
Sbjct  64    GSNTTTENDTLTYNLLMEYVPGGSIHDLIKNSGGKLPEPAIRSYTRQILKGLMYLHGLGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN+++  + +  KIADLGC K   NG    S  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDLKSQNVMIGGETA--KIADLGCAKMAGNG----SLEFSGTPAFMSPEVARGEEQSF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GCTVIEMATG +PW ++ND V+A+Y+I  +G+ PE P   S+  K+FL KCL 
Sbjct  178   PADVWALGCTVIEMATGLSPWPELNDVVAAVYKIGFTGESPEIPECLSEKGKDFLRKCLR  237

Query  774   RDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC-  938
             RD K+RW   ELLQHPFL    +   S + +      +SP++V+DQ  W+S E S+    
Sbjct  238   RDPKQRWVVGELLQHPFLDEEEEEDQSQTQSLSCLNTSSPSTVLDQCFWDSCETSRSRLV  297

Query  939   ----------NSTATAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEEDESTDSEP  1085
                        ST     PA+RI +L+       P+W   + GW  VRGN E E  + + 
Sbjct  298   QADHEDTFANYSTLCGSSPADRIKKLVGDELPGEPEWIMAEDGWTDVRGNGEMEKRNEDD  357

Query  1086  I  1088
             +
Sbjct  358   V  358



>ref|XP_011046960.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Populus euphratica]
Length=472

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 240/385 (62%), Gaps = 25/385 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IGRGSSATVS+A A   SG  FAVKSA LS S  LQ+E+ +LS    P +V 
Sbjct  1     MDWTRGQIIGRGSSATVSMARA-NLSGQVFAVKSAELSKSESLQKEQIVLSTLRCPQIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR--FSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ E+   LYNLFLEY  GGTL D+ + G     E MI+ YA  IL+G+ +LH  
Sbjct  60    YKGCDITNENGKVLYNLFLEYASGGTLIDVIREGGGCLDEDMIRSYARTILLGLEYLHCN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFL-ENGEA--SSSSAFSGTPAFMAPEVAKG  578
             G VHCDIKG NILV+ D    KIADLGC K + E  EA   +++  SGTP +MAPE A+ 
Sbjct  120   GIVHCDIKGHNILVTSD--GAKIADLGCAKRVDEVSEADWGTTATISGTPLYMAPEAARA  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QGFPADIWA GCT++EMATG APW +++DPVSALY+I  SG+ PE P + S  A++FL
Sbjct  178   EHQGFPADIWAVGCTMVEMATGQAPWLNVSDPVSALYQIGFSGNAPEIPSFMSKQARDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKE---FVRNSPTSVMDQAVWNSIEMSQ  929
              KCL RD   RW+A+ELL+H F+  I   ++  KE      ++PT V+DQ +W+S+E  +
Sbjct  238   SKCLKRDPMERWSASELLKHDFI--IEEPNLILKENNSSKADTPTCVLDQVLWDSMEKLE  295

Query  930   PSCNSTATAGF--PANRIGRLIIQAGERLPDWEE-DGGWVTVRGNEEDESTDSEPILISI  1100
              + +ST       P  RI +L  +   +   W   D  WVT+RGN+    +  E  ++S 
Sbjct  296   TTWDSTQNTSLVSPFERIKQL-TEGNGKAHSWSTWDDAWVTIRGNK----SSKEQEMVS-  349

Query  1101  LCPEDLESSIVNEAPSFDSSDDEIS  1175
              C ED   +  N   S ++S  EI+
Sbjct  350   -CSEDYNMAYAN--GSVENSGAEIA  371



>ref|XP_007132528.1| hypothetical protein PHAVU_011G102000g [Phaseolus vulgaris]
 gb|ESW04522.1| hypothetical protein PHAVU_011G102000g [Phaseolus vulgaris]
Length=354

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 214/340 (63%), Gaps = 13/340 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  IGRGSSATVS AT   A G  FAVKSA LS S  L+RE+ ILS   SPYVV 
Sbjct  1     MEWQRGHIIGRGSSATVSTATCC-AGGGVFAVKSAELSQSESLKREQTILSSLSSPYVVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCDI+ + N  L+NLF+EY+P GT++   +R  GR  E  +  Y  QI+ G+ +LHS 
Sbjct  60    YKGCDITMDSNKLLFNLFMEYMPFGTVAQATRRHGGRLEEAAMARYTRQIVQGLEYLHSK  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VHCDIKG NIL+ ED   VKI DLG  K +      S+    GTP FMAPEVA+GEEQ
Sbjct  120   ELVHCDIKGANILIGED--GVKIGDLGFAKSV----VDSAVVIGGTPMFMAPEVARGEEQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  +DIW+ GCTV+EMATG  PW  + DP S LY IA S +VPE P + S++A++FLGKC
Sbjct  174   GCASDIWSLGCTVVEMATGGVPWPSVEDPFSVLYHIAYSSEVPEIPCFLSEEARDFLGKC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L R+ + RW A+ELL+HPF+  + SN+    E   +SPTSV++Q  W S+E S+   N  
Sbjct  234   LRRNPQERWKASELLKHPFIGKLCSNNKEVLESNSSSPTSVLEQGYWGSVEDSESVGNLI  293

Query  948   -ATAGF---PANRIGRLIIQAGERLPDWEEDGGWVTVRGN  1055
               T  F    A R+  L + +G       +D  W+T RGN
Sbjct  294   RKTQKFELLAAGRVRMLALSSGVACWAQHDDENWITARGN  333



>ref|XP_009127060.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Brassica rapa]
Length=473

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 228/357 (64%), Gaps = 17/357 (5%)
 Frame = +3

Query  45    TSPME---WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFD  215
             ++PME   WIRGP IG+GS+ATVSLA     SG  +AVKSA  SSS  LQRE+ ILS   
Sbjct  40    SAPMEEQNWIRGPIIGQGSTATVSLAITN--SGEFYAVKSAEFSSSAFLQREESILSSLS  97

Query  216   SPYVVKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGI  389
             SPYVVK +G + + E++  +YNL +EYVPGG++ DL K+  G+  EP I+FY  QIL G+
Sbjct  98    SPYVVKYIGSNTTTENDKQMYNLLMEYVPGGSIHDLIKKSGGKLPEPEIRFYTRQILKGL  157

Query  390   GFLHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEV  569
              +LH  G +HCD+K QN+++  + +  KIADLGC K   NG       FSGTPAFM+PEV
Sbjct  158   MYLHGAGIIHCDLKSQNVMIGGETA--KIADLGCAKMAGNGRLE----FSGTPAFMSPEV  211

Query  570   AKGEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
             A+G EQ FPAD+WA GCTVIEMATG +PW ++ND V+A+Y+I  +G+ PE P   S+  K
Sbjct  212   ARGGEQSFPADVWALGCTVIEMATGLSPWPELNDVVAAVYKIGFTGESPEIPECLSEKGK  271

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQSI-SSNSVTFKEFVRNSPTSVMDQAVWNSIEMS  926
             +FL  CL RD K RW   ELL+HPFL+    + S++      +SP++V+DQ  W+S E S
Sbjct  272   DFLRNCLRRDPKERWVVEELLKHPFLEEKDQTQSLSLSCLNTSSPSTVLDQCFWDSCETS  331

Query  927   QPSC--NSTATAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEEDESTDSEPI  1088
             +             P +RI +L+       P+W   + GW  VRGN E E  + + +
Sbjct  332   RSRLVQEEHVDTFAPTDRIKKLVGDDNSGEPEWITAEDGWTEVRGNGEMEKRNEDDV  388



>ref|XP_006413128.1| hypothetical protein EUTSA_v10027219mg [Eutrema salsugineum]
 gb|ESQ54581.1| hypothetical protein EUTSA_v10027219mg [Eutrema salsugineum]
Length=480

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 229/357 (64%), Gaps = 27/357 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             + W RGP IGRGS+ T +++TA  +SG  FAVKSA+ SSS  LQ+E+ ILS   SP++VK
Sbjct  3     INWTRGPIIGRGST-TATVSTAISSSGEIFAVKSANASSSAFLQKEQSILSTLSSPHIVK  61

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G  ++ E+   +YN+ +EYV GG+L DL K   G+  EP I+ Y  QIL G+ +LH  
Sbjct  62    YIGSGLTRENGGLVYNILMEYVSGGSLYDLIKNSGGKLPEPAIRSYTSQILKGLMYLHER  121

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+K +N+LV E  + +KIAD+GC K +  GE    S FSGTPAFMAPEVA+GEEQ
Sbjct  122   GIVHCDLKSRNVLVEETGAVLKIADMGCAKSV--GE----SEFSGTPAFMAPEVARGEEQ  175

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+W  GCTVIEM TGS PW ++ND V+A+Y I  SG+ PE P W S+  K+FL  C
Sbjct  176   RFPADVWTLGCTVIEMMTGSNPWPELNDVVAAMYTIGFSGESPEIPGWVSEKGKDFLINC  235

Query  768   LDRDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
               +D K+R T  ELL+HPFL    +  S +S    +   +SP++V+DQ  W+S E+S+  
Sbjct  236   FKKDPKQRLTVEELLKHPFLNDDDEEESQSSDCLNKI--SSPSTVLDQRFWDSREVSKSQ  293

Query  936   CNST----ATAGF------PANRIGRLIIQAGERLPDWE--EDGGWVTVRGNEEDES  1070
               S       AG+      PA RI +L  +    +PDW   +DG W+ VRG+E  E+
Sbjct  294   SISMDQEEILAGYTDCRDSPAGRIEKLAGKEFSSVPDWNMVDDGEWIQVRGDELGET  350



>ref|XP_009347129.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Pyrus x bretschneideri]
Length=424

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 229/356 (64%), Gaps = 23/356 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIG+GSSATVSLAT+   SG  FAVKSA +  S  LQRE+ I S   SP++V 
Sbjct  1     MEWTRGCTIGQGSSATVSLATSC-RSGDKFAVKSAEMFHSEFLQREQKIFSVLSSPHIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
              +G DI+ E+N  +YNL +EY+PGGT+ D   +  G   E +I+ Y   ++ G+ +LHS+
Sbjct  60    YMGHDITSENNKLVYNLLMEYMPGGTIIDAIHSSGGLVDESIIRNYTRGMVKGLDYLHSL  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+NILV E+    KIAD GC ++  N   +S +   GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKGRNILVGEN--GPKIADFGCARW-ANRAGASVATIGGTPMFMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GF  D+WA GCT+IEMATG SAPW +  DPV+ LY+IA S ++PE P + SD AK FL K
Sbjct  177   GFACDVWALGCTIIEMATGGSAPWPNAADPVTVLYQIAYSNELPEIPSFLSDQAKHFLEK  236

Query  765   CLDRDAKRRWTAAELLQHPFLQ---------SISSNSVTFKEFVRNSPTSVMDQAVWNSI  917
             CL RD   RWTA++LL+H FL          S SS++   +     SPTS++DQ +WNS 
Sbjct  237   CLRRDPTERWTASQLLKHSFLGEEEEEKVLISFSSSTKQVQGSTSFSPTSILDQDIWNSF  296

Query  918   EMSQPSCNSTATAGFPAN----RIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDES  1070
               S+ S +      F  +    RI RL + +G+  P W  +D  W+TVRGN+ DES
Sbjct  297   GESETSGSLDRNPSFENSSDDQRIRRLSLFSGD--PGWSWDDETWITVRGNDCDES  350



>gb|KDO78298.1| hypothetical protein CISIN_1g040569mg, partial [Citrus sinensis]
Length=385

 Score =   313 bits (803),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 214/340 (63%), Gaps = 13/340 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGS+ATVS+  +   S   FAVKSA LS+S  LQRE+ ILS    P +V 
Sbjct  1     MDWTRGQTIGRGSTATVSIGMS-NRSSEVFAVKSAELSNSEFLQREQRILSALACPQIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR-FSEPMIQFYAHQILMGIGFLHSMG  410
               GCDIS E+   LYNLFLEY PGGTL+D  + G    E  I+ +   +L+G+ +LHS G
Sbjct  60    YKGCDISEENGKILYNLFLEYAPGGTLTDAIRSGTCLEEGRIRSHTRAVLLGLQYLHSNG  119

Query  411   FVHCDIKGQNILVSEDC-SAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
              VHCDIKGQNILVS+D     KIAD GC +     E        GTP  MAPEVA+GEEQ
Sbjct  120   IVHCDIKGQNILVSKDNEQGAKIADFGCARRARVNEDDEGKPICGTPICMAPEVARGEEQ  179

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GFPAD+WA GCTV+EMATG  PW D+ DP+SAL+RI  S D PE P + S  A++FL KC
Sbjct  180   GFPADVWALGCTVLEMATGRPPWPDVADPISALHRIGFSSDTPEIPGYMSKQAQDFLSKC  239

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKE---FVRNSPTSVMDQAVWNSIEMSQPSC  938
             L R+   RW+A+ELL+H F++  +    T  E   +   SPTSV++Q +W+S   +  SC
Sbjct  240   LIRNPGERWSASELLEHGFVKEQNFKLSTLTEPETYNSESPTSVLNQQLWDS---TLTSC  296

Query  939   NSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNE  1058
             +S +       RI +LI +    + +W  D  WVTVR  E
Sbjct  297   SSASA----KERIRQLIGEGSSEMVNWAWDETWVTVRSKE  332



>ref|XP_009353299.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Pyrus x bretschneideri]
Length=424

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 229/356 (64%), Gaps = 23/356 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIG+GSSATVSLAT+   SG  FAVKSA +  S  LQRE+ I S   SP++V 
Sbjct  1     MEWTRGCTIGQGSSATVSLATSC-RSGDKFAVKSAEMFHSEFLQREQKIFSVLSSPHIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
              +G DI+ E+N  +YNL +EY+PGGT+ D   +  G   E +I+ Y   ++ G+ +LHS+
Sbjct  60    YMGHDITSENNKLVYNLLMEYMPGGTIIDAIHSSGGLVDESIIRNYTRGMVKGLDYLHSL  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG+NILV E+    KIAD GC ++  N   +S +   GTP FMAPEVA+GEEQ
Sbjct  120   GLVHCDIKGRNILVGEN--GPKIADFGCARW-ANPAGASVATIGGTPMFMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GF  D+WA GCT+IEMATG SAPW +  DPV+ LY+IA S ++PE P + SD AK FL K
Sbjct  177   GFACDVWALGCTIIEMATGGSAPWPNAADPVTVLYQIAYSNELPEIPSFLSDQAKHFLEK  236

Query  765   CLDRDAKRRWTAAELLQHPFLQ---------SISSNSVTFKEFVRNSPTSVMDQAVWNSI  917
             CL RD   RWTA++LL+H FL          S SS++   +     SPTS++DQ +WNS 
Sbjct  237   CLRRDPTERWTASQLLKHSFLGEEEEEKVLISFSSSTKQVQGSTSFSPTSILDQDIWNSF  296

Query  918   EMSQPSCNSTATAGFPAN----RIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDES  1070
               S+ S +      F  +    RI RL + +G+  P W  +D  W+TVRGN+ DES
Sbjct  297   GESETSGSLDRNPSFENSSDDQRIRRLSLFSGD--PGWSWDDETWITVRGNDCDES  350



>ref|XP_009600573.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nicotiana tomentosiformis]
Length=416

 Score =   314 bits (804),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 229/356 (64%), Gaps = 18/356 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GSSA VS+A +  +S   FAVKS  LS S  LQ+E+ ILS+  SPY+V 
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSRWSS-EIFAVKSVDLSQSQFLQKEQKILSELSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E++  L+NL +EY+  GT++D  ++  GR +E +I +Y  QIL+G+ +LHS 
Sbjct  60    YKGYDVTKENDKFLFNLMMEYMSDGTITDEIRKQGGRINEQLIGYYTKQILLGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE------ASSSSAFSGTPAFMAPEV  569
             G VHCDIKGQNIL+ +  +  KIAD GC ++++  E      A+S+    GTP +MAPEV
Sbjct  120   GVVHCDIKGQNILLGK--TGAKIADFGCARWVDPAERDGGAAAASAQPIGGTPMYMAPEV  177

Query  570   AKGEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
             A+GEEQGF ADIWA GCT+IEMATG +PW ++ +  S LY+I  SG  P+ P++ S  AK
Sbjct  178   ARGEEQGFAADIWALGCTIIEMATGGSPWTNVANSASLLYKIVFSGQSPQIPKFLSLQAK  237

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQSIS-SNSVTFKEFVRNSPTSVMDQAVWNS---I  917
             +FL KCL R+ K RW A ELL+HPFL+ IS SN    ++ + +SPTS++DQ +WNS   I
Sbjct  238   DFLSKCLRRNPKERWMAKELLKHPFLEEISNSNLKVIQDSITSSPTSILDQDIWNSVEEI  297

Query  918   EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDESTDSE  1082
             E    +     +   P  R+ +L + +  R P+W  +D  W TVR N +    D +
Sbjct  298   ETMDSTIQLETSTDSPLQRVRKLGLNS--RKPNWRWDDEIWTTVRMNSKQNEGDDD  351



>ref|XP_010064941.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Eucalyptus grandis]
Length=508

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 243/433 (56%), Gaps = 74/433 (17%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRGP IGRGS+A VSLATA   SG  FAVKSA LS S  LQRE+ +LS+  SP+VVK
Sbjct  1     MEWIRGPAIGRGSTAAVSLATAV-PSGELFAVKSAELSRSAPLQRERLLLSELASPHVVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LG D++ E     YNL+ EY+P GTL D  +R  GR  EP I+ +  ++L G+ +LH  
Sbjct  60    YLGHDVTRESGELYYNLWTEYLPKGTLFDEIRRRGGRLDEPEIRSHTRKVLRGLEYLHEN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE-------------------------NG  512
             G VH D+K QN+L+  D   VK+ADLGC +F+E                          G
Sbjct  120   GLVHGDVKSQNLLMGSD--GVKVADLGCARFVEPRRSGRVLSPPDAFSGVDTRDAHNARG  177

Query  513   E---------ASSSSAFSGTPAFMAPEVAKGEEQGFPADIWAFGCTVIEMATGSAPWQDM  665
             E          +SS  FSGTP FMAPEVA+ EEQ FP+D+W+ GCTVIEMATG  PW + 
Sbjct  178   EDGVLPEERAMTSSDVFSGTPMFMAPEVARNEEQSFPSDVWSVGCTVIEMATGKGPWAE-  236

Query  666   NDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSN  845
             +DPVS LYRI  SGD PE PR  SD  ++FL KCL RD ++RW   ELL+HPFL      
Sbjct  237   SDPVSVLYRIGFSGDAPEIPRRLSDSGRDFLAKCLARDPRQRWAVTELLKHPFLD----E  292

Query  846   SVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGF--------PAN-RIGRLIIQ-  995
             S T +EF RNSP+ V+D   W+S+++ +   N T +           PA  R+ +LI + 
Sbjct  293   SKTSEEFTRNSPSGVLDSGFWDSMDVWESPRNRTVSDAVDSCSCSRSPATERMKKLIEEC  352

Query  996   ----AGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPEDLESSIVNEAPSF-DSS  1160
                 A    PD   D  W+TVR     E     P  I             + AP F DS+
Sbjct  353   ESSSANWSSPDGASDEEWITVRSEHHKEEVGEIPRPI-------------DGAPPFADST  399

Query  1161  DDEISVNDRVNPR  1199
              DE  +  +++PR
Sbjct  400   SDEEQL--QISPR  410



>emb|CDP10763.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 220/356 (62%), Gaps = 20/356 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG T+G GS+ATVS AT    +G  FA+KS  LS S  LQ E+ ILS  DSP++V 
Sbjct  1     MNWTRGHTLGHGSTATVSAATCR-HTGETFALKSTELSKSEFLQNEQKILSTLDSPFIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRG-RFSEPMIQFYAHQILMGIGFLHSM  407
               G DIS E+N  ++NL LEY+P G+++D + KRG R  E MI  Y  QI+ G+ +LHS 
Sbjct  60    YKGYDISMENNKLMFNLMLEYLPDGSIADAIHKRGGRLEESMISCYTRQIVEGLEYLHSS  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE-----NGEASSSSAFSGTPAFMAPEVA  572
             G VHCD+KG+NIL+ ED    KIAD GC K+               A  GTP FMAPEVA
Sbjct  120   GIVHCDVKGRNILLDED--GAKIADFGCAKWAAPVPRITSREIKKVAVGGTPLFMAPEVA  177

Query  573   KGEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKE  752
             +GE+QG PADIWA GCT+IEMATG +PW +  +  S +Y I  SG++PE P + S+ A +
Sbjct  178   RGEDQGLPADIWALGCTIIEMATGGSPWPNATNAASLMYEIGFSGELPEAPDFLSEQATD  237

Query  753   FLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE----  920
             FL KCL RD + RWTA +LL H FL+  + NS   +E + +SPTS++DQ +WNS+E    
Sbjct  238   FLSKCLRRDPQERWTAKQLLNHQFLEGANPNSKQNQEHITSSPTSILDQDIWNSMEEPDN  297

Query  921   MSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNE----EDESTD  1076
             +S      ++    PA R+  L   +G   P W     W+T+R ++    EDE+ +
Sbjct  298   LSDGEIKESSLNSTPAQRLQFLASNSG--YPSWNSGETWITIRSSKAVKREDEAME  351



>ref|XP_006468187.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Citrus sinensis]
Length=497

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 214/340 (63%), Gaps = 13/340 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGS+ATVS+  +   S   FAVKSA LS+S  LQRE+ ILS    P +V 
Sbjct  1     MDWTRGQTIGRGSTATVSIGMS-NRSSEVFAVKSAELSNSEFLQREQRILSALACPQIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR-FSEPMIQFYAHQILMGIGFLHSMG  410
               GCDIS E+   LYNLFLEY PGGTL+D  + G    E  I+ +   +L+G+ +LHS G
Sbjct  60    YKGCDISEENGKILYNLFLEYAPGGTLTDAIRSGTCLEEGRIRSHTRAVLLGLQYLHSNG  119

Query  411   FVHCDIKGQNILVSEDC-SAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
              VHCDIKGQNILVS+D     KIAD GC +     E        GTP  MAPEVA+GEEQ
Sbjct  120   IVHCDIKGQNILVSKDNEQGAKIADFGCARRARVNEDDEGKPICGTPICMAPEVARGEEQ  179

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GFPAD+WA GCTV+EMATG  PW D+ DP+SAL+RI  S D PE P + S  A++FL KC
Sbjct  180   GFPADVWALGCTVLEMATGRPPWPDVADPISALHRIGFSSDTPEIPGYMSKQAQDFLSKC  239

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKE---FVRNSPTSVMDQAVWNSIEMSQPSC  938
             L R+   RW+A+ELL+H F++  +    T  E   +   SPTSV++Q +W+S   +  SC
Sbjct  240   LIRNPGERWSASELLEHGFVKEQNFKLSTLTEPETYNSESPTSVLNQQLWDS---TLTSC  296

Query  939   NSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNE  1058
             +S +       RI +LI +    + +W  D  WVTVR  E
Sbjct  297   SSASA----KERIRQLIGEGSSEMVNWAWDETWVTVRSKE  332



>ref|XP_010482930.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=445

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 230/359 (64%), Gaps = 29/359 (8%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSLA  +  SG  FAVKS+  SSS  LQRE+ ILS+  SPY+VK +
Sbjct  6     WIRGPIIGRGSTATVSLAIKS--SGDFFAVKSSEFSSSEFLQREESILSKLSSPYIVKYI  63

Query  240   GCDISCEHNN-ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             G +++ E++N ++YNL +EYV GG++ DL K   G+  EP+I+ Y  QIL G+ +LH  G
Sbjct  64    GSNVTTENDNKSMYNLQMEYVSGGSIHDLIKNSGGKLPEPVIRSYTRQILKGLVYLHEQG  123

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCD+K QN+++  + +  KI DLGC K    GE + S  FSGTPAFM+PEVA+GEEQ 
Sbjct  124   IVHCDVKSQNVMIGGETA--KIVDLGCAK-TAVGE-NESLEFSGTPAFMSPEVARGEEQS  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             FPAD+WA GCTVIEMATGS+PW ++ND V+A+Y+I  SG+ P  P W SD  ++FL  CL
Sbjct  180   FPADVWALGCTVIEMATGSSPWPELNDVVAAIYKIGFSGESPVIPVWLSDKGQDFLRNCL  239

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTA  950
              +D K+RW   ELLQHPFL     +         +SP++V+DQ  W+  E S+      A
Sbjct  240   RKDPKQRWNVQELLQHPFLDEEDDDEEACNCLSSSSPSTVLDQGFWDLCETSRSRLVKRA  299

Query  951   ---------------TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSE  1082
                             +  PA+RI +L   +GE  P+WE + GW+ VRG  E  + D +
Sbjct  300   DQEDVFVNSINFLWDDSLVPADRIKKL--SSGE--PEWETN-GWIEVRGEIEKRNEDED  353



>ref|XP_010096875.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
 gb|EXB66329.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
Length=369

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 216/348 (62%), Gaps = 18/348 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW R  TIG GS+ATVSLATA   SG  FA KS  LS S  LQ E+ ILS+ +SPY+VK
Sbjct  1     MEWTREATIGCGSTATVSLATAT-HSGELFAAKSTELSHSKYLQTEQSILSKLNSPYLVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              +G DI+ E++   YNLF+EY+P GTL D  +R  GR  E MI+ Y   IL G+ +LH  
Sbjct  60    YIGFDITRENSQFYYNLFMEYLPRGTLHDEIRRHGGRLEEAMIRRYTRDILQGLEYLHES  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSS---AFSGTPAFMAPEVAKG  578
             G VHCDIK  NIL+ E     KI+DLGC KF E       S    FSGTP FM+PEV  G
Sbjct  120   GVVHCDIKSSNILIGE--KNAKISDLGCAKFFEKVSKIGDSHMVVFSGTPMFMSPEVVVG  177

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             ++QGF ADIWA GCTVIEMATG  PW +++DP+SALYRI  SG+ PE PRW S   ++FL
Sbjct  178   QDQGFEADIWALGCTVIEMATGKNPWPEVHDPISALYRIGFSGESPEIPRWLSQKGRDFL  237

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC  938
               CL R+   R  A ELL+HPF + +   S +      +SP SV DQ+VW+S E  + S 
Sbjct  238   EICLRRNPNDRMAAKELLKHPFFEDLEFASSS----SSSSPRSVFDQSVWDSFEAMESSS  293

Query  939   NSTATAGF--PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTD  1076
             +    +     A+R+  LI       P+W  D  W+TVR N ++ES +
Sbjct  294   DHDGVSSLNSAASRMESLIGCE----PNWIWDEDWITVRSNVKEESEN  337



>ref|XP_009394653.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=388

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 219/354 (62%), Gaps = 33/354 (9%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W RG TIGRGS+ATVSLA AA  SGH FAVKSA LS S  LQRE+ ILS    P +V C
Sbjct  5     QWRRGQTIGRGSTATVSLA-AASPSGHLFAVKSAELSLSAHLQREQAILSSLHHPNIVSC  63

Query  237   LGCDISCEHNNA--LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
             LG D++ E   A   YNLFLEY P G+LSD   +  GR  E  I+ Y   +L G+ +LH+
Sbjct  64    LGFDVAAEAPCAPLSYNLFLEYAPLGSLSDCMMKHGGRLEEAAIRSYTGGMLRGLAYLHA  123

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
               F HCD+K QN+L+  D  A KIADLGC + +  G+  +    +GTP FMAPEVA+GEE
Sbjct  124   KSFAHCDVKSQNVLIWPDGRA-KIADLGCARSIA-GDGDAGQPIAGTPMFMAPEVARGEE  181

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG PAD+WA GCTVIEMATG  PW D+ DPV+AL+RI  + DVP+ P W SD+AK+FL K
Sbjct  182   QGAPADVWALGCTVIEMATGRPPWPDVVDPVAALHRIGFTCDVPKRPTWLSDEAKDFLDK  241

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMDQAVWNSIEMSQPS  935
             CL RDA+ RW A +LL+HPF+   S+ S   +  +     SP S ++Q +W+S+   +  
Sbjct  242   CLRRDARERWPAEQLLEHPFVAKPSTTSCLSESALDQEWISPKSTLEQVLWDSVADEEEE  301

Query  936   ---------CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
                          AT+GFP                +W +D  W+TVR +EE+ +
Sbjct  302   DEEMEAEERIQQLATSGFPTA--------------NWAQDDDWITVRISEEEST  341



>ref|XP_006401496.1| hypothetical protein EUTSA_v10015237mg [Eutrema salsugineum]
 gb|ESQ42949.1| hypothetical protein EUTSA_v10015237mg [Eutrema salsugineum]
Length=455

 Score =   310 bits (794),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 223/356 (63%), Gaps = 31/356 (9%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +WIRGP IGRGS+ATVSLA     SG  FAVKSA LSSS  LQRE+ ILS+  SPY+VK 
Sbjct  5     KWIRGPIIGRGSTATVSLAITN--SGEFFAVKSAELSSSAFLQREESILSKLSSPYIVKY  62

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G D++ E++  +YNL +EY+ GG++ DL K   G+  EP I+ Y   IL G+ +LH  G
Sbjct  63    IGSDLTTENDKLVYNLMMEYISGGSIHDLIKNSGGKLPEPAIRSYTRHILKGLIYLHDRG  122

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFL-ENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               HCD+K QN+++  + +  KIAD GC K + +NG       FSGTPAFM+PEVA+GEEQ
Sbjct  123   IAHCDLKSQNVMIGGETA--KIADFGCAKTVTKNGNLE----FSGTPAFMSPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPAD+WA GCTVIEMATG +PW ++ND V+A+Y+I  +G+ PE P W S+  K+FL  C
Sbjct  177   SFPADVWALGCTVIEMATGLSPWPELNDVVAAIYKIGFTGESPEIPEWLSEKCKDFLRNC  236

Query  768   LDRDAKRRWTAAELLQHPFL---QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ---  929
             L +  K+RW   ELLQHPFL   +   S + +      +SP++V+DQ  W+  E S+   
Sbjct  237   LRKCPKQRWAVEELLQHPFLDEEEDEESQTQSRDCLNSSSPSTVLDQGFWDLCETSRSRL  296

Query  930   -------PSCNSTATA--GFPANRIGRLIIQAGERLPDW---EEDGGWVTVRGNEE  1061
                    P  NS+       PA+RI +L        P+W   E+D  W  VRG  E
Sbjct  297   IQADHEDPFANSSTFLWDSSPADRIKKLTGDENSGEPEWITAEDD--WFEVRGRNE  350



>gb|KCW70203.1| hypothetical protein EUGRSUZ_F03482 [Eucalyptus grandis]
Length=646

 Score =   315 bits (808),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 243/433 (56%), Gaps = 74/433 (17%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRGP IGRGS+A VSLATA   SG  FAVKSA LS S  LQRE+ +LS+  SP+VVK
Sbjct  1     MEWIRGPAIGRGSTAAVSLATAV-PSGELFAVKSAELSRSAPLQRERLLLSELASPHVVK  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              LG D++ E     YNL+ EY+P GTL D  +R  GR  EP I+ +  ++L G+ +LH  
Sbjct  60    YLGHDVTRESGELYYNLWTEYLPKGTLFDEIRRRGGRLDEPEIRSHTRKVLRGLEYLHEN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLE-------------------------NG  512
             G VH D+K QN+L+  D   VK+ADLGC +F+E                          G
Sbjct  120   GLVHGDVKSQNLLMGSD--GVKVADLGCARFVEPRRSGRVLSPPDAFSGVDTRDAHNARG  177

Query  513   E---------ASSSSAFSGTPAFMAPEVAKGEEQGFPADIWAFGCTVIEMATGSAPWQDM  665
             E          +SS  FSGTP FMAPEVA+ EEQ FP+D+W+ GCTVIEMATG  PW + 
Sbjct  178   EDGVLPEERAMTSSDVFSGTPMFMAPEVARNEEQSFPSDVWSVGCTVIEMATGKGPWAE-  236

Query  666   NDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSN  845
             +DPVS LYRI  SGD PE PR  SD  ++FL KCL RD ++RW   ELL+HPFL      
Sbjct  237   SDPVSVLYRIGFSGDAPEIPRRLSDSGRDFLAKCLARDPRQRWAVTELLKHPFLD----E  292

Query  846   SVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGF--------PAN-RIGRLIIQ-  995
             S T +EF RNSP+ V+D   W+S+++ +   N T +           PA  R+ +LI + 
Sbjct  293   SKTSEEFTRNSPSGVLDSGFWDSMDVWESPRNRTVSDAVDSCSCSRSPATERMKKLIEEC  352

Query  996   ----AGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPEDLESSIVNEAPSF-DSS  1160
                 A    PD   D  W+TVR     E     P  I             + AP F DS+
Sbjct  353   ESSSANWSSPDGASDEEWITVRSEHHKEEVGEIPRPI-------------DGAPPFADST  399

Query  1161  DDEISVNDRVNPR  1199
              DE  +  +++PR
Sbjct  400   SDEEQL--QISPR  410



>ref|XP_010655414.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Vitis vinifera]
Length=428

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 175/358 (49%), Positives = 221/358 (62%), Gaps = 16/358 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+GRGSSATVS+AT+   SG  FAVKS  LS S +L+RE+ ILS   S +V++
Sbjct  1     MDWTRGCTLGRGSSATVSIATSH-LSGDIFAVKSTELSQSKLLKREQRILSTVRSAHVIE  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               G +++CE+   +YNL +EY  GGTL    +RG   E  I+     IL G+ +LHS   
Sbjct  60    YRGWNVTCENGKQMYNLCMEYAAGGTLK---QRGSLGEAAIRANTRAILQGLQYLHSNCI  116

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK +NIL++ D   +KI DLGC +  ++     S +  GTPAFMAPEVA+GEEQGF
Sbjct  117   VHCDIKSENILITGD--GLKIGDLGCARLADD----FSDSVCGTPAFMAPEVARGEEQGF  170

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCT+IEMATG APW D++DPVSA+YRI  SGDVPE P W S+DAK+FLGKCL 
Sbjct  171   AADVWALGCTIIEMATGRAPWTDVSDPVSAVYRIGFSGDVPEIPGWVSEDAKDFLGKCLV  230

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVW-NSIEMSQPSCNSTA  950
             RD  +RW+  ELL HPF+      S        +SPTSV+DQ  W +SIE   P    + 
Sbjct  231   RDPVQRWSVGELLGHPFVNEACVFSKEVYGSSSSSPTSVLDQRFWSSSIEELYPFHKKSW  290

Query  951   TAGFPANRIGRLI-IQAGERLPDWEEDGGWVTVRGN--EEDESTDSEPILISILCPED  1115
              +  P  RI  L    +   LP+W  D  WVTVR    EE E     P        ED
Sbjct  291   NS--PRERIHFLANSNSNSGLPNWGWDENWVTVRSGSMEEPEVVSEAPTATMAWAGED  346



>ref|XP_002518446.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43833.1| ATP binding protein, putative [Ricinus communis]
Length=344

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 214/343 (62%), Gaps = 20/343 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
              W RG  +G+GS ATVS+AT    SG  FAVKSA LS S +LQ+E+ ILS    P ++  
Sbjct  3     HWTRGQILGQGSQATVSIATVQ-QSGLAFAVKSAELSQSELLQKEQRILSTLSCPQIIAY  61

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
              G D++ E    L+N+FLEY PGGTL D  ++  G   E MI+ YA  IL+G+  LHS G
Sbjct  62    EGYDVTREDGKLLFNIFLEYAPGGTLIDTIRKHGGFLDEGMIRSYARDILLGLHHLHSNG  121

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCDIKG NILV+ D    KIADLGC + +      S +  +GTP +MAPEVA+GE QG
Sbjct  122   IVHCDIKGHNILVTSD--GAKIADLGCARKVNQ---VSKTPIAGTPVYMAPEVARGEHQG  176

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             FPAD+WA GCT+IEMATG  PW  ++DPVSALY+I  SG VPE P + S  A +F+ KCL
Sbjct  177   FPADVWALGCTIIEMATGRPPWTTISDPVSALYQIGYSGMVPEIPSFMSKQAIDFVSKCL  236

Query  771   DRDAKRRWTAAELLQHPFLQS-----ISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
              RD   RW+A+ELL+H F+       +  N+ +  E    +PTSV+DQ +W S E  + +
Sbjct  237   KRDPVERWSASELLRHAFVTEEACSVLKGNTSSNVE----TPTSVLDQGLWESREELEAT  292

Query  936   CNSTAT--AGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNE  1058
               ST    +  P  RI R + Q   R+P+W  D  WVTVR  +
Sbjct  293   WKSTHKNCSRSPTERI-RQLAQGTARVPNWAWDDSWVTVRSKD  334



>emb|CDY06612.1| BnaC02g13360D [Brassica napus]
Length=482

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 227/361 (63%), Gaps = 26/361 (7%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGPTIGRGS+ATVSLA     SG  +AVKSA  SSS  LQRE+ ILS   SPYVVK +
Sbjct  6     WIRGPTIGRGSTATVSLAITN--SGEFYAVKSAEFSSSAFLQREESILSSLSSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G + + +++   YNL +EYVPGG++ DL K   G+  EP+I+ Y  QIL G+ +LH +G 
Sbjct  64    GSNTTTKNDTLTYNLLMEYVPGGSIHDLIKSSGGKLPEPVIRTYTRQILKGLMYLHGVGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN+++  + +  KIADLGC K   NG    S  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDLKSQNVMIGGETA--KIADLGCAKMAGNG----SLDFSGTPAFMSPEVARGEEQSF  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GC VIEMATG +PW ++ND V+A+Y+I  +G+ PE P   S+  K+FL  CL 
Sbjct  178   AADVWALGCMVIEMATGLSPWPELNDVVAAVYKIGFTGESPEIPECLSEKGKDFLRNCLR  237

Query  774   RDAKRRWTAAELLQHPFL----QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ----  929
             RD K+RW   ELLQHPFL    +   S   +      +SP++V+DQ  W+S E S+    
Sbjct  238   RDPKQRWVVEELLQHPFLDQEDEEDRSQIQSLSCLNTSSPSTVLDQGFWDSCETSRSRLL  297

Query  930   ------PSCN-STATAGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNEEDESTDSEP  1085
                   P  N ST     PA+RI +L+       P+W   + GW+ VR N + E  + + 
Sbjct  298   QEQHEDPFANYSTLCGSSPADRIKKLVGYENSGEPEWITAEDGWIEVRRNGQMEKRNEDD  357

Query  1086  I  1088
             +
Sbjct  358   V  358



>ref|XP_006364161.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=337

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 222/340 (65%), Gaps = 16/340 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+WIRG TIGRGSSA VS A +   SG  FAVKS  L  S +LQ+E+ ILSQ  SPY+V 
Sbjct  1     MDWIRGHTIGRGSSAAVSAAKSI-WSGEVFAVKSVELCQSQLLQKEQKILSQLSSPYIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E +  ++NL +EY+P GTL+D  ++  GR +E +I +Y  QIL+G+ +LHS 
Sbjct  60    YKGYDVTKEKDKLMFNLMMEYMPDGTLTDEIRKQSGRINEQLIGYYTKQILLGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASS-SSAFSGTPAFMAPEVAKGEE  584
             G  H DIKG NIL+ +  +  KIAD GC ++++       ++   GTP FMAPEVA+ EE
Sbjct  120   GIAHSDIKGDNILLGK--TGAKIADFGCSRWVDPANRDGDANPIGGTPMFMAPEVARWEE  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG PADIW  GCT+IEMATG +PW ++ +  S LY+IA SG  PE P++ S  A++FL K
Sbjct  178   QGCPADIWGLGCTIIEMATGGSPWTNVTNSASLLYKIAFSGQSPEIPKFISLQARDFLSK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             CL RDAK RWTA ELL+HPFL+ ++ NS   +    NSPTS++DQ +WNS+E  + + NS
Sbjct  238   CLRRDAKERWTAKELLKHPFLKELNLNSTANQ----NSPTSILDQDIWNSVEELE-TTNS  292

Query  945   T-----ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
             T     ++   P  R+  L   + E    W +D  W+T+R
Sbjct  293   TILRKISSTESPLQRVRELGSNSSELKRIWNDDERWITIR  332



>ref|XP_006280356.1| hypothetical protein CARUB_v10026284mg [Capsella rubella]
 gb|EOA13254.1| hypothetical protein CARUB_v10026284mg [Capsella rubella]
Length=495

 Score =   310 bits (795),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/345 (50%), Positives = 230/345 (67%), Gaps = 27/345 (8%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSLA     SG  FAVKS+ LSSS +L+RE+ ILS+  SPYVVK +
Sbjct  6     WIRGPIIGRGSTATVSLAITN--SGDFFAVKSSELSSSALLRREESILSKLSSPYVVKYI  63

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G +++ E++  +YNL +EYV GG++ DL K   G+  EP+I+ Y  QIL G+ +LH  G 
Sbjct  64    GSNVTTENDKPMYNLQMEYVSGGSIHDLIKNSGGKLPEPVIRSYTRQILKGLVYLHGQGI  123

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+K QN+++  + +  KI DLGC K +  GE + +  FSGTPAFM+PEVA+GEEQ F
Sbjct  124   VHCDVKSQNVMIGGETA--KIVDLGCAKTV--GE-NWNFEFSGTPAFMSPEVARGEEQSF  178

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GCTVIEMATGS+PW ++ND V+A+Y+I  +GD PE P W SD  K+F+  CL 
Sbjct  179   PADVWALGCTVIEMATGSSPWPELNDVVAAIYKIGFTGDSPEIPVWLSDKGKDFMKNCLR  238

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTAT  953
             +D K+RWT  ELLQHPFL   + +         +SP++V+DQ  W+  E S+      A 
Sbjct  239   KDPKQRWTVEELLQHPFLDEDNDDEAR-NCLNSSSPSTVLDQGFWDLCETSRTRALVKAE  297

Query  954   -----AGF-------PANRIGRLIIQAGERLPDWEEDGGWVTVRG  1052
                  A F       PA+RI +L   +GE  P+WE + GW+ VRG
Sbjct  298   HEDTFANFLWDDDSLPADRIKKL--SSGE--PEWETN-GWIEVRG  337



>ref|XP_009790438.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase A-like [Nicotiana sylvestris]
Length=325

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 219/328 (67%), Gaps = 16/328 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGS+A VS+A +   SG  FAVKS  LS S  LQ+E+ ILS  +SPY+V 
Sbjct  1     MDWTRGHTIGRGSTAAVSVAMSR-CSGEIFAVKSTELSRSEFLQKEQKILSTLNSPYIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRGRFS--EPMIQFYAHQILMGIGFLHS  404
               G D++ E+N  ++NL +EY+P GTL++ + ++G  +  E MI++Y  QI+ G+ +LHS
Sbjct  60    YKGYDVTRENNKDMFNLMMEYMPDGTLTNQIREQGTRTGNEQMIRYYTKQIVQGLDYLHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G +H DIKG NIL+ E  +  KIAD GC + ++  + +      GTP FMAPEVA+GEE
Sbjct  120   KGILHRDIKGHNILLCE--TGAKIADFGCARSIDQVKWNG-----GTPMFMAPEVARGEE  172

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QGF ADIWA GCT+IEMATG++PW D  +P S LY IA SG  PE P + S  A++F+ K
Sbjct  173   QGFAADIWALGCTIIEMATGASPWTDSTNPASLLYHIAFSGQKPEIPGFLSSQARDFVSK  232

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP---S  935
             CL RD K+RW+A +L +HPF +  +S     +EF+ +SPTS++DQ +W+S E S+    S
Sbjct  233   CLRRDPKQRWSAKQLFKHPFFEESNSYDKINEEFITSSPTSILDQGIWSSAEESETVDDS  292

Query  936   CNSTATAGFPANRIGRLIIQAGERLPDW  1019
               + ++   P  R+  L +Q+G+  PDW
Sbjct  293   RQTISSMDSPLQRLRELEMQSGK--PDW  318



>ref|XP_004173671.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like, 
partial [Cucumis sativus]
Length=353

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 221/352 (63%), Gaps = 22/352 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GSSATV LAT +  S H FAVK+A LS S  L++E+  LS   SPY+V 
Sbjct  1     MDWTRGHVIGHGSSATVFLATDS-PSRHVFAVKTAQLSHSQSLRKEQQFLSSLASPYIVS  59

Query  234   CLGCDISCEHNNA-LYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLH  401
               G ++S E +   ++NLF+EY+P G+L+D  +R    R  E  I  Y  QILMG+ ++H
Sbjct  60    YRGFEVSREQSGVTMFNLFMEYLPNGSLADTIRRRGGQRLDEATIVIYTRQILMGLQYIH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S G VHCDIK +NIL+  D  A K+AD GC K+      S +    GTP FMAPEVA+GE
Sbjct  120   SKGIVHCDIKARNILIGLDGEA-KLADFGCAKWA----TSQTDPICGTPLFMAPEVARGE  174

Query  582   EQGFPADIWAFGCTVIEMATGS-APW---QDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
              QGFP+DIW+ GCT+IEMA+G  +PW    D  DP+SALYRI  SG+ PE P + S++AK
Sbjct  175   HQGFPSDIWSIGCTIIEMASGGGSPWPKTTDDTDPISALYRIGYSGESPEIPCYLSEEAK  234

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN-SPTSVMDQAVWNSIEMS  926
             +FL KCL R+   RWTA+EL+ HPFL+ ++       E V + SPTS+++Q +W SIE S
Sbjct  235   DFLEKCLKRNPSERWTASELMNHPFLRELNCRREWKTEEVHSESPTSILEQGIWRSIEES  294

Query  927   QPSCNSTAT-----AGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDE  1067
             +             A     +I RL + +GE  P WEED  W+T+R  EE E
Sbjct  295   EIRGRELVRSNGWEAAAAEEQIRRLWMISGE--PRWEEDENWITIRRKEEGE  344



>ref|XP_010475855.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=473

 Score =   308 bits (789),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 233/357 (65%), Gaps = 32/357 (9%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             WIRGP IGRGS+ATVSLA  +  SG  FAVKS+  SSS  LQRE+ ILS+  SPY+VK +
Sbjct  6     WIRGPIIGRGSTATVSLAIKS--SGDFFAVKSSEFSSSEFLQREESILSKLSSPYIVKYI  63

Query  240   GCDISCEHNN-ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             G +++ E++N ++YNL +EYV GG++ DL K   G+  EP+I+ Y  QIL G+ +LH  G
Sbjct  64    GSNVTTENDNKSMYNLQMEYVSGGSIHDLIKNSGGKLPEPVIRSYTRQILKGLVYLHEQG  123

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCD+K QN+++  + +  KI DLGC K +  GE  +   FSGTPAFM+PEVA+GEEQ 
Sbjct  124   IVHCDLKSQNVMIGGETA--KIVDLGCAKTVV-GEYENLE-FSGTPAFMSPEVARGEEQS  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             FPAD+WA GCTVIEMATGS+PW ++ND V+A+Y+I  SG+ P  P W SD  ++FL  CL
Sbjct  180   FPADVWALGCTVIEMATGSSPWPELNDVVAAIYKIGFSGESPVIPVWLSDKGQDFLKNCL  239

Query  771   DRDAKRRWTAAELLQHPFL--QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS---  935
              +D K+RW   ELLQH FL  +  + N ++      +SP++V+DQ  W+  E S+     
Sbjct  240   KKDPKQRWNVQELLQHSFLDEEDEACNGLS-----SSSPSTVLDQGFWDLCETSRSRLVK  294

Query  936   --------CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSE  1082
                      N+   +  P +RI +L   AG+  P+WE D GW+ VRG  E  + D +
Sbjct  295   RADQEDVFVNAWGDSLVPGDRIKKL---AGDE-PEWETD-GWIDVRGEIEKRNEDED  346



>ref|XP_004506258.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=410

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/347 (50%), Positives = 218/347 (63%), Gaps = 26/347 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQ--FDSPYV  227
             M+W RG TIG+GS+ATVSLAT    +G  FAVKS  LS S  L+RE+ ILS   + +PYV
Sbjct  1     MKWNRGHTIGQGSTATVSLATL---NGKIFAVKSTELSCSQPLKREQRILSSLCYPNPYV  57

Query  228   VKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSM  407
             V   GCDI+ E+N  +YNLF+EY+P  TLS     G  SE  I  Y  QI+ G+  LHS 
Sbjct  58    VNYKGCDITMENNKLMYNLFMEYMPFDTLSQHG--GLLSEQAIVCYTRQIVKGLEHLHSK  115

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NIL+ ED    KI D GC K +    A       GTP FMAPEVA+GEEQ
Sbjct  116   GLVHCDIKGANILIGED--GAKIGDFGCAKSVSEAVA----PIRGTPLFMAPEVARGEEQ  169

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
               P+DIW+ GCT+IE++  S PW ++ +P+SALY IA S +VP+ P + S+ AK+FLGKC
Sbjct  170   ECPSDIWSLGCTLIEVSNNSTPWPNVGNPISALYHIAYSNEVPKIPSFLSNQAKDFLGKC  229

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC--N  941
             L R+ K R+TA++LL HPFL  + SN     +F  +SPTS++DQ  WNS+E S+     N
Sbjct  230   LRRNPKERFTASQLLNHPFLGELCSNDKQVVDFNSSSPTSILDQGFWNSMEESKSVSLGN  289

Query  942   STATAGFP----ANRIGRLIIQAGERLPDW----EEDGGWVTVRGNE  1058
                T  F     ANRI RL   AGE    W     E+  W+T+RG E
Sbjct  290   WIHTTSFDENSIANRIKRL---AGEPCCAWWHDDNENESWITIRGKE  333



>ref|XP_010655415.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Vitis vinifera]
Length=428

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 217/340 (64%), Gaps = 14/340 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+GRGSSATVS+AT+   SG  FAVKS  LS S +L+RE+ ILS   S +V++
Sbjct  1     MDWTRGCTLGRGSSATVSIATSH-LSGDIFAVKSTELSQSKLLKREQRILSTVRSAHVIE  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               G +++CE+   +YNL +EY  GGTL    +RG   E  I+     IL G+ +LHS   
Sbjct  60    YRGWNVTCENGKQMYNLCMEYAAGGTLK---QRGSLGEAAIRANTRAILQGLQYLHSNCI  116

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK +NIL++ +   +KI DLGC +  ++     S +  GTPAFMAPEVA+GEEQGF
Sbjct  117   VHCDIKSENILITGE--GLKIGDLGCARLADD----FSDSVCGTPAFMAPEVARGEEQGF  170

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCT+IEMATG APW D++DPVSA+YRI  SGDVPE P W S++AK+FLGKCL 
Sbjct  171   AADVWALGCTIIEMATGRAPWTDVSDPVSAVYRIGFSGDVPEIPGWVSEEAKDFLGKCLV  230

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVW-NSIEMSQPSCNSTA  950
             RD  +RW+  ELL HPF+      S        +SPTSV+DQ  W +SIE   P    + 
Sbjct  231   RDPVKRWSVGELLGHPFVNEACVFSKEVYGSSSSSPTSVLDQRFWSSSIEELYPFHKKSW  290

Query  951   TAGFPANRIGRLI-IQAGERLPDWEEDGGWVTVRGNEEDE  1067
              +  P  RI  L    +   LP+W  D  WVTVR    +E
Sbjct  291   NS--PRERIQFLANSNSNSGLPNWGWDENWVTVRSGSMEE  328



>ref|XP_010099184.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
 gb|EXB77056.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
Length=443

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 218/342 (64%), Gaps = 19/342 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGSSA VS+ATA G SG  FAVKS  LS S  LQRE+ ILS  + P+++ 
Sbjct  1     MDWTRGRTIGRGSSAAVSVATARG-SGEIFAVKSIQLSRSETLQREQKILSSLNCPHIIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G  +S E+   LYNLF+E+ PGG+LSD  +R  G  ++ +I+    +IL+G+ +LHS+
Sbjct  60    YRGFGVSSENGELLYNLFMEFAPGGSLSDQIRRSGGSLNDAVIRSCTKEILLGLEYLHSV  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G  HCD+K +N+LV+ +   +KIADLGC K       +   A  GTP +MAPEVA+GE+Q
Sbjct  120   GIAHCDVKARNVLVTGE--GLKIADLGCAKL------AGDVAIGGTPVYMAPEVARGEQQ  171

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMN-DPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             GF AD+WA GCTVIEMATG APW   + +PVSAL++I  SGD PE P + S   ++FLGK
Sbjct  172   GFAADVWALGCTVIEMATGRAPWAGCDVNPVSALFKIGFSGDGPEIPSFVSKQGRDFLGK  231

Query  765   CLDRDAKRRWTAAELLQHPFLQS---ISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
             CL RD   RW+A+ELL+HPFL+S     +  V F     +SP SV+D    +S+E  +  
Sbjct  232   CLKRDPSERWSASELLKHPFLESSRDFVAKEVGFGSSGLDSPRSVLDSGFLDSMEHGKSG  291

Query  936   CNSTATAGFPANRIGRLIIQAGERLP----DWEEDGGWVTVR  1049
               S++    PA RI RL   +    P    DW  D  WVTVR
Sbjct  292   HESSSPTNSPAERIRRLSGDSTTSSPLGFGDWASDEDWVTVR  333



>ref|XP_004486314.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=435

 Score =   305 bits (780),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 230/371 (62%), Gaps = 34/371 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W+RG TIGRGS+ATV +A     SG HFAVKS  L  S  L+RE++ILS+ + P +V 
Sbjct  1     MDWMRGRTIGRGSTATVYIAENR-HSGEHFAVKSTELHRSEFLKREQEILSKLNCPEIVD  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR----FSEPMIQFYAHQILMGIGFLH  401
               GCD++ E+    +NLF+EY P GTLSD  +         E +++F+A +IL G+ +LH
Sbjct  60    YHGCDVTLENGVEFFNLFMEYAPYGTLSDELRNRNGGNGMEEALVKFHARRILFGLHYLH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S G VHCD+KGQN+L++E     KIAD GC + +E  E       SGTPA+MAPEVA+GE
Sbjct  120   SNGIVHCDLKGQNVLLTE--HGAKIADFGCARRVEEEEM----LISGTPAYMAPEVARGE  173

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQGF AD+WA GCTV+EM T   PWQ ++DP + LYRI  SGDVPE P   S+  K+FL 
Sbjct  174   EQGFSADVWALGCTVLEMITAKMPWQGVSDPAAVLYRIGFSGDVPEIPNSVSEQGKDFLR  233

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNS--PTSVMDQAVWNSIEMSQP-  932
             KCL RD   RW+  ELL H F+         FKE V +S  PT+V+++++W+ +E +Q  
Sbjct  234   KCLKRDPNERWSVIELLGHEFVGE-------FKELVFDSETPTTVLERSIWDCLEKTQEV  286

Query  933   ----SCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISI  1100
                  C S+ ++  P +RI RL   + E + +++ D  W+TVR N      D E   +S+
Sbjct  287   GPTFDCCSSDSSN-PLDRIQRLC--SDEAVWEFDNDDEWITVRSN------DMEFNALSL  337

Query  1101  LCPEDLESSIV  1133
                ED ES  V
Sbjct  338   GEMEDYESDTV  348



>ref|XP_004144594.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
 gb|KGN43511.1| hypothetical protein Csa_7G043040 [Cucumis sativus]
Length=372

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 217/347 (63%), Gaps = 20/347 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R   +G GSSATV LA+ A +SG  FAVKSA L  S  L+ E+ +LS   +P +V 
Sbjct  1     MAWTRRSPVGNGSSATVYLASTA-SSGQLFAVKSAELLKSDFLKIERRVLSSLSNPSIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD--LAKRGRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+   +YNLF+EY  GGTL+D    + GR  E    FY  +I+ G+ +LH  
Sbjct  60    YKGFDVTRENGKLMYNLFMEYAAGGTLADEIFRRGGRIKEATAAFYTREIVRGLEYLHKQ  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK +NIL++ D   +KIAD GC +++   EA       GTP FMAPEVA+GE+Q
Sbjct  120   GLVHCDIKAKNILIAGD--GLKIADFGCSRWVCESEA----VIGGTPMFMAPEVARGEKQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  +DIWA GCT+IEM TG+ PW+  +DPVS LYRI  SG+ PE P + S+  K+FL KC
Sbjct  174   GISSDIWALGCTLIEMVTGAPPWKITDDPVSVLYRIGYSGESPEIPSFLSEKGKDFLRKC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKE--FVRNSPTSVMDQAVWNSIEMSQPSCN  941
             L R+A  RW+A++LL+HPFL  +SS     KE      SPTS++DQ++WNS+E  + S  
Sbjct  234   LRREATERWSASQLLEHPFLGELSSGLEEIKELHLYSESPTSILDQSLWNSLE--EESET  291

Query  942   STATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVR----GNEEDE  1067
                T  +  +RI RL   +GE    WE  D  W+T+R    G +EDE
Sbjct  292   LLRTEQWDDDRIERLATFSGE--IKWELGDENWITIRSYVDGEDEDE  336



>ref|XP_006449765.1| hypothetical protein CICLE_v10014400mg [Citrus clementina]
 gb|ESR63005.1| hypothetical protein CICLE_v10014400mg [Citrus clementina]
Length=730

 Score =   311 bits (798),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 214/340 (63%), Gaps = 14/340 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIGRGS+ATVS+  +   SG  FAVKSA LS+S  LQRE+ ILS    P +V 
Sbjct  1     MDWTRGQTIGRGSTATVSIGMS-NRSGDVFAVKSAELSNSEFLQREQRILSALACPQIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR-FSEPMIQFYAHQILMGIGFLHSMG  410
               GCDIS E+   LYNLFLEY PGGTL+D  + G    E  I+ +   +L+G+ +LHS G
Sbjct  60    YKGCDISAENGKILYNLFLEYAPGGTLTDAIRSGTCLEEGRIRSHTRAVLLGLQYLHSNG  119

Query  411   FVHCDIKGQNILVSEDC-SAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
              VHCDIKGQNILVS+D     KIAD GC +     E        GTP  MAPEVA+GEEQ
Sbjct  120   IVHCDIKGQNILVSKDNEQGAKIADFGCARRARVNE-DEVKPICGTPICMAPEVARGEEQ  178

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GFPAD+WA GCTV+EMATG  PW D+ DP+SAL+RI  S D PE P + S  A++FL KC
Sbjct  179   GFPADVWALGCTVLEMATGRPPWPDVADPISALHRIGFSSDTPEIPGYMSKQAQDFLSKC  238

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKE---FVRNSPTSVMDQAVWNSIEMSQPSC  938
             L R+   RW+A+ELL+H F++  +    T  E   +   SPTSV++Q +W+S   +   C
Sbjct  239   LIRNPGERWSASELLEHGFVKEQNFKLSTLTEHETYNSESPTSVLNQQLWDS---TLTGC  295

Query  939   NSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNE  1058
             +S +       RI +LI +    + +W  D  WVTVR  E
Sbjct  296   SSASA----KERIRQLIGEGSSEMINWAWDETWVTVRSKE  331



>ref|XP_011100411.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1 
[Sesamum indicum]
Length=368

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 227/379 (60%), Gaps = 25/379 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG+G+SATVS A     +G  FAVKSA LS S  L+ E+ ILS  +SP+++ 
Sbjct  1     MDWTRGHTIGQGASATVSTAVCR-RNGDTFAVKSAELSQSKSLRSEQRILSSLNSPHIIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GC +S E+  AL+NL +EY P GTL D  +R  GR  E  I +Y  ++L G+ +LHS 
Sbjct  60    YKGCGVSVENGKALFNLMIEYAPDGTLVDEIRRQGGRLDESTIGYYTSRVLKGLEYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+KG NIL+S++   VKIAD GC K      A+  ++  GTP FMAPEVA+GEEQ
Sbjct  120   GIVHCDVKGSNILLSQE--DVKIADFGCAK------AADEASIGGTPMFMAPEVARGEEQ  171

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              FPADIWA GCT+IEM+TG +PW   N+P S L+RIA SG+ P  P + SD A++FL KC
Sbjct  172   SFPADIWALGCTIIEMSTGKSPWP--NEP-STLHRIAFSGETPRIPTFLSDIARDFLSKC  228

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSI--EMSQ--PS  935
             L  D + RWTA +LL H FLQ   S+ V        SPTS++DQ +W+SI  E SQ    
Sbjct  229   LRVDPRERWTAKQLLGHRFLQEFQSSHVKMIMNSTGSPTSILDQGIWSSIEEEFSQGINE  288

Query  936   CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPED  1115
                       A R+  L + +G    +W E   W+TVR     ES +   I I   C   
Sbjct  289   VRHQDLLDCAAQRVKELSMNSGRERWEWGER--WITVR-----ESENISVISIDSRCKFR  341

Query  1116  LESSIVNEAPSFDSSDDEI  1172
              +S +++E  S     +E+
Sbjct  342   EQSVVLSENSSLRRCTEEL  360



>ref|XP_004167046.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
Length=372

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 216/347 (62%), Gaps = 20/347 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R   +G GSSATV LA+ A +SG  FAVKSA L  S  L+ E+ +LS   +P +V 
Sbjct  1     MAWTRRSPVGNGSSATVYLASTA-SSGQLFAVKSAELLKSDFLKIEQRVLSSLSNPSIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD--LAKRGRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+   +YNLF+EY  GGTL+D    + GR  E    FY  +I+ G+ +LH  
Sbjct  60    YKGFDVTRENGKLMYNLFMEYAAGGTLADEIFRRGGRIKEATAAFYTREIVRGLEYLHKQ  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK +NIL++ D   +KIAD GC +++   EA       GTP FMAPEVA+GE Q
Sbjct  120   GLVHCDIKAKNILIAGD--GLKIADFGCSRWVCESEA----VIGGTPMFMAPEVARGERQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  +DIWA GCT+IEM TG+ PW+  +DPVS LYRI  SG+ PE P + S+  K+FL KC
Sbjct  174   GISSDIWALGCTLIEMVTGAPPWKITDDPVSVLYRIGYSGESPEIPSFLSEKGKDFLRKC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKE--FVRNSPTSVMDQAVWNSIEMSQPSCN  941
             L R+A  RW+A++LL+HPFL  +SS     KE      SPTS++DQ++WNS+E  + S  
Sbjct  234   LRREATERWSASQLLEHPFLGELSSGLEEIKELHLYSESPTSILDQSLWNSLE--EESET  291

Query  942   STATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVR----GNEEDE  1067
                T  +  +RI RL   +GE    WE  D  W+T+R    G +EDE
Sbjct  292   LLRTEQWDDDRIERLATFSGE--IKWELGDENWITIRSYVDGEDEDE  336



>ref|XP_003605967.1| MAP kinase kinase kinase SSK2 [Medicago truncatula]
 gb|AES88164.1| MAP kinase kinase kinase [Medicago truncatula]
Length=401

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 220/350 (63%), Gaps = 27/350 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQ--FDSPYV  227
             M+W RG  IG GS++TVSLAT    SG  FAVKS+ LS S  LQRE+ ILS   + +P+V
Sbjct  1     MKWNRGHAIGHGSTSTVSLATV---SGEIFAVKSSELSRSEPLQREEKILSSLCYPNPHV  57

Query  228   VKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSM  407
             V   GCDI+ ++   +YNLF+EY+P GTLS     G   E  I  Y  Q++ G+  LHS 
Sbjct  58    VSYKGCDITKDNEKFMYNLFMEYMPFGTLSQHG--GMLDEQAIMCYTRQVVKGLEHLHSK  115

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NI++ ED    KI D GC K +    A       GTP FMAPEVA+GEEQ
Sbjct  116   GLVHCDIKGANIMIGED--GAKIGDFGCAKSVNEAAA----PIRGTPVFMAPEVARGEEQ  169

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
              F +DIW+ GCT+IEMATGS+PW +++DP+S LY IA S DVP+ P + S+ AK+FLGKC
Sbjct  170   EFSSDIWSLGCTIIEMATGSSPWPNVDDPISTLYHIAYSNDVPQIPCFLSNQAKDFLGKC  229

Query  768   LDRDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS--C  938
             L R+ K R++A++LL+HPFL + + SN     E    SPTS++DQ  W+S+E SQ    C
Sbjct  230   LRRNPKERFSASQLLKHPFLGELLCSNDKQVLESNSISPTSILDQCFWSSMEESQSLSFC  289

Query  939   NSTATAGFPA----NRIGRLIIQAGERLPDW----EEDGGWVTVRGNEED  1064
             +   T  F      +RI RL   AGE    W     +D  W+T+RG E D
Sbjct  290   SLIHTTSFENSLVDDRIKRL---AGEPCLAWWHDDHDDENWITIRGKEVD  336



>ref|XP_009405196.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=453

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 236/409 (58%), Gaps = 33/409 (8%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  IGRGSSATVSLATA   SG  FAVK A L  S +LQRE+ ILS   SPYVV CL
Sbjct  6     WRRGRVIGRGSSATVSLATALD-SGAVFAVKCAELGRSAILQREQRILSSLRSPYVVSCL  64

Query  240   GCDISCEHNNA--LYNLFLEYVPGGTLSD-LAKRG-RFSEPMIQFYAHQILMGIGFLHSM  407
             G DIS   +     YNLFLEY P G+LSD + K+G R  E  I+ Y+ +IL G+ +LHS 
Sbjct  65    GFDISSHGSTGGLYYNLFLEYAPRGSLSDEIGKQGGRLDEAAIRCYSCEILRGLVYLHSQ  124

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCD+KG+N+LV  D  A KIADLGC + +   +        GTP FMAPEVA+GEEQ
Sbjct  125   GVVHCDVKGRNVLVGTDGHA-KIADLGCARLIAQED---EEGLRGTPMFMAPEVARGEEQ  180

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G PAD+WA GCT+IEMATG   W  ++DP++A++R+A S DVP FP W S + K+FL KC
Sbjct  181   GPPADVWALGCTIIEMATGGPAWPGVSDPIAAIHRVAFSPDVPAFPSWLSGEGKDFLSKC  240

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN--SPTSVMDQAVWNSI--EMSQPS  935
             L RD + RWTA +LLQH F+ S S  S +  +  R   SP S +D A W S+  +  +PS
Sbjct  241   LKRDPRERWTAEQLLQHEFVASSSITSPSKPDTDRRWVSPKSTLDLAFWESLPDQDEEPS  300

Query  936   CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPED  1115
              +       P+ RI +L+  +    P W  D  WV VR  +++             CP  
Sbjct  301   QHPFFD---PSARIQQLVSSSS---PTWTWDDNWVAVRSTDKERGAAPS-------CP--  345

Query  1116  LESSIVNEAPSFDSSDDEISVNDRVNPRTNLDLSCHNFTDAFVSWIQDF  1262
                    E+ S D S + I +N      ++ D    +F       +Q F
Sbjct  346   -----ATESSSRDESLNSIMLNGNCVINSHSDCYSTSFAQVAEEEMQQF  389



>ref|XP_004151935.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
 gb|KGN63238.1| hypothetical protein Csa_2G416770 [Cucumis sativus]
Length=435

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 220/352 (63%), Gaps = 22/352 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GSSATV LAT +  S H FAVK+A LS S  L++E+  LS   SPY+V 
Sbjct  1     MDWTRGHVIGHGSSATVFLATDS-PSRHVFAVKTAQLSHSQSLRKEQQFLSSLASPYIVS  59

Query  234   CLGCDISCEHNNA-LYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLH  401
               G ++S E +   ++NLF+EY+P G+L+D  +R    R  E  I  Y  QILMG+ ++H
Sbjct  60    YRGFEVSREQSGVTMFNLFMEYLPNGSLADTIRRRGGQRLDEATIVIYTRQILMGLQYIH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S G VHCDIK +NIL+  D  A K+AD GC K       S +    GTP FMAPEVA+GE
Sbjct  120   SKGIVHCDIKARNILIGLDGEA-KLADFGCAKRA----TSQTDPICGTPLFMAPEVARGE  174

Query  582   EQGFPADIWAFGCTVIEMATGS-APW---QDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
              QGFP+DIW+ GCT+IEMA+G  +PW    D  DP+SALYRI  SG+ PE P + S++AK
Sbjct  175   HQGFPSDIWSIGCTIIEMASGGGSPWPKTTDDTDPISALYRIGYSGESPEIPCYLSEEAK  234

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN-SPTSVMDQAVWNSIEMS  926
             +FL KCL R+   RWTA+EL+ HPFL+ ++       E V + SPTS+++Q +W SIE S
Sbjct  235   DFLEKCLKRNPSERWTASELMNHPFLRELNCRREWKTEEVHSESPTSILEQGIWRSIEES  294

Query  927   QPSCNSTAT-----AGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDE  1067
             +             A     +I RL + +GE  P WEED  W+T+R  EE E
Sbjct  295   EIRGRELVRSNGWEAAAAEEQIRRLWMISGE--PRWEEDENWITIRRKEEGE  344



>ref|XP_009404796.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=442

 Score =   303 bits (775),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 220/351 (63%), Gaps = 30/351 (9%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RG  IGRG+SATVSLAT+  ASG  FAVKS+ L S   L+ E+ +LS  DSP+VV  
Sbjct  5     EWRRGRIIGRGASATVSLATSM-ASGQVFAVKSSELCS---LRGEQRLLSALDSPFVVSY  60

Query  237   LGCDISCEHNNAL---YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             LG D++  H       YNLF+EY PGG+LSD  KR  GR  E  I+ Y H IL G+ +LH
Sbjct  61    LGFDVTPPHAPGAGFHYNLFMEYAPGGSLSDAIKRQSGRLDELAIRSYLHDILSGLVYLH  120

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S G VHCD+K QN+L+  D  A KIAD GC + ++  E        GTP FMAPEVA+GE
Sbjct  121   SNGLVHCDLKSQNVLICSDGRA-KIADFGCARKVDGDEERHQP--RGTPMFMAPEVARGE  177

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQ  PAD+WA GCT IEMATG  PW +M+DPVSAL+RIA S DVPEFP W S + K+FL 
Sbjct  178   EQSAPADVWALGCTTIEMATGRPPWPNMSDPVSALHRIAFSADVPEFPSWISAEGKDFLS  237

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISS--NSVTFKEFVRNSPTSVMDQAVWNSI------  917
             +CL RD + RWTA +LL+HPF+ +  +     +   + R SP S +DQA W S+      
Sbjct  238   RCLRRDPRERWTAEQLLRHPFVAACFACPRPDSGTNYDRVSPRSTLDQAFWESLADEGDE  297

Query  918   EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDES  1070
              + +PS +       P+ R+  LI   G   P W  + GWVTVR +  ++S
Sbjct  298   AVGEPSED-------PSERMQCLI---GGGAPSWTWNDGWVTVRSHAGEDS  338



>ref|XP_006418061.1| hypothetical protein EUTSA_v10008116mg [Eutrema salsugineum]
 gb|ESQ36414.1| hypothetical protein EUTSA_v10008116mg [Eutrema salsugineum]
Length=342

 Score =   298 bits (764),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 211/346 (61%), Gaps = 18/346 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG TIGRGSSATV  AT    SG  FAVKSA    S  LQRE  ILS  +SPYV+ 
Sbjct  1     MNWTRGKTIGRGSSATVYAATCK-ISGETFAVKSAEFHRSEFLQREAKILSSLNSPYVIG  59

Query  234   CLGCDISCEHNN---ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFL  398
               GC+I+ E  N   A YNL +EY P GTL+D+A +  G   E  +  Y  Q+L+G+ ++
Sbjct  60    YRGCEITKEPFNDGEATYNLLMEYAPHGTLTDVAAKNGGSIEEARVSRYTRQLLLGLEYI  119

Query  399   H-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             H S G  HCDIKG N+LV E+  A KIAD GC K++E      +    GTPA+MAPEVA+
Sbjct  120   HDSKGIAHCDIKGSNVLVGENGEA-KIADFGCAKWVE---PELTEPVRGTPAYMAPEVAR  175

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPW--QDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
             GE QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   ++ AK
Sbjct  176   GERQGKESDIWAVGCTVIEMVTGSPPWICADSTDPVSVLYRVGYLGESPELPSSLTEQAK  235

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQS-ISSNSVTFKEFVRNSPTSVMDQAVWNSIEMS  926
             +FLGKCL  +AK RWTA +LL HPFL +  ++  V     V NSPTSV DQ  W S+E  
Sbjct  236   DFLGKCLKIEAKERWTATQLLNHPFLLTKTNTEPVLITGLVTNSPTSVTDQIFWRSVEEE  295

Query  927   QPSCNSTATAGFPANRIGRLIIQAGERL--PDWEEDGG-WVTVRGN  1055
             +   +  +       RIG ++   G+ +  P W+ DG  W+TVR N
Sbjct  296   EDDLDRPSWWECHEERIG-VLSWIGQVVADPTWDMDGADWITVRRN  340



>ref|XP_010556997.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Tarenaya hassleriana]
Length=354

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 211/343 (62%), Gaps = 22/343 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG T+GRGSSATV  AT    SG   AVKSA LS SG LQRE  ILS  +SPYVV 
Sbjct  1     MEWTRGRTLGRGSSATVYAATCHN-SGEIIAVKSAELSRSGFLQREAKILSSLNSPYVVG  59

Query  234   CLGCDIS-CEHNNALYNLFLEYVPGGTLSDLAKRGR--FSEPMIQFYAHQILMGIGFLHS  404
               GC I+    ++A+YNL +EY P GT++D+A +      E M   Y  QI+ G+ +LHS
Sbjct  60    YRGCHITKMRSDSAVYNLLMEYAPSGTVADVAAKNGSGLGETMFAKYTRQIIRGLEYLHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G VHCDIKG N+L+ E   A+ IAD GC K ++  E  S+    GTPAFMAPE A+GE+
Sbjct  120   KGIVHCDIKGSNVLIGESGDAM-IADFGCAKRVDP-EPDSAEPIRGTPAFMAPEAARGEK  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQ-DMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             QG  +DIWA GCTVIEMATGS PW  +  DP S +YR+  SG+ PE P + ++ AK+FL 
Sbjct  178   QGKESDIWAVGCTVIEMATGSPPWTAEAGDPFSVIYRVGYSGESPEIPCFLTEQAKDFLR  237

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
             +CL+R  + RWTA++LL HPF+             + NSPTSVMDQ  W S+E  +    
Sbjct  238   RCLERKPEERWTASQLLNHPFVCKPDPEPGLIPGSISNSPTSVMDQLFWRSVEEEE----  293

Query  942   STATAGFPAN------RIGRLIIQAGERLPDWEEDGG-WVTVR  1049
                  G P+       RIGRL    G   P W+ +GG WVTVR
Sbjct  294   ---DLGHPSRWVSHDERIGRLRC-VGYGGPTWDLEGGDWVTVR  332



>ref|XP_010475182.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=339

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 209/348 (60%), Gaps = 27/348 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG  IGRGS+ATVS AT    SG   AVKSA    S  LQRE  ILS  +SP+V+ 
Sbjct  1     MNWTRGKIIGRGSTATVSAATLQ-ESGETIAVKSADFHRSEFLQREAKILSSLNSPHVIG  59

Query  234   CLGCDISCEHNN------ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGI  389
               GC I+ E  N        YNL +EY P GTL+D+A +  G   E  +  Y  QIL+G+
Sbjct  60    YRGCQITTESFNNYNGEATTYNLLMEYAPYGTLADVASKNGGSIEEARLVKYTRQILLGL  119

Query  390   GFLH-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPE  566
              ++H SMG  HCDIKG N+LV E+  A KIAD GC K +E      +    GTPAFMAPE
Sbjct  120   EYIHNSMGIAHCDIKGSNVLVGENGEA-KIADFGCAKRVE---PEITEPVRGTPAFMAPE  175

Query  567   VAKGEEQGFPADIWAFGCTVIEMATGSAPWQ--DMNDPVSALYRIANSGDVPEFPRWFSD  740
             VA+GE QG  +D+WA GCTVIEM TGS PW   D NDPVS LYR+   G+ PE P   ++
Sbjct  176   VARGERQGKESDVWAVGCTVIEMVTGSTPWSGADSNDPVSVLYRVGYLGESPELPCSLTE  235

Query  741   DAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-KEFVRNSPTSVMDQAVWNSI  917
              AK+FLGKCL +DAK RWTA++LL HPFL +   N        V NSPTSV DQ  W S+
Sbjct  236   QAKDFLGKCLKKDAKERWTASQLLNHPFLITKPDNEPELVTGLVTNSPTSVTDQMFWRSV  295

Query  918   EMSQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
             E  +PS   C+     G   +  G+ ++++      W+ DG  W+TVR
Sbjct  296   EEDRPSWWECHEDERIGV-LSWTGQFVVES-----TWDTDGADWITVR  337



>ref|XP_008455899.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis melo]
Length=434

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 221/352 (63%), Gaps = 22/352 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GSSATV LAT +  SG  FAVK+A LS S  L++E+  LS   SPY+V 
Sbjct  1     MDWTRGHVIGHGSSATVFLATDS-PSGDVFAVKTAQLSQSQSLRKEQHFLSSLASPYIVS  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLH  401
               G ++  E +  + +NLF+EY+P G+L+D  +R    R  E  I  Y  Q+LMG+ ++H
Sbjct  60    YRGFEVRREQSGVMMFNLFMEYLPNGSLADTIRRRGGQRLDEATIAIYTRQLLMGLQYIH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S G VHCDIK +NIL+  D  A K+AD GC K+      S +    GTP FMAPEVA+GE
Sbjct  120   SKGVVHCDIKARNILIGLDGEA-KLADFGCAKWA----TSQTDPIGGTPLFMAPEVARGE  174

Query  582   EQGFPADIWAFGCTVIEMATGS-APW---QDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
              QGFP+DIW+ GCT+IEM TG  +PW    D  DP+SALYRI  SG+ PE P + S++AK
Sbjct  175   HQGFPSDIWSIGCTIIEMGTGGGSPWPKTTDDTDPISALYRIGYSGESPEIPCYLSEEAK  234

Query  750   EFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN-SPTSVMDQAVWNSIEMS  926
             +FL KCL R+   RWTA EL+ HPFL+ ++       E V + SPTS+++Q +W SIE S
Sbjct  235   DFLEKCLKRNPSERWTANELMNHPFLKELNCRRPCKTEEVHSESPTSILEQGIWRSIEES  294

Query  927   QPSCNSTATA-GFPA----NRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDE  1067
             +        + G+ A     +I RL + +GE  P WEED  W+T+R  EE E
Sbjct  295   EIRGRELVRSDGWEAAEAEEQIRRLWMISGE--PRWEEDENWITIRRKEEGE  344



>ref|XP_008455448.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Cucumis 
melo]
Length=378

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 213/350 (61%), Gaps = 21/350 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R   +G GSSATV LA+ A +SG  FAVKSA L  S  L+ E+ ILS    P +V 
Sbjct  1     MAWTRRSPVGNGSSATVYLASTA-SSGELFAVKSAELLKSDFLKTEQRILSSLSHPSIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSD--LAKRGRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+   +YNLF+EY  GGTL+D    + GR  E    FY  +I+ G+ +LH  
Sbjct  60    YRGFDVTRENGKLMYNLFMEYADGGTLTDEIFRRGGRIKEATAAFYTREIVRGLEYLHKQ  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK +NIL++ D   +KIAD GC K++   EA       GTP FMAPEVA+GE+Q
Sbjct  120   GLVHCDIKAKNILIAGD--GLKIADFGCSKWVCEAEAVKG----GTPMFMAPEVARGEKQ  173

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  +DIWA GCT+IEM TG+ PW+  +DPVS LYRI  SG+ PE P + S+   +FL KC
Sbjct  174   GISSDIWALGCTLIEMVTGALPWKTTDDPVSVLYRIGYSGESPEVPSFLSEKGNDFLRKC  233

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEF--VRNSPTSVMDQAVWNSIEMSQPSCN  941
             L R+A  RW+A++LL+HPFL  +SS     KE      SPTS++DQ++WNS+E    +  
Sbjct  234   LRREATERWSASQLLEHPFLGELSSGLEEIKELHSYSESPTSILDQSLWNSLEEESETLL  293

Query  942   ST---ATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVR----GNEEDE  1067
              T          +RI RL   +GE    WE  D  W+T+R    G +EDE
Sbjct  294   KTEQWDDEDEDDDRIERLATFSGE--IKWEFGDENWITIRSYVDGEDEDE  341



>ref|XP_010457586.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=339

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 207/348 (59%), Gaps = 27/348 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG  IGRGS+ATVS AT    SG   AVKSA    S  LQRE  ILS  +SP+V+ 
Sbjct  1     MNWTRGKIIGRGSTATVSAATLQ-ESGETIAVKSAEFHRSEFLQREAKILSSLNSPHVIG  59

Query  234   CLGCDISCEHNN------ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGI  389
               GC I+ E  N        YNL +EY P GTL+D+A +  G   E  +  Y  QIL+G+
Sbjct  60    YRGCQITKESFNNYNGEATTYNLLMEYAPYGTLADVASKNGGSIDETRVVEYTRQILLGL  119

Query  390   GFLH-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPE  566
              ++H SMG  HCDIKG N+LV ++  A KIAD GC K     E   +    GTPAFMAPE
Sbjct  120   EYIHNSMGIAHCDIKGSNVLVGDNGEA-KIADFGCAK---RDEPERTEPVRGTPAFMAPE  175

Query  567   VAKGEEQGFPADIWAFGCTVIEMATGSAPWQ--DMNDPVSALYRIANSGDVPEFPRWFSD  740
             VA+GE QG  +DIWA GCTVIEM TGS PW   D NDPVS LYR+   G+ PE P   ++
Sbjct  176   VARGERQGKESDIWAMGCTVIEMVTGSTPWSGADSNDPVSVLYRVGYLGESPELPCSLTE  235

Query  741   DAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-KEFVRNSPTSVMDQAVWNSI  917
              AK+FLGKCL +DAK RWTA++LL HPFL +   N        V NSPTSV DQ  W S+
Sbjct  236   QAKDFLGKCLKKDAKERWTASQLLNHPFLITKPDNEPELVTGLVTNSPTSVTDQMFWRSV  295

Query  918   EMSQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
             E   PS   C+     G   +  G+ ++++      W+ DG  W+TVR
Sbjct  296   EEDHPSWWECHEDERIGV-LSWTGQFVVES-----TWDTDGADWITVR  337



>ref|XP_009396715.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=539

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 213/346 (62%), Gaps = 16/346 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W R  TIG GS+ATVSLA     SGH F+VKS+ LS S +++RE+ ILS    P +V C
Sbjct  5     QWCRLRTIGHGSTATVSLAMTY-PSGHLFSVKSSELSLSALVRREQAILSSLHHPNIVSC  63

Query  237   LGCDISCE--HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
             LG +++ E  H    Y+LFLEY PGG+LSD  K+  G   E +I+ Y H IL G+  LH+
Sbjct  64    LGFNVAAEAPHGRLFYHLFLEYAPGGSLSDCMKKHGGLLEEAVIRSYTHDILHGLAHLHA  123

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
             M   HCD+K QNIL+  +  A KIADLGC +    G+  +     GTP FMAPEVA+GEE
Sbjct  124   MFVAHCDVKSQNILIWPEGRA-KIADLGCARS-AAGDDDARWPIMGTPMFMAPEVARGEE  181

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG PADIW+ GCTVIEMATG  PW D+ DPV+AL+R+  S +VP  P W S+  K+FL K
Sbjct  182   QGAPADIWSLGCTVIEMATGRPPWPDVVDPVAALHRVGFSSEVPNRPGWLSEAGKDFLDK  241

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN----SPTSVMDQAVWNSIEMSQP  932
             CL RD + RWTA +LL+HPF+   S     F E   N    SP S ++Q +W+ +   + 
Sbjct  242   CLRRDPRERWTAEQLLEHPFVAKTSPADCCFLESTSNQVVVSPKSTLEQGLWDPVAEEEE  301

Query  933   SCNSTATAGFPANRIGRLIIQAGERLP--DWEEDGGWVTVRGNEED  1064
                    +  PA R+ +L   AG+  P  DW     W+TVR +EE+
Sbjct  302   GEEVARRSDSPAERMQQL---AGDGFPAIDWRWGDNWITVRSSEEE  344



>ref|XP_009418854.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=424

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 218/343 (64%), Gaps = 11/343 (3%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W RG TIGRGS+ATV LATA   SG+ FAVKSA LS    LQRE+ ILS    P +V C
Sbjct  5     QWCRGRTIGRGSTATVFLATAF-PSGYLFAVKSADLSLHASLQREQGILSSLHHPNIVSC  63

Query  237   LGCDISCEHNNAL--YNLFLEYVPGGTLSD-LAKRG-RFSEPMIQFYAHQILMGIGFLHS  404
             LG D++ E +     YNLFLEY P G+LS+ + K G R  E +I+ Y   IL G+ +LH+
Sbjct  64    LGFDVTAESSGGQLSYNLFLEYAPLGSLSECIVKHGDRLEEGVIRSYTGDILRGLAYLHA  123

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
                 HCD+K +N+L+  D  A K+ADLGC +    G+  +    +GTP FMAPEVA+GEE
Sbjct  124   KSIAHCDVKSRNVLIWPDGRA-KVADLGCAR-PTTGDDGTVRPIAGTPMFMAPEVARGEE  181

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG PADIWA GCTV+EMA+G  PW D++ P +AL+RI  + DVP+ P W S++AK+FL K
Sbjct  182   QGAPADIWALGCTVVEMASGLPPWPDVDVPAAALHRIGFTTDVPKCPGWLSEEAKDFLDK  241

Query  765   CLDRDAKRRWTAAELLQHPFLQSIS-SNSVTFKEF--VRNSPTSVMDQAVWNSIEMSQPS  935
             CL RDA+ RWTA +LLQHPFL   S  N  T  +   V+ SP S ++Q++W+S+   +  
Sbjct  242   CLRRDARERWTADQLLQHPFLAKRSPPNRFTESDSSQVKVSPRSTLEQSLWDSVADEEEE  301

Query  936   CNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEED  1064
                      P  RI R +I  G    +W  D  W+TVR +EE+
Sbjct  302   VEMDRQFDSPEERI-RQLISGGFPAANWTCDDNWITVRMSEEE  343



>ref|XP_004295280.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Fragaria vesca subsp. vesca]
Length=407

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 213/346 (62%), Gaps = 27/346 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG TIG GSSATVSLA +   SG  FAVKSA LS S  L  E++ILS    P VV 
Sbjct  1     MNWKRGRTIGVGSSATVSLARSC-VSGEVFAVKSASLSHSHSLHVEQEILSTLSCPQVVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GC+IS E+ N LYNL LEY P GTLSD  +R  G  +E  ++ Y  QIL+G+ +LH+ 
Sbjct  60    YKGCNISTENGNVLYNLCLEYAPAGTLSDEVRRQGGSLTESTMRSYTRQILLGMEYLHAN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NILV+++    K+AD GC + + NG+   S    GTP +MAPE A+GE+Q
Sbjct  120   GIVHCDIKGHNILVTDE--GAKLADFGCARRV-NGDHYGSVTICGTPLYMAPEAARGEQQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GFPAD+WA GCT+IEMATG APW  + DPVS LY I  SGDVP  P   S   +EFL KC
Sbjct  177   GFPADVWALGCTIIEMATGQAPWPSVTDPVSGLYCIGFSGDVPAIPSSLSKQGREFLSKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVW-----NSIEMSQP  932
             L RD   RW+A+ELL+H FL          +E   NSPT+V+D  +W     + +E    
Sbjct  237   LKRDPLERWSASELLKHSFLLE--------EEPCWNSPTTVLDYGLWDLEQFDDMEWEIS  288

Query  933   SCNSTATAGFPANRIGRLI---IQAGERLPDWEEDGGWVTVRGNEE  1061
             +C+ +A       RI RL    +     + +W  DG WVTVR N+E
Sbjct  289   TCSDSAR-----ERIRRLSEGNVDTASLMLNWGCDGDWVTVRSNKE  329



>ref|XP_009421493.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Musa acuminata subsp. malaccensis]
Length=432

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 207/346 (60%), Gaps = 21/346 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  IGRGSSATV LAT    SG  FAVKS  LS S +LQRE+ ILS   SPYVV C 
Sbjct  6     WRRGRVIGRGSSATVLLATDLD-SGEVFAVKSVELSRSAVLQREQRILSSLGSPYVVSCF  64

Query  240   GCDISCEH--NNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             G D+S         YNLF+EY P G+LSD   R  GR  E  I+ Y +QIL G+ ++HS 
Sbjct  65    GFDVSSHRLAGGLYYNLFMEYAPRGSLSDEIVRHGGRLDEAAIRSYTYQILRGLAYIHSE  124

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE--ASSSSAFSGTPAFMAPEVAKGE  581
             G VHCD+KG+N+L+  D  A KIADLGC   ++  +          GTP FMAPEVA+GE
Sbjct  125   GVVHCDVKGRNVLIGSDGRA-KIADLGCASLIDEDDRGGGECRGLRGTPMFMAPEVARGE  183

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQG PAD+WA GCTVIEMATG  PW D+ + +  ++RIA S  VP+FP W S + K+FL 
Sbjct  184   EQGPPADVWALGCTVIEMATGCPPWPDVPNAIGVVHRIAFSRVVPDFPSWLSAEGKDFLS  243

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR--NSPTSVMDQAVWNSI---EMS  926
             KCL RD   RWTA +LL+H F+ S  +N  +  +  R   SP S +DQA W S       
Sbjct  244   KCLKRDPSERWTAEQLLRHEFVASSRTNPSSKPDSDRFWASPKSTLDQAFWESFSEQSAE  303

Query  927   QPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEED  1064
              PS +       P+ RI  LI  +    P+W  D  WV VR + ED
Sbjct  304   HPSHDE------PSARIQHLISSSSS--PNWTWDENWVAVRSDGED  341



>ref|XP_009352665.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Pyrus x bretschneideri]
Length=465

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 181/415 (44%), Positives = 243/415 (59%), Gaps = 48/415 (12%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSATVS+A +   SG  FAVKSA L+ S  LQ+E+ ILS   SP++V+
Sbjct  1     MDWTRGRTIGLGSSATVSIAKSY-VSGEVFAVKSAKLAQSQFLQKEQTILSTLSSPHIVQ  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G +IS E+ + LYNLFLEY PGGT+SD  +R  G   +  I+ YA QIL+G+  LHS 
Sbjct  60    YKGHNISTENGDVLYNLFLEYAPGGTISDAIRRQGGCLDDAAIRCYARQILLGLQHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCD+K QNILV+E+ + VK+ADLGC + +    +   S   GTP +MAPEVA+GEEQ
Sbjct  120   QIAHCDVKCQNILVAENGANVKLADLGCARLVN---SDCDSQIGGTPLYMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCT+IEMATG APW D+ DPVSALYRI  SGD PE P   S   ++F+ KC
Sbjct  177   GVAADLWALGCTIIEMATGRAPWSDVCDPVSALYRIGFSGDAPEIPSSLSQQGRDFVAKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMS-----QP  932
             L  D   RW+A ELL+H F+    ++ +        SPT+V+D+ +W   E        P
Sbjct  237   LIGDPLERWSAGELLEHGFVVEAPNDLL--------SPTTVLDRGLWEEEEFESDEIWDP  288

Query  933   SCNSTATAGFPANRIGRL---IIQAGERLPDWEED-GGWVTVRG---NEEDEST------  1073
             +  S+ +      RI +L   I  +   +P+W  D   WVTVR    N++D +       
Sbjct  289   TRESSGSDYSAKERIRKLSEGIAASSPEMPNWASDEENWVTVRSDNINKQDVAQTHTIFL  348

Query  1074  ----DSEPILISILCPEDLESSIVNEAPSFDSSDDEISVNDR---VNPRTNLDLS  1217
                  S+ + + +L P + E++I        SS    S+ DR    NP TN D S
Sbjct  349   LLAGQSKRVPLCLLSPPN-EANI--------SSQYTKSIYDRPTDTNPDTNTDPS  394



>ref|XP_009383559.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=451

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 207/340 (61%), Gaps = 17/340 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  IGRGSSATVSLATA   SG  FAVKSA LS S +LQRE+ IL   DSPYV+ C 
Sbjct  6     WHRGQVIGRGSSATVSLATAL-TSGEVFAVKSAELSRSAILQREQRILCSLDSPYVISCF  64

Query  240   GCDIS--CEHNNALYNLFLEYVPGGTLSD-LAKRG-RFSEPMIQFYAHQILMGIGFLHSM  407
             G D+S         Y+LF+EY PGG+LSD +A+RG R  E  I+ +A  +L G+ +LHS 
Sbjct  65    GFDLSLPTPSGGLYYDLFMEYAPGGSLSDEIARRGGRLDEVAIRTHACDVLRGLAYLHSR  124

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEA---SSSSAFSGTPAFMAPEVAKG  578
             G VHCD+KG+NIL+  D  A KIADLGC   +   E           GTP FMAPEVA+G
Sbjct  125   GVVHCDVKGRNILIGSDGRA-KIADLGCASRIRGDEEEVEGDCQRLRGTPMFMAPEVARG  183

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  AD+WA GCT+IEMATG  PW D++DPV A++RIA S + P FP W S + K+FL
Sbjct  184   EEQGPAADLWALGCTIIEMATGRPPWPDVSDPVIAIHRIAFSQETPRFPSWLSGEGKDFL  243

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMDQAVWNSIEMSQ  929
              KCL RD + RWTA +LL H F+ S S +    K        SP S +DQA W S+    
Sbjct  244   SKCLRRDPRERWTAEQLLHHEFVASSSKHCPRSKPDADRSWVSPKSTLDQASWESLPEQD  303

Query  930   PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR  1049
                 +      P+ RI  L+   G   P+W  +  W TVR
Sbjct  304   E--ETVEHLDDPSARIQPLVCSCG---PNWTWEENWSTVR  338



>ref|XP_009403739.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 213/340 (63%), Gaps = 17/340 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  IGRG+SATVSLAT+   SG  FAVKS+ LS S +LQRE+ ILS  DSP+VV   
Sbjct  6     WRRGRIIGRGTSATVSLATSV-PSGEVFAVKSSELSRSWLLQREQRILSALDSPFVVSYF  64

Query  240   GCDISCEHNNA--LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             G D++ +   A   YNLF+EY P G+LSD  ++  GR  E  I+ YA  IL G+ +LHS 
Sbjct  65    GFDVAAQTPGAGLCYNLFMEYAPRGSLSDEIRKQGGRLDELAIRSYACDILGGLAYLHSN  124

Query  408   GFVHCDIKGQNILVSEDCSA--VKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             G VHCD+K QN+L+   CS    K+AD GC +  E  +        GTP FMAPEVA+GE
Sbjct  125   GVVHCDLKSQNVLI---CSGGRAKVADFGCARSAEEEDEDERGWMRGTPMFMAPEVARGE  181

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQ  PADIWA GCTVIEMATG  PW  ++D +SAL++IA S DVPEFPRW S++ ++FL 
Sbjct  182   EQSAPADIWALGCTVIEMATGRPPWPLVSDALSALHQIAFSTDVPEFPRWISEEGRDFLS  241

Query  762   KCLDRDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC  938
             +CL RD   RWTA +LLQHPF+  S  +N  +  +++  SP S +DQA   S+       
Sbjct  242   RCLRRDPLERWTAEQLLQHPFVAASRVANPPSKSDWI--SPKSTLDQAFLQSLSDDDDDG  299

Query  939   NST-ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGN  1055
                  T   P  R+  LI   G+  P+W  D  WVTVR N
Sbjct  300   QVLDQTEEDPFERMQSLI---GDAAPNWTWDENWVTVRSN  336



>gb|EYU34013.1| hypothetical protein MIMGU_mgv1a020948mg [Erythranthe guttata]
Length=333

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/339 (47%), Positives = 211/339 (62%), Gaps = 17/339 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG TIG G++A VS+AT+   SG  FA K A LS S  LQRE  ILS  ++P+++   
Sbjct  4     WTRGHTIGHGATAAVSVATSQ-ISGEIFATKFAELSQSEPLQREHKILSTLNNPHIICYK  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGFVH  419
             GC+IS E+N  ++NL +E+ P GT++D   R +  EP I +Y   IL G+ +LHS G VH
Sbjct  63    GCNISVENNKPIFNLMMEFAPKGTIADRILRRQLDEPSIGYYTCGILKGLEYLHSKGIVH  122

Query  420   CDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPA  599
             CDIKG N+L++E  + VKI D GC KF      +  +A SGTP +M+PE A+GEEQGFPA
Sbjct  123   CDIKGSNVLLNE-LNEVKITDFGCAKF------ADEAAISGTPMYMSPEAARGEEQGFPA  175

Query  600   DIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRD  779
             DIWA GCTVIEM+TG +PW +     + L RIA SG+ PE P + S +AK+FL KCL  D
Sbjct  176   DIWALGCTVIEMSTGKSPWPNA---AATLRRIAFSGESPEIPDFLSGEAKDFLSKCLRVD  232

Query  780   AKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE---MSQPSC--NS  944
              K+RWTA ELL+HPFL       +   E    SPTS++D  +W+ IE   +S+  C  N 
Sbjct  233   PKQRWTAKELLRHPFLDEFRFEHLKKIEDDTCSPTSILDHGIWSLIEEEVLSETPCEVNY  292

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEE  1061
                +  P  RI  L   +  R  +WE    W+TVR +E+
Sbjct  293   EDFSDSPMQRIKELATNSSGR-ANWEWRESWITVRDSEK  330



>gb|EEE56860.1| hypothetical protein OsJ_06484 [Oryza sativa Japonica Group]
Length=393

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 223/355 (63%), Gaps = 23/355 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IGRG++ATVS+AT    +G  FAVKS  ++ +G L+RE+ +LS   SP+VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDR-RTGGVFAVKSVDVARAGALRREQGMLSALASPFVVPC  64

Query  237   LGCDISCE---HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             +G  +S        A Y+LFLEY PGG+L+D  KR  GR  EP+I+     +L G+ ++H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSA-FSGTPAFMAPEVAKG  578
             + G  HCD+KG+N+LV  D  A+ +AD GC +++   + ++      GTP F+APE A+G
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAM-LADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARG  183

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QG  ADIWA GCTVIEMATG APW    DPV+AL+ +A+S DVPE P WFS + K+FL
Sbjct  184   EAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAEGKDFL  243

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFV--RNSPTSVMDQAVWNSIEMSQP  932
              +CL RD  +RWTA +LL+HPF+ S +S+S +    +  R SP S++DQ +W S      
Sbjct  244   ARCLIRDPAKRWTAEQLLEHPFVASAASDSTSKAVQIEQRVSPKSILDQCLWEST-----  298

Query  933   SCNSTATAGF-PANRIGRLIIQAGERLPDWE---EDGGWVTVRGNEEDESTDSEP  1085
             S +S AT    PA+R+ R +       PDW    +D  W+ V G   D+  D+ P
Sbjct  299   STDSDATVALAPADRL-RALSAGASVAPDWTWSMDD--WIAVCGGRADDH-DTTP  349



>ref|XP_008371167.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Malus domestica]
Length=476

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 215/358 (60%), Gaps = 23/358 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSATVS+A +   SG  FAVKSA L+ S  LQ+E  ILS   SP++V 
Sbjct  1     MDWTRGRTIGLGSSATVSIAKSH-VSGEVFAVKSAKLAQSQFLQKEXAILSTLSSPHIVH  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G +IS E+ + LYNLFLEY PGGT+SD  +R  G   E  I  YA QIL G+  LHS 
Sbjct  60    YKGHNISTENGDVLYNLFLEYAPGGTISDAIRRQGGCLXEAAIXCYAKQILXGLQHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCD+K +NILV+E+ + VK+ADLGC + +        S   GTP +MAPEVA+GEEQ
Sbjct  120   QIAHCDVKCRNILVAENGANVKLADLGCARLVN---XDCDSPIGGTPLYMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCT+IEMATG APW D+ DPVSALYRI  SGD PE P   S   ++F+ KC
Sbjct  177   GIAADVWALGCTIIEMATGRAPWNDVCDPVSALYRIGFSGDAPEIPSSLSQQGRDFVAKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEM--------  923
             L  D   RW+A ELL+H F+    ++ +        SPT+V+D+ +W   E         
Sbjct  237   LIGDPLERWSAGELLEHGFVVEAPNDLL--------SPTTVLDRXLWEEEEFESDQIWHP  288

Query  924   SQPSCNSTATAGFPANRIGRLIIQAGERLPDWEED-GGWVTVRGNEEDESTDSEPILI  1094
             ++ S  S  +A     ++G  I  +    P+W  D   WVTVR +  ++   ++P  I
Sbjct  289   TRESSGSXYSAKERIRKLGEGIAASSRZXPNWASDEENWVTVRSDNFNKQDVAQPHTI  346



>ref|XP_010484689.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=339

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 209/348 (60%), Gaps = 27/348 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG  IGRGS+ATVS AT    SG   AVKSA    S  LQRE  ILS  +SP+V+ 
Sbjct  1     MNWTRGKIIGRGSTATVSAATLQ-ESGETIAVKSADFHRSEFLQREAKILSSLNSPHVIG  59

Query  234   CLGCDISCEHNN------ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGI  389
               G  I+ E  N        YNL +EY P G+L+D+A +  G   E  +  Y  QIL+G+
Sbjct  60    YRGYQITKESFNNYNGEATTYNLLMEYAPYGSLADVASKNGGSIDETRVVKYTRQILLGL  119

Query  390   GFLH-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPE  566
              ++H SMG  HCDIKG N+LV E+  A KIAD GC K +E      +    GTPAFMAPE
Sbjct  120   EYVHNSMGIAHCDIKGSNVLVGENGEA-KIADFGCAKRIE---PEITEPVRGTPAFMAPE  175

Query  567   VAKGEEQGFPADIWAFGCTVIEMATGSAPWQ--DMNDPVSALYRIANSGDVPEFPRWFSD  740
             VA+GE QG  +DIWA GCTVIEM TGS PW   D NDPVS LYR+   G+ PE P   ++
Sbjct  176   VARGERQGKESDIWAVGCTVIEMVTGSTPWSGADSNDPVSVLYRVGYLGESPELPCSLTE  235

Query  741   DAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-KEFVRNSPTSVMDQAVWNSI  917
              AK+FLGKCL +DAK RWTA++LL HPFL +   N        V NSPTSV DQ +W S+
Sbjct  236   QAKDFLGKCLKKDAKERWTASQLLNHPFLITKPDNEPELVTGLVTNSPTSVTDQMLWRSV  295

Query  918   EMSQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
             E  +PS   C+     G   +  G+ ++++      W+ DG  W+TVR
Sbjct  296   EEDRPSWWECHEDERIGV-LSWTGQFVVES-----TWDTDGADWITVR  337



>ref|XP_002889536.1| MAPKKK18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65795.1| MAPKKK18 [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 216/352 (61%), Gaps = 31/352 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG TIGRGS+ATVS AT    SG   AVKSA    S  LQRE  ILS  +SPYV+ 
Sbjct  1     MNWTRGKTIGRGSTATVSAATCY-KSGETIAVKSAEFHRSEFLQREAKILSSLNSPYVIG  59

Query  234   CLGCDISCE--HNNA---LYNLFLEYVPGGTLSDLA-KRGRF-SEPMIQFYAHQILMGIG  392
               GC+I+ E  +NN     YNL +EY P GTL+D+A K G F  E  +  Y  QIL+G+ 
Sbjct  60    YRGCEITREPVYNNGEATTYNLLMEYAPYGTLTDVAIKNGGFIDEARVVKYTRQILLGLE  119

Query  393   FLH-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEV  569
             ++H S G  HCDIKG N+L+ E+  A KIAD GC K++E      +    GTPAFMAPEV
Sbjct  120   YIHNSKGIAHCDIKGSNVLIGENGEA-KIADFGCAKWVE---PELTEPVRGTPAFMAPEV  175

Query  570   AKGEEQGFPADIWAFGCTVIEMATGSAPW--QDMNDPVSALYRIANSGDVPEFPRWFSDD  743
             A+GE QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   ++ 
Sbjct  176   ARGERQGKESDIWAVGCTVIEMVTGSPPWIGADSTDPVSVLYRVGYLGESPELPCSLTEQ  235

Query  744   AKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-  920
             AK+FLGKCL ++AK RWTA++LL HPFL +     VT    V NSPTSV DQ  W S+E 
Sbjct  236   AKDFLGKCLKKEAKERWTASQLLNHPFLLNKEPELVT--GLVTNSPTSVTDQMFWRSVEE  293

Query  921   ---MSQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTVRGN  1055
                  +PS   C+     G   + IG +++++      W+ DG  W+TVR N
Sbjct  294   EVSADRPSWWECHGDERIGV-LSWIGHVVVES-----TWDLDGEDWITVRRN  339



>dbj|BAD15943.1| protein kinase-like [Oryza sativa Japonica Group]
 dbj|BAD28858.1| protein kinase-like [Oryza sativa Japonica Group]
Length=453

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/349 (46%), Positives = 220/349 (63%), Gaps = 22/349 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IGRG++ATVS+AT    +G  FAVKS  ++ +G L+RE+ +LS   SP+VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDR-RTGGVFAVKSVDVARAGALRREQGMLSALASPFVVPC  64

Query  237   LGCDISCE---HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             +G  +S        A Y+LFLEY PGG+L+D  KR  GR  EP+I+     +L G+ ++H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSA-FSGTPAFMAPEVAKG  578
             + G  HCD+KG+N+LV  D  A+ +AD GC +++   + ++      GTP F+APE A+G
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAM-LADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARG  183

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QG  ADIWA GCTVIEMATG APW    DPV+AL+ +A+S DVPE P WFS + K+FL
Sbjct  184   EAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAEGKDFL  243

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFV--RNSPTSVMDQAVWNSIEMSQP  932
              +CL RD  +RWTA +LL+HPF+ S +S+S +    +  R SP S++DQ +W S      
Sbjct  244   ARCLIRDPAKRWTAEQLLEHPFVASAASDSTSKAVQIEQRVSPKSILDQCLWEST-----  298

Query  933   SCNSTATAGF-PANRIGRLIIQAGERLPDWE---EDGGWVTVRGNEEDE  1067
             S +S AT    PA+R+ R +       PDW    +D  W+ V G   D+
Sbjct  299   STDSDATVALAPADRL-RALSAGASVAPDWTWSMDD--WIAVCGGRADD  344



>ref|XP_010543009.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=349

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 210/339 (62%), Gaps = 11/339 (3%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW +G TIGRGS ATVS AT    S    AVKSA LS S +L+RE  ILS   SPYVV 
Sbjct  1     MEWTKGRTIGRGSCATVSAATYHN-SCDIIAVKSAELSRSELLEREAKILSSLSSPYVVG  59

Query  234   CLGCDISCEHNNA-LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               GC I+   +    Y++ +EY P GT++D A +  G   E ++  Y   IL G+ +LHS
Sbjct  60    YRGCGITNNPDGVDTYSILMEYAPYGTVADKAAKNGGGLEENLVVKYTRHILCGLEYLHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCDIKG N+L+ E+  A KIAD GC K ++  E+ S+    GTPAFMAPEVA+GE+
Sbjct  120   KGIAHCDIKGSNVLIGENGDA-KIADFGCAKRVDT-ESDSAETVRGTPAFMAPEVARGEK  177

Query  585   QGFPADIWAFGCTVIEMATGSAPWQ-DMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             QG  +DIWA GCTVIEMATGS PW  D  DPVS LYRI  SG+ PE P   ++  K+FL 
Sbjct  178   QGMESDIWAVGCTVIEMATGSLPWTIDSGDPVSVLYRIGYSGESPEIPCCLTEPTKDFLQ  237

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
             KCL R  + RWTA +LL HPFL    + S      + NSPTSVMD+  W S+E ++   N
Sbjct  238   KCLKRHPEERWTANQLLNHPFLAKPDAKSDPVSGSMSNSPTSVMDELFWGSVEEAEEEEN  297

Query  942   STATAGFPAN--RIGRLIIQAGERLPDWEEDGG-WVTVR  1049
                  G+ ++  RIGRL    G   P W+ +GG WVTVR
Sbjct  298   LDRPNGWVSHEERIGRL-WSVGNAGPTWDLEGGDWVTVR  335



>gb|KEH36902.1| MAP kinase kinase kinase [Medicago truncatula]
Length=335

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/345 (45%), Positives = 212/345 (61%), Gaps = 22/345 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IGRGS+ATV +A    + G  FAVKS  L  S +L++E+ IL++   P +V 
Sbjct  3     MDWSRGRIIGRGSTATVYVADRCHSGGEVFAVKSTELHRSELLKKEQQILTKLKCPQIVS  62

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGR-FSEPMIQFYAHQILMGIGFLHSMG  410
               GC+++ E+   L+NLF+EY P GTLSD  + G    E M+ FYA QIL+G+ +LH  G
Sbjct  63    YQGCEVTFENGVQLFNLFMEYAPKGTLSDAVRNGNGMEEAMVGFYARQILLGLNYLHLNG  122

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VHCD+KGQN+LV+E     KI+D GC + +E          SGTPAFMAPEVA+GEEQG
Sbjct  123   IVHCDLKGQNVLVTE--QGAKISDFGCARRVEE-----ELVISGTPAFMAPEVARGEEQG  175

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
             F +D+WA GCT++EM TG  PWQ  +DP + LYRI  SGDVPE P + S+  K+FL KCL
Sbjct  176   FASDVWALGCTLLEMITGKMPWQGFSDPAAVLYRIGFSGDVPEIPDYVSEQGKDFLRKCL  235

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAV--WNSIEMSQ---PS  935
              RD   RW+  ELL H F+     +      F   +PT+V++     W+S+E +Q   P+
Sbjct  236   KRDPNERWSVVELLGHEFVGKFKDSV-----FDSETPTTVLEGGFWDWDSLETTQDVVPT  290

Query  936   CNSTATAGFPA--NRIGRLIIQAGERLPDWEEDGGWVTVRGNEED  1064
                + ++   +  NRI  L   + E   + ++D  WVTVR N E+
Sbjct  291   LECSCSSDSSSLRNRIQSLC--SDEAFWESDDDDEWVTVRSNGEE  333



>ref|NP_001046691.2| Os02g0322400 [Oryza sativa Japonica Group]
 dbj|BAF08605.2| Os02g0322400 [Oryza sativa Japonica Group]
Length=425

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 223/355 (63%), Gaps = 23/355 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IGRG++ATVS+AT    +G  FAVKS  ++ +G L+RE+ +LS   SP+VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDR-RTGGVFAVKSVDVARAGALRREQGMLSALASPFVVPC  64

Query  237   LGCDISCE---HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             +G  +S        A Y+LFLEY PGG+L+D  KR  GR  EP+I+     +L G+ ++H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSA-FSGTPAFMAPEVAKG  578
             + G  HCD+KG+N+LV  D  A+ +AD GC +++   + ++      GTP F+APE A+G
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAM-LADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARG  183

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QG  ADIWA GCTVIEMATG APW    DPV+AL+ +A+S DVPE P WFS + K+FL
Sbjct  184   EAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAEGKDFL  243

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFV--RNSPTSVMDQAVWNSIEMSQP  932
              +CL RD  +RWTA +LL+HPF+ S +S+S +    +  R SP S++DQ +W S      
Sbjct  244   ARCLIRDPAKRWTAEQLLEHPFVASAASDSTSKAVQIEQRVSPKSILDQCLWEST-----  298

Query  933   SCNSTATAGF-PANRIGRLIIQAGERLPDWE---EDGGWVTVRGNEEDESTDSEP  1085
             S +S AT    PA+R+ R +       PDW    +D  W+ V G   D+  D+ P
Sbjct  299   STDSDATVALAPADRL-RALSAGASVAPDWTWSMDD--WIAVCGGRADDH-DTTP  349



>ref|XP_009357591.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Pyrus x bretschneideri]
Length=437

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 219/353 (62%), Gaps = 22/353 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG TIG GSSATVS+A +   SG  FAVKSA LS S  LQ+E+ IL+   SPY+V+
Sbjct  1     MDWTRGRTIGLGSSATVSIAKSH-RSGEVFAVKSAELSQSQFLQKEQTILATLSSPYIVQ  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G +IS E+   LYNLFLEY PGGT+SD  +R  G  +E + + YA QIL+G+  LHS 
Sbjct  60    YKGHNISNENGAVLYNLFLEYAPGGTISDAIRRQGGCLNEAVTRCYARQILLGLQHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCD+K QNILV+E+ + VK+ADLGC   +     S      GTP +M PEVA+GE+Q
Sbjct  120   QIAHCDVKCQNILVAENGAKVKLADLGCAHRVNYDRGS---PIGGTPLYMPPEVARGEDQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCT+IEMATG APW D+ DPVSALYRI  SGD P  P   S   ++F+ KC
Sbjct  177   GIAADVWALGCTIIEMATGRAPWPDVCDPVSALYRIGVSGDAPGIPSSLSKQGRDFVAKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAV----WNSIEMSQPS  935
             L RD   RW+A ELL+H FL    ++ +        SPT+V+D+ +    ++S ++  P+
Sbjct  237   LIRDPLERWSAGELLEHGFLLEAPNDLL--------SPTTVLDRDLLEEEFDSDQIWDPT  288

Query  936   CNSTATAGFPANRIGRLI--IQAGERLPDWE-EDGGWVTVRGNE-EDESTDSE  1082
             C S  +      RI  L     +   LP+W  ++  WVTVR N  E++  D +
Sbjct  289   CESGCSDCSAKERIRHLSEGNASSLELPNWACDEDNWVTVRSNNIENQDLDQK  341



>emb|CBI23211.3| unnamed protein product [Vitis vinifera]
Length=1122

 Score =   309 bits (792),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 175/358 (49%), Positives = 221/358 (62%), Gaps = 16/358 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+GRGSSATVS+AT+   SG  FAVKS  LS S +L+RE+ ILS   S +V++
Sbjct  1     MDWTRGCTLGRGSSATVSIATSH-LSGDIFAVKSTELSQSKLLKREQRILSTVRSAHVIE  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               G +++CE+   +YNL +EY  GGTL    +RG   E  I+     IL G+ +LHS   
Sbjct  60    YRGWNVTCENGKQMYNLCMEYAAGGTLK---QRGSLGEAAIRANTRAILQGLQYLHSNCI  116

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK +NIL++ D   +KI DLGC +  ++     S +  GTPAFMAPEVA+GEEQGF
Sbjct  117   VHCDIKSENILITGD--GLKIGDLGCARLADD----FSDSVCGTPAFMAPEVARGEEQGF  170

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCT+IEMATG APW D++DPVSA+YRI  SGDVPE P W S+DAK+FLGKCL 
Sbjct  171   AADVWALGCTIIEMATGRAPWTDVSDPVSAVYRIGFSGDVPEIPGWVSEDAKDFLGKCLV  230

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVW-NSIEMSQPSCNSTA  950
             RD  +RW+  ELL HPF+      S        +SPTSV+DQ  W +SIE   P    + 
Sbjct  231   RDPVQRWSVGELLGHPFVNEACVFSKEVYGSSSSSPTSVLDQRFWSSSIEELYPFHKKSW  290

Query  951   TAGFPANRIGRLI-IQAGERLPDWEEDGGWVTVRGN--EEDESTDSEPILISILCPED  1115
              +  P  RI  L    +   LP+W  D  WVTVR    EE E     P        ED
Sbjct  291   NS--PRERIHFLANSNSNSGLPNWGWDENWVTVRSGSMEEPEVVSEAPTATMAWAGED  346


 Score =   306 bits (784),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 217/340 (64%), Gaps = 14/340 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+GRGSSATVS+AT+   SG  FAVKS  LS S +L+RE+ ILS   S +V++
Sbjct  444   MDWTRGCTLGRGSSATVSIATSH-LSGDIFAVKSTELSQSKLLKREQRILSTVRSAHVIE  502

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               G +++CE+   +YNL +EY  GGTL    +RG   E  I+     IL G+ +LHS   
Sbjct  503   YRGWNVTCENGKQMYNLCMEYAAGGTLK---QRGSLGEAAIRANTRAILQGLQYLHSNCI  559

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCDIK +NIL++ +   +KI DLGC +  ++     S +  GTPAFMAPEVA+GEEQGF
Sbjct  560   VHCDIKSENILITGE--GLKIGDLGCARLADD----FSDSVCGTPAFMAPEVARGEEQGF  613

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCT+IEMATG APW D++DPVSA+YRI  SGDVPE P W S++AK+FLGKCL 
Sbjct  614   AADVWALGCTIIEMATGRAPWTDVSDPVSAVYRIGFSGDVPEIPGWVSEEAKDFLGKCLV  673

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVW-NSIEMSQPSCNSTA  950
             RD  +RW+  ELL HPF+      S        +SPTSV+DQ  W +SIE   P    + 
Sbjct  674   RDPVKRWSVGELLGHPFVNEACVFSKEVYGSSSSSPTSVLDQRFWSSSIEELYPFHKKSW  733

Query  951   TAGFPANRIGRLI-IQAGERLPDWEEDGGWVTVRGNEEDE  1067
              +  P  RI  L    +   LP+W  D  WVTVR    +E
Sbjct  734   NS--PRERIQFLANSNSNSGLPNWGWDENWVTVRSGSMEE  771



>gb|EEC73042.1| hypothetical protein OsI_06987 [Oryza sativa Indica Group]
Length=448

 Score =   294 bits (753),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 159/349 (46%), Positives = 220/349 (63%), Gaps = 22/349 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IGRG++ATVS+AT    +G  FAVKS  ++ +G L+RE+ +LS   SP+VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDR-RTGGVFAVKSVDVARAGALRREQGMLSALASPFVVPC  64

Query  237   LGCDISCE---HNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             +G  +S        A Y+LFLEY PGG+L+D  KR  GR  EP+I+     +L G+ ++H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSA-FSGTPAFMAPEVAKG  578
             + G  HCD+KG+N+LV  D  A+ +AD GC +++   + ++      GTP F+APE A+G
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAM-LADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARG  183

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E QG  ADIWA GCTVIEMATG APW    DPV+AL+ +A+S DVPE P WFS + K+FL
Sbjct  184   EAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAEGKDFL  243

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFV--RNSPTSVMDQAVWNSIEMSQP  932
              +CL RD  +RWTA +LL+HPF+ S +S+S +    +  R SP S++DQ +W S      
Sbjct  244   ARCLIRDPAKRWTAEQLLEHPFVASAASDSTSKAVQIEQRVSPKSILDQCLWEST-----  298

Query  933   SCNSTATAGF-PANRIGRLIIQAGERLPDWE---EDGGWVTVRGNEEDE  1067
             S +S AT    PA+R+ R +       PDW    +D  W+ V G   D+
Sbjct  299   STDSDATVALAPADRL-RALSAGASVAPDWTWSMDD--WIAVCGGRADD  344



>ref|XP_010046333.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Eucalyptus grandis]
 gb|KCW88768.1| hypothetical protein EUGRSUZ_A01110 [Eucalyptus grandis]
Length=422

 Score =   293 bits (751),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 232/380 (61%), Gaps = 40/380 (11%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG T+GRGS+A VSLAT+A  SG  FAVKSA L +S  LQRE+ ILS   SP VV+
Sbjct  1     MEWTRGRTVGRGSTAVVSLATSA-ESGEVFAVKSAELGASASLQREQRILSSLASPRVVE  59

Query  234   CLGCDISCEHNNA--LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
               G  ++ E  +    YNLF+E+VPGGTL+DL ++  GR S+P I  YA QIL G+  LH
Sbjct  60    YRGFGVTREGGDGRLTYNLFMEFVPGGTLADLTRKLGGRLSQPAIARYARQILEGLEHLH  119

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSA--FSGTPAFMAPEVAK  575
             S G  HCD+KG NIL+ ED    K+AD GC + +++  A++ +   F GTP +M+PEVA+
Sbjct  120   SRGIAHCDVKGSNILMGED--GPKLADFGCARRVDDPAAAAEAEAPFGGTPMYMSPEVAR  177

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GEEQG   D+WA GCTV+EMATG APW+   DP S LY+IA SG+ PE P W S+ A++F
Sbjct  178   GEEQGRACDVWALGCTVVEMATGGAPWRG-GDPASVLYKIAYSGESPEIPGWLSEGARDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFL--QSISSNSVTFKEFVR---------NSPTSVMDQA  902
             LGKCL RD + RWT  +LL H FL  +  S + + F+   R          SPTSV+D+ 
Sbjct  237   LGKCLRRDPRGRWTPRQLLGHSFLLGECESESELDFRGAKRIREWESSASTSPTSVLDRG  296

Query  903   VWNSIEMSQPSCNSTATAGF---------PANRIGRLIIQAGERLPDW-----EEDGGWV  1040
              W+S   ++P    T+ AG+          A+RI RL   +      W       +G W+
Sbjct  297   AWSS--AAEP---ETSAAGYDGACVGDETAADRIRRLSASSVGPRSMWDGDGDGAEGDWI  351

Query  1041  TVRGNEEDESTDSEPILISI  1100
              VRG  +D+  + EP   SI
Sbjct  352   DVRGCVDDDVGNEEPADSSI  371



>ref|XP_009141244.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Brassica rapa]
Length=357

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 206/352 (59%), Gaps = 28/352 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  A     S    AVKS+ +  S  LQRE  ILS  +SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATVCSAMCHN-SNEILAVKSSEIHRSEFLQREAKILSSLNSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+D AK+  GR  E MI  Y  +IL G+ ++HS
Sbjct  60    YRGSETKIESNGVVTYNLLMEYAPYGTLTDAAKKNGGRLEEAMIVKYTREILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V+E   A K+AD GC K +       S A +GTPAFMAPEVA+GE+
Sbjct  120   KGIAHCDVKGSNVVVAEKGEA-KLADFGCAKRV------GSEAVTGTPAFMAPEVARGEK  172

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + +   DPVS LYR+  SG+ PE P   +++AK+F
Sbjct  173   QGSESDIWAVGCTVIEMATGSPPWTEASSREDPVSVLYRVGYSGETPELPCLLTEEAKDF  232

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISS-NSVTFKEFVRNSPTSVMDQAVWNSIE----  920
             L  C  R+AK RWTA +LL HPFL        V     V +SPTSV DQ  W S+E    
Sbjct  233   LKMCFKREAKERWTATQLLNHPFLIGKPDIEPVLGSGLVSSSPTSVTDQTFWRSVEDEIV  292

Query  921   ------MSQPSCN--STATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
                   +   S N        F   RIGRL    G   P W+ +GG WVTVR
Sbjct  293   EEEAVDLQDESRNLDRLNLWAFHLERIGRLRCVGGLDGPRWDMEGGDWVTVR  344



>ref|XP_009394082.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Musa acuminata subsp. malaccensis]
Length=407

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 211/343 (62%), Gaps = 15/343 (4%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  +GRG+SATVS+A A+ +SG  FAVKSA LSSSG LQRE+ ILS  DSPYVV   
Sbjct  6     WRRGRIVGRGASATVSVA-ASLSSGEIFAVKSAELSSSGDLQREQRILSSLDSPYVVSYF  64

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G ++        Y+LF+EY PGG++SD  K+  GR  E  I+ Y   +L G+ +LHS G 
Sbjct  65    GFEV-----GLCYDLFMEYAPGGSMSDEIKKRGGRLDELNIRSYTCDLLRGLAYLHSNGV  119

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFL--ENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             VHCD+K QN+L+     A KIAD GC +    E+ +        GTP FMAPEVA+GEEQ
Sbjct  120   VHCDLKSQNVLICSGGRA-KIADFGCARRADEEDKDGGGRVQPRGTPMFMAPEVARGEEQ  178

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
               PAD+WA GCTVIEMATG  PW   +DPVSAL+RIA S  VPEFP W S+D  +FL +C
Sbjct  179   SAPADVWALGCTVIEMATGQPPWPHASDPVSALHRIAFSAAVPEFPCWLSEDGNDFLSRC  238

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD + RW+A +LL+HPF+ S +SN + ++     SP S +DQ  W+++   +   +  
Sbjct  239   LRRDPRERWSAEQLLRHPFVASWTSNPLDYRWV---SPKSTLDQGFWSALSEEEEEEDEE  295

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTD  1076
             +    PA      +       P+W     WVTVR +  D S D
Sbjct  296   SLEQ-PAEDASERMQSLLGIAPNWTWGEDWVTVRSDGRDRSVD  337



>ref|NP_172003.1| mitogen-activated protein kinase kinase kinase 18 [Arabidopsis 
thaliana]
 gb|AAC97990.1| Strong similarity to Dsor1 protein kinase gb|D13782 from Drosophila 
melanogaster [Arabidopsis thaliana]
 gb|AAL36395.1| putative NPK1-related MAP kinase [Arabidopsis thaliana]
 gb|AAM14033.1| putative NPK1-related MAP kinase [Arabidopsis thaliana]
 gb|AAO42413.1| putative NPK1-related MAP kinase [Arabidopsis thaliana]
 gb|AEE27791.1| mitogen-activated protein kinase kinase kinase 18 [Arabidopsis 
thaliana]
Length=339

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/352 (48%), Positives = 212/352 (60%), Gaps = 31/352 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG T+GRGS+ATVS AT    SG   AVKSA    S  LQRE  ILS  +SPYV+ 
Sbjct  1     MNWTRGKTLGRGSTATVSAATCH-ESGETLAVKSAEFHRSEFLQREAKILSSLNSPYVIG  59

Query  234   CLGCDISCE--HNNA---LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIG  392
               GC+I+ E  HNN     Y+L +EY P GTL+D+A +  G   E  +  Y  QIL+G+ 
Sbjct  60    YRGCEITREPFHNNGEATTYSLLMEYAPYGTLTDVATKNGGFIDEARVVKYTRQILLGLE  119

Query  393   FLH-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEV  569
             ++H S G  HCDIKG N+LV E+  A KIAD GC K++E      +    GTPAFMAPE 
Sbjct  120   YIHNSKGIAHCDIKGSNVLVGENGEA-KIADFGCAKWVE---PEITEPVRGTPAFMAPEA  175

Query  570   AKGEEQGFPADIWAFGCTVIEMATGSAPW--QDMNDPVSALYRIANSGDVPEFPRWFSDD  743
             A+GE QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G++PE P   ++ 
Sbjct  176   ARGERQGKESDIWAVGCTVIEMVTGSQPWIGADFTDPVSVLYRVGYLGELPELPCSLTEQ  235

Query  744   AKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE-  920
             AK+FLGKCL ++A  RWTA++LL HPFL +     VT    V NSPTSV DQ  W S+E 
Sbjct  236   AKDFLGKCLKKEATERWTASQLLNHPFLVNKEPELVT--GLVTNSPTSVTDQMFWRSVEE  293

Query  921   ------MSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTVRGN  1055
                    S   C+     G   + IG +++++      W+ DG  W+TVR N
Sbjct  294   EVSEDRSSWWECHEDERIGV-LSWIGHVVVES-----TWDLDGEDWITVRRN  339



>emb|CDY19144.1| BnaA04g18840D [Brassica napus]
Length=357

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 165/352 (47%), Positives = 206/352 (59%), Gaps = 28/352 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  A     S    AVKS+ +  S  LQRE  ILS  +SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATVCSAMCHN-SNEILAVKSSEIHRSEFLQREAKILSSLNSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+D AK+  GR  E MI  Y  +IL G+ ++HS
Sbjct  60    YRGSETKIESNGVVTYNLLMEYAPYGTLTDAAKKNGGRLEEAMIVKYTREILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V+E   A K+AD GC K +       S A +GTPAFMAPEVA+GE+
Sbjct  120   KGIAHCDVKGSNVVVAEKGEA-KLADFGCAKRV------GSEAVTGTPAFMAPEVARGEK  172

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + +   DPVS LYR+  SG+ PE P   +++AK+F
Sbjct  173   QGSESDIWAVGCTVIEMATGSPPWTEASSREDPVSVLYRVGYSGETPELPCLLTEEAKDF  232

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISS-NSVTFKEFVRNSPTSVMDQAVWNSIE----  920
             L  C  R+AK RWTA +LL HPFL S      V     V +SPTSV DQ  W S+E    
Sbjct  233   LKMCFKREAKERWTATQLLNHPFLISKPDIEPVLGSGLVSSSPTSVTDQTFWRSVEDEIV  292

Query  921   ------MSQPSCNSTATAGFPA--NRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
                   +   S N            RIGRL    G   P W+ +GG W+TVR
Sbjct  293   EEEAVDLQDESRNLDRLNLLACYLERIGRLRCVGGLDGPRWDMEGGDWITVR  344



>ref|XP_006342282.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=338

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 211/345 (61%), Gaps = 27/345 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  IG GS+A VS+A +   +G  FAVKS  LS S  L++E+ ILS  +SPYVV 
Sbjct  1     MDWTRGHIIGHGSTAAVSVAMSR-CTGEIFAVKSTELSRSEFLEKEQKILSTLNSPYVVD  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+N  ++NL +EY+P GTL D  ++  G+ +E +I+ Y  QI+ G+ +LHS 
Sbjct  60    YKGYDVTRENNKVMFNLMMEYMPDGTLIDEIRKQGGQLNEELIRHYTKQIVQGLDYLHSK  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NIL+    +  KI D GC K ++           GTP FMAPEV +GEEQ
Sbjct  120   GIVHCDIKGHNILLCN--TGAKIGDFGCSKRVD------GVTIGGTPMFMAPEVVRGEEQ  171

Query  588   GFPADIWAFGCTVIEMATGSAPWQD-----MNDPVSALYRIANSGDVPEFPRWFSDDAKE  752
             GF ADIWA GCT+IEMATG +PW       +N+  S LY IA SG  PE P++ S  AK+
Sbjct  172   GFRADIWALGCTIIEMATGGSPWTSVVNSTVNNSASLLYHIAFSGLTPEIPKFLSSQAKD  231

Query  753   FLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP  932
             FL KCL RD K+R +A ELL+H FL   +  +  FK     SPTSV+DQ +WNS E S+ 
Sbjct  232   FLKKCLRRDQKQRCSAKELLKHRFLDLYNEENQDFKTC---SPTSVIDQCIWNSNEESEI  288

Query  933   SCNST-----ATAGFPANRIGRLIIQAGERLPDWEED-GGWVTVR  1049
               +S              R+ +L +Q+G+  PDW+ D   W+ VR
Sbjct  289   IDDSIQEMSRCLTDLTLQRVRKLELQSGK--PDWKLDYECWIMVR  331



>ref|XP_003596952.1| Mitogen-activated protein kinase kinase kinase A [Medicago truncatula]
 gb|ABN08520.1| Protein kinase [Medicago truncatula]
 gb|AES67203.1| MAP kinase kinase kinase [Medicago truncatula]
Length=400

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 168/383 (44%), Positives = 226/383 (59%), Gaps = 23/383 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAH--LSSSGMLQREKDILSQFDSPYV  227
             MEW RG  IG GSSATV LAT+  ++    AVKSA   L +S  LQ E+ ILS   SPY+
Sbjct  3     MEWTRGNIIGHGSSATVYLATSRRSTDVS-AVKSAETSLPNSNQLQSEQRILSSLSSPYI  61

Query  228   VKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             V   GC+ S E+N  L+NLF+EY+P G LS +  R  GR +E MI +Y  QI+ G+ +LH
Sbjct  62    VTYKGCNFSKENNKHLFNLFMEYMPFGNLSQVTCRNGGRLNEAMIAYYTRQIVEGLEYLH  121

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             S   VHCDIKG NILV E    VKI D GC K ++    ++     GTP +MAPEVA+GE
Sbjct  122   SKDVVHCDIKGSNILVCE--KGVKIGDFGCAKMIDEIAPAA-----GTPMYMAPEVARGE  174

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQGFP D+W+ GCT++EMATG +PW ++ D V  LYR+A S +VP  P + S+ AK+FL 
Sbjct  175   EQGFPCDVWSLGCTIVEMATGFSPWSNVEDSVHVLYRVAYSDEVPMIPCFLSEQAKDFLE  234

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP---  932
             KCL RD+K RW+ ++LL+H FL          +EF   SPTS+++Q  WN  E S+    
Sbjct  235   KCLRRDSKERWSCSQLLKHQFLD---CGVEKIEEFDSCSPTSILEQGFWNCDEGSESFFF  291

Query  933   -SCNSTATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDE-STDSEPILISIL  1103
                        P  RI +L + +  R P W+  D  W+T R N+ D  S+ S+ +    L
Sbjct  292   DDLGKINFVNCPVGRIKKLALCS--RDPCWKWGDENWITTRENDADAGSSISDELDFDEL  349

Query  1104  CPEDLESSIVNEAPSFDSSDDEI  1172
                D    I  +   +D S+ +I
Sbjct  350   EKSDFSGRISGDYFGYDYSNCKI  372



>ref|XP_007212556.1| hypothetical protein PRUPE_ppa015439mg, partial [Prunus persica]
 gb|EMJ13755.1| hypothetical protein PRUPE_ppa015439mg, partial [Prunus persica]
Length=339

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 212/349 (61%), Gaps = 28/349 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGPTIG GSSATVS+A + G SG  FAVKSA LS S  LQ E+ ILS   S  +V 
Sbjct  1     MDWTRGPTIGHGSSATVSIAKSHG-SGEVFAVKSAKLSQSHSLQMEQTILSTLSSAQIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GC+ S E+    YN+FLEY PGGTLSD  +R  G  +E  I+ Y  QIL+G+  LHS 
Sbjct  60    YKGCNTSTENGTVFYNIFLEYAPGGTLSDAIRRQGGCLNEAAIRSYTRQILLGLHHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCDIKGQN+LV+ + + VK+ADLGC K +     +      GTP +MAPEVA+GE+Q
Sbjct  120   QIAHCDIKGQNVLVTNNGAEVKLADLGCAKRVN---FAHGLPIGGTPVYMAPEVARGEQQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCTVIEMATG APW  ++DPVSA+YRI  SG+VPE P   S   ++F+ KC
Sbjct  177   GLAADVWALGCTVIEMATGRAPWPCVSDPVSAMYRIGFSGEVPEIPSSLSKQGRDFVTKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNS-----IE----  920
             L RD   RW+A ELL+H FL    +  +        SPT+V+D  +W       +E    
Sbjct  237   LMRDPMERWSAGELLKHEFLFEAPNYWL--------SPTTVLDHGLWEEEFDLDLEHIWE  288

Query  921   -MSQPSCNSTATAGFPANRIGRLIIQAGERLPDW--EEDGGWVTVRGNE  1058
                Q  C ++A         G+ +  +G  + +W  +++  WVTVR N+
Sbjct  289   PTHQSGCPNSARGRIRQLSEGKAVSFSG--VTNWACDDEDFWVTVRSND  335



>ref|XP_004134977.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis sativus]
Length=396

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/349 (44%), Positives = 216/349 (62%), Gaps = 26/349 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRG TIGRGSSA VS+AT     G   AVKS   S    L+RE+ ILSQ +   V+ 
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDI-RFGQVMAVKSVEFSHLDFLKREQRILSQLNCSRVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+ N + NL +E+ PGG++ D  ++  GR  E   QFY  ++L G+ ++HS 
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKAGGRLDEATAQFYTREVLSGLQYVHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK  NIL+ ED   +KIAD GC + +E     S    +GTP FMAPEVA+GE+Q
Sbjct  120   GVVHCDIKCCNILMGED--GIKIADFGCARRVEE---VSGGNLAGTPIFMAPEVARGEKQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF AD+W+ GC VI+M TG  PW +++DP++A+YRI +  D+PE PR  S+  K+FL +C
Sbjct  175   GFAADVWSVGCAVIQMVTGRVPWANLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFLRRC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ------  929
             L RD + RW+  ELL+HPF+Q   S+    K+  R +PTS++DQ +W+++   +      
Sbjct  235   LIRDPEERWSVNELLKHPFVQEQKSHP---KQNSR-TPTSILDQGIWDTVNDPETVESPI  290

Query  930   -PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR--GNEEDE  1067
              P    T     P  RI +L   +   +P+WE D  W+TVR  G EE++
Sbjct  291   RPKIQRT-----PLQRIQQLNEVSTIGIPNWECDEDWITVRSIGLEEND  334



>ref|XP_006305299.1| hypothetical protein CARUB_v10009674mg [Capsella rubella]
 gb|EOA38197.1| hypothetical protein CARUB_v10009674mg [Capsella rubella]
Length=336

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 213/351 (61%), Gaps = 34/351 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG  +GRGS+ATVS AT    SG   AVKSA    S  LQRE +ILS  +SP+V+ 
Sbjct  1     MNWTRGKIVGRGSTATVSAATCQ-ESGETIAVKSAEFHRSEFLQREAEILSSLNSPHVIG  59

Query  234   CLGCDISCE--HNN----ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGI  389
               GC I+ E   NN      YNL +EY P GTL+D+A +  G   E  +  Y  Q+L+G+
Sbjct  60    YRGCAITKEPSSNNDGEATTYNLLMEYAPYGTLADVASKNGGFLEEARVVKYTRQLLLGL  119

Query  390   GFLH-SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPE  566
              ++H SMG  HCD+KG N+L+ E+  A KIAD GC K +E      +    GTPAFMAPE
Sbjct  120   EYIHNSMGIAHCDVKGSNVLIGENGEA-KIADFGCAKRVE---PERTEPVRGTPAFMAPE  175

Query  567   VAKGEEQGFPADIWAFGCTVIEMATGSAPWQDM--NDPVSALYRIANSGDVPEFPRWFSD  740
             VA+GE QG  +DIWA GCTVIEM TGS PW     NDPVS LYR+   G+ PE P   ++
Sbjct  176   VARGERQGRESDIWAVGCTVIEMVTGSTPWSGAGWNDPVSVLYRVGYLGESPELPCSLTE  235

Query  741   DAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE  920
              AK+FLGKCL ++AK RWTA++LL HPFL  I+   +     V NSPTSV DQ  W S+E
Sbjct  236   QAKDFLGKCLKKEAKERWTASQLLNHPFL--ITKPEMMVTSLVTNSPTSVTDQMFWRSVE  293

Query  921   MSQ--PS---CNSTATAGFPANRIGRLIIQAGERLPD--WEEDGG-WVTVR  1049
              S+  PS   C+          RIG L   +G+ + D  W+ DG  W+TVR
Sbjct  294   ESEDRPSWWECHED-------ERIGVLSC-SGQFVVDSTWDMDGADWITVR  336



>ref|XP_008441103.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis melo]
Length=463

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/350 (45%), Positives = 220/350 (63%), Gaps = 29/350 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRG T+GRGSSA VS+AT    SG   AVK+   S    L+RE+ ILSQ +   V+ 
Sbjct  1     MEWIRGRTLGRGSSAAVSVATDL-RSGQVMAVKTVEFSRLDFLKREQRILSQLNCSRVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+ N + NL +E+ PGG++ D  ++  GR  E   QFY  +IL G+ ++HS 
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDTMEKAGGRLDEATAQFYTREILSGLHYVHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK  NILV ED   +KIAD GC + +E+    +    +GTP FMAPEVA+GE+Q
Sbjct  120   GVVHCDIKCCNILVGED--GIKIADFGCARRVEDVFGGN---LAGTPIFMAPEVARGEKQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF AD+W+ GC VI+M TG APW +++DP++A+YRI +  D+PE PR  S+  K+FL +C
Sbjct  175   GFAADVWSVGCAVIQMVTGRAPWANLSDPLAAIYRIGSGDDLPEIPRNMSEQGKDFLRRC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD + RW+  ELL+HPF+Q   SN    K+  R +PTS+++Q +W+++       N  
Sbjct  235   LIRDPEERWSVNELLKHPFVQEQKSNP---KQNSR-TPTSILEQGIWDTV-------NDP  283

Query  948   ATAGFPAN-RIGRLIIQAGERL-------PDWEEDGGWVTVR--GNEEDE  1067
              T   P   +I R  +Q  ++L       P+WE D  W+TVR  G EE++
Sbjct  284   ETVESPIRPKIHRTPLQRIQQLNEVSTNGPNWECDEDWITVRSIGLEEND  333



>gb|KGN49092.1| hypothetical protein Csa_6G513560 [Cucumis sativus]
Length=402

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/349 (44%), Positives = 216/349 (62%), Gaps = 26/349 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEWIRG TIGRGSSA VS+AT     G   AVKS   S    L+RE+ ILSQ +   V+ 
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDI-RFGQVMAVKSVEFSHLDFLKREQRILSQLNCSRVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G D++ E+ N + NL +E+ PGG++ D  ++  GR  E   QFY  ++L G+ ++HS 
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKAGGRLDEATAQFYTREVLSGLQYVHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIK  NIL+ ED   +KIAD GC + +E     S    +GTP FMAPEVA+GE+Q
Sbjct  120   GVVHCDIKCCNILMGED--GIKIADFGCARRVEE---VSGGNLAGTPIFMAPEVARGEKQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             GF AD+W+ GC VI+M TG  PW +++DP++A+YRI +  D+PE PR  S+  K+FL +C
Sbjct  175   GFAADVWSVGCAVIQMVTGRVPWANLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFLRRC  234

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ------  929
             L RD + RW+  ELL+HPF+Q   S+    K+  R +PTS++DQ +W+++   +      
Sbjct  235   LIRDPEERWSVNELLKHPFVQEQKSHP---KQNSR-TPTSILDQGIWDTVNDPETVESPI  290

Query  930   -PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVR--GNEEDE  1067
              P    T     P  RI +L   +   +P+WE D  W+TVR  G EE++
Sbjct  291   RPKIQRT-----PLQRIQQLNEVSTIGIPNWECDEDWITVRSIGLEEND  334



>gb|EYU33995.1| hypothetical protein MIMGU_mgv1a025547mg, partial [Erythranthe 
guttata]
Length=330

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/339 (45%), Positives = 208/339 (61%), Gaps = 17/339 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  IG G++A VS+AT+   SG  FAVKSA LS S  LQRE  ILS  ++P+++   
Sbjct  4     WTRGHIIGHGATAAVSVATSQ-ISGEIFAVKSAELSQSEPLQREHKILSTLNNPHIICYK  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGFVH  419
             GC+IS E+N  ++NL +E+ P GT++D   R +  E  I +Y   IL G+ +LHS G VH
Sbjct  63    GCNISVENNKPIFNLMMEFAPKGTIADRILRIQLDETSIGYYTCGILKGLEYLHSKGIVH  122

Query  420   CDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPA  599
             CDIKG N+L++E  + VKI D GC KF      +  +A  GTP +M+PE A+GEEQ FPA
Sbjct  123   CDIKGSNVLLTE-LNEVKITDFGCAKF------ADEAAIGGTPMYMSPEAARGEEQSFPA  175

Query  600   DIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRD  779
             DIWA GCTVIEM+TG +PW +     + L RIA SG+ PE P + S +AK+FL KCL  D
Sbjct  176   DIWALGCTVIEMSTGKSPWPNA---AATLRRIAFSGESPEIPDFISGEAKDFLSKCLRVD  232

Query  780   AKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE---MSQPSC--NS  944
              K+RWTA ELL+HPFL       +   E    SPTS++D  +W+ +E   +S+  C  N 
Sbjct  233   PKQRWTAKELLRHPFLDEFRFEHLEKIEDNTCSPTSILDHGIWSLVEEEVLSETPCEVNY  292

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEE  1061
                +  P  RI  L   +  R  +WE    W+ VR +E+
Sbjct  293   EDLSDSPMERIKELATNSSGR-ANWEWRESWIIVRDSEK  330



>ref|XP_007217243.1| hypothetical protein PRUPE_ppa006485mg [Prunus persica]
 gb|EMJ18442.1| hypothetical protein PRUPE_ppa006485mg [Prunus persica]
Length=409

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 202/316 (64%), Gaps = 17/316 (5%)
 Frame = +3

Query  162   LSSSGMLQREKDILSQFDSPYVVKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--G  335
             +S S  L+RE+ ILS   SP+++  +G D++ E N  +YNLF+EY+P GT+ D      G
Sbjct  1     MSQSEFLRREQKILSALRSPHIISYMGHDMTSESNKLMYNLFIEYMPRGTIIDEIHNHGG  60

Query  336   RFSEPMIQFYAHQILMGIGFLHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGE  515
             +  E +I+ Y   I+ G+ +LHS G VHCDIKG+NILV +D    KIAD GC ++  N  
Sbjct  61    QIDESLIRDYTRDIVKGLEYLHSHGLVHCDIKGRNILVGDD--GPKIADFGCARW-ANPA  117

Query  516   ASSSSAFSGTPAFMAPEVAKGEEQGFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYR  692
                +    GTP FMAPEVA+GEEQGFP D+WA GCT+IEMATG S PW +  +PVS LY+
Sbjct  118   GEVAVPIVGTPMFMAPEVARGEEQGFPCDVWALGCTIIEMATGGSVPWPNAANPVSVLYQ  177

Query  693   IANSGDVPEFPRWFSDDAKEFLGKCLDRDAKRRWTAAELLQHPFLQS-----ISSNSVTF  857
             IA SG+VPE P + SD AKEFLGKCL RD   RWTA++LL+H FL       I+S++   
Sbjct  178   IAYSGEVPEIPSFLSDQAKEFLGKCLRRDPTERWTASQLLKHSFLGEKEELIITSSAKQV  237

Query  858   KEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGFPA----NRIGRLIIQAGERLPDWEE  1025
             +E    SPTS++DQ +WNS+E S+   N      F      +RI RL + +G   P W  
Sbjct  238   QESTSFSPTSILDQGLWNSLEESETLGNLVQFPSFENSSSDHRIRRLSLSSGN--PRWAL  295

Query  1026  DGGWVTVRGNEEDEST  1073
             D  W+TVRGN+ +ES 
Sbjct  296   DETWITVRGNDCEESN  311



>ref|XP_009403738.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=455

 Score =   290 bits (741),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 212/342 (62%), Gaps = 19/342 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W RG  IGRG+SATVSLAT+  +SG  FAVKS+ LS S +LQRE+ ILS  DSP+VV   
Sbjct  6     WRRGRIIGRGTSATVSLATSV-SSGDVFAVKSSELSRSWLLQREQRILSALDSPFVVSYF  64

Query  240   GCDISCEHNNA--LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             G D++ +   A   YNLF+EY   G+LSD  ++  GR  E  I+ YA  IL G+ +LHS 
Sbjct  65    GFDVAAQTPGAGLCYNLFMEYAARGSLSDEIRKQGGRLDELAIRSYACDILGGLAYLHSN  124

Query  408   GFVHCDIKGQNILVSEDCSA--VKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGE  581
             G  HCD+K QN+L+   CS    K+AD GC +  E  +        GTP FMAPEVA+GE
Sbjct  125   GVFHCDLKSQNVLI---CSGGRAKVADFGCARSAEEEDEDERGWMRGTPMFMAPEVARGE  181

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             EQ  PADIWA GCTVIEMATG  PW  ++D +SAL++IA + DVPEFPRW S++ ++FL 
Sbjct  182   EQSAPADIWALGCTVIEMATGRPPWPLVSDALSALHQIAFATDVPEFPRWISEEGRDFLS  241

Query  762   KCLDRDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSC  938
             +CL RD   RWTA +LLQHPF+  S  +N  +  +++  SP S +DQA   S+       
Sbjct  242   RCLRRDPLERWTAEQLLQHPFVAASRVANPPSKSDWI--SPKSTLDQAFLQSLSDDDDDD  299

Query  939   NSTA---TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGN  1055
             +      T   P  R+  LI   G+  P+W  D  W TVR N
Sbjct  300   DGQVLDQTEEDPFERMQSLI---GDAAPNWTWDETWATVRSN  338



>ref|XP_002881230.1| MAPKKK17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57489.1| MAPKKK17 [Arabidopsis lyrata subsp. lyrata]
Length=372

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 205/351 (58%), Gaps = 24/351 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  AT    S    AVKS+ L  S  LQRE  ILS  +SPYV+ 
Sbjct  1     MEWTRGKILGRGSTATVYAATCHN-SDEILAVKSSELHHSEFLQREAKILSSLNSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YN+ +EY P GTL+D A +  GR  E  +  Y  +IL G+ ++HS
Sbjct  60    YRGSETKRESNGVVTYNILMEYAPYGTLTDAAAKNGGRVDETRVVKYTREILRGLEYVHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G VHCD+KG N++++E   A KIAD GC K ++       S   GTPAFMAPEVA+GE+
Sbjct  120   EGIVHCDVKGSNVVLAEKGEA-KIADFGCAKRVDQ---EFESPVMGTPAFMAPEVARGEK  175

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEM TGS PW + N   DPVS LYR+  SG+ PE P   +++AK+F
Sbjct  176   QGKESDIWAVGCTVIEMVTGSPPWTEANSREDPVSVLYRVGYSGETPELPCLLAEEAKDF  235

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISS-NSVTFKEFVRNSPTSVMDQAVWNSI-----  917
             L KCL R+AK RWTA +LL HPFL + S          V +SPTSV DQ  W S+     
Sbjct  236   LEKCLKREAKERWTATQLLNHPFLTTKSDIEPALVSGLVSSSPTSVTDQTFWRSVEEEEE  295

Query  918   ------EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
                   +      +     G  + RIGRL    G     W+ +GG W+TVR
Sbjct  296   EETEELQKDSRDLDRLNLWGCYSERIGRLRCLGGLDGTRWDMEGGDWITVR  346



>ref|XP_003534712.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=422

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 207/336 (62%), Gaps = 19/336 (6%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T+GRGS+A V +  +   SG  FAVKSA L  S  L+RE+ ILS    P +V 
Sbjct  1     MDWTRGHTLGRGSTAAVYIGESH-RSGEVFAVKSAELHRSEFLKREERILSTLKCPQIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               GCD + E+    +N+F+EY P GTL++  + G   E ++     QIL G+ +LHS G 
Sbjct  60    YRGCDNTFENGVQWFNMFMEYAPHGTLAE--RGGGMEEAVVGSCTRQILQGLNYLHSNGI  117

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+KGQN+LV+E    VKIAD GC + +E     SSS  +GTP FMAPEVA+GE+QGF
Sbjct  118   VHCDVKGQNVLVTE--QGVKIADFGCARRVEE----SSSVIAGTPRFMAPEVARGEQQGF  171

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GCTV+EM TG+ PWQ   DP + +YRI  SG+ PE P + S+  ++FLGKCL 
Sbjct  172   PADVWALGCTVLEMITGTPPWQGGGDPAAVVYRIGFSGESPEIPGYVSEQGRDFLGKCLK  231

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTAT  953
             R+   RW+  ELL H F++  +   +   +   ++PT V+++  W+S+E +Q   +    
Sbjct  232   REPGERWSVEELLGHGFVKECTELKLLVLD--SDTPTGVLERGFWDSLETAQ---HEALD  286

Query  954   AGFPANRIGRLIIQAGERLPDW-EEDGGWVTVRGNE  1058
                P +RI RL        P W   D  WVTVRGNE
Sbjct  287   CPSPRDRIRRLFSDE----PVWASNDDEWVTVRGNE  318



>emb|CDY53387.1| BnaAnng12350D [Brassica napus]
Length=337

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 205/348 (59%), Gaps = 27/348 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R  TIGRGSSATV  AT    SG   AVKSA    S  LQRE  +LS  +SPYV+ 
Sbjct  1     MNWTREKTIGRGSSATVYAATCQD-SGETIAVKSAEFHQSEFLQREAKLLSSLNSPYVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-S  404
               GC+++ E   A YNL +EY P GTL+D+A +  G   E  +  Y  QIL+G+ ++H S
Sbjct  60    YRGCEVTKE-PLATYNLLMEYAPYGTLADVAAKNGGCIDEARVVSYTRQILLGLEYVHNS  118

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
                 HCD+KG N+LV  +  A KIAD GC K +E      +    GTPAFMAPEVA+GE 
Sbjct  119   KRIAHCDVKGSNVLVGVNGEA-KIADFGCAKRVE---PELTEPVRGTPAFMAPEVARGER  174

Query  585   QGFPADIWAFGCTVIEMATGSAPWQ--DMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   S+ AK+FL
Sbjct  175   QGKESDIWALGCTVIEMVTGSHPWTGGDTTDPVSVLYRVGYMGETPELPSSLSEQAKDFL  234

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-KEFVRNSPTSVMDQAVWNSIE----M  923
             GKCL R+AK RWTA +LL HPF+ +  +    F    V NSPTSV DQ  W S+E     
Sbjct  235   GKCLRREAKERWTARQLLNHPFVTTKPNTEPEFVTGLVTNSPTSVTDQMFWRSVEEEEDQ  294

Query  924   SQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTVRGN  1055
              +PS   C+     G   + IG+ ++      P W+  G  W+TVR N
Sbjct  295   ERPSWWECHEERIGGL--SWIGQAVVD-----PTWDMGGEDWITVRRN  335



>gb|AGA37258.1| mitogen activated kinase kinase kinase 18.2 [Brassica napus]
Length=342

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 207/349 (59%), Gaps = 29/349 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R  TIGRGSSATV  AT    SG   AVKSA    S  LQRE  +LS  +SPYV+ 
Sbjct  1     MNWTREKTIGRGSSATVYAATCQ-ESGETIAVKSAEFHQSEFLQREAKLLSSMNSPYVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-S  404
               GC+++ E   A YNL +EY P GT++D+A +  G   E  +  Y  QIL+G+ ++H S
Sbjct  60    YRGCEVTKEPL-ATYNLLMEYAPYGTMADVAAKNGGCIDEARVVSYTRQILLGLEYVHDS  118

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N+LV  +  A KIAD GC K +E      +    GTPAFMAPEVA+GE 
Sbjct  119   KGIAHCDVKGSNVLVGVNGEA-KIADFGCAKRVE---PELTEPVRGTPAFMAPEVARGER  174

Query  585   QGFPADIWAFGCTVIEMATGSAPW--QDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   ++ AK+FL
Sbjct  175   QGKESDIWALGCTVIEMVTGSPPWVGGDSTDPVSVLYRVGYMGESPELPSSLTEQAKDFL  234

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKE--FVRNSPTSVMDQAVWNSIE----  920
             GKCL RDAK RWTA +LL HPF+ +   N+    E   V NSPTSV DQ  W S+E    
Sbjct  235   GKCLRRDAKERWTATQLLNHPFV-TTKPNTEPESETGLVTNSPTSVTDQMFWRSVEEEED  293

Query  921   MSQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTVRGN  1055
               +PS   C+         + IG+ ++      P W+ DG  W+TVR N
Sbjct  294   QERPSWWECHEERIGVL--SWIGQAVVD-----PTWDMDGEDWITVRRN  335



>ref|XP_009119207.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Brassica 
rapa]
Length=337

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 208/350 (59%), Gaps = 31/350 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R  TIGRGSSATV  AT    SG   AVKSA    S  LQRE  +LS  +SPYV+ 
Sbjct  1     MNWTREKTIGRGSSATVYAATCQD-SGETIAVKSAEFHQSEFLQREAKLLSSLNSPYVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-S  404
               GC+++ E   A YNL +EY P GTL+D+A +  G   E  +  Y  QIL+G+ ++H S
Sbjct  60    YRGCEVTKE-PLATYNLLMEYAPYGTLADVAAKNGGCIDEARVVSYTRQILLGLEYVHNS  118

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+K  N+LV E+  A KIAD GC K +E      +    GTPAFMAPEVA+GE 
Sbjct  119   KGIAHCDVKASNVLVGENGEA-KIADFGCAKRVE---PELTEPVRGTPAFMAPEVARGER  174

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN--DPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             QG  +DIWA GCTVIEM TGS PW D +  DPVS LYR+   G+ PE P   ++ AK+FL
Sbjct  175   QGKESDIWALGCTVIEMVTGSHPWSDADYTDPVSVLYRVGYMGESPELPSSLTEQAKDFL  234

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-KEFVRNSPTSVMDQAVWNSIE----M  923
             GKCL R+AK RWTA +LL HPF+ +  +    F    V NSPTSV DQ  W S+E     
Sbjct  235   GKCLRREAKERWTATQLLNHPFVTTKPNTEPEFVTGLVTNSPTSVTDQMFWRSVEEEEDQ  294

Query  924   SQPS---CNSTATAGFPANRIGRLIIQAGERL--PDWEEDG-GWVTVRGN  1055
              +PS   C+          RIG L+   G+ +  P W+  G  W+TVR N
Sbjct  295   ERPSWWECHD--------ERIG-LLSWIGQAVVDPTWDMGGEDWITVRRN  335



>ref|XP_004954858.1| PREDICTED: serine/threonine-protein kinase DDB_G0283821-like 
[Setaria italica]
Length=555

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 217/347 (63%), Gaps = 28/347 (8%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IG G+SATVS+AT    +G  FAVKS  L+ +G+LQRE+ +LS   SPYVV C
Sbjct  6     EWQRGPVIGHGASATVSIATDR-RTGGVFAVKSVELARAGVLQREQSVLSALSSPYVVSC  64

Query  237   LGCDISCEHNNA---LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH  401
             LG D+S   + +    Y+LFLEY PGG+L+D  KR  GR  E +I+  A  +L G+ ++H
Sbjct  65    LGADVSVAADGSGRMCYDLFLEYAPGGSLADEIKRRGGRCEEAVIRSRAADVLRGLAYVH  124

Query  402   SMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLEN-----GEASSSSAFSGTPAFMAPE  566
               G  HCD+KG+N+L+  D  A+ +AD GC + + N     G  +      GTP FM+PE
Sbjct  125   GSGVTHCDVKGRNVLLRADGRAM-LADFGCARLMANEDGNAGVGAGGMIVRGTPMFMSPE  183

Query  567   VAKGEEQGFPADIWAFGCTVIEMATGSAPWQD-MNDPVSALYRIANSGDVPEFPRWFSDD  743
              A+GE QG  ADIWA GCTVIEMATG APWQ    DPV+AL+ IA+SGDVP+ P W SD+
Sbjct  184   AARGEAQGAAADIWALGCTVIEMATGGAPWQQRFADPVAALHHIAHSGDVPQAPAWLSDE  243

Query  744   AKEFLGKCLDRDAKRRWTAAELLQHPFLQSISS--NSVTFKEF---VRNSPTSVMDQAVW  908
             AK+FL +CL  D  +RW+A +LLQH F+ S S+  +  + K     +R SP SV+DQA W
Sbjct  244   AKDFLSRCLIMDPAKRWSAEQLLQHQFVASSSAPIDPASVKAAPIELRVSPKSVLDQAFW  303

Query  909   NSIEMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTV  1046
                   + S + T  +  PA+R+  L   A +   DW   G  W+TV
Sbjct  304   ------EDSDSDTTVSLTPADRVRAL---AYDVAADWTWSGEHWITV  341



>emb|CDY18290.1| BnaC05g03130D [Brassica napus]
Length=337

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 207/349 (59%), Gaps = 29/349 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W R  TIGRGSSATV  AT    SG   AVKSA    S  LQRE  +LS  +SPYV+ 
Sbjct  1     MNWTREKTIGRGSSATVYAATCQ-ESGETIAVKSAEFHQSEFLQREAKLLSSMNSPYVIG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-S  404
               GC+++ E   A YNL +EY P GT++D+A +  G   E  +  Y  QIL+G+ ++H S
Sbjct  60    YRGCEVTKEPL-ATYNLLMEYAPYGTMADVAAKNGGCIDEARVVSYTRQILLGLEYVHDS  118

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N+LV  +  A KIAD GC K +E      +    GTPAFMAPEVA+GE 
Sbjct  119   KGIAHCDVKGSNVLVGVNGEA-KIADFGCAKRVE---PELTEPVRGTPAFMAPEVARGER  174

Query  585   QGFPADIWAFGCTVIEMATGSAPW--QDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   ++ AK+FL
Sbjct  175   QGKESDIWALGCTVIEMVTGSPPWVGGDSTDPVSVLYRVGYMGESPELPSSLTEQAKDFL  234

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKE--FVRNSPTSVMDQAVWNSIE----  920
             GKCL RDAK RWTA +LL HPF+ +   N+    E   V NSPTSV DQ  W S+E    
Sbjct  235   GKCLRRDAKERWTATQLLNHPFV-TTKPNTEPESETGLVTNSPTSVTDQMFWRSVEEEED  293

Query  921   MSQPS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTVRGN  1055
               +PS   C+         + IG+ ++      P W+ DG  W+TVR N
Sbjct  294   QERPSWWECHEERIGVL--SWIGQAVVD-----PTWDMDGEDWITVRRN  335



>ref|XP_008224751.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Prunus mume]
Length=435

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 207/347 (60%), Gaps = 26/347 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RGPTIG GSSATVS+A + G SG  FAVKSA LS S  LQ E+ ILS   S  +V 
Sbjct  1     MDWTRGPTIGHGSSATVSIAKSHG-SGEVFAVKSAKLSQSHSLQMEQTILSTLSSAQIVS  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GC+ S E+    YNLFLEY PGGTLSD  +   GR +E  I+ Y  QIL+G+  LHS 
Sbjct  60    YKGCNTSTENGTVFYNLFLEYAPGGTLSDAIRSQGGRLNEAAIRSYTRQILLGLHHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCDIKGQN+LV+ + + VK+ADLGC K +            GTP +MAPEVA+GE+Q
Sbjct  120   QIAHCDIKGQNVLVTNNGADVKLADLGCAKRVN---FDHGLPIGGTPVYMAPEVARGEQQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCTVIEMATG A W  ++DPVSA+Y+I  SG+VPE P   S   ++F+ KC
Sbjct  177   GLAADVWALGCTVIEMATGRATWPCVSDPVSAMYKIGFSGEVPEIPSSLSKKGRDFVTKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNS-----IEMSQP  932
             L RD   RW+A ELL+H FL    +           SPT+V+D  +W       +E    
Sbjct  237   LMRDPMERWSAGELLKHGFLLEAPN--------YLPSPTTVLDHGLWEEEFDLDLEHIWE  288

Query  933   SCNSTATAGFPANRIGRLIIQAGER----LPDW--EEDGGWVTVRGN  1055
               + +  +     RI RL+ +        + +W  +++  WVTVR N
Sbjct  289   PTHQSGCSNSARERI-RLLSEGKAASFLGVTNWPCDDEDTWVTVRSN  334



>gb|KFK40368.1| hypothetical protein AALP_AA3G364600 [Arabis alpina]
Length=336

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 185/295 (63%), Gaps = 11/295 (4%)
 Frame = +3

Query  54   MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
            M W RG TIG GSSATV  AT   +SG   AVK+A    S  LQRE +ILS  +SPYV+K
Sbjct  1    MNWTRGKTIGHGSSATVYAATCH-SSGEIIAVKTAEYHRSEFLQREANILSSLNSPYVIK  59

Query  234  CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-S  404
              GC+I+     A YNL +EY P GTL+D+  +  G   E  +  Y  QIL+G+ ++H S
Sbjct  60   YRGCEITETPFEATYNLLMEYAPYGTLTDVTAKNGGLLDEARVVKYTRQILLGLEYIHNS  119

Query  405  MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
             G  HCDIKG NILV ++  A KI D GC KF++      +    GTPAFMAPEVA+GE 
Sbjct  120  KGIAHCDIKGSNILVGDNGEA-KIGDFGCAKFVK---PEITEPVKGTPAFMAPEVARGER  175

Query  585  QGFPADIWAFGCTVIEMATGSAPW--QDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
            QG  +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   ++ AK+FL
Sbjct  176  QGIESDIWAVGCTVIEMVTGSHPWIGLDSTDPVSVLYRVGYLGEAPELPCSLTEQAKDFL  235

Query  759  GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKE-FVRNSPTSVMDQAVWNSIE  920
            GKCL ++AK RWTA +LL HPFL +  +         V NSPTSV DQ  W S+E
Sbjct  236  GKCLKKEAKERWTATQLLNHPFLVTKPNIEPELGTGLVTNSPTSVTDQVFWRSVE  290



>ref|XP_008384252.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=441

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/374 (44%), Positives = 219/374 (59%), Gaps = 31/374 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T G GSSATVS+A +   SG  FAVKSA LS S  LQ+E+ ILS   SPY V+
Sbjct  1     MDWTRGRTXGLGSSATVSIAKSH-RSGEVFAVKSAELSQSQFLQKEQTILSTLSSPYXVQ  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G +IS E+   LYNLFLEY PGG +SD  +R  G  +E   + YA QIL+ +  LHS 
Sbjct  60    YKGXNISNENGAVLYNLFLEYAPGGXVSDAIRRQGGCLNEAATRCYARQILLXLQHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCD+K QNILV+E+ + VK+ADLGC + + +   S      GTP +MAPEVA+GEEQ
Sbjct  120   QIAHCDVKCQNILVAENGAKVKLADLGCARRVNSDRGS---PIGGTPLYMAPEVARGEEQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCT+IEMATG APW D+ DPVSALYRI  SGD P  P   S   ++F+ KC
Sbjct  177   GIAADVWALGCTIIEMATGRAPWPDVCDPVSALYRIGFSGDAPGIPSSLSKQGRDFVAKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAV----WNSIEMSQPS  935
             L RD   RW+A ELL+H FL    ++ +        SPT+V+D+ +    ++  ++  P+
Sbjct  237   LIRDPLERWSAVELLEHGFLLEAPNDLL--------SPTTVLDRGLLEEEFDXDQIXDPT  288

Query  936   CNSTATAGFPANRIGRLIIQAGERL--PDWE-EDGGWVTVRGNE------EDESTDSEPI  1088
               S  +      RI  L       L  P+W  ++  WV VR N         + T   P+
Sbjct  289   XESGCSDYSAKERIRHLSEGNTSSLXVPNWACDEHNWVNVRSNNIENQDLAQKHTAFSPL  348

Query  1089  ----LISILCPEDL  1118
                  +++LCP + 
Sbjct  349   NRQFKLALLCPHNF  362



>ref|XP_008349313.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=420

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 219/371 (59%), Gaps = 31/371 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG T G GSSATVS+A +   SG  FAVKSA LS S  LQ+E+ ILS   SPY V+
Sbjct  1     MDWTRGRTXGLGSSATVSIAKSH-RSGEVFAVKSAELSQSQFLQKEQTILSTLSSPYXVQ  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               G +IS E+   LYNLFLEY PGG +SD  +R  G  +E   + YA QIL+ +  LHS 
Sbjct  60    YKGXNISNENGAVLYNLFLEYAPGGXVSDAIRRQGGCLNEAATRCYARQILLXLQHLHSN  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
                HCD+K QNILV+E+ + VK+ADLGC + + +   S      GTP +MAPEVA+ EEQ
Sbjct  120   QIAHCDVKCQNILVAENGAKVKLADLGCARRVNSDRGS---PIGGTPLYMAPEVARXEEQ  176

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCT+IEMATG APW D+ DPVSALYRI  SGD P  P   S   ++F+ KC
Sbjct  177   GIAADVWALGCTIIEMATGRAPWPDVCDPVSALYRIGFSGDAPGIPSSLSKQGRDFVAKC  236

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAV----WNSIEMSQPS  935
             L RD   RW+A ELL+H FL    ++ +        SPT+V+D+ +    ++S ++  P+
Sbjct  237   LIRDPLERWSAVELLEHGFLLEAPNDLL--------SPTTVLDRGLLEEEFDSDQIWDPT  288

Query  936   CNSTATAGFPANRIGRLIIQAGERL--PDWE-EDGGWVTVRGN---EEDESTDSEPIL--  1091
               S  +      RI  L       L  P+W  ++  WV VR N   ++D +      L  
Sbjct  289   RESGCSDYSAKERIRHLSEGNTSSLDVPNWACDEHNWVNVRSNNIEKQDVAQKHTAFLPP  348

Query  1092  -----ISILCP  1109
                  +S+LCP
Sbjct  349   TRQFKLSLLCP  359



>gb|AGA37215.1| mitogen-activated protein kinase kinase kinase 18.1 [Brassica 
napus]
Length=337

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 204/346 (59%), Gaps = 27/346 (8%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W R  TIGRGSSATV  AT    SG   AVKSA    S  LQRE  +LS  +SPYV+   
Sbjct  4     WTREKTIGRGSSATVYAATCQD-SGETIAVKSAEFHQSEFLQREAKLLSSLNSPYVIGYR  62

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLH-SMG  410
             GC+++ E   A YNL +EY P GTL+D+A +  G   E  +  Y  QIL+G+ ++H S  
Sbjct  63    GCEVTKE-PLATYNLLMEYAPYGTLADVAAKNGGCIDEARVVSYTRQILLGLEYVHNSKR  121

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
               HCD+KG N+LV  +  A KIAD GC K +E      +    GTPAFMAPEVA+GE QG
Sbjct  122   IAHCDVKGSNVLVGVNGEA-KIADFGCAKRVE---PELTEPVRGTPAFMAPEVARGERQG  177

Query  591   FPADIWAFGCTVIEMATGSAPWQ--DMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
               +DIWA GCTVIEM TGS PW   D  DPVS LYR+   G+ PE P   S+ AK+FLGK
Sbjct  178   KESDIWALGCTVIEMVTGSHPWTGGDTTDPVSVLYRVGYMGETPELPSSLSEQAKDFLGK  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTF-KEFVRNSPTSVMDQAVWNSIE----MSQ  929
             CL R+AK RWTA +LL HPF+ +  +    F    V NSPTSV DQ  W S+E      +
Sbjct  238   CLRREAKERWTARQLLNHPFVTTKPNTEPEFVTGLVTNSPTSVTDQMFWRSVEEEEDQER  297

Query  930   PS---CNSTATAGFPANRIGRLIIQAGERLPDWEEDG-GWVTVRGN  1055
             PS   C+     G   + IG+ ++      P W+  G  W+TVR N
Sbjct  298   PSWWECHEERIGGL--SWIGQAVVD-----PTWDMGGEDWITVRRN  336



>ref|XP_010469578.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=363

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 210/355 (59%), Gaps = 26/355 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG T+GRGS+ATV  AT    S    AVKS+ L  S  L+RE  ILS  DSPYV+ 
Sbjct  1     MEWTRGRTLGRGSTATVYAATCHN-SEEVLAVKSSELHRSEFLKREAKILSLLDSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+++A +  GR  E  +  Y  +IL G+ ++HS
Sbjct  60    YRGSETKRESNGVVTYNLLMEYAPYGTLTEVAAKNGGRLDETRVVKYTREILKGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++++E   A KIAD GC K ++           GTPAFMAPEVA+GE+
Sbjct  120   EGIAHCDVKGSNVVLAEKGEA-KIADFGCAKRVD---PEFELMVMGTPAFMAPEVARGEK  175

Query  585   QGFPADIWAFGCTVIEMATGSAPWQD-MNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             QG  +DIWA GCTVIEM TGS PW +  +DP+S LYR+  SG+ PE P   ++DAK+FL 
Sbjct  176   QGKESDIWAVGCTVIEMLTGSPPWTEARDDPLSVLYRVGYSGETPELPCLLAEDAKDFLE  235

Query  762   KCLDRDAKRRWTAAELLQHPFLQS---ISSNSVTFKEFVRNSPTSVMDQAVWNSI-----  917
             KCL R+AK RWTAA+LL HPFL +   I  + V+    V +SPTSV DQ  W S+     
Sbjct  236   KCLKREAKERWTAAQLLNHPFLITKPDIEQDLVSG--LVSSSPTSVTDQTFWRSVEEEEE  293

Query  918   ------EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVRGNEE  1061
                   +      +  +  G  + RIGRL    G   P    +GG W+TVR   E
Sbjct  294   EETEELQKGSRDLDRLSLWGCYSERIGRLRCVGGLDGPRCNMEGGDWITVRARCE  348



>ref|XP_004170035.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis sativus]
Length=304

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 196/306 (64%), Gaps = 19/306 (6%)
 Frame = +3

Query  54   MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
            MEWIRG TIGRGSSA VS+AT    SG   AVKS   S    L+RE+ ILSQ +   V+ 
Sbjct  1    MEWIRGRTIGRGSSAAVSVATDI-RSGQVMAVKSVEFSHLDFLKREQRILSQLNCSRVIG  59

Query  234  CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
              G D++ E+ N + NL +E+ PGG++ D  ++  GR  E   QFY  ++L G+ ++HS 
Sbjct  60   YKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKAGGRLDEATAQFYTREVLSGLQYVHSN  119

Query  408  GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
            G VHCDIK  NIL+ ED   +KIAD GC + +E     S    +GTP FMAPEVA+GE+Q
Sbjct  120  GVVHCDIKCCNILMGED--GIKIADFGCARRVEE---VSGGNLAGTPIFMAPEVARGEKQ  174

Query  588  GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
            GF AD+W+ GC VI+M TG  PW +++DP++A+YRI +  D+PE PR  S+  K+FL +C
Sbjct  175  GFAADVWSVGCAVIQMVTGRVPWANLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFLRRC  234

Query  768  LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
            L RD + RW+  ELL+HPF+Q   S+    K+  R +PTS++DQ +W+++       N  
Sbjct  235  LIRDPEERWSVNELLKHPFVQEQKSHP---KQNSR-TPTSILDQGIWDTV-------NDP  283

Query  948  ATAGFP  965
             T G P
Sbjct  284  ETVGSP  289



>ref|XP_008342026.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Malus 
domestica]
Length=267

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 179/261 (69%), Gaps = 7/261 (3%)
 Frame = +3

Query  54   MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
            M+W RG TIG+GSSA VSLAT   +SG  FAVKSA +S S  LQRE+ I S   S +VV 
Sbjct  1    MDWTRGSTIGQGSSAAVSLATXR-SSGDKFAVKSAQVSQSEFLQREQKIHSVLSSRHVVS  59

Query  234  CLGCDISCEHNNALYNLFLEYVPGGTLSDL--AKRGRFSEPMIQFYAHQILMGIGFLHSM  407
             +G DI+ E+N  +YNL +EYVPGGT+ D   ++ G   E MI+ Y   I+ G+ +LHS+
Sbjct  60   YMGHDITSENNKLMYNLLMEYVPGGTIIDAIRSRGGLVDESMIRNYTRGIVKGLDYLHSL  119

Query  408  GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
            G VHCDIKG+NIL  ED    KIAD GC ++     AS+++   GTP FMAPEVA+GEEQ
Sbjct  120  GLVHCDIKGRNILAGED--GPKIADFGCARWAXPAVASATT-IGGTPMFMAPEVARGEEQ  176

Query  588  GFPADIWAFGCTVIEMATG-SAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
            GF  DIWA GCT+IEMATG SAPW     PV+ LY+IA S D+P+ P + S+ AK FL K
Sbjct  177  GFACDIWALGCTIIEMATGGSAPWPKAAXPVTVLYQIAYSNDLPZIPSFLSEQAKHFLEK  236

Query  765  CLDRDAKRRWTAAELLQHPFL  827
            CL RD   RWTA++LL+H  L
Sbjct  237  CLQRDPTERWTASQLLKHSXL  257



>emb|CDY52049.1| BnaCnng21650D [Brassica napus]
Length=355

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 204/353 (58%), Gaps = 32/353 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  A    +S    AVKS+ L  S  LQRE  ILS  +SPYV++
Sbjct  1     MEWTRGRILGRGSTATVC-AAMYRSSNEILAVKSSELHRSEFLQREAKILSSLNSPYVIR  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P  TL+D A +  GR  E MI  Y  +IL G+ ++HS
Sbjct  60    YRGTETKIESNGVVTYNLLMEYAPYETLTDAAAKNGGRLEEAMIAKYTREILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V+E   A K+AD GC K +       S   +GTPAFMAPEVA+GE+
Sbjct  120   KGIAHCDVKGSNVVVAEKGEA-KLADFGCAKRV------GSETVTGTPAFMAPEVARGEK  172

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + +   DPVS LYR+  SG+ PE P   +D+AK+F
Sbjct  173   QGSESDIWAVGCTVIEMATGSPPWTEASSREDPVSVLYRVGYSGETPELPCLLTDEAKDF  232

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNS-------  914
             L  C  R+AK R TA +LL HPFL  IS   +     V +SPTSV DQ  W S       
Sbjct  233   LKMCFKREAKERRTATQLLNHPFL--ISKPDIE-PVLVSSSPTSVTDQTFWRSVEEEVVE  289

Query  915   -------IEMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVR  1049
                    ++    + +          RIGRL    G   P W+ +GG W+TVR
Sbjct  290   EEEEAVELQDESRNLDRLNLLACYLERIGRLRCVGGLDGPIWDREGGDWITVR  342



>ref|XP_006410384.1| hypothetical protein EUTSA_v10016838mg [Eutrema salsugineum]
 gb|ESQ51837.1| hypothetical protein EUTSA_v10016838mg [Eutrema salsugineum]
Length=365

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/350 (46%), Positives = 200/350 (57%), Gaps = 23/350 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  AT    S    AVKSA L  S  LQRE  I+S  +SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATVYAATCHN-SNEILAVKSAELHRSEFLQREATIISSLNSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + +NL +EY P G L+D A +  GR  E  +  Y  QIL G+ ++HS
Sbjct  60    YRGSETKTESNGVVTHNLLMEYAPYGKLTDAAAKNGGRLDEAQVVKYTRQILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V+ D    KIAD GC K ++       S   GTPAFMAPEVA+GE+
Sbjct  120   KGIAHCDVKGSNVVVA-DKGVAKIADFGCAKRVD---PEVESPVMGTPAFMAPEVARGEK  175

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + N   DPVS LYR+  SG+ PE PR  + +AK+F
Sbjct  176   QGKESDIWAVGCTVIEMATGSPPWTEANMREDPVSVLYRVGYSGETPELPRLLTKEAKDF  235

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISS-NSVTFKEFVRNSPTSVMDQAVWNSIEMSQP  932
             L KCL R+A  RWTA +LL HPFL +      V    +V  SPTSV DQ  W S+E  + 
Sbjct  236   LEKCLKREANERWTATQLLNHPFLVTKPDIEPVLVSGWVSCSPTSVTDQTFWRSVEEEEE  295

Query  933   SCNSTATAGFPANR----------IGRLIIQAGERLPDWEEDGG-WVTVR  1049
                         +R          IGRL        P W+ +GG W+ VR
Sbjct  296   ETEELQEDSRDLDRLKLWACYSEKIGRLRCVGVLDGPRWDMEGGDWIMVR  345



>emb|CDY12200.1| BnaC04g12300D [Brassica napus]
Length=365

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 206/350 (59%), Gaps = 25/350 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  AT    S    AVKS+ L  S  L+RE  ILS   SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATVYAATRHN-SNEILAVKSSELHRSEFLKREAKILSSLSSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+D A +  G   E  I  Y   IL G+ ++HS
Sbjct  60    YRGSETKRESNGVVTYNLLMEYAPYGTLTDAAAKNGGGLEEATIVKYTRDILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V E   A KIAD GC K ++      S A  GTPAFMAPEVA+GE+
Sbjct  120   RGVAHCDVKGSNVVVGEKGEA-KIADFGCAKRVD--PEVDSEAVMGTPAFMAPEVARGEK  176

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + +    PVS LYR+  SG+ PE P   +++AK+F
Sbjct  177   QGRESDIWAVGCTVIEMATGSPPWTEASSGESPVSVLYRVGYSGEAPELPCLLTEEAKDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQP-  932
             L KC  R+AK RWTA +LL HPFL +   N+     FV +SPTSV+DQ  W+S++  +  
Sbjct  237   LEKCFKREAKERWTATQLLNHPFLIT-KPNTEPVSGFVSSSPTSVIDQTFWSSVDEEEET  295

Query  933   --------SCNSTATAGFPANRIGRLIIQA---GERLPDWEEDGGWVTVR  1049
                     + + +      + RIGRL       G RL    E GGW+TVR
Sbjct  296   EELQEDPRNLDRSNMWACHSERIGRLRCVGGLDGSRLD--MEGGGWITVR  343



>ref|XP_010035556.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Eucalyptus grandis]
 gb|KCW46981.1| hypothetical protein EUGRSUZ_K00788 [Eucalyptus grandis]
Length=419

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 211/343 (62%), Gaps = 15/343 (4%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  +GRG+SATVS+AT    SG  FAVKSA L  S +L+RE+  LS   SP +V 
Sbjct  1     MDWTRGRAVGRGASATVSVATCR-RSGDVFAVKSAELVRSELLRREQRTLSSLSSPRIVG  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GC+I+ E +  ++N+F++Y+P G+L+D  +   G+  EP I+ Y  QIL G+ +LHS 
Sbjct  60    YRGCEITSEDSRIMFNIFMDYLPRGSLADQIRSHGGKLDEPAIRAYTSQILEGLDYLHSR  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSG--TPAFMAPEVAKGE  581
             G  HCDIK  N+L+ +D  A KIAD GC K +    A++++A     TP FMAPE A+GE
Sbjct  120   GIAHCDIKSANVLIGDD-GAAKIADFGCAKRVGPAGAAATAAAGIGGTPMFMAPEAARGE  178

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQDMND-----PVSALYRIANSGDVPEFPRWFSDDA  746
             EQG   D WA GCTV+EMATG +PWQ         PVS LYRIA SG+ P  P   S +A
Sbjct  179   EQGLAGDAWAVGCTVVEMATGKSPWQAGAAAGADDPVSVLYRIACSGESPAIPGCLSAEA  238

Query  747   KEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMS  926
             ++F+ KCL RD + RWT  +LL+HPFL+S    S   ++    SPTSV+DQ  W++++ +
Sbjct  239   RDFVSKCLRRDPRERWTVGQLLEHPFLESNKLGSSQAEQTNTKSPTSVLDQEFWDAMDEA  298

Query  927   QPSCNSTATAGFPA--NRIGRLIIQAGERLPDWEEDGGWVTVR  1049
             +    +T      +  +RI  L  + G   P    D GW+TVR
Sbjct  299   ESEAATTGGERIESALDRIRTLSFREGR--PCRPCDEGWITVR  339



>ref|XP_010522353.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Tarenaya hassleriana]
Length=342

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 205/341 (60%), Gaps = 17/341 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG TIGRGSSATV  AT    SG   AVKSA LS   +LQRE  ILS  +SPYVV 
Sbjct  1     MEWTRGRTIGRGSSATVPAATCH-KSGEIIAVKSAELSRLDLLQREAKILSSLNSPYVVG  59

Query  234   CLGCDISCEHNNALY-NLFLEYVPGGTLSDLAKRGR-----FSEPMIQFYAHQILMGIGF  395
               G +I+ E   A   NL +EY P GT+++ A +         E +I  Y  QIL G+ +
Sbjct  60    YRGWEITKEPCGATTSNLLMEYAPYGTVAEAAAKNNGGGGGLDESLIVKYTRQILRGLEY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             LHS G  HCD KG N+L+ ++  A+ IAD GC K ++     SS    G+PAFM+PE A+
Sbjct  120   LHSKGITHCDAKGSNVLIGKNGHAM-IADFGCAKRVD-----SSEPIRGSPAFMSPEAAR  173

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQ-DMNDPVSALYRIANSGDVPEFPRWFSDDAKE  752
             GE+QG  +DIWA  CTVIEM+TGS PW  D  DPV+ +YR+  SG+ PE PR+ ++ AK+
Sbjct  174   GEKQGKESDIWAVACTVIEMSTGSPPWTADYGDPVTVIYRVGYSGESPEIPRFLTEQAKD  233

Query  753   FLGKCLDRDAKRRWTAAELLQHPFL-QSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ  929
             FL KCL R+ + RWTA +LL HPF+ +   +          NSPTSV+DQ  W S+E  +
Sbjct  234   FLEKCLKREPEERWTARQLLNHPFVAKPPDAEPGPITGPTSNSPTSVVDQLFWRSVEEEE  293

Query  930   PSCNSTATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVR  1049
                + ++       RIGRL   AG   P W+ E G W TVR
Sbjct  294   EDLDRSSRWASHEERIGRL-KWAGFEGPTWDLECGDWATVR  333



>ref|XP_010686869.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Beta vulgaris subsp. vulgaris]
Length=396

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 208/349 (60%), Gaps = 17/349 (5%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RG  IG GSSA V LA +   SG   A KS   S +  LQ+E++I S      +++
Sbjct  1     MNWTRGKLIGHGSSAMVFLAKSL-PSGDTLAAKSIEYSRAYTLQKEQEIHSSLKCDRIIE  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
               GCD++ E     YN+ LEY  GGT+ D+ ++  G  +EP+++ Y  +I+ GI +LHS 
Sbjct  60    YKGCDVTLEDGKLFYNILLEYASGGTVMDVIQKKDGGITEPLVRRYTKEIVQGIEYLHSK  119

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
             G VHCDIKG NILV+ D   VKI D GC +  ++    SS+   GTP +MAPEVA+GE+Q
Sbjct  120   GMVHCDIKGANILVTSD--GVKIGDFGCCRRFDD---LSSTKIGGTPIYMAPEVARGEQQ  174

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMN-DPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
              +P+D+WA GC V EMATG +PW +++ DP+SALY I  SG +PE P +    AK+FL K
Sbjct  175   SYPSDVWALGCIVFEMATGLSPWPNISQDPLSALYHIGFSGALPEIPDFLPGQAKDFLSK  234

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIE---MSQPS  935
             C  +D K RW+ AELL+HPF+         F     ++PTS++DQ +W ++E   + Q +
Sbjct  235   CFKKDPKERWSVAELLKHPFV----CEDGPFHGPSLDTPTSILDQGIWKTLEDPYIVQKN  290

Query  936   CNSTATAGFPANRIGRLIIQ-AGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                  +   P  R+  LI+  + +  P+W  D  W+T R N+  +  +S
Sbjct  291   MTHVRSTKSPFERLRELIVNSSSDEFPNWASDEDWITARSNKIGDEAES  339



>emb|CDY42094.1| BnaA05g10920D [Brassica napus]
Length=376

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 203/353 (58%), Gaps = 31/353 (9%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  AT    S    AVKS+ L  S  LQRE +ILS   SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATVCAATRHN-SNEILAVKSSELHRSEFLQREAEILSSLSSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+D A +  G   E MI  Y  ++L G+ ++HS
Sbjct  60    YRGSETKRELNGVVTYNLLMEYAPYGTLTDAAAKNGGGLEEAMIVKYTREMLRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V E   A KI D GC K ++      S A  GTPAFMAPEVA+GE+
Sbjct  120   RGVAHCDVKGSNVVVGEKGEA-KIVDFGCAKRVD--PEVDSGAVVGTPAFMAPEVARGEK  176

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + +    PVS LYR+  SG+ PE P   +++AK+F
Sbjct  177   QGRESDIWAVGCTVIEMATGSPPWTEASSGESPVSVLYRVGYSGEAPELPCLLTEEAKDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
             L KC  R+AK RWTA +LL HPFL +   N+        NSPTSV DQ  W S++  +  
Sbjct  237   LEKCFKREAKERWTATQLLNHPFLIT-KPNTEPVSGLFSNSPTSVTDQTFWTSVDEEE--  293

Query  936   CNSTATAGFPAN------------RIGRLIIQA---GERLPDWEEDGGWVTVR  1049
               +      P N            RIGRL       G RL    E GGW+TVR
Sbjct  294   -ETEELQEEPRNLDRLNLWACHSERIGRLRCVGGLDGSRLD--MEGGGWITVR  343



>ref|XP_010236368.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Brachypodium distachyon]
Length=472

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/376 (45%), Positives = 226/376 (60%), Gaps = 21/376 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IGRG+SATVS+AT A  +G  FAVKS  ++ +G L+RE+ +LS   SPYVV C
Sbjct  7     EWRRGPVIGRGASATVSIATDA-LTGEAFAVKSVGIALAGALRREQSVLSALSSPYVVSC  65

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G   + +   + Y LFLE  PGG+L+D  KR  GR  E ++   A  +L G+  +H  G
Sbjct  66    VGSSGASDDGRS-YELFLELAPGGSLADEMKRCGGRCEEALVASRAGDVLRGLAHVHGAG  124

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENG-EASSSSAFSGTPAFMAPEVAKGEEQ  587
               HCD+K +N+L+  D  A K+AD GC ++     E    +A  GTP FM+PE A+GE Q
Sbjct  125   IAHCDVKARNVLLGADGRA-KLADFGCARWTTKAKEDGIGNAIMGTPMFMSPEAARGEAQ  183

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  ADIWA GCTVIEMATG APW+  + PV+AL+ +A+SGDVPE P WFS+  K+FL +C
Sbjct  184   GAAADIWALGCTVIEMATGGAPWR-FSSPVAALHHVAHSGDVPEAPSWFSEQGKDFLARC  242

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNST  947
             L RD  +RWTA +LL+HPF+ +++S+S         SP SV+DQ +W     +    ++T
Sbjct  243   LVRDPAQRWTAEQLLEHPFVAAVTSSSKAAPIAHWVSPKSVLDQDIWEDSSSTDSGDDTT  302

Query  948   ATAGFPANRIGRLIIQAGERLPD-WEEDG-GWVTVRGNEEDESTDSEPILISILCPEDLE  1121
                  PA+R+  L   + E  PD W   G  W+TV G   D  TDS   L   L PE   
Sbjct  303   VVP--PADRVRAL--ASVECSPDCWTWSGEEWITVCGGLTD--TDSNTAL--SLTPE---  351

Query  1122  SSIVNEAPSFDSSDDE  1169
              +   EA    + DDE
Sbjct  352   -ADTMEAAGSSNGDDE  366



>ref|NP_180810.1| mitogen-activated protein kinase kinase kinase 17 [Arabidopsis 
thaliana]
 gb|AAC25933.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08695.1| mitogen-activated protein kinase kinase kinase 17 [Arabidopsis 
thaliana]
Length=372

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/355 (45%), Positives = 200/355 (56%), Gaps = 24/355 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  A A   S    AVKS+ +  S  LQRE  ILS   SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATV-YAAAGHNSDEILAVKSSEVHRSEFLQREAKILSSLSSPYVIG  59

Query  234   CLGCDISCEHNNA-LYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N   +YNL +EY P GTL+D A +  GR  E  +  Y   IL G+ ++HS
Sbjct  60    YRGSETKRESNGVVMYNLLMEYAPYGTLTDAAAKDGGRVDETRVVKYTRDILKGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G VHCD+KG N+++SE   A KIAD GC K ++       S   GTPAFMAPEVA+GE+
Sbjct  120   KGIVHCDVKGSNVVISEKGEA-KIADFGCAKRVD---PVFESPVMGTPAFMAPEVARGEK  175

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCT+IEM TGS PW   +   DPVS LYR+  S + PE P   +++AK+F
Sbjct  176   QGKESDIWAVGCTMIEMVTGSPPWTKADSREDPVSVLYRVGYSSETPELPCLLAEEAKDF  235

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISS-NSVTFKEFVRNSPTSVMDQAVWNS------  914
             L KCL R+A  RWTA +LL HPFL +      V     + NSPTSV DQ  W S      
Sbjct  236   LEKCLKREANERWTATQLLNHPFLTTKPDIEPVLVPGLISNSPTSVTDQTFWRSVEEEEE  295

Query  915   -----IEMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVRGNEE  1061
                  I+      +  +  G  + RIGRL    G      + +GG W+ VR   E
Sbjct  296   EETEEIQKDSRDLDRLSLWGCYSERIGRLKCVGGLDGTRCDMEGGDWIMVRARCE  350



>ref|XP_010413987.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=363

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/355 (45%), Positives = 208/355 (59%), Gaps = 26/355 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG T+GRGS+ATV  AT    S    AVKS+ L  S  L+RE  ILS  DSPYV+ 
Sbjct  1     MEWTRGRTLGRGSTATVYAATFHN-SEEVLAVKSSELHRSEFLKREARILSSLDSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL++ A +  G   E  +  Y  +IL G+ ++HS
Sbjct  60    YRGSETKRESNGVVTYNLLMEYAPYGTLTEAAAKNGGGLDETRVVKYTREILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++++E   A KIAD GC K ++           GTPAFMAPEVA+GE+
Sbjct  120   EGIAHCDVKGSNVVLAEKGEA-KIADFGCAKRVD---PEFELMVMGTPAFMAPEVARGEK  175

Query  585   QGFPADIWAFGCTVIEMATGSAPWQD-MNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             QG  +D+WA GCTVIEM TGS PW +  +DP+S LYR+  SG+ PE P   ++DAK+FL 
Sbjct  176   QGKESDVWAVGCTVIEMLTGSPPWTEARDDPLSVLYRVGYSGETPELPCLLAEDAKDFLE  235

Query  762   KCLDRDAKRRWTAAELLQHPFLQS---ISSNSVTFKEFVRNSPTSVMDQAVWNSI-----  917
             KCL R+AK RWTA +LL HPFL +   I  + V+    V +SPTSV DQ  W S+     
Sbjct  236   KCLKREAKERWTATQLLNHPFLITKPDIEQDLVSG--LVSSSPTSVTDQTFWRSVEEEEE  293

Query  918   ------EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGG-WVTVRGNEE  1061
                   +      +  +  G  + RIG+L    G   P  + +GG W+TVR   E
Sbjct  294   EETEELQKGSRDLDRLSLWGCYSERIGQLRCVGGLDGPRCDMEGGDWITVRARCE  348



>gb|KCW44336.1| hypothetical protein EUGRSUZ_L02203, partial [Eucalyptus grandis]
Length=375

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/368 (45%), Positives = 225/368 (61%), Gaps = 28/368 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGPT+GRGSSA VS+A A G SG  FAVKSA  S S  L+RE+ IL++ D P+VV 
Sbjct  1     MSWTRGPTVGRGSSAAVSVAAAPG-SGDVFAVKSAEASRSDSLRRERAILAELDCPHVVT  59

Query  234   CLGCDISCEHN-NALYNLFLEYVPGGTLSDLAKRGRFS-----EPMIQFYAHQILMGIGF  395
               G D++ E     + NL +EY P GTL+D A           EP +++ A  IL G+ +
Sbjct  60    YRGWDVTREAGGRRVCNLLMEYAPRGTLADAAAAAGARGGRLGEPAVRWCARGILRGLEY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             +H  G  HCDIKGQNILV+ +    KIAD G  + +  G+ ++     GTP FMAPEVA+
Sbjct  120   VHGRGVAHCDIKGQNILVTGE--GPKIADFGLARRV-GGDWAAEGPVGGTPLFMAPEVAR  176

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GE  GF AD+W+ GCTVIE+ATG  PW D++DP+SA++RI  SG+ PE P + S+  ++F
Sbjct  177   GERPGFAADVWSLGCTVIEIATGRPPWADVSDPISAIHRIGFSGESPEIPSFLSEQCRDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-------KEFVRNSPTSVMDQ-AVWN  911
             L KCL RD   RW+A ELL+HPFL+ +   +  F       K     SPTSV++Q A+W+
Sbjct  237   LSKCLRRDPSERWSAGELLRHPFLEEVGEEAPEFLSEEAQTKIPDTESPTSVLEQAAIWS  296

Query  912   SIEMSQPS---CNSTATAGFPANRIGRLIIQ------AGERLPDWEEDGGWVTVRGNEED  1064
             S+E S+P       +     P  RI +LI +         ++P+WE+D  WVTVR +EE 
Sbjct  297   SLENSEPCHPLLQRSPPNRPPGERIQQLIGEWSANSIPPPQMPNWEQDESWVTVRSSEES  356

Query  1065  -ESTDSEP  1085
              E+ ++ P
Sbjct  357   REAPETSP  364



>gb|KCW75260.1| hypothetical protein EUGRSUZ_E04012, partial [Eucalyptus grandis]
Length=390

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 221/361 (61%), Gaps = 29/361 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGPT+GRGSSA VS+A A G SG  FAVKSA  S S  L+RE+ IL++ D P+VV 
Sbjct  1     MSWTRGPTVGRGSSAAVSVAAAPG-SGDVFAVKSAEASRSESLRRERAILAELDCPHVVT  59

Query  234   CLGCDISCEHN-NALYNLFLEYVPGGTLSDLAKRGRFS-----EPMIQFYAHQILMGIGF  395
               G D++ E     + NL +EY P GTL+D A           EP +++ A  IL G+ +
Sbjct  60    YRGWDVTREAGGRRVCNLLMEYAPRGTLADAAAAAGARGGRLGEPAVRWCARGILRGLEY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             +H  G  HCDIKGQNILV+ +    KIAD G  + +  G+ ++     GTP FMAPEVA+
Sbjct  120   VHGRGVAHCDIKGQNILVTGE--GPKIADFGLARRV-GGDWAAEGPVGGTPLFMAPEVAR  176

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GE  GF AD+W+ GCTVIE+ATG  PW D++DP+SA++RI  SG+ PE P + S+  ++F
Sbjct  177   GERPGFAADVWSLGCTVIEIATGRPPWADVSDPISAIHRIGFSGESPEIPSFLSEQCRDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-------KEFVRNSPTSVMDQ-AVWN  911
             L KCL RD   RW+A ELL+HPFL+ +   +  F       K     SPTSV++Q A+W+
Sbjct  237   LSKCLRRDPSERWSAGELLRHPFLEEVGEEAPEFLSEEAQTKIPDTESPTSVLEQAAIWS  296

Query  912   SIEMSQPSCNSTATAGFPANRIGRLIIQ-AGE---------RLPDWEEDGGWVTVRGNEE  1061
             S+E S+P C+       P    G  I Q  GE         ++P+WE+D  WVTVR +EE
Sbjct  297   SLENSEP-CHPLLQRSPPNRPPGERIQQLVGEWSANSIPPPQMPNWEQDESWVTVRSSEE  355

Query  1062  D  1064
             +
Sbjct  356   N  356



>ref|XP_007147708.1| hypothetical protein PHAVU_006G148000g [Phaseolus vulgaris]
 gb|ESW19702.1| hypothetical protein PHAVU_006G148000g [Phaseolus vulgaris]
Length=453

 Score =   274 bits (700),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 220/379 (58%), Gaps = 39/379 (10%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M+W RG  +GRGS+A V +A +   SG  FAVKSA L  S  L+RE+ ILS    P++V 
Sbjct  1     MDWTRGHMLGRGSTAAVYIAESH-RSGRVFAVKSAELHRSEFLKREEMILSTLKCPHIVA  59

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
               G D + E+    +N+F+EY P GTL++  + G   E ++  Y  QIL  + +LHS G 
Sbjct  60    YQGFDTTFENGVYWFNMFMEYAPHGTLAE--RGGGMEEAVVGSYTRQILQALHYLHSNGI  117

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VHCD+KGQN+LV+E+   VKIADLGC +          SA +GTPAFM+PEVA+GE+QGF
Sbjct  118   VHCDVKGQNVLVTEE--GVKIADLGCAR-----RVGELSAIAGTPAFMSPEVARGEQQGF  170

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
             PAD+WA GCTV+EM TG  PW    DP + +YRI  S ++PE P   S+  ++FLGKCL 
Sbjct  171   PADVWALGCTVLEMITGKPPWNGGGDPAAVVYRIGFSDELPEIPSGVSEQGRDFLGKCLK  230

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNS--PTSVMDQAVWNSIEMSQPSCNST  947
             RD   RW+  ELL H F++  +      K F+ +S  PT V+++  W+S+E  +      
Sbjct  231   RDPNERWSVEELLGHGFVKECTE----LKLFLLDSDTPTGVLERGFWDSLETIEHGARDC  286

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGG-----WVTVRGNEEDES-------------T  1073
              +   P +RIGRL   + E +  W  D       WVTVR NE  E              +
Sbjct  287   PS---PRDRIGRLF--SDEPVWVWNNDDDNDDEQWVTVRSNEFHEGLSLLKTETTFNMVS  341

Query  1074  DSEPILISILCPEDLESSI  1130
             D E  L+++  P+ + +S+
Sbjct  342   DEETGLVTLCEPKIVATSV  360



>ref|XP_009143997.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3 [Brassica 
rapa]
 gb|AGA37214.1| mitogen-activated protein kinase kinase kinase 17.1 [Brassica 
napus]
Length=367

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/350 (45%), Positives = 202/350 (58%), Gaps = 25/350 (7%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG  +GRGS+ATV  AT    S    AVKS+ L  S  LQRE +ILS   SPYV+ 
Sbjct  1     MEWTRGRILGRGSTATVCAATRHN-SNEILAVKSSELHRSEFLQREAEILSSLSSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+D A +  G   E MI  Y  ++L G+ ++HS
Sbjct  60    YRGSETKRELNGVVTYNLLMEYAPYGTLTDAAAKNGGGLEEAMIVKYTREMLRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++V E   A KI D GC K ++      S    GTPAFMAPEVA+GE+
Sbjct  120   RGVAHCDVKGSNVVVGEKGEA-KIVDFGCAKRVD--PEVESEPVVGTPAFMAPEVARGEK  176

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMN---DPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             QG  +DIWA GCTVIEMATGS PW + +     VS LYR+  SG+ PE P   +++AK+F
Sbjct  177   QGRESDIWAVGCTVIEMATGSPPWTEASSGESSVSVLYRVGYSGEAPELPCLLTEEAKDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNS-------  914
             L KC  R+AK RWTA +LL HPFL +   N+      V +SPTSV+DQ  W S       
Sbjct  237   LEKCFKREAKERWTATQLLNHPFLIT-KPNTEPVSGLVSSSPTSVIDQTFWTSGGEEEET  295

Query  915   --IEMSQPSCNSTATAGFPANRIGRLIIQA---GERLPDWEEDGGWVTVR  1049
               ++    + +        + RIGRL       G RL    E GGW+TVR
Sbjct  296   EELQEDSRNLDRLNLWACHSERIGRLRCVGGLDGSRLD--MEGGGWITVR  343



>ref|XP_006646238.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Oryza brachyantha]
Length=459

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 152/344 (44%), Positives = 208/344 (60%), Gaps = 15/344 (4%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W R  T+GRG+S  V      GASG  FAVK+A  + + ML+RE+ ++S   SP+VV C+
Sbjct  9     WTRLRTLGRGASGAVVSLAEDGASGELFAVKTAGAAEAAMLRRERGMMSGLSSPHVVPCI  68

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G     +  +  YNLFLE+ PGG+L+D   R  G   E  I+ YA  +L G+ +LH    
Sbjct  69    G---GSDGPDGSYNLFLEFAPGGSLADEVARNGGHLEECAIRVYAADVLRGLAYLHGRSL  125

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VH D+K +NI++  D  A K+AD GC K ++     S+    GTPAFMAPEVA+GEEQG 
Sbjct  126   VHGDVKARNIVIGVDGLA-KLADFGCAKTMD-----SARPVGGTPAFMAPEVARGEEQGP  179

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCT+IEMATG APW DM+D ++A++RI  +  VPE P W S +AK+FL  CL 
Sbjct  180   AADVWALGCTIIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPAWLSAEAKDFLAMCLV  239

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNSTA  950
             R+A  R TAA+LL HPF+ + + + V   + +R  SP S +D A W S    +   + TA
Sbjct  240   RNASNRSTAAQLLDHPFV-AFACHEVKAAQPLRWVSPKSTLDAAFWESETDDEEEAHETA  298

Query  951   TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSE  1082
              +    +RI  L       LPDW+ D GW+ +   E+ ES DSE
Sbjct  299   ESLRLCDRIKSLACSVSA-LPDWDSDEGWIDLF-VEQCESRDSE  340



>ref|XP_010059586.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
Length=469

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 226/369 (61%), Gaps = 30/369 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGPT+GRGSSA VS+A A G SG  FAVKSA  S S  L+RE+ IL++ D P+VV 
Sbjct  1     MSWTRGPTVGRGSSAAVSVAAAPG-SGDVFAVKSAEASRSESLRRERAILAELDCPHVVT  59

Query  234   CLGCDISCEHN-NALYNLFLEYVPGGTLSDLAKRGRFS-----EPMIQFYAHQILMGIGF  395
               G D++ E     + NL +EY P GTL+D A           EP +++ A  IL G+ +
Sbjct  60    YRGWDVTREAGGRRVCNLLMEYAPRGTLADAAAAAGARGGRLGEPAVRWCARGILRGLEY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             +H  G  HCDIKGQNILV+ +    KIAD G  + +  G+ ++     GTP FMAPEVA+
Sbjct  120   VHGRGVAHCDIKGQNILVTGE--GPKIADFGLARRV-GGDWAAEGPVGGTPLFMAPEVAR  176

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GE  GF AD+W+ GCTVIE+ATG  PW D++DP+SA++RI  SG+ PE P + S+  ++F
Sbjct  177   GERPGFAADVWSLGCTVIEIATGRPPWADVSDPISAIHRIGFSGESPEIPSFLSEQCRDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-------KEFVRNSPTSVMDQ-AVWN  911
             L KCL RD   RW+A ELL+HPFL+ +   +  F       K     SPTSV++Q A+W+
Sbjct  237   LSKCLRRDPSERWSAGELLRHPFLEEVGEEAPEFLSEEAQTKIPDTESPTSVLEQAAIWS  296

Query  912   SIEMSQPSCNSTATAGFPANRIGRLIIQ-AGE---------RLPDWEEDGGWVTVRGNEE  1061
             S+E S+P C+       P    G  I Q  GE         ++P+WE+D  WVTVR +EE
Sbjct  297   SLENSEP-CHPLLQRSPPNRPPGERIQQLVGEWSANSIPPPQMPNWEQDESWVTVRSSEE  355

Query  1062  D-ESTDSEP  1085
             + E+ ++ P
Sbjct  356   NREAPETGP  364



>ref|XP_006295854.1| hypothetical protein CARUB_v10024983mg [Capsella rubella]
 gb|EOA28752.1| hypothetical protein CARUB_v10024983mg [Capsella rubella]
Length=363

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 212/373 (57%), Gaps = 30/373 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             MEW RG T+G+GS+ATV  A     S    AVKS+ L  S  L+RE  ILS  +SPYV+ 
Sbjct  1     MEWTRGRTLGQGSTATV-YAVKCHNSEEFLAVKSSDLHRSEFLKREAKILSSMNSPYVIG  59

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
               G +   E N  + YNL +EY P GTL+D A +  G   E  +  Y  +IL G+ ++HS
Sbjct  60    YRGSETRRESNGVVTYNLLMEYAPYGTLTDAAAKNGGGLDETRVVKYTREILRGLEYIHS  119

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
              G  HCD+KG N++++E   A KIAD GC K ++           GTPAFMAPEVA+GE+
Sbjct  120   KGIAHCDLKGSNVVLAEKGEA-KIADFGCAKRVD---PEFELKVMGTPAFMAPEVARGEK  175

Query  585   QGFPADIWAFGCTVIEMATGSAPWQD-MNDPVSALYRIANSGDVPEFPRWFSDDAKEFLG  761
             QG  +DIWA GCTVIEM TGS PW +  +DPVS LYR+  SG+ PE P    +DAK+FL 
Sbjct  176   QGKESDIWAVGCTVIEMVTGSPPWTEATDDPVSVLYRVGYSGETPELPCLLEEDAKDFLE  235

Query  762   KCLDRDAKRRWTAAELLQHPFLQSISS-NSVTFKEFVRNSPTSVMDQAVWNSI-------  917
             KCL R+AK RWTA +LL HPFL +            V +SPTSV DQ  W S+       
Sbjct  236   KCLKREAKERWTATQLLNHPFLVTKPDIEPSLVSGLVSSSPTSVTDQTFWRSVEEEEEEE  295

Query  918   --EMSQPSCNSTATAGFP---ANRIGRLIIQAGERLPDWEEDG-GWVTVRGNEEDESTDS  1079
               E+ + S +    + +    + RIGRL    G   P W+ +G  W+TVR          
Sbjct  296   TEELKKDSRDLDRLSSWGCCYSERIGRLRCVGGLDGPRWDMEGEDWITVRAR-------C  348

Query  1080  EPILISILCPEDL  1118
             E  +IS+   E+L
Sbjct  349   EGTMISVWSHEEL  361



>ref|XP_010041453.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
Length=481

 Score =   270 bits (690),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 164/368 (45%), Positives = 225/368 (61%), Gaps = 28/368 (8%)
 Frame = +3

Query  54    MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
             M W RGPT+GRGSSA VS+A A G SG  FAVKSA  S S  L+RE+ IL++ D P+VV 
Sbjct  1     MSWTRGPTVGRGSSAAVSVAAAPG-SGDVFAVKSAEASRSDSLRRERAILAELDCPHVVT  59

Query  234   CLGCDISCEHN-NALYNLFLEYVPGGTLSDLAKRGRFS-----EPMIQFYAHQILMGIGF  395
               G D++ E     + NL +EY P GTL+D A           EP +++ A  IL G+ +
Sbjct  60    YRGWDVTREAGGRRVCNLLMEYAPRGTLADAAAAAGARGGRLGEPAVRWCARGILRGLEY  119

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAK  575
             +H  G  HCDIKGQNILV+ +    KIAD G  + +  G+ ++     GTP FMAPEVA+
Sbjct  120   VHGRGVAHCDIKGQNILVTGE--GPKIADFGLARRV-GGDWAAEGPVGGTPLFMAPEVAR  176

Query  576   GEEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             GE  GF AD+W+ GCTVIE+ATG  PW D++DP+SA++RI  SG+ PE P + S+  ++F
Sbjct  177   GERPGFAADVWSLGCTVIEIATGRPPWADVSDPISAIHRIGFSGESPEIPSFLSEQCRDF  236

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTF-------KEFVRNSPTSVMDQ-AVWN  911
             L KCL RD   RW+A ELL+HPFL+ +   +  F       K     SPTSV++Q A+W+
Sbjct  237   LSKCLRRDPSERWSAGELLRHPFLEEVGEEAPEFLSEEAQTKIPDTESPTSVLEQAAIWS  296

Query  912   SIEMSQPS---CNSTATAGFPANRIGRLIIQ------AGERLPDWEEDGGWVTVRGNEED  1064
             S+E S+P       +     P  RI +LI +         ++P+WE+D  WVTVR +EE 
Sbjct  297   SLENSEPCHPLLQRSPPNRPPGERIQQLIGEWSANSIPPPQMPNWEQDESWVTVRSSEES  356

Query  1065  -ESTDSEP  1085
              E+ ++ P
Sbjct  357   REAPETSP  364



>gb|EAY98899.1| hypothetical protein OsI_20854 [Oryza sativa Indica Group]
Length=439

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 165/436 (38%), Positives = 237/436 (54%), Gaps = 44/436 (10%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W R  T+GRG+S       A  ASG  FAVKS   + +  L+RE+ +++   SP+VV C
Sbjct  12    QWTRVRTLGRGASGAEVFLAADDASGELFAVKSVGAAGAAALRREQGVMAGLSSPHVVPC  71

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G  +     +  Y +FLE+ PGG+L+D+A R  GR  E  +  YA  +  G+ +LH MG
Sbjct  72    IGGRVG---RDGSYQMFLEFAPGGSLADVAARCGGRMEERAVGEYAADVARGLAYLHGMG  128

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K +N+++  D  A K+AD GC ++ ++G         GTPAFMAPEVA+GEEQ 
Sbjct  129   LVHGDVKARNVVIGGDGRA-KLADFGCARWADSGRP-----IGGTPAFMAPEVARGEEQS  182

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S DAK+FL +CL
Sbjct  183   PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTEAVPEVPGWLSADAKDFLARCL  242

Query  771   DRDAKRRWTAAELLQHPFLQSISSNS---VTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
              R    R TAA+LL+HPF+ S + +        ++V  SP S +D A+W S    +    
Sbjct  243   QRRPIDRSTAAQLLEHPFVASAAGDGKPEAAKSKWV--SPKSTLDAALWESDTDEEEDDE  300

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPEDLE  1121
              + +    A RIG L   A   LPDW+ D GW+ V     +ES ++              
Sbjct  301   LSQST---AERIGSLAC-AASSLPDWDSDDGWIDVISTPTEESCET-------------T  343

Query  1122  SSIVNEAPSFDSSDDEISVNDRVNPRTNLDL----SCHNFTDAFVSWIQD-----FDDNI  1274
             +S  +E  + D + D I   +   P  ++D     + HN  +A    I       FD  +
Sbjct  344   TSPADEETTTDLNGD-IRTAEFELPHIDVDSGNGNTTHNVGEANAQHIISPSNLVFDQVL  402

Query  1275  LKTSFSSKAL-ILFTP  1319
              KT F +K + I F P
Sbjct  403   CKTPFCNKHIAIEFIP  418



>ref|NP_001056212.1| Os05g0545400 [Oryza sativa Japonica Group]
 dbj|BAF18126.1| Os05g0545400, partial [Oryza sativa Japonica Group]
Length=425

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 165/436 (38%), Positives = 237/436 (54%), Gaps = 44/436 (10%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W R  T+GRG+S       A  ASG  FAVKS   + +  L+RE+ +++   SP+VV C
Sbjct  14    QWTRVRTLGRGASGAEVFLAADDASGELFAVKSVGAAGAAALRREQGVMAGLSSPHVVPC  73

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G  +     +  Y +FLE+ PGG+L+D+A R  GR  E  +  YA  +  G+ +LH MG
Sbjct  74    IGGRVG---RDGSYQMFLEFAPGGSLADVAARCGGRMEECAVGEYAVDVARGLAYLHGMG  130

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K +N+++  D  A K+AD GC ++ ++G         GTPAFMAPEVA+GEEQ 
Sbjct  131   LVHGDVKARNVVIGGDGRA-KLADFGCARWADSGRP-----IGGTPAFMAPEVARGEEQS  184

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S DAK+FL +CL
Sbjct  185   PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTEAVPEVPGWLSADAKDFLARCL  244

Query  771   DRDAKRRWTAAELLQHPFLQSISSNS---VTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
              R    R TAA+LL+HPF+ S + +        ++V  SP S +D A+W S    +    
Sbjct  245   QRRPIDRSTAAQLLEHPFVASAAGDGKPEAAKSKWV--SPKSTLDAALWESDTDEEEDDE  302

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPEDLE  1121
              + +    A RIG L   A   LPDW+ D GW+ V     +ES ++              
Sbjct  303   LSQST---AERIGSLAC-AASSLPDWDSDDGWIDVISTPTEESCET-------------T  345

Query  1122  SSIVNEAPSFDSSDDEISVNDRVNPRTNLDL----SCHNFTDAFVSWIQD-----FDDNI  1274
             +S  +E  + D + D I   +   P  ++D     + HN  +A    I       FD  +
Sbjct  346   TSPADEETTTDLNGD-IRTAEFELPHIDVDSGNGNTTHNVGEANAQHIISPSNLVFDQVL  404

Query  1275  LKTSFSSKAL-ILFTP  1319
              KT F +K + I F P
Sbjct  405   CKTPFCNKHIAIEFIP  420



>ref|XP_003567029.2| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Brachypodium distachyon]
Length=509

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 204/345 (59%), Gaps = 21/345 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
              W R  T+GRG+S  V    AA  SG  FAVKSA  + +  L+RE DILS   SP+V+ C
Sbjct  81    RWTRVRTLGRGASGAVVSLAAADLSGALFAVKSARAAGAEQLRREGDILSGLSSPHVLPC  140

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG       ++    LFLE+ PGG+++D+A+R  GR  E  I+ YA  +  G+ +LH M 
Sbjct  141   LGF----RADSGECQLFLEFAPGGSVADVAERSGGRLEECAIRAYAADVARGLAYLHGMS  196

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+KG+N++V  D  A K+AD GC + ++     S     GTPAFMAPEVA+GEEQG
Sbjct  197   LVHGDLKGRNVVVGADGRA-KLADFGCARTVD-----SDRPIGGTPAFMAPEVARGEEQG  250

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTV+EMATG APW DM+D ++A++RI  +  VPE P W S +AK FL  C 
Sbjct  251   PAADVWALGCTVVEMATGRAPWSDMDDVLAAMHRIGYTDAVPEVPGWLSAEAKHFLAMCF  310

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN--SPTSVMDQAVWNSIEMSQPSCNS  944
              RDA+ R TAA+LL+HPFL +++   V   E      SP S +D A+W S    +   + 
Sbjct  311   ARDARNRCTAAQLLEHPFL-ALAGCGVKPDEMATKWVSPKSTLDAALWESDTEEEEENSE  369

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
             +        RI + +       PDW+ D  W+ V  NE  E++D+
Sbjct  370   SPA-----ERI-KALASTCSAFPDWDSDESWIDVLNNERCEASDA  408



>gb|KDP20719.1| hypothetical protein JCGZ_21190 [Jatropha curcas]
Length=414

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 208/338 (62%), Gaps = 18/338 (5%)
 Frame = +3

Query  90    SSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDS-PYVVKCLGCDISCEHN  266
             S+ATVS+AT    S   FAVKSA LS S  LQ+E+ IL      P ++   G +++ E+ 
Sbjct  7     STATVSIATV-DESDQAFAVKSAELSQSEFLQKEQSILFTLRPCPQIIAYKGFEVTEEYG  65

Query  267   NALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGFVHCDIKGQN  440
                YN+FLEY P GTL+D  +   G   E +I+ Y  +IL+G+  LHS G +H DIK  N
Sbjct  66    KLFYNIFLEYAPAGTLTDAIRLRGGCLEEGIIRSYTREILLGLHHLHSNGIIHSDIKCHN  125

Query  441   ILVSEDCSAVKIADLGCGKFLEN-GEASSSSAFSGTPAFMAPEVAKGEEQGFPADIWAFG  617
             ILV+ D    K+AD GC + ++    A++ +  +GTP +MAPEVA+GE QGFPAD+WA G
Sbjct  126   ILVTSD--GPKLADFGCARRVDQFCSATARTTIAGTPIYMAPEVARGEHQGFPADVWALG  183

Query  618   CTVIEMATGSAPWQDMNDPVSALYRIANS-GDVPEFPRWFSDDAKEFLGKCLDRDAKRRW  794
             C V+EMATG APW +++DPVSA+Y+I  S   +PE P + S   K+F+ KCL RD   RW
Sbjct  184   CAVVEMATGRAPWTNISDPVSAIYQIGFSDKSMPEIPSFMSKQGKDFISKCLKRDPVERW  243

Query  795   TAAELLQHPFLQ----SISSNSVTFKEFVRNSPTSVMDQ---AVWNSIEMSQPSCNST-A  950
             +A+ELL H F+     ++ S +   KE   +SPTSV++    ++W+  E  + +   T  
Sbjct  244   SASELLNHSFIAEEGFNVDSPTSVLKEINVDSPTSVLEHQELSLWDPNEEVETTWKWTHK  303

Query  951   TAGFPANRIGRL--IIQAGERLPDWEEDGGWVTVRGNE  1058
             + G P + I R+  + Q   R+P+WE D  W+TVRG +
Sbjct  304   SKGNPHSPIERISKLAQTQPRVPNWESDDNWITVRGKD  341



>gb|EEE64568.1| hypothetical protein OsJ_19420 [Oryza sativa Japonica Group]
Length=441

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 165/436 (38%), Positives = 237/436 (54%), Gaps = 44/436 (10%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W R  T+GRG+S       A  ASG  FAVKS   + +  L+RE+ +++   SP+VV C
Sbjct  14    QWTRVRTLGRGASGAEVFLAADDASGELFAVKSVGAAGAAALRREQGVMAGLSSPHVVPC  73

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G  +     +  Y +FLE+ PGG+L+D+A R  GR  E  +  YA  +  G+ +LH MG
Sbjct  74    IGGRVG---RDGSYQMFLEFAPGGSLADVAARCGGRMEECAVGEYAVDVARGLAYLHGMG  130

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K +N+++  D  A K+AD GC ++ ++G         GTPAFMAPEVA+GEEQ 
Sbjct  131   LVHGDVKARNVVIGGDGRA-KLADFGCARWADSGRP-----IGGTPAFMAPEVARGEEQS  184

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S DAK+FL +CL
Sbjct  185   PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTEAVPEVPGWLSADAKDFLARCL  244

Query  771   DRDAKRRWTAAELLQHPFLQSISSNS---VTFKEFVRNSPTSVMDQAVWNSIEMSQPSCN  941
              R    R TAA+LL+HPF+ S + +        ++V  SP S +D A+W S    +    
Sbjct  245   QRRPIDRSTAAQLLEHPFVASAAGDGKPEAAKSKWV--SPKSTLDAALWESDTDEEEDDE  302

Query  942   STATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILCPEDLE  1121
              + +    A RIG L   A   LPDW+ D GW+ V     +ES ++              
Sbjct  303   LSQST---AERIGSLAC-AASSLPDWDSDDGWIDVISTPTEESCET-------------T  345

Query  1122  SSIVNEAPSFDSSDDEISVNDRVNPRTNLDL----SCHNFTDAFVSWIQD-----FDDNI  1274
             +S  +E  + D + D I   +   P  ++D     + HN  +A    I       FD  +
Sbjct  346   TSPADEETTTDLNGD-IRTAEFELPHIDVDSGNGNTTHNVGEANAQHIISPSNLVFDQVL  404

Query  1275  LKTSFSSKAL-ILFTP  1319
              KT F +K + I F P
Sbjct  405   CKTPFCNKHIAIEFIP  420



>ref|XP_003560747.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Brachypodium distachyon]
Length=507

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 205/357 (57%), Gaps = 34/357 (10%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             EW RGP IGRGSSA VSLA     +G  FAVKS     +  L+RE+ IL    SPYVV+C
Sbjct  5     EWTRGPAIGRGSSAVVSLAVDR-VTGVVFAVKSVGAGRAAELRREQSILRGLSSPYVVRC  63

Query  237   LG--CDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
             LG   D S E       + +EY  GG+L+D  +R  GR  E +I+  A  +L G+   H 
Sbjct  64    LGYVADGSGE-------MLMEYAAGGSLADEIRRCGGRCPEALIRCRARDVLRGLAHAHG  116

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGK-FLENGEASSSSAFSGTPAFMAPEVAKGE  581
              G  HCD+K +N+LV     A+ +AD GC +  + +          GTP FMAPE A+GE
Sbjct  117   AGVAHCDVKARNVLVGSHGRAM-LADFGCARRIVASSREPQLMGMGGTPMFMAPEAARGE  175

Query  582   EQGFPADIWAFGCTVIEMATGSAPWQD-MNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             E+G  AD+WA GCTVIEMATG APW+    DPV+AL+ +A SG+ PE P W S+  KEFL
Sbjct  176   ERGAAADVWAVGCTVIEMATGGAPWRSRFADPVAALHHVAFSGEAPELPPWLSEAGKEFL  235

Query  759   GKCLDRDAKRRWTAAELLQHP-FLQ----SISSNS-----VTFKEFVRNSPTSVMDQAVW  908
             G+CL +D + RWTA +LL+HP FLQ    ++S +S     +T KE    SP SV+DQ  W
Sbjct  236   GRCLRQDPRERWTAEQLLEHPWFLQADADAVSCSSSFLPGITGKETTFVSPKSVLDQVPW  295

Query  909   NSIEMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
             +  +        T     P +R+  L   +G   PDW  DG W+TV   + D+  D+
Sbjct  296   DDDD------TRTGADNDPTDRVRAL---SGGGAPDWTWDGSWITVHSGDNDDHHDA  343



>gb|ACH99693.1| NPKL1 [Oryza sativa Indica Group]
Length=483

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 206/358 (58%), Gaps = 31/358 (9%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
              W R  T+GRG+S  V      GASG  FAVK+A  + + ML+RE+ ++S   SP+VV C
Sbjct  8     RWTRLRTLGRGASGAVVSLAEDGASGELFAVKTAAAAEAAMLRRERGMMSGLSSPHVVPC  67

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G     +  +  YNLFLE+ PGG+L++   R  GR  E  I+ YA  +L G+ +LH M 
Sbjct  68    IG---GGDGPDGSYNLFLEFAPGGSLANEVARDGGRLEERAIRVYAADVLRGLTYLHGMS  124

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K  NI++  D  A K+AD GC K ++     S     GTPAFMAPEVA+GEEQG
Sbjct  125   LVHGDVKADNIVIGVDGLA-KLADFGCAKTMD-----SERPVGGTPAFMAPEVARGEEQG  178

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S +AK+FL  C 
Sbjct  179   PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPVWLSAEAKDFLAMCF  238

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSI-------EMS  926
              R+A  R TAA+LL+HPF+          +   R  SP S +D A W S        E++
Sbjct  239   ARNAGDRSTAAQLLEHPFVAFACHEVKAAQPKPRWVSPKSTLDAAFWESETDDEEVDEIT  298

Query  927   QPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISI  1100
             +  C+   +   P +            LPDW+ D GW+ + G E+ E+ DSE    SI
Sbjct  299   ESLCDRIKSLACPVS-----------ALPDWDSDEGWIDLLG-EQCEACDSEAARESI  344



>ref|NP_001043977.1| Os01g0699100 [Oryza sativa Japonica Group]
 dbj|BAF05891.1| Os01g0699100, partial [Oryza sativa Japonica Group]
Length=431

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 165/407 (41%), Positives = 223/407 (55%), Gaps = 37/407 (9%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
              W R  T+GRG+S  V      GASG  FAVK+A  + + ML+RE+ ++S   SP+VV C
Sbjct  8     RWTRLRTLGRGASGAVVSLAEDGASGELFAVKTAAAAEAAMLRRERGMMSGLSSPHVVPC  67

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G     +  +  YNLFLE+ PGG+L++   R  GR  E  I+ YA  +L G+ +LH M 
Sbjct  68    IG---GGDGPDGSYNLFLEFAPGGSLANEVARDGGRLEERAIRVYAADVLRGLTYLHGMS  124

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K  NI++  D  A K+AD GC K ++     S    SGTPAFMAPEVA+GEEQG
Sbjct  125   LVHGDVKADNIVIGVDGLA-KLADFGCAKTMD-----SERPVSGTPAFMAPEVARGEEQG  178

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S +AK+FL  C 
Sbjct  179   PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPVWLSAEAKDFLAMCF  238

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNST  947
              R+A  R TAA+LL+HPF+          +   R  SP S +D A W S    +   +  
Sbjct  239   ARNAGDRSTAAQLLEHPFVAFACHEVKAAQPKPRWVSPKSTLDAAFWESETDDEEEVDEI  298

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEP----ILISILCPED  1115
               +    +RI  L       LPDW+ D GW+ + G E+ E+ DSE     I ++   P  
Sbjct  299   TES--LCDRIKSLACPV-SALPDWDSDEGWIDLLG-EQCEACDSEAARESIDVARSAPSK  354

Query  1116  LESSIV----------------NEAPSFDSS-DDEISVNDRVNPRTN  1205
             + S+                  NEA +FD S   +I   DR   R N
Sbjct  355   VSSAATVPAAEVVLVGGGCCPSNEADAFDQSIGGDIQAADRSIERRN  401



>gb|ACH99692.1| NPKL1 [Oryza sativa Japonica Group]
Length=484

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 153/351 (44%), Positives = 205/351 (58%), Gaps = 16/351 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
              W R  T+GRG+S  V      GASG  FAVK+A  + + ML+RE+ ++S   SP+VV C
Sbjct  8     RWTRLRTLGRGASGAVVSLAEDGASGELFAVKTAAAAEAAMLRRERGMMSGLSSPHVVPC  67

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G     +  +  YNLFLE+ PGG+L++   R  GR  E  I+ YA  +L G+ +LH M 
Sbjct  68    IG---GGDGPDGSYNLFLEFAPGGSLANEVARDGGRLEERAIRVYAADVLRGLTYLHGMS  124

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K  NI++  D  A K+AD GC K ++     S    SGTPAFMAPEVA+GEEQG
Sbjct  125   LVHGDVKADNIVIGVDGLA-KLADFGCAKTMD-----SERPVSGTPAFMAPEVARGEEQG  178

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S +AK+FL  C 
Sbjct  179   PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPVWLSAEAKDFLAMCF  238

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNST  947
              R+A  R TAA+LL+HPF+          +   R  SP S +D A W S    +   +  
Sbjct  239   ARNAGDRSTAAQLLEHPFVAFACHEVKAAQPKPRWVSPKSTLDAAFWESETDDEEEVDEI  298

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISI  1100
               +    +RI  L       LPDW+ D GW+ + G E+ E+ DSE    SI
Sbjct  299   TES--LCDRIKSLACPVSA-LPDWDSDEGWIDLLG-EQCEACDSEAARESI  345



>gb|ACH99695.1| NPKL2 [Oryza sativa Indica Group]
Length=393

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 194/343 (57%), Gaps = 18/343 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W R  T+GRG+S  V    A   SG  FAVKSA  +++  L RE  ILS   SP+V+ CL
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAEQLVREGRILSGLRSPHVLPCL  68

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G             LFLE+ PGG+L+D+  R  GR  E  I+ YA  +  G+ +LH M  
Sbjct  69    GFRA---EAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMSL  125

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VH D+KG+N++V  D  A KIAD GC + +      S     GTPAFMAPEVA+GEEQ  
Sbjct  126   VHGDVKGRNVVVGADGRA-KIADFGCARTV-----GSDRPIGGTPAFMAPEVARGEEQEP  179

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCTVIEMATG APW DM D +SA+ RI  +  VPE P W S +AK+FL +C  
Sbjct  180   AADVWALGCTVIEMATGRAPWSDMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCFA  239

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNSTA  950
             R+ + RWT+++LL+HPFL S   +  T +   +  SP S +D A W S            
Sbjct  240   RNPRERWTSSQLLEHPFLASAGCSVKTGEAAPQWVSPKSTLDAAFWESDTDD----EEDD  295

Query  951   TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                 PA RI  L       LPDW+ D GW+ V  NE  E+ D+
Sbjct  296   MPASPAERIKALACPCSA-LPDWDSDEGWIQVL-NESSEACDT  336



>gb|EAY77607.1| hypothetical protein OsI_32649 [Oryza sativa Indica Group]
Length=526

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 156/370 (42%), Positives = 209/370 (56%), Gaps = 32/370 (9%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSA-HLSSSGMLQREKDILSQFDSPYVVKC  236
             W R  ++GRG+S  V    A   SG  F +KSA   ++   L+RE  ++S   SP+V+KC
Sbjct  11    WTRLRSVGRGASGAVVSLAANDVSGELFVIKSAGEGAARQQLRREWSVMSWLSSPHVLKC  70

Query  237   LG-CDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             LG    S       + LFLEY PGG+L+D+  R  GR  E  ++ YA  +L+G+ +LH  
Sbjct  71    LGFVQASGGCGGGEHQLFLEYAPGGSLADVVARNGGRLDEGAVRAYAADVLIGLDYLHGK  130

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VH D+KG N+LV  D  A K+ D GC +    G  S      GTPAFMAPEVA+GEEQ
Sbjct  131   LVVHGDVKGSNVLVGADGRA-KLTDFGCARVAMPG-GSKQPVLGGTPAFMAPEVARGEEQ  188

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCTVIEMATG APW DM++ + AL++I  +  VP+ PRW S +AK+FL  C
Sbjct  189   GLAADVWALGCTVIEMATGRAPWSDMDNVLPALHKIGYTDAVPDLPRWLSPEAKDFLRGC  248

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMDQAVWNS-------I  917
             L R A  R TAA+LLQHPF+    S  +  KE V+    SPTS +D  +W S        
Sbjct  249   LQRRAGDRPTAAQLLQHPFIS--KSCGLNNKETVKATWVSPTSALDATLWESESSSTDGE  306

Query  918   EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDG---GWVTVRG----NEEDESTD  1076
             E+   S NS      P  RI R +  +G+ LPDW+ D     W+ V G    N  +++  
Sbjct  307   EVDDMSSNS------PTGRI-RAMACSGQTLPDWDSDDHGCSWIEVLGSVSINVANKTAA  359

Query  1077  SEPILISILC  1106
              E  + S+ C
Sbjct  360   IEQRVTSMAC  369



>ref|XP_003567028.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Brachypodium distachyon]
Length=488

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 151/345 (44%), Positives = 210/345 (61%), Gaps = 18/345 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSS-ATVSLATAAGASGHHFAVKSAH-LSSSGMLQREKDILSQFDSPYVV  230
              W R  T+G G+S A VSLAT A ASG  FAVKS    + + +L RE+ ILS   SP++V
Sbjct  8     HWTRLRTLGCGASGAVVSLATDA-ASGELFAVKSVRGAADADLLSREQGILSGLSSPHIV  66

Query  231   KCLGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRGRF-SEPMIQFYAHQILMGIGFLHS  404
             +C+G     E  +  Y+LFLE+ PGG+L+D +A+ G F  E  I+ YA  +L G+ ++H 
Sbjct  67    RCIGG--LGEDRDGSYHLFLEFAPGGSLADEVARNGGFLEEHAIRAYAADVLRGLAYIHG  124

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
                VH D+K +N+++  D  A KIAD GC + L+     S+    GTPAFMAPEVA+GEE
Sbjct  125   ESLVHGDVKARNVVIGVDGRA-KIADFGCARALD-----STRPIGGTPAFMAPEVARGEE  178

Query  585   QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             QG  AD+WA GCT+IEMATG APW DM+D ++A++RI  +  VPE P W S +AK FL  
Sbjct  179   QGPAADVWALGCTIIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPMWMSAEAKNFLAM  238

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             C  R+A+ R TA +LL+HPF+ ++ +       +V  SP S +D A W S    +     
Sbjct  239   CFARNARDRCTAEQLLEHPFV-AVQAGEAKAARWV--SPKSTLDAAFWESETDGEEE-ED  294

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
               ++   + RI  L       LPDW+ D GW+ V G++ DE+ DS
Sbjct  295   EISSQSSSERIKSLSCPVSA-LPDWDSDEGWIDVLGDQHDEACDS  338



>ref|XP_004972118.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Setaria italica]
Length=496

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 200/346 (58%), Gaps = 35/346 (10%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGM-LQREKDILSQFDSPYVVKC  236
             W R  T+GRG+S  V    A GASG  FAVKSA  + +   L+RE+ +L+   SP+VV+C
Sbjct  10    WRRLHTLGRGASGAVVSLAADGASGELFAVKSAAAAHAAAALRRERGVLAGLSSPHVVRC  69

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G     E  +  Y LFLEY PGG+L+D   R  G   E  ++ YA  +  G+ +LH+  
Sbjct  70    VG---GAEGADGSYQLFLEYAPGGSLADEVARNGGSLGERAVRAYAADVARGLAYLHARS  126

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K +N+++  D  A K+AD G  +        S+ A  GTPAFMAPEVA+GEEQG
Sbjct  127   VVHGDVKARNVVIGADGRA-KLADFGSAR-----APGSARAIGGTPAFMAPEVARGEEQG  180

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM+D ++AL+RI  +  VPE P W S +AK+FL  C 
Sbjct  181   PAADVWALGCTVIEMATGRAPWSDMDDVLAALHRIGYTDAVPEVPSWLSAEAKDFLACCF  240

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSI------EMSQ  929
              RDA  RWTAAELL+HPF+    ++     E  R  SP S +D A W S       EM +
Sbjct  241   ARDAADRWTAAELLEHPFVAFAGAD-----EKARWVSPKSTLDAAFWESESDDEADEMPE  295

Query  930   PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDE  1067
              +          A RI  L   A    PDW+ + GW+ V G ++ E
Sbjct  296   DA----------AERIKSLACSASA-FPDWDCEEGWIDVLGEQQSE  330



>gb|ACH99694.1| NPKL2 [Oryza sativa Japonica Group]
Length=394

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 151/344 (44%), Positives = 194/344 (56%), Gaps = 19/344 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKC  236
             W R  T+GRG+S  V    A   SG  FAVKSA  +++   L RE  ILS   SP+V+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG             LFLE+ PGG+L+D+  R  GR  E  I+ YA  +  G+ +LH M 
Sbjct  69    LGFRA---EAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMS  125

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+KG+N++V  D  A KIAD GC + +      S     GTPAFMAPEVA+GEEQ 
Sbjct  126   LVHGDVKGRNVVVGADGRA-KIADFGCARTV-----GSDRPIGGTPAFMAPEVARGEEQE  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM D +SA+ RI  +  VPE P W S +AK+FL +C 
Sbjct  180   PAADVWALGCTVIEMATGRAPWSDMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCF  239

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNST  947
              R+ + RWT+++LL+HPFL S   +  T +   +  SP S +D A W S           
Sbjct  240   ARNPRERWTSSQLLEHPFLASAGCSVKTGEAAPQWVSPKSTLDVAFWESDTDD----EED  295

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                  PA RI  L       LPDW+ D GW+ V  NE  E+ D+
Sbjct  296   DMPASPAERIKALACPCSA-LPDWDSDEGWIQVL-NESSEACDT  337



>ref|XP_004972119.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Setaria italica]
Length=469

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 196/347 (56%), Gaps = 17/347 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W R  T+GRG+S  V    A  ASG  FAVKSA  S+   L+RE  ILS   SP+V+ CL
Sbjct  9     WTRVRTLGRGASGAVVSLAADEASGALFAVKSAPASAEEQLRREGSILSALRSPHVLPCL  68

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSMGF  413
             G   +         LFLE+ PGG+L+D   RG  R  E  ++ YA  +  G+ +LH    
Sbjct  69    GFRAAAGE----CQLFLEFAPGGSLADAVARGGGRLGERAVRAYAADVARGLAYLHERAL  124

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VH D+K  N+++  D  A K+AD GC +      A S+    GTPAFMAPEVA+G+EQG 
Sbjct  125   VHGDVKPANVVLGADGRA-KLADFGCARM-----AGSARPLGGTPAFMAPEVARGDEQGP  178

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCTVIEMATG APW DM D ++A++RI  +  VPE P W S +AK+FL +C  
Sbjct  179   AADVWALGCTVIEMATGRAPWSDMEDLLAAVHRIGYTDAVPEVPAWMSAEAKDFLARCFA  238

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNSTA  950
             R+ + R TAA+LL+HPFL S      T +   R  SP S +D A+W S           +
Sbjct  239   RNPRDRCTAAQLLEHPFLASAGCGVKTEEVAARWVSPKSTLDAALWESDSDDSDDEGDVS  298

Query  951   TAGFPANRIGRLIIQAGERLPDWEED-GGWVTVRGNEEDESTDSEPI  1088
              +  P  RI  L   A   LPDW+ D G W+ V   + D++    P+
Sbjct  299   ES--PTQRIKEL-AGACSALPDWDSDEGDWIQVLNEQCDKACHLVPV  342



>gb|EAY75501.1| hypothetical protein OsI_03400 [Oryza sativa Indica Group]
Length=418

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/344 (44%), Positives = 194/344 (56%), Gaps = 19/344 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKC  236
             W R  T+GRG+S  V    A   SG  FAVKSA  +++   L RE  ILS   SP+V+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG             LFLE+ PGG+L+D+  R  GR  E  I+ YA  +  G+ +LH M 
Sbjct  69    LGFR---AEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMS  125

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+KG+N++V  D  A KIAD GC + +      S     GTPAFMAPEVA+GEEQ 
Sbjct  126   LVHGDVKGRNVVVGADGRA-KIADFGCARTV-----GSDRPIGGTPAFMAPEVARGEEQE  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM D +SA+ RI  +  VPE P W S +AK+FL +C 
Sbjct  180   PAADVWALGCTVIEMATGRAPWSDMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCF  239

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNST  947
              R+ + RWT+++LL+HPFL S   +  T +   +  SP S +D A W S           
Sbjct  240   ARNPRERWTSSQLLEHPFLASAGCSVKTGEAAPQWVSPKSTLDAAFWESDTDD----EED  295

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                  PA RI  L       LPDW+ D GW+ V  NE  E+ D+
Sbjct  296   DMPASPAERIKALACPCSA-LPDWDSDEGWIQVL-NESSEACDT  337



>ref|NP_001043978.1| Os01g0699400 [Oryza sativa Japonica Group]
 dbj|BAF05892.1| Os01g0699400, partial [Oryza sativa Japonica Group]
Length=413

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/344 (44%), Positives = 194/344 (56%), Gaps = 19/344 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKC  236
             W R  T+GRG+S  V    A   SG  FAVKSA  +++   L RE  ILS   SP+V+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG             LFLE+ PGG+L+D+  R  GR  E  I+ YA  +  G+ +LH M 
Sbjct  69    LGFRA---EAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMS  125

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+KG+N++V  D  A KIAD GC + +      S     GTPAFMAPEVA+GEEQ 
Sbjct  126   LVHGDVKGRNVVVGADGRA-KIADFGCARTV-----GSDRPIGGTPAFMAPEVARGEEQE  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM D +SA+ RI  +  VPE P W S +AK+FL +C 
Sbjct  180   PAADVWALGCTVIEMATGRAPWSDMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCF  239

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNST  947
              R+ + RWT+++LL+HPFL S   +  T +   +  SP S +D A W S           
Sbjct  240   ARNPRERWTSSQLLEHPFLASAGCSVKTGEAAPQWVSPKSTLDVAFWESDTDD----EED  295

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                  PA RI  L       LPDW+ D GW+ V  NE  E+ D+
Sbjct  296   DMPASPAERIKALACPCSA-LPDWDSDEGWIQVL-NESSEACDT  337



>gb|EAZ13219.1| hypothetical protein OsJ_03139 [Oryza sativa Japonica Group]
Length=418

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 151/344 (44%), Positives = 194/344 (56%), Gaps = 19/344 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKC  236
             W R  T+GRG+S  V    A   SG  FAVKSA  +++   L RE  ILS   SP+V+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             LG             LFLE+ PGG+L+D+  R  GR  E  I+ YA  +  G+ +LH M 
Sbjct  69    LGFR---AEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMS  125

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+KG+N++V  D  A KIAD GC + +      S     GTPAFMAPEVA+GEEQ 
Sbjct  126   LVHGDVKGRNVVVGADGRA-KIADFGCARTV-----GSDRPIGGTPAFMAPEVARGEEQE  179

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTVIEMATG APW DM D +SA+ RI  +  VPE P W S +AK+FL +C 
Sbjct  180   PAADVWALGCTVIEMATGRAPWSDMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCF  239

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVR-NSPTSVMDQAVWNSIEMSQPSCNST  947
              R+ + RWT+++LL+HPFL S   +  T +   +  SP S +D A W S           
Sbjct  240   ARNPRERWTSSQLLEHPFLASAGCSVKTGEAAPQWVSPKSTLDVAFWESDTDD----EED  295

Query  948   ATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
                  PA RI  L       LPDW+ D GW+ V  NE  E+ D+
Sbjct  296   DMPASPAERIKALACPCSA-LPDWDSDEGWIQVL-NESSEACDT  337



>gb|AAM23244.1|AC092553_10 Putative NPK1-related protein kinase [Oryza sativa Japonica Group]
 gb|AAM47615.1|AC122147_4 Putative NPK1-related protein kinase [Oryza sativa Japonica Group]
 gb|AAP51982.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ15192.1| hypothetical protein OsJ_30611 [Oryza sativa Japonica Group]
Length=526

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 155/370 (42%), Positives = 207/370 (56%), Gaps = 32/370 (9%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSA-HLSSSGMLQREKDILSQFDSPYVVKC  236
             W R  ++GRG+S  V    A   SG  F +KSA   ++   L+RE  ++S   SP+V+KC
Sbjct  11    WTRLRSVGRGASGAVVSLAANDVSGELFVIKSAGEGAARQQLRREWSVMSGLSSPHVLKC  70

Query  237   LG-CDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSM  407
             LG    S       + LFLEY PGG+L+D+  R  GR  E  ++ YA  +L G+ +LH  
Sbjct  71    LGFVQASGGCGGGEHQLFLEYAPGGSLADVVARNGGRLDEGAVRTYAADVLRGLDYLHGK  130

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VH D+KG N+LV  D  A K+ D GC +    G  S      GTPAFMAPEVA+GEEQ
Sbjct  131   LVVHGDVKGSNVLVGADGRA-KLTDFGCARVAMPG-GSKQPVLGGTPAFMAPEVARGEEQ  188

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKC  767
             G  AD+WA GCTVIEMATG APW DM++ + AL++I  +  VP+ PRW S +AK+FL  C
Sbjct  189   GLAADVWALGCTVIEMATGRAPWSDMDNVLPALHKIGYTDAVPDLPRWLSPEAKDFLRGC  248

Query  768   LDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMDQAVWNS-------I  917
             L R A  R TAA+LLQHPF+    S  +  KE V+    SPTS +D  +W S        
Sbjct  249   LQRRAGDRPTAAQLLQHPFIS--KSCGLNNKETVKATWVSPTSALDATLWESESSSTDGE  306

Query  918   EMSQPSCNSTATAGFPANRIGRLIIQAGERLPDWEEDG---GWVTVRG----NEEDESTD  1076
             E+   S NS      P  RI R +  + + LPDW+ D     W+ V G    N  +++  
Sbjct  307   EVDDMSSNS------PTGRI-RAMACSCQTLPDWDSDDHGCSWIEVLGSVSINVANKTAA  359

Query  1077  SEPILISILC  1106
              E  + S+ C
Sbjct  360   IEQRVTSMAC  369



>gb|AAM23245.1|AC092553_11 Putative NPK1-related protein kinase [Oryza sativa Japonica Group]
 gb|AAM47616.1|AC122147_5 Putative NPK1-related protein kinase [Oryza sativa Japonica Group]
 gb|AAP51983.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
Length=525

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 204/347 (59%), Gaps = 22/347 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSS-ATVSLATAAGASGHHFAVKSA----HLSSSGMLQREKDILSQFDSPY  224
             W R  +IG G+S ATVSLA A  ASG  F VKSA      ++   L+RE  ++S   SP+
Sbjct  13    WTRLRSIGHGASGATVSLA-ADDASGELFVVKSAGDAVAATARQQLRREWSVMSGLSSPH  71

Query  225   VVKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFL  398
             V++CLG   +       + L LEY PGG+L+D+  R   R  E   + YA  +L G+ +L
Sbjct  72    VLRCLGFVQAAAGAGGEHQLLLEYAPGGSLADVVARNGDRLDESAFRAYAADVLRGLDYL  131

Query  399   HSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKG  578
             H    VH D+KG N+LV  D  A K+AD GC + +  G  S      GTPAFMAPEVA+G
Sbjct  132   HEKLVVHGDVKGSNVLVGADGRA-KLADFGCARVVMPG-GSKQPVLGGTPAFMAPEVARG  189

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  AD+WA GCTVIEMATG APW DM+D ++AL  I  +  VP+ P W S +AK+FL
Sbjct  190   EEQGPAADVWALGCTVIEMATGRAPWSDMDDVLAALRMIGYTDAVPDLPPWLSPEAKDFL  249

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMD--QAVWNSIEM  923
              +C+ R A  R TAA+LLQHPF   +S +    KE V+    SPTS +D   A+W S E 
Sbjct  250   RRCMQRRAGDRPTAAQLLQHPF---VSKSCGLKKEVVKATWVSPTSALDAAAALWES-ET  305

Query  924   SQPSCNSTA--TAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGN  1055
             S  + +  A   +  P  RI  +    G+ LPDW+ +D GW+ V G 
Sbjct  306   SSSTDDEEADDMSNSPTGRIIAMASSGGQTLPDWDSDDHGWIEVLGT  352



>ref|XP_004972120.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Setaria italica]
Length=485

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/340 (42%), Positives = 199/340 (59%), Gaps = 22/340 (6%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKCLGCDI  251
             T+GRG+S  V    +  ASG   AVKSA  +++   L+RE  +L    SP++V CLG   
Sbjct  12    TLGRGASGAVVWLASDEASGELLAVKSARAAAAAAQLRREGRVLEGLSSPHIVPCLGARA  71

Query  252   SCEHNNALYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLHSMGFVHC  422
             +       Y L LE+ PGG+L+D A R   GR  E  I+ YA  +  G+ +LH+   VH 
Sbjct  72    AA---GGEYQLLLEFAPGGSLADEAARSAGGRLDERDIRAYAGDVARGLAYLHARALVHG  128

Query  423   DIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPAD  602
             D+K +N+++  D  A ++ D GC + +E     S+    GTPAFMAPEVA+GEEQG  AD
Sbjct  129   DVKARNVVIGADGRA-RLTDFGCARPVE-----SARPIGGTPAFMAPEVARGEEQGPAAD  182

Query  603   IWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDA  782
             +WA GCTV+EMATG APW DM+D ++A++RI  +  VPE P W S +AK+FL  C  R A
Sbjct  183   VWALGCTVVEMATGRAPWSDMDDLLAAVHRIGYTDAVPEVPAWLSAEAKDFLASCFKRRA  242

Query  783   KRRWTAAELLQHPFLQSISS--NSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATA  956
               R TAA+LL HPFL S ++  +    +EF   SP S +  A W+S    +    ST   
Sbjct  243   SARPTAAQLLAHPFLASAAAVRDLPAKQEF--PSPKSTLHDAFWDSDTEDEADEMSTGA-  299

Query  957   GFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTD  1076
                A RIG L   A   LPDW+ D GW+ ++G++  E+ D
Sbjct  300   ---AERIGALACAASA-LPDWDSDEGWIDLQGDDRSETVD  335



>emb|CDM80579.1| unnamed protein product [Triticum aestivum]
Length=473

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 200/343 (58%), Gaps = 20/343 (6%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W R  T+G G+S  V    A  ASG  FAVKS   + +  L RE+ ILS   SP+VV C
Sbjct  8     QWTRLRTLGCGASGAVVTLAADAASGELFAVKSVRAADAAQLSREQGILSGLSSPHVVGC  67

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
             +G        +  Y+LFLE+ PGG+L+D A R  GR  E  I+ YA  +L G+ ++H   
Sbjct  68    IG---GGGDRDGSYHLFLEFAPGGSLADEAARNGGRLEERAIRAYAADVLRGLAYIHGKS  124

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K +N+++  D  A+ IAD GC + L      S+    GTPAFMAPEVA+GEEQG
Sbjct  125   LVHGDVKSRNVVIGADGRAM-IADFGCARAL-----GSAGPIGGTPAFMAPEVARGEEQG  178

Query  591   FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
               AD+WA GCTV+EMATG APW +M++ ++A++RI  +  VPE P W S +AK FL  C 
Sbjct  179   PAADVWALGCTVVEMATGRAPWGEMDNVLAAVHRIGYTDAVPEVPTWLSAEAKSFLAMCF  238

Query  771   DRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTA  950
              R+A+ R TAA+LL+HPF+ ++ +     +     SP S +D A W S    +       
Sbjct  239   ARNARDRCTAAQLLEHPFV-ALQAGEAKARWV---SPKSTLDAAFWESETDEEEE-EEEE  293

Query  951   TAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDS  1079
              +  P+ RI  L       LPDW+ D GW+ V G E+ E+ DS
Sbjct  294   VSESPSERIKSLSCSV---LPDWDSDEGWIDVLG-EQCEACDS  332



>ref|XP_011087640.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=363

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/354 (41%), Positives = 207/354 (58%), Gaps = 25/354 (7%)
 Frame = +3

Query  51    PMEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGM--LQREKDILSQFDSPY  224
             P EW++G  IG GS  TV LA  + ++G  F +KSA +S +G+  L+ E  IL   DSPY
Sbjct  12    PTEWLKGKVIGSGSFGTVHLAIDS-STGALFVIKSA-ISDAGITSLKNEASILENLDSPY  69

Query  225   VVKCLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGF  395
             +VKC+G D+S   N  + +NLF+EY+ GG+LSD+A+   G  +E +I+ Y  +IL G+ +
Sbjct  70    IVKCIGKDVSFAENGEIKHNLFMEYMAGGSLSDVAQNFGGALNEKLIRLYTREILEGLRY  129

Query  396   LHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFS-------GTPAF  554
             LH  G VH D+K +N+L+     AVK+AD GC + L + + SS    S       GTP +
Sbjct  130   LHKNGIVHSDVKCKNVLLGAS-GAVKLADFGCARRLNDNKVSSHKTSSQRYNGIGGTPLW  188

Query  555   MAPEVAKGEEQGFPADIWAFGCTVIEMATGSAPW---QDMNDPVSALYRIANSGDVPEFP  725
             MAPEV + E   F ADIW+ GCTVIEMATG  PW       +P++AL +IA   ++PEFP
Sbjct  189   MAPEVLRNEALNFAADIWSLGCTVIEMATGRPPWGLDATSKNPMAALLKIAKGHELPEFP  248

Query  726   RWFSDDAKEFLGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAV  905
             R FSD+  +FL KCL+RD ++RWT+ +L  HPF+    + +   ++ V  SPTSV+D A 
Sbjct  249   RHFSDEGLDFLQKCLERDPEKRWTSEKLAGHPFVTGKLTYTQCSRKEVAFSPTSVLDVAR  308

Query  906   WNSIEMSQPSCNSTATAGFPANRIGRLIIQAGERLP------DWEEDGGWVTVR  1049
             ++S E    SC+           +    ++    LP        E    W+TVR
Sbjct  309   YDS-EYDDDSCSPDELVSRVPFSVKCCFMEQNFLLPKHASENQLESSDNWITVR  361



>dbj|BAJ98346.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 188/331 (57%), Gaps = 16/331 (5%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W R  T+G G+S  V    A GASG  FAVKSA  + +  L RE+ ILS   SP+VV C+
Sbjct  9     WTRLRTLGCGASGAVVSLAADGASGELFAVKSARGADAAQLSREQGILSGLCSPHVVACI  68

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGF  413
             G        +  Y+LFLE+ PGG+L+D   R  GR  E  ++ YA  +L G+ ++H    
Sbjct  69    G---GGGARDGSYHLFLEFAPGGSLADEVARNGGRLEERAVRAYAADVLRGLAYIHGESV  125

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VH D+K +N+++  D  A K+AD GC + +      S     GTPAFMAPEVA+GEEQG 
Sbjct  126   VHGDVKPRNVVIGADGRA-KMADFGCARAV-----GSPRPIGGTPAFMAPEVARGEEQGP  179

Query  594   PADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLD  773
              AD+WA GCTV+EMATG APW +M++ ++A++RI  +  VPE P W S DAK FL  C  
Sbjct  180   AADVWALGCTVVEMATGRAPWGEMDNVLAAVHRIGYTDAVPEVPAWLSADAKSFLAACFA  239

Query  774   RDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTAT  953
             R A+ R TAA+LL+HPF+    +     +     SP S +D A W S    +        
Sbjct  240   RSARDRCTAAQLLEHPFVALQQAGEAKARWV---SPKSTLDAAFWESETEDEDEEEEVLP  296

Query  954   AGFPANRIGRLIIQAGERLPDWEEDGGWVTV  1046
                P+ RI  L   A   LPDW+ D GW  V
Sbjct  297   ES-PSERIKSLSCSA-SALPDWDSDEGWTDV  325



>gb|EYU35020.1| hypothetical protein MIMGU_mgv1a019444mg [Erythranthe guttata]
Length=339

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 141/339 (42%), Positives = 200/339 (59%), Gaps = 12/339 (4%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGM-LQREKDILSQFDSPYVVK  233
             +W++G  IG GS  TV LA    ++G  F  KSA   +  M L+ E +IL   DS Y+VK
Sbjct  3     DWLKGSVIGSGSFGTVHLAVDT-STGALFVAKSAKTEAGIMSLKNEAEILENLDSRYIVK  61

Query  234   CLGCDISCEHNNAL-YNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHS  404
             C+G D+S   N    YNLF EY+ GG+LSDL+++  G   E +I+ Y  +IL G+ +LH 
Sbjct  62    CVGKDVSFTRNGETNYNLFFEYMAGGSLSDLSQKFGGSLDERLIRLYTREILQGLKYLHK  121

Query  405   MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSS--AFSGTPAFMAPEVAKG  578
              G VH DIK +N+LV +   A+K+AD GC K L + ++  S      GTP +MAPEV + 
Sbjct  122   NGIVHSDIKCKNVLV-DSLGAIKVADFGCAKRLCDKKSRKSCVIGIGGTPLWMAPEVVRN  180

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQ-DMNDPVSALYRIANSGDVPEFPRWFSDDAKEF  755
             E   F ADIW+ GCT+IEMATG  PW  D  +P++AL +IA   ++PEFPR FS +  +F
Sbjct  181   EGLDFAADIWSLGCTIIEMATGRPPWGGDAANPMAALLKIAKGNEIPEFPRHFSSEGLDF  240

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPS  935
             L KCL RD ++RWT+ ELL HPF+   +S     ++ V  SPTSV+D A + S       
Sbjct  241   LSKCLQRDPRKRWTSEELLCHPFVTRKASFVSNSRKGVSFSPTSVVDFASYESDGSYSSD  300

Query  936   CNSTATAGFPANRIGRLIIQ-AGERLPDWEEDGGWVTVR  1049
              +        +  + +L+ +   E + +  ED  W+TVR
Sbjct  301   DDEFVVDKMISFTVKKLMPKYESENVFEASED--WITVR  337



>dbj|BAJ97064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 196/353 (56%), Gaps = 18/353 (5%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCLGCDIS  254
             T+GRG+S  V    +  ASG   AVKSA    +  L+RE  +L+   SP+++ CLG   S
Sbjct  14    TLGRGASGAVVWLASDEASGKLLAVKSAAAGGAAQLEREGSVLTGLCSPHIIPCLG---S  70

Query  255   CEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGFVHCDI  428
                    Y LFLE+ PGG+L+D A R  G   E  I+ YA  +  G+ +LH+   VH D+
Sbjct  71    RAAECGEYQLFLEFAPGGSLADEAVRSGGCLPESAIRAYAGDVARGLEYLHARSLVHADV  130

Query  429   KGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADIW  608
             K +N+++  D  A ++ D GC + ++     S     GTPAFMAPEVA+GEEQG  +D+W
Sbjct  131   KARNVVIGGDGRA-RLTDFGCARAVD-----SLLPMGGTPAFMAPEVARGEEQGPASDVW  184

Query  609   AFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAKR  788
             A GCTV+EMATG APW DMND ++A++RI  +  VPE P W S DAK+FL  C  R    
Sbjct  185   ALGCTVVEMATGRAPWSDMNDLLAAVHRIGYTAAVPEVPGWLSADAKDFLAGCFKRQPSD  244

Query  789   RWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGFPA  968
             R TAA+LL HPF+ +         +    SP S +  A+W+S    +    ST     PA
Sbjct  245   RSTAAQLLDHPFVAAAGDYKAAPVKQQYASPKSTLHDALWDSDTDDEADEMSTT----PA  300

Query  969   NRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILISILC-PEDLES  1124
              RI  L   A   LPDW+ D GW+ V G E     DS P     L  PE+ E+
Sbjct  301   ERIAALAC-ATSALPDWDSDDGWIDVCG-EVSRVPDSPPAGAGYLVGPEETEA  351



>emb|CDY29258.1| BnaC01g19100D [Brassica napus]
Length=370

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 185/322 (57%), Gaps = 36/322 (11%)
 Frame = +3

Query  288   LEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGFVHCDIKGQNILVSEDC  461
             +EYV GG+L DL K   G+  EP I+ Y  QIL G+ +LH  G VHCD+K QN+LV E+ 
Sbjct  1     MEYVSGGSLHDLIKNSGGKLPEPAIRSYTRQILRGLSYLHERGIVHCDLKSQNVLVEENG  60

Query  462   SAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADIWAFGCTVIEMAT  641
                KIAD+GC K +        S FSGTPAFMAPEVA+GEEQ FPAD+WA GCTVIEM T
Sbjct  61    VVCKIADMGCAKPV------LKSGFSGTPAFMAPEVARGEEQRFPADVWALGCTVIEMMT  114

Query  642   GSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAKRRWTAAELLQHP  821
             G++PW ++ND V+A+Y+I  SG+ PE P W S+  K+FL  CL+ D K+RWT   LL+HP
Sbjct  115   GASPWPELNDVVAAMYKIGYSGESPEIPEWISEKGKDFLMSCLENDPKQRWTVEGLLKHP  174

Query  822   FLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQ----------PSCNSTATAGFPAN  971
             FL       V       +SP++V+DQ  WNS E S+          P    +     PA+
Sbjct  175   FLD--EDEDVESHLQSSSSPSTVLDQRFWNSCEASESRSLSMDHEYPFAGYSGAWDSPAD  232

Query  972   RIGRLIIQAGERLPDWEE--DGGWVTVRGNEEDESTDSEPILISILCPEDLESSIVNEAP  1145
             RI +L       +PDW+   DG W+ VRG+          +L   +C E+  SS    + 
Sbjct  233   RIEQLAGDEFSSVPDWDTVADGEWIQVRGD----------VLQDAVCVEETSSS----SQ  278

Query  1146  SFDSSDDEISVNDRVNPRTNLD  1211
               +  D+ IS  D +    +LD
Sbjct  279   EIEVVDEWISDQDSLFSEYSLD  300



>dbj|BAJ85437.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 220/406 (54%), Gaps = 40/406 (10%)
 Frame = +3

Query  45    TSPMEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPY  224
             T+  +  R  T+GRG+S  V    +  ASG   AVKSA   ++  L+RE  +++   SP+
Sbjct  4     TAAKQLRRLRTLGRGASGAVVWLASDDASGQLLAVKSAGAGAADTLRREGRVMAGLCSPH  63

Query  225   VVKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFL  398
             VV CLG   +       Y LFLE+ P G+L+D A R  G  +E  IQ YA  +  G+ +L
Sbjct  64    VVPCLGSRAAA---GGEYQLFLEFAPRGSLADEAARSGGSLAERAIQGYAADVASGLAYL  120

Query  399   HSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKG  578
             H    VH D+K +N++V  D  A K+AD GC +      A S  A +GTPAFMAPEVA+G
Sbjct  121   HGNSLVHGDVKARNVMVGADGRA-KLADFGCAR-----AAGSDRAIAGTPAFMAPEVARG  174

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  AD+WA GCTVIEMATG APW DM+D  + ++RI  +  VPE P   S  AK+FL
Sbjct  175   EEQGRAADVWALGCTVIEMATGRAPWGDMDDVFAVVHRIGYTDAVPELPASLSPQAKDFL  234

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN--SPTSVMDQAVWNSIEMSQP  932
              KCL R+ + R TAAELL+HPFL S   +    +   ++  SP S ++   W S +    
Sbjct  235   RKCLARNPRHRPTAAELLEHPFLASAFRDYGDAEPAKQDWVSPKSTLNAEFWESDDEESE  294

Query  933   SCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRG--NEEDESTDSEPILISILC  1106
             + ++  +A   A RIG L       LPDW+ D GW+ V G  +E  E+  +  I  +   
Sbjct  295   TEDTLTSA---AERIGSLASPCSA-LPDWDSDDGWIDVHGERSEPSETATAAEIAGADFG  350

Query  1107  P---EDLESSI------------------VNEAPSFDSSDDEISVN  1181
             P   E LE+ +                  V+ A  FD  + ++SVN
Sbjct  351   PWSEEGLEAEVDVHFADADASRWYGLVRNVDGAHYFDGYERDLSVN  396



>ref|XP_011047271.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Populus euphratica]
Length=227

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 158/235 (67%), Gaps = 13/235 (6%)
 Frame = +3

Query  54   MEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
            M+W RG TIGRGS+ATVS+AT+   SG  FAVKS  LS SG LQRE+ ILS   SP++V 
Sbjct  1    MDWTRGHTIGRGSTATVSVATSI-QSGDVFAVKSVELSQSGFLQREQKILSSLISPFIVS  59

Query  234  CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLHS  404
              GCD++ ++N  +YNLFLEY+P G+LS+  +    GR  E +I+ + +QIL G+ +LH 
Sbjct  60   YKGCDVTRKNNKVMYNLFLEYMPRGSLSNAIRAHDGGRLDESLIRIFTYQILQGLDYLHL  119

Query  405  MGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEE  584
             G VHCDIK  NILV++  S  KIAD GC K +E          +GTP FMAPEVA+GEE
Sbjct  120  NGLVHCDIKSSNILVAQ--SGAKIADFGCAKRVEQ-----QGPIAGTPMFMAPEVARGEE  172

Query  585  QGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAK  749
            QGF +DIWA GCT+IEMA+G  PW +++DPVS +YR      V +   W + + K
Sbjct  173  QGFASDIWALGCTIIEMASGGTPWHNVSDPVSIIYRAGYLRKVIQL--WMTLNTK  225



>tpg|DAA57972.1| TPA: putative MAPKKK family protein kinase, partial [Zea mays]
Length=435

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/339 (42%), Positives = 201/339 (59%), Gaps = 16/339 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSS-ATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
              W R  T+GRG+S A VSLA+ A ASG  FAVKSA  S +  L+RE  +L    SP+VV+
Sbjct  6     RWRRLRTLGRGASGAVVSLASDA-ASGELFAVKSAGASGAATLRREHAVLRGLRSPHVVR  64

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSM  407
             C+G     E  +  Y +FLEY PGG+++D   RG     E  I+  A  +L G+ +LH  
Sbjct  65    CVG---GGEGADGSYQVFLEYAPGGSVADAVARGGGALEERAIRALAADVLRGLAYLHGR  121

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VH D+K +N+L+  D  A ++AD GC +       S+     GTPAFMAPEVA+GE Q
Sbjct  122   SVVHGDVKARNVLLGADGRA-RLADFGCAR---TPGFSARRPLGGTPAFMAPEVARGEAQ  177

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMN-DPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             G  AD+WA GCTV+EMATG APW   + D ++A++RI  +  VP+ P W S +A++FL +
Sbjct  178   GPAADVWALGCTVVEMATGRAPWGGADADVLAAVHRIGYTDAVPDAPSWMSAEARDFLAR  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             C  RDA  RWTAA+LL+HPF+ +   +     E  R SP S +D A W + +    +  +
Sbjct  238   CFARDAAERWTAAQLLEHPFVAA-PCHGHGDHEAPRVSPKSTLDAAFWEAEDDDDDADEA  296

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEE  1061
              + +   + RI  L   A   LPDW+ + GW+ V G+++
Sbjct  297   VSASA--SERIKSLACSACA-LPDWDGEDGWIEVLGDQQ  332



>gb|EEC71339.1| hypothetical protein OsI_03402 [Oryza sativa Indica Group]
Length=395

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 194/345 (56%), Gaps = 17/345 (5%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKCLGCDI  251
             T+GRG+S  V    +  ASG   AVKSA        L+RE  ++S   SP++V CLG   
Sbjct  10    TLGRGASGAVVWLASDDASGELLAVKSAAGEGGAEQLRREGRVMSGLCSPHIVPCLG---  66

Query  252   SCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGFVHCD  425
             S    +  Y LFLE+ PGG+L+D A R  GR +E  I  YA  +   + +LH    VH D
Sbjct  67    SRTATSGEYQLFLEFAPGGSLADEAARSGGRLAERAISAYAADVARALAYLHGNSLVHGD  126

Query  426   IKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADI  605
             +K +NI+V  D  A K+AD GC +        S     GTPAFMAPEVA+GEEQG  AD+
Sbjct  127   VKARNIMVGADGRA-KLADFGCAR-----RTDSERPIGGTPAFMAPEVARGEEQGPAADV  180

Query  606   WAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAK  785
             WA GCT+IEMATG  PW DM+D  SA++RI  +  VPE P W S +AK FL +C  R+  
Sbjct  181   WALGCTIIEMATGRVPWSDMDDVFSAVHRIGYTDAVPEIPEWLSPEAKNFLSRCFTRNPS  240

Query  786   RRWTAAELLQHPFLQSISSN-SVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGF  962
              R TAA+LL+HPFL S SS+   T  +    SP S ++   W S E  +     + +A  
Sbjct  241   DRPTAAQLLEHPFLASASSDIDETAPKHGWVSPKSTLNAECWESDEDDEVEEGMSQSA--  298

Query  963   PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILIS  1097
                RI  L I     LPDW+ + GW+ ++ +  + S    P++++
Sbjct  299   -TKRISALAITCSA-LPDWDSEDGWIDLQSDPSEVSETPAPMVVT  341



>ref|XP_008676309.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Zea mays]
Length=448

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 142/339 (42%), Positives = 201/339 (59%), Gaps = 16/339 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSS-ATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVK  233
              W R  T+GRG+S A VSLA+ A ASG  FAVKSA  S +  L+RE  +L    SP+VV+
Sbjct  6     RWRRLRTLGRGASGAVVSLASDA-ASGELFAVKSAGASGAATLRREHAVLRGLRSPHVVR  64

Query  234   CLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSM  407
             C+G     E  +  Y +FLEY PGG+++D   RG     E  I+  A  +L G+ +LH  
Sbjct  65    CVG---GGEGADGSYQVFLEYAPGGSVADAVARGGGALEERAIRALAADVLRGLAYLHGR  121

Query  408   GFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQ  587
               VH D+K +N+L+  D  A ++AD GC +       S+     GTPAFMAPEVA+GE Q
Sbjct  122   SVVHGDVKARNVLLGADGRA-RLADFGCAR---TPGFSARRPLGGTPAFMAPEVARGEAQ  177

Query  588   GFPADIWAFGCTVIEMATGSAPWQDMN-DPVSALYRIANSGDVPEFPRWFSDDAKEFLGK  764
             G  AD+WA GCTV+EMATG APW   + D ++A++RI  +  VP+ P W S +A++FL +
Sbjct  178   GPAADVWALGCTVVEMATGRAPWGGADADVLAAVHRIGYTDAVPDAPSWMSAEARDFLAR  237

Query  765   CLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNS  944
             C  RDA  RWTAA+LL+HPF+ +   +     E  R SP S +D A W + +    +  +
Sbjct  238   CFARDAAERWTAAQLLEHPFVAA-PCHGHGDHEAPRVSPKSTLDAAFWEAEDDDDDADEA  296

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEE  1061
              + +   + RI  L   A   LPDW+ + GW+ V G+++
Sbjct  297   VSASA--SERIKSLACSACA-LPDWDGEDGWIEVLGDQQ  332



>ref|XP_010233496.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Brachypodium distachyon]
Length=428

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 144/329 (44%), Positives = 189/329 (57%), Gaps = 19/329 (6%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCLGCDIS  254
             T+GRG+S  V    +  ASG   AVKS    S+  LQRE  +L+   SP++V CLG   S
Sbjct  14    TLGRGASGAVVWLASDDASGELLAVKS---GSAARLQREGRVLAGLCSPHIVPCLG---S  67

Query  255   CEHNNALYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLHSMGFVHCD  425
                    Y LFLE+ P G+L+D A R   GR +E  IQ YA  +  G+ +LH    VH D
Sbjct  68    RAAPGGEYQLFLEFAPRGSLADEAARSTGGRLAERAIQGYAADVARGLAYLHGNSLVHGD  127

Query  426   IKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADI  605
             +K +N++V  D  A K+AD GC +        S     GTPAFMAPEVA+GEEQG  AD+
Sbjct  128   VKARNVMVGADGRA-KLADFGCAR--STTATDSGRPIGGTPAFMAPEVARGEEQGPAADV  184

Query  606   WAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAK  785
             WA GCTV+EMATG APW DM+D  +A++RI  +  VPE P W S DAK+FLGKCL R+ +
Sbjct  185   WALGCTVVEMATGRAPWSDMDDVFAAVHRIGYTDAVPELPGWLSPDAKDFLGKCLARNPR  244

Query  786   RRWTAAELLQHPFLQSISSNSVTFKEFVRN--SPTSVMDQAVWNSIEMSQPSCNSTATAG  959
              R TAA+LL+HPFL S   + V  +   ++  SP S ++   W S E  +      +   
Sbjct  245   HRPTAAQLLEHPFLVSACRDVVEAEPAKQDWVSPKSTLNAEFWESDEEDETEDMLRSA--  302

Query  960   FPANRIGRLIIQAGERLPDWEEDGGWVTV  1046
                 RIG L       LPDW+ + GW+ V
Sbjct  303   --TERIGSLASPCAA-LPDWDFEDGWIEV  328



>ref|XP_003565967.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Brachypodium distachyon]
Length=475

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 158/411 (38%), Positives = 220/411 (54%), Gaps = 44/411 (11%)
 Frame = +3

Query  60    WIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKCL  239
             W R  T+GRG+S       A   SG  FAVKSA   +   L+RE++I++   SP V+ C+
Sbjct  10    WKRVRTLGRGASGAEVFLAADDVSGELFAVKSA--GAGATLRREQEIMAGLRSPNVLSCI  67

Query  240   GCDISCEHNNALYNLFLEYVPGGTLSDLAKRG---RFSEPMIQFYAHQILMGIGFLHSMG  410
             G  +    ++  Y LFLE+ PGG+L+D  + G   R  E +++ YA  +  G+ +LH  G
Sbjct  68    GGRVG---HDGSYQLFLEFAPGGSLADAVRSGAGGRLEERVVRAYAEDMAAGLAYLHGAG  124

Query  411   FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
              VH D+K +N+++  D  A K+AD GC +  +    S      GTPAFMAPEVA+GEEQG
Sbjct  125   LVHGDVKPRNVVIGGDGRA-KLADFGCSRKTD----SRGPILGGTPAFMAPEVARGEEQG  179

Query  591   FPADIWAFGCTVIEMATGSAPWQ--DMNDP--VSALYRIANSGD-VPEFPRWFSDDAKEF  755
               ADIWA GCTV+EMATG APW    M D   ++AL+RI  + D VPE P+W S DAK+F
Sbjct  180   PAADIWALGCTVVEMATGRAPWNGTGMEDDGVLAALHRIGYTDDAVPEVPKWLSADAKDF  239

Query  756   LGKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRNSPTSVMDQAVW--NSIEMSQ  929
             L +CL R    R TAA+LL+HPFL +        +E+V  SP S +D A W  +  E   
Sbjct  240   LARCLTRRPSDRCTAAQLLEHPFLSA-------EREWV--SPKSTLDAAFWETDGSEEED  290

Query  930   PSCNSTATAGFPANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILI---SI  1100
                  +A     A RI  L   A     DW+ D GW+ V  +   E++D+ P+ +     
Sbjct  291   DDAEVSAVEHSMAERIRALACSASSLPEDWDSDEGWIDVMNSTPSEASDAAPVPVPAEET  350

Query  1101  LCPED---------LESSIVNEAPSFDSSDDEISVNDRVNPRTNLDLSCHN  1226
               P+D          E+S +    + DSS   ++  D V    N  L  HN
Sbjct  351   TEPDDGGVRSEEWSAETSGLGLGITVDSS---VTARDDVEEADNNSLISHN  398



>gb|EAY75499.1| hypothetical protein OsI_03399 [Oryza sativa Indica Group]
Length=303

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 166/259 (64%), Gaps = 11/259 (4%)
 Frame = +3

Query  57   EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             W R  T+GRG+S  V      GASG  FAVK+A  + + ML+RE+ ++S   SP+VV C
Sbjct  8    RWTRLRTLGRGASGAVVSLAEDGASGELFAVKTAAAAEAAMLRRERGMMSGLSSPHVVPC  67

Query  237  LGCDISCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMG  410
            +G     +  +  YNLFLE+ PGG+L++   R  GR  E  I+ YA  +L G+ +LH M 
Sbjct  68   IG---GGDGPDGSYNLFLEFAPGGSLANEVARDGGRLEERAIRVYAADVLRGLTYLHGMS  124

Query  411  FVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQG  590
             VH D+K  NI++  D  A K+AD GC K ++     S     GTPAFMAPEVA+GEEQG
Sbjct  125  LVHGDVKADNIVIGVDGLA-KLADFGCAKTMD-----SERPVGGTPAFMAPEVARGEEQG  178

Query  591  FPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
              AD+WA GCTVIEMATG APW DM+D ++A++RI  +  VPE P W S +AK+FL  C 
Sbjct  179  PAADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPVWLSAEAKDFLAMCF  238

Query  771  DRDAKRRWTAAELLQHPFL  827
             R+A  R TAA+LL+ PF+
Sbjct  239  ARNAGDRSTAAQLLEQPFV  257



>ref|XP_003567030.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Brachypodium distachyon]
Length=460

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 204/351 (58%), Gaps = 28/351 (8%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG--MLQREKDILSQFDSPYVVKCLGCD  248
             T+GRG+S  V    +  ASG   AVKSA  +     +L+RE  +L+   SP++V CLG  
Sbjct  14    TLGRGASGAVVWLASDEASGELLAVKSAAAAGGAARLLEREGCVLTGLCSPHIVPCLGSR  73

Query  249   ISCEHNNALYNLFLEYVPGGTLSDLAKR---GRFSEPMIQFYAHQILMGIGFLHSMGFVH  419
              + E     Y LFLE+ PGG+L+D A +   GR  EP I+ YA  +  G+ +LH+   VH
Sbjct  74    AAEECGE--YQLFLEFAPGGSLADEAAKSAGGRLPEPAIRAYAGDVARGLEYLHARSLVH  131

Query  420   CDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPA  599
              D+K +N+++  D  A ++ D GC + ++     S     GTPAFMAPEVA+GEEQG  +
Sbjct  132   GDVKARNVVIGGDGRA-RLTDFGCARPVD-----SLLPMGGTPAFMAPEVARGEEQGTAS  185

Query  600   DIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRD  779
             D+WA GCTV+EMATG APW DM+D  +A++RI  + DVPE P W S +AK+FL  C  R 
Sbjct  186   DVWALGCTVVEMATGRAPWSDMSDLFAAVHRIGYTADVPEVPGWLSAEAKDFLDGCFRRT  245

Query  780   AKRRWTAAELLQHPFLQSISSNSVTFKE--------FVRNSPTSVMDQAVWNSIEMSQPS  935
                R TAA+LL HPF+ S+++   +  E        FVR SP S +  A+W+S    +  
Sbjct  246   PGDRSTAAQLLDHPFITSVAARDCSRAEPEAAKKQGFVR-SPKSTLHDALWDSDSDDEAD  304

Query  936   CNSTATAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGNEEDESTDSEP  1085
               ST  A   A RIG L   A   LPDW+ ED GW+ V  +E  +  DS P
Sbjct  305   DVSTTAA---AERIGALAC-AASALPDWDSEDEGWIHVH-DEVTKVPDSPP  350



>dbj|BAK07218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 193/334 (58%), Gaps = 18/334 (5%)
 Frame = +3

Query  57    EWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSGMLQREKDILSQFDSPYVVKC  236
             +W R  T+GRG+S       A  ASG  FAVKSA  + +  L+RE+ +++   SP VV C
Sbjct  6     QWTRVRTLGRGASGAEVFLAADDASGELFAVKSASTACAAALRREQRVMAGLRSPRVVSC  65

Query  237   LGCDISCEHNNALYNLFLEYVPGGTLSD-LAKRGRFSEPMIQFYAHQILMGIGFLHSMGF  413
             +G        +  Y LFLE+ PGG+L+D +A  G   E  I+ YA  I  G+ +LHS G 
Sbjct  66    IG---GRGDRDGSYQLFLEFAPGGSLADRVASNGGLDELAIRGYAADIASGLAYLHSAGM  122

Query  414   VHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGF  593
             VH D+K +N+++  D  A K+AD GC +      A+ +    GTPAFMAPEVA+GEEQG 
Sbjct  123   VHGDVKARNVVIGADGRA-KLADFGCAREA----AAGAPIIGGTPAFMAPEVARGEEQGP  177

Query  594   PADIWAFGCTVIEMATGSAPWQDMN-DPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCL  770
              AD+WA GC V+EMATG APW  M+ + ++AL+RI  +  VPE P+W S +AK+FL  CL
Sbjct  178   AADVWALGCAVVEMATGRAPWTGMDGNALAALHRIGYTEAVPEVPQWLSAEAKDFLRGCL  237

Query  771   DRDAKRRWTAAELLQHPFLQS-ISSNSVTFKEFVRNSPTSVMDQAVWNS-IEMSQPSCNS  944
              R A  R TAA+LL+H FL S +        E    SP S +D A W S  +  +   +S
Sbjct  238   VRQAGERCTAAQLLEHAFLASAVVDAKPQAVESKWVSPKSTLDAAFWESESDTEEAEHDS  297

Query  945   TATAGFPANRIGRLIIQAGERLPDWEEDGGWVTV  1046
             TA       RI  L   A   LPDW+ D GW+ V
Sbjct  298   TAE-----MRIMALACPA-SALPDWDSDEGWIDV  325



>gb|EAY77608.1| hypothetical protein OsI_32650 [Oryza sativa Indica Group]
Length=1080

 Score =   256 bits (653),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 204/347 (59%), Gaps = 22/347 (6%)
 Frame = +3

Query  60    WIRGPTIGRGSS-ATVSLATAAGASGHHFAVKSA----HLSSSGMLQREKDILSQFDSPY  224
             W R  +IG G+S ATVSLA A  ASG  F VKSA      ++   L+RE  ++S   SP+
Sbjct  13    WTRLRSIGHGASGATVSLA-ADDASGELFVVKSAGDAVAATARQQLRREWSVMSGLSSPH  71

Query  225   VVKCLGCDISCEHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFL  398
             V++CLG   +       + L LEY PGG+L+D+  R   R  E   + YA  +L G+ +L
Sbjct  72    VLRCLGFVQAAAGAGGEHQLLLEYAPGGSLADVVARNGDRLDESAFRAYAADVLRGLDYL  131

Query  399   HSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKG  578
             H    VH D+KG N+LV  D  A K+AD GC + +  G  S      GTPAFMAPEVA+G
Sbjct  132   HGKLVVHGDVKGSNVLVGADGRA-KLADFGCARVVMPG-GSKQPVLGGTPAFMAPEVARG  189

Query  579   EEQGFPADIWAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFL  758
             EEQG  AD+WA GCTVIEMATG APW DM+D ++AL  I  +  VP+ P W S +AK+FL
Sbjct  190   EEQGPAADVWALGCTVIEMATGRAPWSDMDDVLAALRMIGYTDAVPDLPPWLSPEAKDFL  249

Query  759   GKCLDRDAKRRWTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMD--QAVWNSIEM  923
              +C+ R A  R TAA+LLQHPF   +S +    KE V+    SPTS +D   A+W S E 
Sbjct  250   RRCMQRRAGDRPTAAQLLQHPF---VSKSCGLKKEVVKATWVSPTSALDAAAALWES-ET  305

Query  924   SQPSCNSTA--TAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGN  1055
             S  + +  A   +  P  RI  +    G+ LPDW+ +D GW+ V G 
Sbjct  306   SSSTDDEEADDMSNSPTGRIIAMASSGGQTLPDWDSDDHGWIEVLGT  352


 Score =   248 bits (632),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 150/336 (45%), Positives = 196/336 (58%), Gaps = 21/336 (6%)
 Frame = +3

Query  90    SSATVSLATAAGASGHHFAVKSA----HLSSSGMLQREKDILSQFDSPYVVKCLGCDISC  257
             S ATVSLA A  ASG  F VKSA      ++   L RE  ++S   SP+V++CLG   + 
Sbjct  579   SGATVSLA-ADDASGELFVVKSAGDAVAATARQQLWREWSVMSGLSSPHVLRCLGFVQAS  637

Query  258   EHNNALYNLFLEYVPGGTLSDLAKRG--RFSEPMIQFYAHQILMGIGFLHSMGFVHCDIK  431
                   + L LEY PGG+L+D+  R   R  E   + YA  +L G+ +LH    VH D+K
Sbjct  638   AGAGGEHQLLLEYAPGGSLADVVARNGDRLDESAFRAYAADVLRGLDYLHGKLVVHGDVK  697

Query  432   GQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADIWA  611
             G N+LV  D  A K+AD GC + +  G  S      GTPAFMAPEVA+GEEQG  AD+WA
Sbjct  698   GSNVLVGADGRA-KLADFGCARVVMPG-GSKQPVLGGTPAFMAPEVARGEEQGPAADVWA  755

Query  612   FGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAKRR  791
              GCTVIEMATG APW DM+D ++AL  I  +  VP+ P W S +AK+FL +C+ R A  R
Sbjct  756   LGCTVIEMATGRAPWSDMDDVLAALRMIGYTDAVPDLPPWLSPEAKDFLRRCMQRRAGDR  815

Query  792   WTAAELLQHPFLQSISSNSVTFKEFVRN---SPTSVMD--QAVWNSIEMSQPSCNSTA--  950
              TAA+LLQHPF   +S +    KE V+    SPTS +D   A+W S E S  + +  A  
Sbjct  816   PTAAQLLQHPF---VSKSCGLKKEVVKATWVSPTSALDAAAALWES-ETSSSTDDEEADD  871

Query  951   TAGFPANRIGRLIIQAGERLPDWE-EDGGWVTVRGN  1055
              +  P  RI  +    G+ LPDW+ +D GW+ V G 
Sbjct  872   MSNSPTGRIIAMASSGGQTLPDWDSDDHGWIEVLGT  907



>gb|ACH99699.1| NPKL4 [Oryza sativa Indica Group]
Length=411

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 194/345 (56%), Gaps = 17/345 (5%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKCLGCDI  251
             T+GRG+S  V    +  ASG   AVKSA        L+RE  ++S   SP++V CLG   
Sbjct  10    TLGRGASGAVVWLASDDASGELLAVKSAAGEGGAEQLRREGRVMSGLCSPHIVPCLG---  66

Query  252   SCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGFVHCD  425
             S    +  Y LFLE+ PGG+L+D A R  GR +E  I  YA  +   + +LH    VH D
Sbjct  67    SRTATSGEYQLFLEFAPGGSLADEAARSGGRLAERAISAYAADVARALAYLHGNSLVHGD  126

Query  426   IKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADI  605
             +K +NI+V  D  A K+AD GC +        S     GTPAFMAPEVA+GEEQG  AD+
Sbjct  127   VKARNIMVGADGRA-KLADFGCAR-----RTDSERPIGGTPAFMAPEVARGEEQGPAADV  180

Query  606   WAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAK  785
             WA GCT+IEMATG  PW DM+D  SA++RI  +  VPE P W S +AK FL +C  R+  
Sbjct  181   WALGCTIIEMATGRVPWSDMDDVFSAVHRIGYTDAVPEIPEWLSPEAKNFLSRCFTRNPS  240

Query  786   RRWTAAELLQHPFLQSISSN-SVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGF  962
              R TAA+LL+HPFL S SS+   T  +    SP S ++   W S E  +     + +A  
Sbjct  241   DRPTAAQLLEHPFLASASSDIDETAPKHGWVSPKSTLNAECWESDEDDEVEEGMSQSA--  298

Query  963   PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILIS  1097
                RI  L I     LPDW+ + GW+ ++ +  + S    P++++
Sbjct  299   -TKRISALAITCSA-LPDWDSEDGWIDLQSDPSEVSETPAPMVVT  341



>ref|XP_002960952.1| hypothetical protein SELMODRAFT_74353, partial [Selaginella moellendorffii]
 gb|EFJ38491.1| hypothetical protein SELMODRAFT_74353, partial [Selaginella moellendorffii]
Length=272

 Score =   239 bits (611),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 170/272 (63%), Gaps = 15/272 (6%)
 Frame = +3

Query  42   QTSPMEWIRGPTIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG---MLQREKDILSQF  212
            Q     WIRG  IG GS  TVSLA    A G  FAVKSA + +SG    L+ E+ IL   
Sbjct  6    QKQGFSWIRGKAIGAGSFGTVSLAVNR-ADGSLFAVKSAEMGNSGEIAALENERQILESL  64

Query  213  DSPYVVKCLGCDISCEHNN--ALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQIL  380
            D P V++CLG D +    +  A+ N+FLEY+PGG+L+DL  +  G+  E +++ Y   IL
Sbjct  65   DCPQVIRCLGGDDTAAEPSKPAMKNVFLEYMPGGSLADLMAKLGGKLDESLVRIYTRGIL  124

Query  381  MGIGFLHSMGFVHCDIKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMA  560
            +G+ FLH  G VHCDIKG+NILV   C +VK+AD G  K +  G  S +    GTP +MA
Sbjct  125  LGLEFLHKSGIVHCDIKGKNILVG--CESVKLADFGAAKRV--GAKSMAGGVKGTPLWMA  180

Query  561  PEVAKGEEQGFPADIWAFGCTVIEMATGSAPWQDM---NDPVSALYRIANSGDVPEFPRW  731
            PE  + EEQG  +DIW+ GCTVIEM TG APW +    + P+ A+Y+IA S ++PE P +
Sbjct  181  PEAVRQEEQGAASDIWSLGCTVIEMLTGKAPWGEAVSGSSPMVAMYKIACSNEIPELPSF  240

Query  732  FSDDAKEFLGKCLDRDAKRRWTAAELLQHPFL  827
             S   ++FL KCL RD   R +A ELL+HPF+
Sbjct  241  VSSAGRDFLAKCLCRDPCSRASAEELLRHPFV  272



>gb|ACH99698.1| NPKL4 [Oryza sativa Japonica Group]
Length=411

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 193/345 (56%), Gaps = 17/345 (5%)
 Frame = +3

Query  75    TIGRGSSATVSLATAAGASGHHFAVKSAHLSSSG-MLQREKDILSQFDSPYVVKCLGCDI  251
             T+GRG+S  V    +  ASG   AVKSA        L+RE  ++S   SP++V CLG   
Sbjct  10    TLGRGASGAVVWLASDDASGELLAVKSAAGEGGAEQLRREGRVMSGLCSPHIVPCLG---  66

Query  252   SCEHNNALYNLFLEYVPGGTLSDLAKR--GRFSEPMIQFYAHQILMGIGFLHSMGFVHCD  425
             S       Y LFLE+ PGG+L+D A R  GR +E  I  YA  +   + +LH    VH D
Sbjct  67    SRAAAGGEYQLFLEFAPGGSLADEAARSGGRLAERAISAYAADVARALAYLHGNSLVHGD  126

Query  426   IKGQNILVSEDCSAVKIADLGCGKFLENGEASSSSAFSGTPAFMAPEVAKGEEQGFPADI  605
             +K +NI+V  D  A K+AD GC +        S     GTPAFMAPEVA+GEEQG  AD+
Sbjct  127   VKARNIMVGADGRA-KLADFGCAR-----RTDSERPIGGTPAFMAPEVARGEEQGPAADV  180

Query  606   WAFGCTVIEMATGSAPWQDMNDPVSALYRIANSGDVPEFPRWFSDDAKEFLGKCLDRDAK  785
             WA GCT+IEMATG  PW DM+D  SA++RI  +  VPE P W S +AK FL +C  R+  
Sbjct  181   WALGCTIIEMATGRVPWSDMDDVFSAVHRIGYTDAVPEIPEWLSPEAKNFLSRCFTRNPS  240

Query  786   RRWTAAELLQHPFLQSISSN-SVTFKEFVRNSPTSVMDQAVWNSIEMSQPSCNSTATAGF  962
              R TAA+LL+HPFL S SS+   T  +    SP S ++   W S E  +     + +A  
Sbjct  241   DRPTAAQLLEHPFLASASSDIDETAPKHGWVSPKSTLNAECWESDEDDEVEEGMSQSA--  298

Query  963   PANRIGRLIIQAGERLPDWEEDGGWVTVRGNEEDESTDSEPILIS  1097
                RI  L I     LPDW+ + GW+ ++ +  + S    P++++
Sbjct  299   -TKRISALAITCSA-LPDWDSEDGWIDLQSDPSEVSETPAPMVVT  341



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3500367830012