BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32295_g1_i1 len=790 path=[1:0-789]

Length=790
                                                                      Score     E

ref|XP_006358850.1|  PREDICTED: protein FAM63B-like                     122   6e-28   
ref|XP_004245663.1|  PREDICTED: protein FAM63B                          116   9e-26   
ref|XP_009617781.1|  PREDICTED: protein FAM63B                          114   6e-25   
ref|XP_009772020.1|  PREDICTED: protein FAM63B                          104   1e-21   
ref|XP_002303556.2|  hypothetical protein POPTR_0003s11980g           91.7    2e-17   Populus trichocarpa [western balsam poplar]
gb|KDO63619.1|  hypothetical protein CISIN_1g036470mg                 83.2    1e-14   
ref|XP_010676580.1|  PREDICTED: protein FAM63A isoform X2             82.0    3e-14   
emb|CDP09830.1|  unnamed protein product                              71.2    1e-10   
ref|XP_011081058.1|  PREDICTED: protein FAM63A-like                   67.8    1e-09   
ref|XP_010255585.1|  PREDICTED: protein FAM63A-like                   63.5    4e-08   
ref|XP_011029149.1|  PREDICTED: protein FAM63B isoform X3             62.0    1e-07   
gb|EPS62597.1|  hypothetical protein M569_12193                       60.8    1e-07   
ref|XP_011029146.1|  PREDICTED: protein FAM63B isoform X1             62.0    1e-07   
ref|XP_011029148.1|  PREDICTED: protein FAM63B isoform X2             62.0    1e-07   
ref|XP_002509683.1|  conserved hypothetical protein                   62.0    1e-07   Ricinus communis
gb|KDP25542.1|  hypothetical protein JCGZ_20698                       61.2    3e-07   
ref|XP_007211299.1|  hypothetical protein PRUPE_ppa001890mg           60.8    3e-07   
ref|XP_008238757.1|  PREDICTED: protein FAM63B                        60.8    3e-07   
ref|XP_007211298.1|  hypothetical protein PRUPE_ppa001890mg           60.8    3e-07   
ref|XP_011071984.1|  PREDICTED: protein FAM63B-like                   60.5    4e-07   
ref|XP_009362835.1|  PREDICTED: protein FAM63B-like                   60.5    4e-07   
ref|XP_006828905.1|  hypothetical protein AMTR_s00001p00199010        60.5    4e-07   
ref|XP_003516684.1|  PREDICTED: protein FAM63B-like isoform X1        59.7    7e-07   
gb|KHN25739.1|  Protein FAM63A                                        59.7    7e-07   
ref|XP_006573752.1|  PREDICTED: protein FAM63B-like isoform X2        59.7    7e-07   
ref|XP_007158448.1|  hypothetical protein PHAVU_002G153200g           59.3    1e-06   
ref|XP_004511617.1|  PREDICTED: protein FAM63B-like                   58.9    1e-06   
ref|XP_002299570.2|  hypothetical protein POPTR_0001s08530g           58.9    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006368742.1|  hypothetical protein POPTR_0001s08530g           58.9    1e-06   
ref|XP_008437193.1|  PREDICTED: uncharacterized protein LOC103482...  58.5    2e-06   
ref|XP_008437192.1|  PREDICTED: protein FAM63A isoform X1             58.5    2e-06   
ref|XP_011033828.1|  PREDICTED: protein FAM63A-like isoform X1        58.2    3e-06   
ref|XP_011033830.1|  PREDICTED: protein FAM63A-like isoform X3        58.2    3e-06   
ref|XP_011033829.1|  PREDICTED: protein FAM63A-like isoform X2        58.2    3e-06   
ref|XP_008375808.1|  PREDICTED: protein FAM63B-like isoform X1        57.8    4e-06   
ref|XP_008375809.1|  PREDICTED: protein FAM63B-like isoform X2        57.8    4e-06   
ref|XP_007040087.1|  Uncharacterized protein isoform 5                57.8    4e-06   
ref|XP_007040083.1|  Uncharacterized protein isoform 1                57.8    4e-06   
ref|XP_004298726.1|  PREDICTED: uncharacterized protein LOC101309929  57.4    4e-06   
ref|XP_007040084.1|  Uncharacterized protein isoform 2                57.4    5e-06   
ref|XP_004173165.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAM6...  57.0    5e-06   
ref|XP_004143997.1|  PREDICTED: uncharacterized protein LOC101220291  57.0    6e-06   
gb|KGN50156.1|  hypothetical protein Csa_5G156160                     57.0    6e-06   
gb|EYU36933.1|  hypothetical protein MIMGU_mgv1a022265mg              57.0    6e-06   
ref|XP_009377899.1|  PREDICTED: protein FAM63B-like                   57.0    6e-06   
ref|XP_010272598.1|  PREDICTED: protein FAM63A isoform X1             56.2    1e-05   
ref|XP_010272599.1|  PREDICTED: protein FAM63A isoform X2             56.2    1e-05   
ref|XP_007040085.1|  Uncharacterized protein isoform 3                55.1    2e-05   
emb|CBI34769.3|  unnamed protein product                              55.1    3e-05   
ref|XP_006440500.1|  hypothetical protein CICLE_v10019075mg           54.7    3e-05   
ref|XP_010676579.1|  PREDICTED: protein FAM63A isoform X1             54.7    4e-05   
ref|XP_006477357.1|  PREDICTED: protein FAM63B-like                   54.7    4e-05   
ref|XP_010108057.1|  hypothetical protein L484_023142                 53.9    7e-05   
ref|XP_010434086.1|  PREDICTED: protein FAM63A-like                   53.5    8e-05   
ref|XP_010455599.1|  PREDICTED: protein FAM63A-like                   53.5    8e-05   
ref|XP_010422138.1|  PREDICTED: protein FAM63A-like                   53.5    8e-05   
gb|KHN34990.1|  Protein FAM63A                                        53.5    9e-05   
gb|KEH27444.1|  FAM63A-like protein, putative                         53.1    1e-04   
ref|XP_003611174.1|  Protein FAM63A                                   53.5    1e-04   
gb|KHF99932.1|  Protein FAM63A                                        53.1    1e-04   
gb|KHG27744.1|  Protein FAM63A                                        53.1    1e-04   
gb|KHG24879.1|  Protein FAM63A                                        53.1    1e-04   
ref|XP_002275737.1|  PREDICTED: protein FAM63B                        53.1    1e-04   Vitis vinifera
ref|XP_003538713.1|  PREDICTED: protein FAM63B-like                   52.4    2e-04   
ref|XP_002874729.1|  hypothetical protein ARALYDRAFT_490003           52.0    2e-04   
gb|KCW77635.1|  hypothetical protein EUGRSUZ_D01938                   51.6    3e-04   
ref|NP_567383.1|  uncharacterized protein                             51.6    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907483.1|  PREDICTED: protein FAM63A                        51.6    4e-04   
ref|XP_006396840.1|  hypothetical protein EUTSA_v10028490mg           51.2    5e-04   
ref|XP_006657335.1|  PREDICTED: protein FAM63B-like                   50.8    7e-04   
emb|CDY13285.1|  BnaC09g23710D                                        50.4    8e-04   
emb|CAB44324.1|  putative protein                                     50.4    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794672.1|  PREDICTED: uncharacterized protein LOC103710...  50.4    0.001   



>ref|XP_006358850.1| PREDICTED: protein FAM63B-like [Solanum tuberosum]
Length=694

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 129/359 (36%), Positives = 171/359 (48%), Gaps = 103/359 (29%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTLMGELV+L+T++M +EHKK++EDD VD  AATTAALGVP           DS V+I+D
Sbjct  172  NTLMGELVSLDTQNMETEHKKSSEDDDVDFAAATTAALGVPSPCLSRGRSFDDSPVTITD  231

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDHERLVSDKAS  328
            +H A KGD+EEE +L +AL LS  E   SSV+   T+  NS   +AN+K  E +V +K S
Sbjct  232  RHAARKGDIEEEAELLKALQLSEAETATSSVE---TDGLNSLGEIANLKCPEPVVLNKTS  288

Query  329  EINVAKDSSQP----------EAPISNVVTVSDDFVLNPNscesesagvaasssPRIGHD  478
            E+N  +  +QP          E  ++N+  +S D   +PNS +  S    +SS       
Sbjct  289  EVNAIE--TQPVLQHEALISTEELVANISKISGDG--SPNSSQLASEVAVSSSLKCDQET  344

Query  479  PSKDTQEPNLLVENID---QSEDIPSSAGGSHVRIVGDNIDIKDS---------------  604
            P+ D     LL EN     +S  I  SA  +H  + G   DI  +               
Sbjct  345  PTLDLGNAKLLAENESLPLESGQISLSACENHEHLSGGMNDIPGTIVIAEDGNAAEPNQV  404

Query  605  -----------------DLSSGRRQDSDDPETFTSS------------------------  661
                             D S GR+ D+D+ ETF SS                        
Sbjct  405  GCDVFDSSSSSIPSAAPDSSGGRQHDTDEAETFNSSIDGDEPMYEGEDCILESATTSYQS  464

Query  662  ----------------GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                            GDSR V     KD I+ +EGEL+RNF K+SASQLTI+GLF LQ
Sbjct  465  REPMYEGEVILAEQVNGDSRDVPEIIVKDEITQKEGELVRNFLKNSASQLTIFGLFSLQ  523



>ref|XP_004245663.1| PREDICTED: protein FAM63B [Solanum lycopersicum]
Length=694

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 170/359 (47%), Gaps = 103/359 (29%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTLMGELV+L+T++M +EHKK +EDD VD  AATTAALGVP           DS VSI+D
Sbjct  172  NTLMGELVSLDTQNMETEHKKTSEDDDVDFAAATTAALGVPSPCLSRGRSFDDSPVSITD  231

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDHERLVSDKAS  328
            +H A KGD+EEE +L +AL LS  E    SV+   T+  +S   +AN+K  E +V +K S
Sbjct  232  RHTARKGDIEEEAELLKALQLSEAEIATPSVE---TDGLHSLGEIANLKCPEPVVLNKIS  288

Query  329  EINVAKDSSQP----------EAPISNVVTVSDDFVLNPNscesesagvaasssPRIGHD  478
            E+N  +  +QP          E  ++N+  +S D   N +   SE A  ++    +    
Sbjct  289  EVNAIE--TQPVLQHEALVSTEEIVANISKISGDGSRNSSQLASEVAVKSSLKCDQ--ET  344

Query  479  PSKDTQEPNLLVEN---IDQSEDIPSSAGGSHVRIVGD----------------------  583
            P++D     LL EN   + +S  I SSA  +H  + G                       
Sbjct  345  PTQDLGNAKLLAENESLLLESGQISSSACENHEHLSGGMNDIPGKIVIAEDGNAAEPNQV  404

Query  584  NIDIKDS----------DLSSGRRQDSDDPETFTSS------------------------  661
              D+ DS          D S GR  D+D+ ETF SS                        
Sbjct  405  GCDVFDSSSLSIPSAATDSSDGRGHDTDEAETFNSSIDGDEPMYEGEDCILESATTSYQS  464

Query  662  ----------------GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                            G SR V     KD I+ +EGEL+RNF K+SASQLTI+GLF LQ
Sbjct  465  REPMYEGEVVLAEQVNGGSRDVPAIIAKDEITQKEGELVRNFLKNSASQLTIFGLFSLQ  523



>ref|XP_009617781.1| PREDICTED: protein FAM63B [Nicotiana tomentosiformis]
Length=691

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 124/357 (35%), Positives = 157/357 (44%), Gaps = 101/357 (28%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTLMGELVALET++M + +KK++EDD VD  AATTAALGVP           DS VSI+D
Sbjct  173  NTLMGELVALETQNMDTGNKKSSEDDDVDFAAATTAALGVPSPCLSRGRSFEDSPVSITD  232

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDHERLVSDKAS  328
             H A KG  + EE+     AL + E  +   D L     NS   +AN+K  E +V  K S
Sbjct  233  NHTARKG--DIEEEAELLRALQLSETSLVETDGL-----NSLGEIANLKCPEPMVLTKTS  285

Query  329  E---INVAKDSSQPEAPISNVVTVSDDFVL----NPNscesesagvaasssPRIGHDPSK  487
            E   I   +   Q EA I   V VS+D  +    +PNS +  S     SS       PS+
Sbjct  286  EGNDIETTQPVLQHEALIPTEVLVSNDRDISGDADPNSSQIVSGAAINSSLKIDQETPSQ  345

Query  488  DTQEPNLLVENID---QSEDIPSSAGGSHVRIVGDNIDIKDSDL----------------  610
            +     LL EN     +S  + SSA  +H  + G    I+ +                  
Sbjct  346  ELGNAKLLAENESVPLESGQVSSSACENHEHLFGGMNGIQGTHTIAGNANAAEPNHQVGC  405

Query  611  -----------------SSGRRQDSDDPETFTSS--------------------------  661
                             S GRR D+D+PETF SS                          
Sbjct  406  DAFDSSSSSIPSTVSGSSGGRRHDTDEPETFNSSIDDDEPIYEGEDCILESATTSYQSRE  465

Query  662  --------------GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                          G S  V     KD I+ REGEL+RNF K+SASQLTI+GLF LQ
Sbjct  466  PMYEGEVVLAEQVNGGSTDVPETIVKDEITQREGELVRNFLKNSASQLTIFGLFSLQ  522



>ref|XP_009772020.1| PREDICTED: protein FAM63B [Nicotiana sylvestris]
Length=690

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 121/356 (34%), Positives = 154/356 (43%), Gaps = 100/356 (28%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTLMGELVALET++M +E+KK++EDD VD  AATTAALGVP           DS VSI++
Sbjct  173  NTLMGELVALETQNMDTENKKSSEDDDVDFAAATTAALGVPSPCLSRGRSFEDSPVSITN  232

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDHERLVSDKAS  328
             H A KG  + EE+     AL + E  +   D L     NS    AN+K  E +   K S
Sbjct  233  NHTARKG--DIEEEAELLRALQLSETSLVETDGL-----NSLGETANLKCPEPMGLTKTS  285

Query  329  E---INVAKDSSQPEAPISNVVTVSDDFVL----NPNscesesagvaasssPRIGHDPSK  487
            E   I   +   Q EA I   V  S++  +    +PNS +  S     SS       P +
Sbjct  286  EGNDIETTQPVLQHEALIPTEVIASNNRDISGDADPNSSQIVSGAAINSSLKIDQETPPQ  345

Query  488  DTQEPNLLVENID---QSEDIPSSAGGSHVRIVG-------------------------D  583
            +     LL EN     +S  + SSA  +H  + G                         D
Sbjct  346  ELGNAKLLAENESVPLESGQVFSSACENHEHLSGGTNGIQGTHTIAGNGNASEPKQVGCD  405

Query  584  NIDIKDSDL-------SSGRRQDSDDPETFTSS---------------------------  661
              D   S +       S GRR D+D+PETF SS                           
Sbjct  406  AFDSASSSIPSAVSGSSGGRRHDTDEPETFNSSIDDDEPIYEGEDCILESATTSYQSREP  465

Query  662  -------------GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                         G S  V      D I+ REGEL+RNF K+SASQLTI+GLF LQ
Sbjct  466  MYEGEVVLAEQVNGGSTDVPETIVNDEITQREGELVRNFLKNSASQLTIFGLFSLQ  521



>ref|XP_002303556.2| hypothetical protein POPTR_0003s11980g [Populus trichocarpa]
 gb|EEE78535.2| hypothetical protein POPTR_0003s11980g [Populus trichocarpa]
Length=598

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 101/283 (36%), Positives = 134/283 (47%), Gaps = 63/283 (22%)
 Frame = +2

Query  2    NTLMGELVALETRDM--------GSEHKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M        G   K   E+D +D VAATTA LGVP           
Sbjct  185  NTLMGELVALETRNMEDESKNLTGEHSKTKTEEDCIDFVAATTATLGVPSPCLSKARSFD  244

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDHE  304
            DS  S+SD  K  KGDLEEE +L R L LS  E PI SVDD + +V      V ++  HE
Sbjct  245  DSPHSVSDHQKVRKGDLEEEAELLRVLKLSETELPI-SVDDFVADVDGR---VVSVGSHE  300

Query  305  RLVSDKASEINVAKDSSQPEAPISNVVTVSDDFVLNPNscesesagvaasssPRIGHDPS  484
                 K + +  + D+S+                                    +G D +
Sbjct  301  S-TPMKGTMVVASWDTSE----------------------------------GHVGVDIN  325

Query  485  KDTQEPNLLVENIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGR-RQDSDDPETFTSS  661
              +   +  ++N D  ++  SS  GS     G+   I DS  S+   R+   + E   S 
Sbjct  326  LKSDSSSGRMQNFDTPDNFNSSVDGSEPIYEGEEC-IFDSRTSNCEDREPMYEGEVILSE  384

Query  662  GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
               + V +   KD I+A++GELIRNF K++ASQLT  GLFCLQ
Sbjct  385  QADKTVRS---KDEITAQQGELIRNFLKNNASQLTFNGLFCLQ  424



>gb|KDO63619.1| hypothetical protein CISIN_1g036470mg [Citrus sinensis]
Length=697

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 113/371 (30%), Positives = 154/371 (42%), Gaps = 117/371 (32%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALET  MG + K N+E+D VD  AATTA LGVP           DS  S+SD
Sbjct  168  NAIMGELVALET--MGGDCKSNSEEDCVDFAAATTATLGVPSPCLSKARSFDDSPRSVSD  225

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDHERLVSDKAS  328
            +    KGDLEEEE+L RAL LS  + P S  + +L NV  +   V++ +          S
Sbjct  226  QQTLRKGDLEEEEELLRALKLSESDVPSSPGNSVLANVNGATMPVSSDE-------STCS  278

Query  329  EINVAKDS---------------SQPEAPISNVVTVSDDFVLNPNscesesagvaasssP  463
             ++V  DS                QPE+ IS+      ++    +    ++ G      P
Sbjct  279  NMDVPADSVHTLERRTVVESESFHQPESSISDKNGSFWEYCWGRSKFTLKADGSMKLDQP  338

Query  464  ----RIGHDPSKDTQEPNLLVENIDQSEDIPSSAGGSHVRIVGDNIDIK-----------  598
                 + H+ SKD  E   + + +   E I  S G     +V   ++I            
Sbjct  339  SKMESVAHNISKDLVEKKSVQKLVQIEETILFSPGKDTATVVETQVEISQGGKEVENEPT  398

Query  599  ---------------------------DSDLSSGRRQDSDDPETFTSSGD-SRHVH----  682
                                       DSD SSGR Q SD PE FTSS D S  ++    
Sbjct  399  STNVHEPVDNLSRCSTTEVSCLSVHNGDSDSSSGRVQLSDVPENFTSSVDGSEPIYEGEE  458

Query  683  -----------------------------------NESPKDGISAREGELIRNFFKDSAS  757
                                               N   KD I+ ++GELI++F K++A+
Sbjct  459  CILDSGTAMYEDREPVYEGEVILAEQADKSTLDACNVWSKDEITQQQGELIKSFLKNNAN  518

Query  758  QLTIYGLFCLQ  790
            QLT YGLFCLQ
Sbjct  519  QLTFYGLFCLQ  529



>ref|XP_010676580.1| PREDICTED: protein FAM63A isoform X2 [Beta vulgaris subsp. vulgaris]
Length=651

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 108/339 (32%), Positives = 148/339 (44%), Gaps = 108/339 (32%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSV-----------SISD  148
            NT+MG+LV+LET  M +E K  +++D +D  AATTA LGVP  S+           SISD
Sbjct  167  NTVMGDLVSLETWKMENEGKDKSDEDCIDFAAATTATLGVPSPSLSRGKSFEESPRSISD  226

Query  149  KHKAGKGdleeeedlrralalSMGEGP----ISSVDDLLTNVQNSPNVVANIKDHERLVS  316
            +H   KGD EEE  L   L LS+ + P    IS+          S NV  N   +  L  
Sbjct  227  QHTLKKGDAEEEAQLLEVLKLSVNDLPSREAISA---------GSHNVHGNSDRNIPLSE  277

Query  317  DKASEINVAKDSSQP-------------EAPISN--VVTVSDDFVLNPNscesesagvaa  451
            ++A+   +A D+ +              E P+SN      SD  +LN  +  S       
Sbjct  278  EQAASPTLADDTHERENHSDQLISVQLGEVPLSNDLAKCTSDTPILNEATPSS-------  330

Query  452  sssPRIGHDPSKDT---QEPNLLVENIDQSEDIPSSAGGSHVRIVGDNIDI----KDSDL  610
                     P+KDT   QE    VEN   S  + +S GG + + V +N  +     DS+ 
Sbjct  331  ---------PAKDTVHDQE----VENF--STPVMNSTGGLYKQNVEENSGVAAGHADSES  375

Query  611  SSGRRQDSDDPETFTSSGDS----------------------------------------  670
            SSG +   +  E+FTSS D                                         
Sbjct  376  SSGGKPSIEAVESFTSSLDGSEPIYEGEECILDPGKTVCGDREPVYEGEMVLAEQADKGI  435

Query  671  RHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCL  787
            +  ++ S K+ IS R+GELI NF K +ASQLT YGLFCL
Sbjct  436  KDTYDASSKEEISPRQGELISNFLKSNASQLTFYGLFCL  474



>emb|CDP09830.1| unnamed protein product [Coffea canephora]
Length=722

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 11/92 (12%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTLMGELVALET++M ++HKKN+E+D VD  AATTA LGVP           D+ +S+ D
Sbjct  175  NTLMGELVALETQNMETQHKKNSEEDCVDFAAATTATLGVPSPCLSRGRSFDDAPISLPD  234

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVD  244
             H   KGD+EEE++L R L LS  E P SS D
Sbjct  235  HHIGRKGDIEEEQELMRVLKLSESEVPTSSAD  266


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  695  KDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            KD I+ +EGELI+NF K+SASQLTIYGLFCLQ
Sbjct  514  KDQITTKEGELIQNFLKNSASQLTIYGLFCLQ  545



>ref|XP_011081058.1| PREDICTED: protein FAM63A-like [Sesamum indicum]
Length=709

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 12/134 (9%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVSI------SDKHKAG  163
            NTLMGELV+LET+ M SE K N+E+D VD VAATTAALGVP   +S       S  HKA 
Sbjct  185  NTLMGELVSLETQTMESEQKNNSEEDSVDFVAATTAALGVPSPCLSRGQSFDDSPPHKAR  244

Query  164  KGdleeeedlrralalSMGEGPISSVDDLL--TNVQNSPNVVANIKDHERLVSDKASEIN  337
            KGD+EE+ +L R L LS  EG  S  D ++   N+  S    A +KD E +   + +E N
Sbjct  245  KGDIEEQAELLRVLKLSEAEGSNSLSDGVVGAVNLHES----AYVKDSEPITLLETAEKN  300

Query  338  VAKDSSQPEAPISN  379
             + ++ +    IS+
Sbjct  301  FSDETVKTGTLISD  314


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  695  KDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            K+ IS ++GE+IRNF ++SASQLTIYGLFCLQ
Sbjct  505  KERISTKQGEIIRNFLRNSASQLTIYGLFCLQ  536



>ref|XP_010255585.1| PREDICTED: protein FAM63A-like [Nelumbo nucifera]
Length=700

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 41/67 (61%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTLMGELVALETR+   EHK + E+D +D  AATTA LGVP           DS  SIS 
Sbjct  163  NTLMGELVALETRNTSEEHKSSPEEDCIDFAAATTATLGVPSPCISRCKSFDDSPHSISG  222

Query  149  KHKAGKG  169
              KA KG
Sbjct  223  HQKARKG  229


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  689  SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            SPKD I+ ++GELIRNF K +ASQLTIYGLFCLQ
Sbjct  506  SPKDEITQQKGELIRNFLKTNASQLTIYGLFCLQ  539



>ref|XP_011029149.1| PREDICTED: protein FAM63B isoform X3 [Populus euphratica]
Length=717

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 59/106 (56%), Gaps = 19/106 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDM--------GSEHKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M        G + K   E+D VD VAATTA LGVP           
Sbjct  177  NTLMGELVALETRNMEDESKHVTGEDFKNKTEEDCVDFVAATTATLGVPSPCLSKARSFD  236

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNV  262
            DS  S+SD     KGDLEE   L R L  S  E P S+ D L+++V
Sbjct  237  DSPRSVSDHQNVRKGDLEEAAALLRVLKFSEAELPCSAGDSLVSDV  282


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 3/93 (3%)
 Frame = +2

Query  512  VENIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGDSRHVHNES  691
            ++NID  ++  SS  GS     G+   +     +   R+   + E   +    R V +  
Sbjct  454  MQNIDAPDNFTSSVDGSEPIYEGEECILDTGTSNYEEREPMYEGEVVLAEQADRTVRS--  511

Query  692  PKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  512  -KDEITPQQGELIGNFLKNNASQLTFYGLFCLQ  543



>gb|EPS62597.1| hypothetical protein M569_12193, partial [Genlisea aurea]
Length=237

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  695  KDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            KDGIS +EGE+IR+F K+SASQLT+YGLFCLQ
Sbjct  81   KDGISLKEGEIIRSFMKNSASQLTVYGLFCLQ  112



>ref|XP_011029146.1| PREDICTED: protein FAM63B isoform X1 [Populus euphratica]
Length=724

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 59/106 (56%), Gaps = 19/106 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDM--------GSEHKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M        G + K   E+D VD VAATTA LGVP           
Sbjct  184  NTLMGELVALETRNMEDESKHVTGEDFKNKTEEDCVDFVAATTATLGVPSPCLSKARSFD  243

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNV  262
            DS  S+SD     KGDLEE   L R L  S  E P S+ D L+++V
Sbjct  244  DSPRSVSDHQNVRKGDLEEAAALLRVLKFSEAELPCSAGDSLVSDV  289


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 3/93 (3%)
 Frame = +2

Query  512  VENIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGDSRHVHNES  691
            ++NID  ++  SS  GS     G+   +     +   R+   + E   +    R V +  
Sbjct  461  MQNIDAPDNFTSSVDGSEPIYEGEECILDTGTSNYEEREPMYEGEVVLAEQADRTVRS--  518

Query  692  PKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  519  -KDEITPQQGELIGNFLKNNASQLTFYGLFCLQ  550



>ref|XP_011029148.1| PREDICTED: protein FAM63B isoform X2 [Populus euphratica]
Length=719

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 59/106 (56%), Gaps = 19/106 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDM--------GSEHKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M        G + K   E+D VD VAATTA LGVP           
Sbjct  179  NTLMGELVALETRNMEDESKHVTGEDFKNKTEEDCVDFVAATTATLGVPSPCLSKARSFD  238

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNV  262
            DS  S+SD     KGDLEE   L R L  S  E P S+ D L+++V
Sbjct  239  DSPRSVSDHQNVRKGDLEEAAALLRVLKFSEAELPCSAGDSLVSDV  284


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 3/93 (3%)
 Frame = +2

Query  512  VENIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGDSRHVHNES  691
            ++NID  ++  SS  GS     G+   +     +   R+   + E   +    R V +  
Sbjct  456  MQNIDAPDNFTSSVDGSEPIYEGEECILDTGTSNYEEREPMYEGEVVLAEQADRTVRS--  513

Query  692  PKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  514  -KDEITPQQGELIGNFLKNNASQLTFYGLFCLQ  545



>ref|XP_002509683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51070.1| conserved hypothetical protein [Ricinus communis]
Length=730

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 61/127 (48%), Gaps = 36/127 (28%)
 Frame = +2

Query  512  VENIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGD--------  667
            + N+ ++ DI  S+G       G ++   DSD SSGR Q+ D  ETFTSS D        
Sbjct  441  IANVHEAADI--SSGRDPAEASGLSMPNPDSDSSSGRLQNVDVTETFTSSVDGSEPIYEG  498

Query  668  --------SRHVHNESP------------------KDGISAREGELIRNFFKDSASQLTI  769
                    +    +  P                  KD I+ ++GELI+NF K++ASQLT 
Sbjct  499  EECILDSGTATFEDREPMYEGEVILAEQADKSVRLKDEITPQQGELIKNFLKNNASQLTF  558

Query  770  YGLFCLQ  790
            YGLFCLQ
Sbjct  559  YGLFCLQ  565


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALET+ M  E K NAE+D VD VAATTA LGVP           DS  S+SD
Sbjct  190  NAIMGELVALETQVMEGESKNNAEEDSVDFVAATTATLGVPSPCLSKTRSFDDSPHSVSD  249

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNV  262
                 KGDLEEE +L  AL LS  E P S+ + L+ +V
Sbjct  250  NQSLRKGDLEEEAELLMALKLSEAELPTSTGNMLVADV  287



>gb|KDP25542.1| hypothetical protein JCGZ_20698 [Jatropha curcas]
Length=715

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            NTLMGELVAL+TR+M  E K N E+D VD  AATTA LGVP  S+S
Sbjct  176  NTLMGELVALDTRNMEGESKNNPEEDSVDFAAATTATLGVPSPSLS  221


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 46/93 (49%), Gaps = 29/93 (31%)
 Frame = +2

Query  599  DSDLSSGRRQDSDDPETFTSSGDSRHVHNESPK---------------------------  697
            DSD SSGR Q+ D PETFTSS D      E  +                           
Sbjct  456  DSDSSSGRIQNVDVPETFTSSVDGSEPIYEGEECILDSGTAEPMYEGEVILAEQADKTVM  515

Query  698  --DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
              D I+ ++GELIR F K++A+QLT YGLFCLQ
Sbjct  516  SNDEITPQQGELIRTFLKNNANQLTFYGLFCLQ  548



>ref|XP_007211299.1| hypothetical protein PRUPE_ppa001890mg [Prunus persica]
 gb|EMJ12498.1| hypothetical protein PRUPE_ppa001890mg [Prunus persica]
Length=746

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 60/102 (59%), Gaps = 11/102 (11%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALET +M SE K   E+D VD  AATTA LGVP           +S +S SD
Sbjct  211  NALMGELVALETWNMESECKNTPEEDCVDFAAATTATLGVPSPCLSKTRSFDESPLSASD  270

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSP  274
            + KA KGDLEEE +L  AL +S GE   +  D L     N+P
Sbjct  271  EPKARKGDLEEEAELIMALKMSEGELTTTVGDPLGATTDNAP  312


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 48/97 (49%), Gaps = 35/97 (36%)
 Frame = +2

Query  605  DLSSGRRQDSDDPETFTSSG--------------------DSRHVH----------NESP  694
            D SSGR Q +D  +T TSSG                    D   V+          ++SP
Sbjct  483  DSSSGRVQQTDALDTLTSSGGEPIYEGEERILDSVTTVLQDKEPVYEGEVVLANQADKSP  542

Query  695  KDG-----ISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             D      I+ ++GELIRNF K++ASQLT YGLFCLQ
Sbjct  543  LDARSKGEITPQQGELIRNFLKNNASQLTFYGLFCLQ  579



>ref|XP_008238757.1| PREDICTED: protein FAM63B [Prunus mume]
Length=715

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALET +M SE K  +E+D VD  AATTA LGVP           +S  S SD
Sbjct  180  NALMGELVALETWNMESECKNTSEEDCVDFAAATTATLGVPSPCLSKTRSFDESPHSASD  239

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVV  283
            + KA KGDLEEE +L  AL +S GE   +  D L     N+P +V
Sbjct  240  EPKARKGDLEEEAELIMALKMSEGELTTTVGDPLGATTDNAPPLV  284


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 48/97 (49%), Gaps = 35/97 (36%)
 Frame = +2

Query  605  DLSSGRRQDSDDPETFTSSG--------------------DSRHVH----------NESP  694
            D SSGR Q +D  ET TSSG                    D   V+          ++SP
Sbjct  452  DSSSGRVQQTDASETLTSSGSEPIYEGEERILDSGTTVLQDKEPVYEGEVVLANQADKSP  511

Query  695  KDG-----ISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             D      I+ ++GELIRNF K++ASQLT YGLFCLQ
Sbjct  512  LDARSMGEITPQQGELIRNFLKNNASQLTFYGLFCLQ  548



>ref|XP_007211298.1| hypothetical protein PRUPE_ppa001890mg [Prunus persica]
 gb|EMJ12497.1| hypothetical protein PRUPE_ppa001890mg [Prunus persica]
Length=743

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 60/102 (59%), Gaps = 11/102 (11%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALET +M SE K   E+D VD  AATTA LGVP           +S +S SD
Sbjct  211  NALMGELVALETWNMESECKNTPEEDCVDFAAATTATLGVPSPCLSKTRSFDESPLSASD  270

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSP  274
            + KA KGDLEEE +L  AL +S GE   +  D L     N+P
Sbjct  271  EPKARKGDLEEEAELIMALKMSEGELTTTVGDPLGATTDNAP  312


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 48/97 (49%), Gaps = 35/97 (36%)
 Frame = +2

Query  605  DLSSGRRQDSDDPETFTSSG--------------------DSRHVH----------NESP  694
            D SSGR Q +D  +T TSSG                    D   V+          ++SP
Sbjct  483  DSSSGRVQQTDALDTLTSSGGEPIYEGEERILDSVTTVLQDKEPVYEGEVVLANQADKSP  542

Query  695  KDG-----ISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             D      I+ ++GELIRNF K++ASQLT YGLFCLQ
Sbjct  543  LDARSKGEITPQQGELIRNFLKNNASQLTFYGLFCLQ  579



>ref|XP_011071984.1| PREDICTED: protein FAM63B-like [Sesamum indicum]
Length=738

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVSIS  145
            NTLMGELV+LE +   SE K+N EDD VD VAATTAALGVP   +S S
Sbjct  179  NTLMGELVSLEAQTRESEQKENPEDDTVDFVAATTAALGVPSPCLSRS  226


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  512  VENIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGDSRHVHNES  691
            V  I  SE   SS   S     G+   ++  ++  G R+   + E   +    +   ++ 
Sbjct  461  VHKIGMSEAFTSSIDDSEPIYEGEECVMESGNVVIGNREPVYEGEVVLAEQVDKGCKDDG  520

Query  692  PKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             KD +S ++GELIRNF  +SASQLT+YGLFCLQ
Sbjct  521  FKDRLSVKQGELIRNFVNNSASQLTVYGLFCLQ  553



>ref|XP_009362835.1| PREDICTED: protein FAM63B-like [Pyrus x bretschneideri]
Length=731

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVSI-----------SD  148
            N LMGELVALET++M SE+K   E+D VD  AATTA LGVP   +S            SD
Sbjct  192  NALMGELVALETQNMESEYKNTPEEDCVDFAAATTATLGVPTPCLSTTRSFNKSPHSASD  251

Query  149  KHKAGKG  169
            + KA KG
Sbjct  252  EPKARKG  258


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  689  SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            SPK  I+ ++GEL+R F K++ASQLT+YGLFCL+
Sbjct  530  SPKGEITPQQGELVRTFLKNNASQLTVYGLFCLK  563



>ref|XP_006828905.1| hypothetical protein AMTR_s00001p00199010 [Amborella trichopoda]
 gb|ERM96321.1| hypothetical protein AMTR_s00001p00199010 [Amborella trichopoda]
Length=790

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 3/38 (8%)
 Frame = +2

Query  686  ESPKDG---ISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            E P +G   ++AREGELIRNF K++ASQLTIYGLFCLQ
Sbjct  521  EQPCEGPYNLTAREGELIRNFLKNNASQLTIYGLFCLQ  558



>ref|XP_003516684.1| PREDICTED: protein FAM63B-like isoform X1 [Glycine max]
Length=726

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N+LMGELV+LET +M   HK N E+D VD VAATTA LGVP  S+S
Sbjct  184  NSLMGELVSLETLNMEVHHKNNPEEDCVDFVAATTATLGVPSPSLS  229



>gb|KHN25739.1| Protein FAM63A [Glycine soja]
Length=726

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N+LMGELV+LET +M   HK N E+D VD VAATTA LGVP  S+S
Sbjct  184  NSLMGELVSLETLNMEVHHKNNPEEDCVDFVAATTATLGVPSPSLS  229



>ref|XP_006573752.1| PREDICTED: protein FAM63B-like isoform X2 [Glycine max]
Length=707

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N+LMGELV+LET +M   HK N E+D VD VAATTA LGVP  S+S
Sbjct  184  NSLMGELVSLETLNMEVHHKNNPEEDCVDFVAATTATLGVPSPSLS  229



>ref|XP_007158448.1| hypothetical protein PHAVU_002G153200g [Phaseolus vulgaris]
 gb|ESW30442.1| hypothetical protein PHAVU_002G153200g [Phaseolus vulgaris]
Length=720

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELV+LET +M   HK  AE+D VD VAATTA LGVP  S+S
Sbjct  185  NALMGELVSLETLNMDVHHKNVAEEDCVDFVAATTATLGVPSPSIS  230



>ref|XP_004511617.1| PREDICTED: protein FAM63B-like [Cicer arietinum]
Length=724

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELV+LETR++  + K N E+D VD VAATTAALGVP  S+S
Sbjct  186  NALMGELVSLETRNIEIQPKNNLEEDCVDFVAATTAALGVPSPSLS  231



>ref|XP_002299570.2| hypothetical protein POPTR_0001s08530g [Populus trichocarpa]
 gb|EEE84375.2| hypothetical protein POPTR_0001s08530g [Populus trichocarpa]
Length=686

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 57/106 (54%), Gaps = 19/106 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSE--------HKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M  E         K   E+D VD VAATTA LGVP           
Sbjct  179  NTLMGELVALETRNMEDESKNVTREDFKSKTEEDCVDFVAATTATLGVPSPCLSKARSFD  238

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNV  262
            DS  S SD     KGDLEE   L R L  S  E P S+ D L+++V
Sbjct  239  DSPRSASDHQNVRKGDLEEAAALLRVLKFSEAELPCSAGDSLVSDV  284


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 54/120 (45%), Gaps = 45/120 (38%)
 Frame = +2

Query  533  EDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSS-----------------  661
            ED+P SA             + +S+ S GR Q+ D P+TFTSS                 
Sbjct  402  EDVPGSASP-----------VLESNSSIGRMQNVDAPDTFTSSVDGSEPIYEGEECILDT  450

Query  662  GDSRHVHNE-----------------SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            G S +   E                   KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  451  GTSNYEEREPMYEGEVVLAEQADRTVRSKDEITPQQGELIGNFLKNNASQLTFYGLFCLQ  510



>ref|XP_006368742.1| hypothetical protein POPTR_0001s08530g [Populus trichocarpa]
 gb|ERP65311.1| hypothetical protein POPTR_0001s08530g [Populus trichocarpa]
Length=721

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 57/106 (54%), Gaps = 19/106 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSE--------HKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M  E         K   E+D VD VAATTA LGVP           
Sbjct  179  NTLMGELVALETRNMEDESKNVTREDFKSKTEEDCVDFVAATTATLGVPSPCLSKARSFD  238

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNV  262
            DS  S SD     KGDLEE   L R L  S  E P S+ D L+++V
Sbjct  239  DSPRSASDHQNVRKGDLEEAAALLRVLKFSEAELPCSAGDSLVSDV  284


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 54/120 (45%), Gaps = 45/120 (38%)
 Frame = +2

Query  533  EDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSS-----------------  661
            ED+P SA             + +S+ S GR Q+ D P+TFTSS                 
Sbjct  437  EDVPGSASP-----------VLESNSSIGRMQNVDAPDTFTSSVDGSEPIYEGEECILDT  485

Query  662  GDSRHVHNE-----------------SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            G S +   E                   KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  486  GTSNYEEREPMYEGEVVLAEQADRTVRSKDEITPQQGELIGNFLKNNASQLTFYGLFCLQ  545



>ref|XP_008437193.1| PREDICTED: uncharacterized protein LOC103482694 isoform X2 [Cucumis 
melo]
Length=654

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  662  GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            G S +  N   K  IS R+GELIRNF K++ASQLT YGLFCLQ
Sbjct  445  GSSINFRNIQSKVEISPRQGELIRNFLKNNASQLTFYGLFCLQ  487


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +M ELVALET+ M  + K N EDD +D VAATTA LGVP           +S  SISD
Sbjct  120  NAIMEELVALETQHMEDQCKNNPEDDCIDFVAATTATLGVPSPNLSKVRSFDESPRSISD  179

Query  149  KHKAGKGdleeeedlrralalSMGEGPI  232
            +    KGDLEEE +L +AL LS  E PI
Sbjct  180  EQPLRKGDLEEEAELLKALRLSESETPI  207



>ref|XP_008437192.1| PREDICTED: protein FAM63A isoform X1 [Cucumis melo]
Length=718

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  659  SGDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             G S +  N   K  IS R+GELIRNF K++ASQLT YGLFCLQ
Sbjct  508  CGSSINFRNIQSKVEISPRQGELIRNFLKNNASQLTFYGLFCLQ  551


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +M ELVALET+ M  + K N EDD +D VAATTA LGVP           +S  SISD
Sbjct  184  NAIMEELVALETQHMEDQCKNNPEDDCIDFVAATTATLGVPSPNLSKVRSFDESPRSISD  243

Query  149  KHKAGKGdleeeedlrralalSMGEGPI  232
            +    KGDLEEE +L +AL LS  E PI
Sbjct  244  EQPLRKGDLEEEAELLKALRLSESETPI  271



>ref|XP_011033828.1| PREDICTED: protein FAM63A-like isoform X1 [Populus euphratica]
Length=721

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 34/100 (34%)
 Frame = +2

Query  593  IKDSDLSSGRRQDSDDPETFTSSGD--------------SRHVHNE--------------  688
            + +SD SSGR Q+ D P+TFTSS D              SR+   E              
Sbjct  450  VPESDSSSGRMQNIDTPDTFTSSVDGSEPIYKGEKCILDSRNSKFEDREPMYEGEVILSE  509

Query  689  ------SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                    KD I+A++GELIRNF K+SASQLT  GL CLQ
Sbjct  510  QADKTVRSKDEITAQQGELIRNFLKNSASQLTCNGLSCLQ  549


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 58/103 (56%), Gaps = 20/103 (19%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSE--------HKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M  E         K   E+D +D V ATTA LG P           
Sbjct  184  NTLMGELVALETRNMEDEGKNLIREDSKTKTEEDCIDFVTATTATLGGPSPCLSKARSFD  243

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLL  253
            DS  S+SD  K  KGDLEEE +L R L LS  E PI SVDD L
Sbjct  244  DSPHSVSDDKKVRKGDLEEEAELLRILKLSETELPI-SVDDSL  285



>ref|XP_011033830.1| PREDICTED: protein FAM63A-like isoform X3 [Populus euphratica]
Length=719

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 34/100 (34%)
 Frame = +2

Query  593  IKDSDLSSGRRQDSDDPETFTSSGD--------------SRHVHNE--------------  688
            + +SD SSGR Q+ D P+TFTSS D              SR+   E              
Sbjct  448  VPESDSSSGRMQNIDTPDTFTSSVDGSEPIYKGEKCILDSRNSKFEDREPMYEGEVILSE  507

Query  689  ------SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                    KD I+A++GELIRNF K+SASQLT  GL CLQ
Sbjct  508  QADKTVRSKDEITAQQGELIRNFLKNSASQLTCNGLSCLQ  547


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 58/103 (56%), Gaps = 20/103 (19%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSE--------HKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M  E         K   E+D +D V ATTA LG P           
Sbjct  182  NTLMGELVALETRNMEDEGKNLIREDSKTKTEEDCIDFVTATTATLGGPSPCLSKARSFD  241

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLL  253
            DS  S+SD  K  KGDLEEE +L R L LS  E PI SVDD L
Sbjct  242  DSPHSVSDDKKVRKGDLEEEAELLRILKLSETELPI-SVDDSL  283



>ref|XP_011033829.1| PREDICTED: protein FAM63A-like isoform X2 [Populus euphratica]
Length=720

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 34/100 (34%)
 Frame = +2

Query  593  IKDSDLSSGRRQDSDDPETFTSSGD--------------SRHVHNE--------------  688
            + +SD SSGR Q+ D P+TFTSS D              SR+   E              
Sbjct  450  VPESDSSSGRMQNIDTPDTFTSSVDGSEPIYKGEKCILDSRNSKFEDREPMYEGEVILSE  509

Query  689  ------SPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
                    KD I+A++GELIRNF K+SASQLT  GL CLQ
Sbjct  510  QADKTVRSKDEITAQQGELIRNFLKNSASQLTCNGLSCLQ  549


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 58/103 (56%), Gaps = 20/103 (19%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSE--------HKKNAEDDGVDCVAATTAALGVP-----------  124
            NTLMGELVALETR+M  E         K   E+D +D V ATTA LG P           
Sbjct  184  NTLMGELVALETRNMEDEGKNLIREDSKTKTEEDCIDFVTATTATLGGPSPCLSKARSFD  243

Query  125  DSSVSISDKHKAGKGdleeeedlrralalSMGEGPISSVDDLL  253
            DS  S+SD  K  KGDLEEE +L R L LS  E PI SVDD L
Sbjct  244  DSPHSVSDDKKVRKGDLEEEAELLRILKLSETELPI-SVDDSL  285



>ref|XP_008375808.1| PREDICTED: protein FAM63B-like isoform X1 [Malus domestica]
Length=730

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVSI-----------SD  148
            N LMGELVALET++M SE K   E+D VD  AATTA LGVP   +S            SD
Sbjct  191  NALMGELVALETQNMESECKNTPEEDCVDFAAATTATLGVPSPCLSTTRSFNKSPHSASD  250

Query  149  KHKAGKG  169
            + +A KG
Sbjct  251  EPRARKG  257


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  692  PKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            PK  I+ ++GELIR F K++ASQLT YGLFCLQ
Sbjct  530  PKGEITPQQGELIRTFLKNNASQLTFYGLFCLQ  562



>ref|XP_008375809.1| PREDICTED: protein FAM63B-like isoform X2 [Malus domestica]
Length=718

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVSI-----------SD  148
            N LMGELVALET++M SE K   E+D VD  AATTA LGVP   +S            SD
Sbjct  191  NALMGELVALETQNMESECKNTPEEDCVDFAAATTATLGVPSPCLSTTRSFNKSPHSASD  250

Query  149  KHKAGKG  169
            + +A KG
Sbjct  251  EPRARKG  257


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  692  PKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            PK  I+ ++GELIR F K++ASQLT YGLFCLQ
Sbjct  530  PKGEITPQQGELIRTFLKNNASQLTFYGLFCLQ  562



>ref|XP_007040087.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY24588.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=677

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 56/128 (44%), Gaps = 41/128 (32%)
 Frame = +2

Query  530  SEDIPSSAGGSHVRIVGD-NIDIKDSDLSSGRRQDSDDPETFTSS---------------  661
            ++ IP +  G  +  V   +I   DSD SSGR   +D PE FTSS               
Sbjct  439  AQKIPDNVNGCDMTEVSSVSIQNADSDSSSGRIHHADVPEAFTSSLDGSEPIYEGEECIL  498

Query  662  -----------------------GDSRHVH--NESPKDGISAREGELIRNFFKDSASQLT  766
                                    D + V   N   KD I+ ++GELI NF K++ASQLT
Sbjct  499  DSVTTTYEDREPIYEGEVILAEQADKKAVEGCNVRSKDEITPQQGELIANFLKNNASQLT  558

Query  767  IYGLFCLQ  790
             YGLFCLQ
Sbjct  559  FYGLFCLQ  566


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 12/67 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALETR+M    K N+E D VD  AATTA LGVP           DS  S SD
Sbjct  198  NAIMGELVALETRNMEVSRKNNSE-DCVDFAAATTATLGVPSPSLSKTRSFDDSPCSASD  256

Query  149  KHKAGKG  169
            + +  KG
Sbjct  257  QQRLRKG  263



>ref|XP_007040083.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24584.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=733

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 56/128 (44%), Gaps = 41/128 (32%)
 Frame = +2

Query  530  SEDIPSSAGGSHVRIVGD-NIDIKDSDLSSGRRQDSDDPETFTSS---------------  661
            ++ IP +  G  +  V   +I   DSD SSGR   +D PE FTSS               
Sbjct  439  AQKIPDNVNGCDMTEVSSVSIQNADSDSSSGRIHHADVPEAFTSSLDGSEPIYEGEECIL  498

Query  662  -----------------------GDSRHVH--NESPKDGISAREGELIRNFFKDSASQLT  766
                                    D + V   N   KD I+ ++GELI NF K++ASQLT
Sbjct  499  DSVTTTYEDREPIYEGEVILAEQADKKAVEGCNVRSKDEITPQQGELIANFLKNNASQLT  558

Query  767  IYGLFCLQ  790
             YGLFCLQ
Sbjct  559  FYGLFCLQ  566


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 12/67 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALETR+M    K N+E D VD  AATTA LGVP           DS  S SD
Sbjct  198  NAIMGELVALETRNMEVSRKNNSE-DCVDFAAATTATLGVPSPSLSKTRSFDDSPCSASD  256

Query  149  KHKAGKG  169
            + +  KG
Sbjct  257  QQRLRKG  263



>ref|XP_004298726.1| PREDICTED: uncharacterized protein LOC101309929 [Fragaria vesca 
subsp. vesca]
Length=718

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 66/108 (61%), Gaps = 13/108 (12%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHK-KNA-EDDGVDCVAATTAALGVPDSSV-----------SI  142
            NTLMGELVALET++M SE K KN  ++D VD VAATTA LGVP  S+           S 
Sbjct  180  NTLMGELVALETKNMESECKGKNIPQEDCVDFVAATTATLGVPSPSLSKTRSFEESPHSA  239

Query  143  SDKHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVA  286
            SD+ K  KGD EEEE+L  AL +S  E P S  D    ++ + P +V+
Sbjct  240  SDEPKLRKGDREEEEELLMALQMSEAELPTSVGDPFAASIDSLPLLVS  287



>ref|XP_007040084.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY24585.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=752

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 56/128 (44%), Gaps = 41/128 (32%)
 Frame = +2

Query  530  SEDIPSSAGGSHVRIVGD-NIDIKDSDLSSGRRQDSDDPETFTSS---------------  661
            ++ IP +  G  +  V   +I   DSD SSGR   +D PE FTSS               
Sbjct  439  AQKIPDNVNGCDMTEVSSVSIQNADSDSSSGRIHHADVPEAFTSSLDGSEPIYEGEECIL  498

Query  662  -----------------------GDSRHVH--NESPKDGISAREGELIRNFFKDSASQLT  766
                                    D + V   N   KD I+ ++GELI NF K++ASQLT
Sbjct  499  DSVTTTYEDREPIYEGEVILAEQADKKAVEGCNVRSKDEITPQQGELIANFLKNNASQLT  558

Query  767  IYGLFCLQ  790
             YGLFCLQ
Sbjct  559  FYGLFCLQ  566


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 12/67 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALETR+M    K N+E D VD  AATTA LGVP           DS  S SD
Sbjct  198  NAIMGELVALETRNMEVSRKNNSE-DCVDFAAATTATLGVPSPSLSKTRSFDDSPCSASD  256

Query  149  KHKAGKG  169
            + +  KG
Sbjct  257  QQRLRKG  263



>ref|XP_004173165.1| PREDICTED: LOW QUALITY PROTEIN: protein FAM63A-like, partial 
[Cucumis sativus]
Length=541

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  662  GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            G S +  N   K  IS ++GELIRNF K++ASQLT YGLFCLQ
Sbjct  359  GSSINFRNIQSKVEISPKQGELIRNFLKNNASQLTFYGLFCLQ  401


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +M ELVALET+ M  + K N EDD +D VAATTA LGVP           +S  SISD
Sbjct  34   NAIMEELVALETQHMEEQCKNNPEDDCIDFVAATTATLGVPSPNLSKVRSFDESPRSISD  93

Query  149  KHKAGKGdleeeedlrralalSMGEGPI  232
            +    KGDLEEE +L +AL LS  E PI
Sbjct  94   EQPVRKGDLEEEAELLKALRLSESETPI  121



>ref|XP_004143997.1| PREDICTED: uncharacterized protein LOC101220291 [Cucumis sativus]
Length=719

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  662  GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            G S +  N   K  IS ++GELIRNF K++ASQLT YGLFCLQ
Sbjct  510  GSSINFRNIQSKVEISPKQGELIRNFLKNNASQLTFYGLFCLQ  552


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +M ELVALET+ M  + K N EDD +D VAATTA LGVP           +S  SISD
Sbjct  185  NAIMEELVALETQHMEEQCKNNPEDDCIDFVAATTATLGVPSPNLSKVRSFDESPRSISD  244

Query  149  KHKAGKGdleeeedlrralalSMGEGPI  232
            +    KGDLEEE +L +AL LS  E PI
Sbjct  245  EQPVRKGDLEEEAELLKALRLSESETPI  272



>gb|KGN50156.1| hypothetical protein Csa_5G156160 [Cucumis sativus]
Length=719

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  662  GDSRHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            G S +  N   K  IS ++GELIRNF K++ASQLT YGLFCLQ
Sbjct  510  GSSINFRNIQSKVEISPKQGELIRNFLKNNASQLTFYGLFCLQ  552


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +M ELVALET+ M  + K N EDD +D VAATTA LGVP           +S  SISD
Sbjct  185  NAIMEELVALETQHMEEQCKNNPEDDCIDFVAATTATLGVPSPNLSKVRSFDESPRSISD  244

Query  149  KHKAGKGdleeeedlrralalSMGEGPI  232
            +    KGDLEEE +L +AL LS  E PI
Sbjct  245  EQPVRKGDLEEEAELLKALRLSESETPI  272



>gb|EYU36933.1| hypothetical protein MIMGU_mgv1a022265mg, partial [Erythranthe 
guttata]
Length=644

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            NTLMGELV L+T+ M SE +K+ E D VD  A+TTAALGVP   +S
Sbjct  178  NTLMGELVTLDTQTMKSEQRKDTEGDTVDFAASTTAALGVPSPCLS  223


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  698  DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            D IS ++GE+IR F K SASQLTIYGLFCLQ
Sbjct  466  DRISVKQGEVIREFMKTSASQLTIYGLFCLQ  496



>ref|XP_009377899.1| PREDICTED: protein FAM63B-like [Pyrus x bretschneideri]
 ref|XP_009377900.1| PREDICTED: protein FAM63B-like [Pyrus x bretschneideri]
Length=725

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALE ++M SE K   E+D VD  AATTA LGVP           +S  S SD
Sbjct  182  NALMGELVALEAQNMESECKSTLEEDCVDFAAATTATLGVPSPCLSKTRSFDESPRSASD  241

Query  149  KHKAGKG  169
            + KA KG
Sbjct  242  EPKARKG  248



>ref|XP_010272598.1| PREDICTED: protein FAM63A isoform X1 [Nelumbo nucifera]
Length=698

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  686  ESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            + P++ I+ ++GELIRNF +++ASQLTIYGLFCLQ
Sbjct  502  QCPENEITEQKGELIRNFLRNNASQLTIYGLFCLQ  536


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            NTL+GELV+LE R+   EHK + E+D +D  AATTA LGVP   +S
Sbjct  163  NTLVGELVSLEARNTEEEHKSSPEEDCIDFSAATTATLGVPSPCLS  208



>ref|XP_010272599.1| PREDICTED: protein FAM63A isoform X2 [Nelumbo nucifera]
Length=622

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  686  ESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            + P++ I+ ++GELIRNF +++ASQLTIYGLFCLQ
Sbjct  426  QCPENEITEQKGELIRNFLRNNASQLTIYGLFCLQ  460


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            NTL+GELV+LE R+   EHK + E+D +D  AATTA LGVP   +S
Sbjct  163  NTLVGELVSLEARNTEEEHKSSPEEDCIDFSAATTATLGVPSPCLS  208



>ref|XP_007040085.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 ref|XP_007040086.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 ref|XP_007040088.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY24586.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY24587.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY24589.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=543

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 12/67 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALETR+M    K N+E D VD  AATTA LGVP           DS  S SD
Sbjct  198  NAIMGELVALETRNMEVSRKNNSE-DCVDFAAATTATLGVPSPSLSKTRSFDDSPCSASD  256

Query  149  KHKAGKG  169
            + +  KG
Sbjct  257  QQRLRKG  263



>emb|CBI34769.3| unnamed protein product [Vitis vinifera]
Length=662

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 74/139 (53%), Gaps = 20/139 (14%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N L+GELVAL++R+M  E K   E+D +D  AATTA LGVP           DS  SISD
Sbjct  168  NALVGELVALDSRNMEGEPKSTPEEDCIDFAAATTATLGVPSPSLSRARSFEDSPHSISD  227

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVDDLLTNVQNSPNVVANIKDH-ERLVSDKA  325
                 KGDL+EE +L R L LS  E   +  D L+       N +  I  H + +V +  
Sbjct  228  NQTVRKGDLQEEAELSRILKLSEAELSTTVDDSLIV------NAIGGISIHSDSVVVNTN  281

Query  326  SEINVAKDSS--QPEAPIS  376
             EI+V+ D +  Q EA IS
Sbjct  282  GEISVSSDQNFHQQEAAIS  300



>ref|XP_006440500.1| hypothetical protein CICLE_v10019075mg [Citrus clementina]
 gb|ESR53740.1| hypothetical protein CICLE_v10019075mg [Citrus clementina]
Length=709

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 13/67 (19%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALET  MG + K N+E+D VD  AATTA LGVP           DS  S+SD
Sbjct  168  NAIMGELVALET--MGGDCKSNSEEDCVDFAAATTATLGVPSPCLSKARSFDDSPRSVSD  225

Query  149  KHKAGKG  169
            +    KG
Sbjct  226  QQTLRKG  232



>ref|XP_010676579.1| PREDICTED: protein FAM63A isoform X1 [Beta vulgaris subsp. vulgaris]
Length=692

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSV-----------SISD  148
            NT+MG+LV+LET  M +E K  +++D +D  AATTA LGVP  S+           SISD
Sbjct  167  NTVMGDLVSLETWKMENEGKDKSDEDCIDFAAATTATLGVPSPSLSRGKSFEESPRSISD  226

Query  149  KHKAGKG  169
            +H   KG
Sbjct  227  QHTLKKG  233


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  671  RHVHNESPKDGISAREGELIRNFFKDSASQLTIYGLFCL  787
            +  ++ S K+ IS R+GELI NF K +ASQLT YGLFCL
Sbjct  477  KDTYDASSKEEISPRQGELISNFLKSNASQLTFYGLFCL  515



>ref|XP_006477357.1| PREDICTED: protein FAM63B-like [Citrus sinensis]
Length=709

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 13/67 (19%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALET  MG + K N+E+D VD  AATTA LGVP           DS  S+SD
Sbjct  168  NAIMGELVALET--MGGDCKSNSEEDCVDFAAATTATLGVPSPCLSKARSFDDSPRSVSD  225

Query  149  KHKAGKG  169
            +    KG
Sbjct  226  QQTLRKG  232



>ref|XP_010108057.1| hypothetical protein L484_023142 [Morus notabilis]
 gb|EXC17789.1| hypothetical protein L484_023142 [Morus notabilis]
Length=748

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = +2

Query  518  NIDQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGDSRHVHNESPK  697
            ++D SE + SS  GS     G+   +         R+   + E   ++   +      PK
Sbjct  457  HVDTSEALTSSVDGSEPIYEGEECILDSGTTVFEDREPVYEGEVVLANQADKSTLESRPK  516

Query  698  DGISAREGELIRNFFKDSASQLTIYGLFCL  787
            D I+ + GELIRNF K +ASQLT  GLFCL
Sbjct  517  DAITPQAGELIRNFLKYNASQLTFTGLFCL  546



>ref|XP_010434086.1| PREDICTED: protein FAM63A-like [Camelina sativa]
Length=693

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  698  DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            DG+SA+EGELIRNF K+SASQLT  GLF LQ
Sbjct  488  DGLSAKEGELIRNFMKNSASQLTFCGLFRLQ  518


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALET+++ +   +N  +D VD  AATTAALGVP           +S  + ++
Sbjct  196  NALMGELVALETQNVEARGDQNPGEDSVDFAAATTAALGVPSPCLLKTRSFDESPPAAAE  255

Query  149  KHKAGKGdleeeedlrralalSMGEG  226
             H+  KGDLEEE +L +AL LS G+G
Sbjct  256  LHRMRKGDLEEETELLQALQLSQGQG  281



>ref|XP_010455599.1| PREDICTED: protein FAM63A-like [Camelina sativa]
Length=694

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  698  DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            DG+SA+EGELIRNF K+SASQLT  GLF LQ
Sbjct  489  DGLSAKEGELIRNFMKNSASQLTFCGLFRLQ  519


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 72/134 (54%), Gaps = 24/134 (18%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALET+++ +   +N  +D VD  AATTAALGVP           +S  + ++
Sbjct  197  NALMGELVALETQNVEARGDQNPGEDSVDFAAATTAALGVPSPCLLKTRSFDESPPAAAE  256

Query  149  KHKAGKGdleeeedlrralalSMGEGPISS---------VDDLLTNVQNSPNV--VANIK  295
             H+  KGDLEEE +L +AL LS G+G  S+          D   T    SP     ANI 
Sbjct  257  LHRMRKGDLEEETELLQALQLSQGQGNDSAPNTHEDSINQDSTFTFSDASPTSTHCANIS  316

Query  296  DHERLVS--DKASE  331
              E+  S  DKASE
Sbjct  317  QLEQFKSDDDKASE  330



>ref|XP_010422138.1| PREDICTED: protein FAM63A-like [Camelina sativa]
Length=694

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  698  DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            DG+SA+EGELIRNF K+SASQLT  GLF LQ
Sbjct  489  DGLSAKEGELIRNFMKNSASQLTFCGLFRLQ  519


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELVALET+++ +   +N  +D VD  AATTAALGVP           +S  + ++
Sbjct  197  NALMGELVALETQNVEARGDQNPGEDSVDFAAATTAALGVPSPCLLKTRSFDESPPAAAE  256

Query  149  KHKAGKGdleeeedlrralalSMGEG  226
             H+  KGDLEEE +L +AL LS G+G
Sbjct  257  LHRMRKGDLEEETELLQALQLSQGQG  282



>gb|KHN34990.1| Protein FAM63A [Glycine soja]
Length=721

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELV+LET +M   H+ N ED  VD VAATTA LGVP  S+S
Sbjct  183  NALMGELVSLETLNMNVHHENNPED-CVDFVAATTATLGVPSPSLS  227



>gb|KEH27444.1| FAM63A-like protein, putative [Medicago truncatula]
Length=675

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKN-AEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++ +  K N  E+D VD VAATTAALGVP  S+S
Sbjct  194  NALMGELVALETQNIETLPKNNPEEEDCVDFVAATTAALGVPSPSLS  240



>ref|XP_003611174.1| Protein FAM63A [Medicago truncatula]
 gb|AES94132.1| FAM63A-like protein, putative [Medicago truncatula]
Length=737

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKN-AEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++ +  K N  E+D VD VAATTAALGVP  S+S
Sbjct  194  NALMGELVALETQNIETLPKNNPEEEDCVDFVAATTAALGVPSPSLS  240



>gb|KHF99932.1| Protein FAM63A [Gossypium arboreum]
Length=714

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N +M ELVALETR+M   HK N+E D VD  AATTA LGVP  S+S
Sbjct  192  NAIMEELVALETRNMEVSHKNNSE-DCVDFAAATTATLGVPSPSLS  236


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  695  KDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            K+ I+ ++GELI NF K++A+QLT YGLFCLQ
Sbjct  519  KEEITPQQGELIANFLKNNANQLTFYGLFCLQ  550



>gb|KHG27744.1| Protein FAM63A [Gossypium arboreum]
Length=736

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  683  NESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            N   KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  534  NMRSKDEINLQQGELIGNFLKNNASQLTFYGLFCLQ  569


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 56/92 (61%), Gaps = 12/92 (13%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N +MGELVALETR+M    K N+E D VD  AATTA LGVP           DS  S+SD
Sbjct  201  NAIMGELVALETRNMEISPKNNSE-DCVDFAAATTATLGVPSPCLSKTRSFDDSPHSVSD  259

Query  149  KHKAGKGdleeeedlrralalSMGEGPISSVD  244
            +    KGDLEEE +L +AL LS  E P S+ D
Sbjct  260  QQSLRKGDLEEEAELMKALKLSEAELPTSNGD  291



>gb|KHG24879.1| Protein FAM63A [Gossypium arboreum]
Length=666

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  683  NESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            N   KD I+ ++GELI NF K++ASQLT YGLFCLQ
Sbjct  461  NVRSKDEITPQQGELIGNFLKNNASQLTFYGLFCLQ  496



>ref|XP_002275737.1| PREDICTED: protein FAM63B [Vitis vinifera]
Length=720

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N L+GELVAL++R+M  E K   E+D +D  AATTA LGVP           DS  SISD
Sbjct  168  NALVGELVALDSRNMEGEPKSTPEEDCIDFAAATTATLGVPSPSLSRARSFEDSPHSISD  227

Query  149  KHKAGKG  169
                 KG
Sbjct  228  NQTVRKG  234



>ref|XP_003538713.1| PREDICTED: protein FAM63B-like [Glycine max]
Length=723

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 39/67 (58%), Gaps = 13/67 (19%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            N LMGELV+LET  M   H+ N ED  VD VAATTA LGVP           DSS SISD
Sbjct  183  NALMGELVSLETLIMNVHHENNPED-CVDFVAATTATLGVPSPSLSKARSFDDSSHSISD  241

Query  149  KHKAGKG  169
             H   KG
Sbjct  242  -HMQRKG  247



>ref|XP_002874729.1| hypothetical protein ARALYDRAFT_490003 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50988.1| hypothetical protein ARALYDRAFT_490003 [Arabidopsis lyrata subsp. 
lyrata]
Length=687

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++ ++  +N  +D VD  AATTAALGVP   +S
Sbjct  189  NALMGELVALETQNVEAQGDQNPGEDSVDFAAATTAALGVPSPCLS  234



>gb|KCW77635.1| hypothetical protein EUGRSUZ_D01938, partial [Eucalyptus grandis]
Length=631

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  695  KDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            +D ++ ++GEL+RNF   SA+QLTIYGLFCLQ
Sbjct  434  RDEMTPQQGELVRNFLNGSANQLTIYGLFCLQ  465



>ref|NP_567383.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM62819.1| unknown [Arabidopsis thaliana]
 dbj|BAF01280.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83059.1| uncharacterized protein AT4G11860 [Arabidopsis thaliana]
Length=682

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  698  DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            DG++A EGELIRNF K+SASQLT  GLF LQ
Sbjct  477  DGLTAEEGELIRNFMKNSASQLTFCGLFRLQ  507


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++ ++  +N  +D VD  AATTA LGVP   +S
Sbjct  185  NALMGELVALETQNVEAQGDQNPGEDSVDFAAATTAVLGVPSPCLS  230



>ref|XP_010907483.1| PREDICTED: protein FAM63A [Elaeis guineensis]
Length=690

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +2

Query  524  DQSEDIPSSAGGSHVRIVGDNIDIKDSDLSSGRRQDSDDPETFTSSGDSRHVHNESPK--  697
            D SE + SS  GS     G+   ++ +  +   R+   + E   +    +   ++SPK  
Sbjct  434  DVSEAVSSSFEGSEPIYEGEERILESAFTTHENREPVYEGEAILAEQADKMEEDDSPKNL  493

Query  698  -DGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
             D ++  + +LI+NF +++ASQLTIYGLFCLQ
Sbjct  494  EDEVTQHQWQLIKNFLENNASQLTIYGLFCLQ  525



>ref|XP_006396840.1| hypothetical protein EUTSA_v10028490mg [Eutrema salsugineum]
 gb|ESQ38293.1| hypothetical protein EUTSA_v10028490mg [Eutrema salsugineum]
Length=679

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++ +   +N  +D VD  AATTAALGVP   +S
Sbjct  182  NALMGELVALETQNVEARGDQNLGEDSVDFAAATTAALGVPSPCLS  227



>ref|XP_006657335.1| PREDICTED: protein FAM63B-like [Oryza brachyantha]
Length=680

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  686  ESPKDGISAREGELIRNFFKDSASQLTIYGLFCLQ  790
            E  +DG +  + ELI NF +++ASQLT+YGLFCLQ
Sbjct  468  ECMQDGAAEHQWELIDNFLQNTASQLTVYGLFCLQ  502



>emb|CDY13285.1| BnaC09g23710D [Brassica napus]
Length=641

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++  EH+ N  +D VD VAATTAALGVP   +S
Sbjct  181  NALMGELVALETQNV--EHE-NPGEDSVDFVAATTAALGVPSPCLS  223



>emb|CAB44324.1| putative protein [Arabidopsis thaliana]
 emb|CAB78229.1| putative protein [Arabidopsis thaliana]
Length=626

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVPDSSVS  139
            N LMGELVALET+++ ++  +N  +D VD  AATTA LGVP   +S
Sbjct  185  NALMGELVALETQNVEAQGDQNPGEDSVDFAAATTAVLGVPSPCLS  230



>ref|XP_008794672.1| PREDICTED: uncharacterized protein LOC103710635 isoform X1 [Phoenix 
dactylifera]
Length=702

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    NTLMGELVALETRDMGSEHKKNAEDDGVDCVAATTAALGVP-----------DSSVSISD  148
            NTL+GELVA E R    E+K   E+D +D  AATTA LGVP           D  +S S 
Sbjct  163  NTLVGELVAFEARKSEGENKSVQEEDSIDFAAATTATLGVPSPCLSRGRSFDDHPISTSV  222

Query  149  KHKAGKG  169
              + GKG
Sbjct  223  DQRRGKG  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1438369239528