BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32291_g1_i1 len=1134 path=[1:0-1133]

Length=1134
                                                                      Score     E

ref|XP_002534670.1|  Derlin-2, putative                                 342   7e-113   Ricinus communis
ref|XP_002266374.1|  PREDICTED: derlin-1.1-like                         333   2e-109   Vitis vinifera
gb|KDP22457.1|  hypothetical protein JCGZ_26288                         332   9e-109   
ref|XP_011028466.1|  PREDICTED: derlin-1-like                           331   2e-108   
gb|KEH32845.1|  derlin-2 protein                                        328   2e-107   
ref|XP_006385123.1|  hypothetical protein POPTR_0004s24140g             328   4e-107   
ref|XP_006385124.1|  hypothetical protein POPTR_0004s24145g             327   1e-106   
emb|CAN79229.1|  hypothetical protein VITISV_027074                     325   4e-106   Vitis vinifera
ref|XP_008234433.1|  PREDICTED: derlin-1.1-like                         325   4e-106   
ref|XP_010062513.1|  PREDICTED: derlin-1.2-like                         325   5e-106   
ref|XP_010042305.1|  PREDICTED: derlin-1.2-like                         324   2e-105   
ref|XP_010042306.1|  PREDICTED: derlin-1.2-like                         324   2e-105   
ref|XP_003527555.1|  PREDICTED: derlin-1-like                           323   4e-105   
gb|KHN32503.1|  Derlin-1                                                322   7e-105   
emb|CBI38648.3|  unnamed protein product                                324   8e-105   
ref|XP_003522846.1|  PREDICTED: derlin-1-like isoform X1                321   2e-104   
ref|XP_007148719.1|  hypothetical protein PHAVU_005G008800g             321   2e-104   
ref|XP_007218677.1|  hypothetical protein PRUPE_ppa014581mg             318   3e-103   
ref|XP_008453882.1|  PREDICTED: derlin-1.1-like isoform X1              318   4e-103   
ref|XP_007038301.1|  DERLIN-1 isoform 1                                 318   4e-103   
ref|XP_004499635.1|  PREDICTED: derlin-1-like                           317   5e-103   
ref|XP_004146908.1|  PREDICTED: derlin-1.1-like isoform 2               317   1e-102   
emb|CDP05367.1|  unnamed protein product                                315   6e-102   
ref|XP_006421587.1|  hypothetical protein CICLE_v10006512mg             315   7e-102   
gb|KDO45280.1|  hypothetical protein CISIN_1g021348mg                   315   1e-101   
ref|XP_007038302.1|  DERLIN-1 isoform 2                                 313   3e-101   
ref|XP_006490169.1|  PREDICTED: derlin-1-like                           314   8e-101   
gb|KHN42778.1|  Derlin-1                                                311   1e-100   
ref|XP_009370435.1|  PREDICTED: derlin-1.1-like                         307   4e-99    
gb|KCW90867.1|  hypothetical protein EUGRSUZ_A02914                     308   7e-99    
ref|XP_008376384.1|  PREDICTED: derlin-1.1-like                         306   2e-98    
ref|XP_009372842.1|  PREDICTED: derlin-1.1-like                         305   2e-98    
ref|XP_004146907.1|  PREDICTED: derlin-1.1-like isoform 1               306   2e-98    
emb|CBI38645.3|  unnamed protein product                                296   3e-94    
ref|XP_009404549.1|  PREDICTED: derlin-1                                292   2e-93    
ref|XP_010267104.1|  PREDICTED: derlin-1                                290   1e-92    
ref|XP_010249470.1|  PREDICTED: derlin-1-like                           285   7e-91    
ref|XP_010914944.1|  PREDICTED: derlin-1                                284   1e-90    
ref|XP_010047297.1|  PREDICTED: derlin-1                                283   3e-90    
ref|XP_004307787.1|  PREDICTED: derlin-1.1-like                         283   1e-89    
ref|XP_008453883.1|  PREDICTED: derlin-1.1-like isoform X2              282   2e-89    
ref|XP_004146909.1|  PREDICTED: derlin-1.1-like isoform 3               281   6e-89    
ref|XP_002275238.1|  PREDICTED: derlin-1                                280   7e-89    Vitis vinifera
ref|XP_009605271.1|  PREDICTED: derlin-1-like                           280   2e-88    
ref|XP_008799776.1|  PREDICTED: LOW QUALITY PROTEIN: derlin-1-like      278   2e-88    
ref|XP_007202495.1|  hypothetical protein PRUPE_ppa010620mg             278   4e-88    
gb|KCW79180.1|  hypothetical protein EUGRSUZ_C00616                     277   2e-87    
ref|XP_007012984.1|  DERLIN-1                                           275   5e-87    
ref|XP_004287492.1|  PREDICTED: derlin-1-like                           273   3e-86    
gb|KDP33776.1|  hypothetical protein JCGZ_07347                         273   4e-86    
ref|XP_002514197.1|  Derlin-3, putative                                 271   5e-86    Ricinus communis
ref|XP_003630693.1|  Derlin-1                                           272   6e-86    
ref|XP_003530537.1|  PREDICTED: derlin-1-like                           272   1e-85    
ref|XP_006338200.1|  PREDICTED: derlin-1-like                           273   1e-85    
ref|NP_194662.2|  derlin-1                                              272   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541005.1|  PREDICTED: derlin-1                                271   3e-85    
ref|XP_004503500.1|  PREDICTED: derlin-1-like                           271   3e-85    
ref|XP_002869440.1|  hypothetical protein ARALYDRAFT_491823             271   4e-85    
ref|XP_004239327.1|  PREDICTED: derlin-1                                271   5e-85    
ref|XP_008242542.1|  PREDICTED: derlin-1                                269   9e-85    
ref|XP_007160273.1|  hypothetical protein PHAVU_002G307400g             269   1e-84    
ref|XP_010433107.1|  PREDICTED: derlin-1-like                           270   2e-84    
ref|XP_009798903.1|  PREDICTED: derlin-1-like                           270   2e-84    
ref|XP_006451340.1|  hypothetical protein CICLE_v10009327mg             268   3e-84    
gb|AFK48055.1|  unknown                                                 268   4e-84    
gb|AFK44105.1|  unknown                                                 268   4e-84    
gb|KHG24854.1|  Derlin-1 -like protein                                  268   5e-84    
ref|XP_010438311.1|  PREDICTED: derlin-1                                268   5e-84    
ref|XP_009352574.1|  PREDICTED: derlin-1                                267   6e-84    
ref|XP_011007263.1|  PREDICTED: derlin-1                                267   7e-84    
ref|XP_007202494.1|  hypothetical protein PRUPE_ppa010620mg             266   8e-84    
ref|XP_010447866.1|  PREDICTED: derlin-1-like                           268   1e-83    
ref|XP_003525291.1|  PREDICTED: derlin-1-like isoform X1                266   1e-83    
ref|XP_010919662.1|  PREDICTED: derlin-1-like                           266   2e-83    
ref|XP_008337606.1|  PREDICTED: derlin-1                                266   2e-83    
gb|KHF99830.1|  Derlin-1 -like protein                                  265   3e-83    
ref|XP_002309232.2|  hypothetical protein POPTR_0006s15780g             265   4e-83    Populus trichocarpa [western balsam poplar]
ref|XP_006412852.1|  hypothetical protein EUTSA_v10025986mg             266   5e-83    
ref|XP_009760788.1|  PREDICTED: derlin-1-like                           264   8e-83    
emb|CDY06822.1|  BnaC01g09210D                                          264   1e-82    
ref|XP_010688360.1|  PREDICTED: derlin-1                                263   2e-82    
ref|XP_004960894.1|  PREDICTED: derlin-1-like                           263   2e-82    
emb|CAB79691.1|  putative protein                                       265   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613361.1|  PREDICTED: derlin-1-like                           263   3e-82    
emb|CDY48611.1|  BnaA01g07540D                                          265   3e-82    
ref|XP_006284336.1|  hypothetical protein CARUB_v10005507mg             263   4e-82    
gb|AET05171.2|  derlin-2 protein                                        262   6e-82    
ref|XP_008803830.1|  PREDICTED: derlin-1.2-like                         262   6e-82    
ref|XP_009128855.1|  PREDICTED: derlin-1                                261   2e-81    
ref|XP_003630694.1|  Derlin-1                                           258   7e-81    
ref|XP_004135679.1|  PREDICTED: derlin-1-like                           259   1e-80    
ref|XP_006284337.1|  hypothetical protein CARUB_v10005507mg             257   2e-80    
ref|XP_003568781.1|  PREDICTED: derlin-1                                258   3e-80    
ref|XP_011093654.1|  PREDICTED: derlin-1                                257   4e-80    
gb|AAS88720.1|  putative Der1-like family protein                       258   5e-80    Cynodon dactylon
ref|XP_008450797.1|  PREDICTED: derlin-1                                256   2e-79    
dbj|BAJ96246.1|  predicted protein                                      254   4e-79    
sp|Q06397.2|DERL1_ORYSJ  RecName: Full=Derlin-1; AltName: Full=18...    254   5e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EYU27250.1|  hypothetical protein MIMGU_mgv1a012777mg                253   1e-78    
ref|XP_006580484.1|  PREDICTED: derlin-1-like isoform X2                252   3e-78    
gb|KDO55857.1|  hypothetical protein CISIN_1g022636mg                   253   8e-78    
ref|XP_006654127.1|  PREDICTED: derlin-1-like                           251   1e-77    
ref|XP_002440740.1|  hypothetical protein SORBIDRAFT_09g005900          251   1e-77    Sorghum bicolor [broomcorn]
ref|XP_010109598.1|  hypothetical protein L484_002163                   266   2e-77    
gb|ACG43860.1|  derlin-3                                                250   3e-77    Zea mays [maize]
ref|NP_001105797.1|  derlin-1.2                                         249   5e-77    Zea mays [maize]
ref|NP_001105945.1|  derlin-1.1                                         249   5e-77    Zea mays [maize]
ref|XP_010110870.1|  hypothetical protein L484_006985                   243   1e-74    
ref|XP_006853718.1|  hypothetical protein AMTR_s00056p00158870          242   3e-74    
ref|XP_008654203.1|  PREDICTED: derlin-1.1 isoform X1                   241   2e-73    
ref|XP_006578365.1|  PREDICTED: derlin-1-like isoform X2                236   3e-72    
ref|XP_006450745.1|  hypothetical protein CICLE_v10010701mg             237   1e-71    
ref|NP_001105128.1|  sor protein                                        236   2e-71    Zea mays [maize]
emb|CDP03237.1|  unnamed protein product                                234   4e-71    
gb|AAS86403.1|  putative Der1 protein                                   232   2e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EPS66230.1|  hypothetical protein M569_08547                         229   3e-69    
gb|AFW82015.1|  hypothetical protein ZEAMMB73_273794                    228   4e-69    
gb|EMS65096.1|  hypothetical protein TRIUR3_27036                       223   5e-66    
ref|XP_007012198.1|  DERLIN-1, putative                                 219   6e-64    
ref|XP_001776950.1|  predicted protein                                  214   3e-63    
gb|ACU23590.1|  unknown                                                 206   3e-61    Glycine max [soybeans]
gb|KDO79933.1|  hypothetical protein CISIN_1g035602mg                   191   5e-55    
gb|ACN34963.1|  unknown                                                 182   3e-52    Zea mays [maize]
ref|XP_008654204.1|  PREDICTED: derlin-1.1 isoform X2                   183   5e-52    
ref|XP_008390846.1|  PREDICTED: derlin-1-like                           179   6e-51    
ref|XP_003054796.1|  predicted protein                                  182   8e-51    
ref|XP_002507057.1|  derlin-like protein                                177   8e-49    Micromonas commoda
gb|ABK93254.1|  unknown                                                 172   3e-48    Populus trichocarpa [western balsam poplar]
ref|XP_002964485.1|  hypothetical protein SELMODRAFT_266761             175   3e-48    
gb|AAY41612.1|  derlin1-1                                               172   8e-48    Zea mays [maize]
ref|XP_007512331.1|  predicted protein                                  159   2e-42    
ref|XP_006908733.1|  PREDICTED: derlin-3                                151   2e-39    
ref|XP_002955525.1|  hypothetical protein VOLCADRAFT_33117              147   2e-38    
ref|XP_007973300.1|  PREDICTED: derlin-3 isoform X9                     147   4e-38    
ref|XP_001084965.2|  PREDICTED: derlin-3 isoform 1                      147   8e-38    Macaca mulatta [rhesus macaque]
ref|XP_004466478.1|  PREDICTED: derlin-3                                146   1e-37    
ref|XP_002724059.1|  PREDICTED: derlin-3 isoform X1                     146   2e-37    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006999087.1|  PREDICTED: LOW QUALITY PROTEIN: derlin 3           146   2e-37    
ref|XP_005360262.1|  PREDICTED: LOW QUALITY PROTEIN: derlin-3           145   2e-37    
gb|AAI67034.1|  Derl3 protein                                           144   6e-37    Rattus norvegicus [brown rat]
ref|NP_001103047.2|  derlin-3                                           144   7e-37    Rattus norvegicus [brown rat]
ref|XP_005070802.1|  PREDICTED: derlin-3                                144   8e-37    
gb|EKC32336.1|  Derlin-2                                                144   9e-37    
ref|XP_001696906.1|  hypothetical protein CHLREDRAFT_184920             144   1e-36    Chlamydomonas reinhardtii
ref|XP_006277064.1|  PREDICTED: derlin-2-like                           144   1e-36    
ref|NP_077760.1|  derlin-3                                              143   1e-36    Mus musculus [mouse]
ref|XP_005649415.1|  Derlin-1                                           144   2e-36    
gb|AAH04729.1|  Derl3 protein                                           142   2e-36    Mus musculus [mouse]
ref|XP_006922293.1|  PREDICTED: derlin-2                                143   2e-36    
ref|XP_005233323.1|  PREDICTED: derlin-2-like isoform X1                142   4e-36    
gb|ACQ57961.1|  Derlin-2                                                142   5e-36    Anoplopoma fimbria
ref|XP_001362900.1|  PREDICTED: derlin-2                                142   5e-36    Monodelphis domestica
ref|XP_010396455.1|  PREDICTED: derlin-3 isoform X1                     142   6e-36    
ref|XP_004684800.1|  PREDICTED: derlin-2                                141   9e-36    
ref|XP_008988450.1|  PREDICTED: derlin-3 isoform X3                     140   1e-35    
ref|NP_001019566.1|  derlin-2                                           141   1e-35    Danio rerio [leopard danio]
ref|XP_007245328.1|  PREDICTED: derlin-2                                142   1e-35    
ref|NP_001232219.1|  derlin-3                                           141   1e-35    
ref|XP_010284371.1|  PREDICTED: derlin-2-like                           141   1e-35    
ref|XP_010740552.1|  PREDICTED: derlin-2                                141   1e-35    
ref|XP_008854175.1|  PREDICTED: derlin-2                                141   1e-35    
ref|XP_003226631.1|  PREDICTED: derlin-2                                141   1e-35    
ref|XP_005288618.1|  PREDICTED: derlin-3 isoform X1                     141   1e-35    
ref|XP_008988449.1|  PREDICTED: derlin-3 isoform X2                     140   1e-35    
ref|XP_005524546.1|  PREDICTED: derlin-2-like isoform X1                141   1e-35    
ref|XP_008170229.1|  PREDICTED: derlin-3 isoform X2                     140   1e-35    
emb|CEF97386.1|  Derlin                                                 141   1e-35    
ref|XP_008874664.1|  hypothetical protein H310_10163                    140   2e-35    
ref|XP_005815935.1|  PREDICTED: derlin-2-like                           140   2e-35    
ref|XP_008154958.1|  PREDICTED: derlin-2                                140   2e-35    
gb|AHG98170.1|  Derlin-2 variant 1                                      140   2e-35    
ref|XP_010573794.1|  PREDICTED: derlin-3 isoform X1                     140   2e-35    
gb|AHG98172.1|  Derlin-2 variant 1                                      140   2e-35    
ref|XP_008060177.1|  PREDICTED: derlin-2                                140   2e-35    
ref|XP_003439537.1|  PREDICTED: derlin-2-like                           140   2e-35    
gb|ACO10173.1|  Derlin-2                                                140   2e-35    Osmerus mordax
gb|KDO32535.1|  hypothetical protein SPRG_03010                         140   2e-35    
ref|XP_007102876.1|  PREDICTED: derlin-2 isoform X2                     140   3e-35    
ref|XP_003791281.1|  PREDICTED: derlin-2                                140   3e-35    
ref|XP_008621042.1|  hypothetical protein SDRG_16604                    140   3e-35    
ref|XP_002763528.1|  PREDICTED: derlin-3 isoform X1                     140   3e-35    Callithrix jacchus [common marmoset]
gb|AHG98171.1|  Derlin-2 variant 2                                      140   3e-35    
ref|XP_008281421.1|  PREDICTED: derlin-2                                140   3e-35    
ref|NP_001016097.1|  derlin 2                                           140   3e-35    Xenopus tropicalis [western clawed frog]
gb|ACM08454.1|  Derlin-2                                                140   3e-35    Salmo salar
ref|XP_006899844.1|  PREDICTED: derlin-2                                140   3e-35    
gb|AHG98256.1|  Derlin-2 variant 1                                      140   3e-35    
ref|XP_008995525.1|  PREDICTED: derlin-2 isoform X2                     139   3e-35    
ref|XP_009954320.1|  PREDICTED: derlin-2-like isoform X1                139   3e-35    
ref|XP_007054210.1|  PREDICTED: derlin-2                                140   3e-35    
ref|XP_005882642.1|  PREDICTED: derlin-2                                140   3e-35    
ref|XP_007091703.1|  PREDICTED: derlin-2                                139   4e-35    
ref|XP_010221597.1|  PREDICTED: derlin-2 isoform X2                     139   4e-35    
ref|XP_005649417.1|  Derlin-1                                           140   4e-35    
ref|XP_004638372.1|  PREDICTED: derlin-2                                139   4e-35    
ref|XP_003274617.1|  PREDICTED: derlin-2                                139   4e-35    
gb|EDM05070.1|  rCG34415, isoform CRA_a                                 139   4e-35    
gb|AAL14868.1|AF208064_1  F-LANa                                        139   4e-35    Mus musculus [mouse]
ref|XP_004483566.1|  PREDICTED: derlin-2                                139   4e-35    
ref|NP_291040.1|  derlin-2 isoform a                                    139   5e-35    Mus musculus [mouse]
ref|XP_006994163.1|  PREDICTED: derlin-2                                139   5e-35    
ref|NP_001134187.1|  derlin-2                                           139   5e-35    Salmo salar
emb|CDQ67098.1|  unnamed protein product                                139   5e-35    
dbj|BAC38974.1|  unnamed protein product                                139   5e-35    Mus musculus [mouse]
ref|XP_008251218.1|  PREDICTED: derlin-3 isoform X2                     139   5e-35    
ref|XP_004666948.1|  PREDICTED: derlin-2                                139   5e-35    
ref|XP_008008224.1|  PREDICTED: derlin-2 isoform X7                     139   5e-35    
ref|XP_001504789.1|  PREDICTED: derlin-2                                139   5e-35    Equus caballus [domestic horse]
ref|XP_004946518.1|  PREDICTED: derlin-2 isoform X4                     138   5e-35    
ref|XP_007102875.1|  PREDICTED: derlin-2 isoform X1                     139   6e-35    
gb|EDL12637.1|  Der1-like domain family, member 2, isoform CRA_a        139   6e-35    
emb|CCA13929.1|  Der1like family putative                               140   6e-35    
ref|XP_007189240.1|  PREDICTED: derlin-2-like isoform X1                139   6e-35    
ref|XP_006177088.1|  PREDICTED: derlin-2 isoform X2                     139   6e-35    
ref|NP_057125.2|  derlin-2                                              139   6e-35    Homo sapiens [man]
ref|XP_005647558.1|  DER1-domain-containing protein                     139   6e-35    
ref|XP_003416910.1|  PREDICTED: derlin-2                                139   6e-35    
ref|XP_008571677.1|  PREDICTED: derlin-2 isoform X1                     139   6e-35    
ref|XP_007935704.1|  PREDICTED: derlin-2                                139   6e-35    
ref|XP_004716205.1|  PREDICTED: derlin-2                                139   6e-35    
ref|XP_003466351.1|  PREDICTED: derlin-2                                139   6e-35    
ref|XP_007542973.1|  PREDICTED: derlin-2                                139   7e-35    
ref|NP_001257645.1|  Der1-like domain family, member 3                  139   7e-35    
ref|XP_009841117.1|  hypothetical protein, variant                      139   7e-35    
ref|XP_003996191.1|  PREDICTED: derlin-2                                139   7e-35    
ref|XP_006874998.1|  PREDICTED: derlin-3                                139   7e-35    
ref|XP_005284455.1|  PREDICTED: derlin-2 isoform X1                     139   7e-35    
ref|XP_008285267.1|  PREDICTED: derlin-2-like                           139   7e-35    
ref|XP_010604141.1|  PREDICTED: derlin-2 isoform X1                     139   8e-35    
ref|NP_001290910.1|  derlin 2                                           139   8e-35    
ref|XP_006752394.1|  PREDICTED: LOW QUALITY PROTEIN: derlin 2           139   8e-35    
ref|XP_007421633.1|  PREDICTED: derlin-2                                139   9e-35    
ref|XP_005141430.1|  PREDICTED: derlin-2                                139   9e-35    
ref|XP_511992.3|  PREDICTED: derlin-2 isoform X1                        139   9e-35    Pan troglodytes
ref|XP_010874547.1|  PREDICTED: derlin-3                                139   9e-35    
ref|XP_008323682.1|  PREDICTED: derlin-2                                139   1e-34    
ref|XP_010186109.1|  PREDICTED: derlin-2                                139   1e-34    
ref|XP_010221596.1|  PREDICTED: derlin-2 isoform X1                     139   1e-34    
ref|XP_004946517.1|  PREDICTED: derlin-2 isoform X3                     138   1e-34    
ref|XP_008533841.1|  PREDICTED: derlin-2                                139   1e-34    
emb|CCA13928.1|  Der1like family putative                               140   1e-34    
ref|XP_004594923.1|  PREDICTED: derlin-2                                138   1e-34    
ref|XP_008008218.1|  PREDICTED: derlin-2 isoform X1                     139   1e-34    
ref|XP_002192688.1|  PREDICTED: derlin-2-like                           138   2e-34    Taeniopygia guttata
ref|XP_006640468.1|  PREDICTED: derlin-2-like                           138   2e-34    
ref|XP_008422997.1|  PREDICTED: derlin-2                                139   2e-34    
ref|XP_006640887.1|  PREDICTED: derlin-2-like                           138   2e-34    
ref|XP_005619945.1|  PREDICTED: derlin-2 isoform X2                     139   2e-34    
ref|XP_003965159.1|  PREDICTED: derlin-2-like                           138   2e-34    
ref|XP_006256388.1|  PREDICTED: derlin-3 isoform X9                     137   2e-34    
ref|NP_957197.1|  derlin-3                                              138   2e-34    Danio rerio [leopard danio]
dbj|BAB68409.1|  putative NADH oxidoreductase complex I subunit h...    137   3e-34    Homo sapiens [man]
ref|XP_007906635.1|  PREDICTED: derlin-2                                137   3e-34    
ref|XP_004555769.1|  PREDICTED: derlin-2-like                           137   4e-34    
ref|XP_005730635.1|  PREDICTED: derlin-2-like                           137   4e-34    
ref|XP_003444573.2|  PREDICTED: derlin-2-like isoform X1                137   4e-34    
ref|XP_006797758.1|  PREDICTED: derlin-2-like                           137   4e-34    
ref|XP_009841116.1|  hypothetical protein H257_14897                    137   4e-34    
ref|XP_009045203.1|  hypothetical protein LOTGIDRAFT_224116             137   5e-34    
ref|XP_005949010.1|  PREDICTED: derlin-2-like                           137   5e-34    
ref|XP_009436216.1|  PREDICTED: derlin-3 isoform X10                    136   5e-34    
ref|XP_007189239.1|  PREDICTED: derlin-2-like                           137   5e-34    
ref|XP_005988627.1|  PREDICTED: derlin-2 isoform X1                     137   5e-34    
ref|XP_003078497.1|  Predicted membrane protein (ISS)                   142   5e-34    
ref|XP_005988629.1|  PREDICTED: derlin-2 isoform X3                     136   6e-34    
ref|XP_008477750.1|  PREDICTED: derlin-2                                136   7e-34    
gb|EHJ66704.1|  putative Der1-like domain family, member 2              136   8e-34    
gb|AHG98173.1|  Derlin-2 variant 2                                      135   1e-33    
ref|XP_004075079.1|  PREDICTED: derlin-2-like isoform 1                 135   1e-33    
ref|XP_004887562.1|  PREDICTED: derlin-3 isoform X2                     134   1e-33    
gb|ETO84951.1|  hypothetical protein F444_01201                         135   1e-33    
ref|XP_008890862.1|  hypothetical protein PPTG_01019                    135   1e-33    
ref|XP_006213360.1|  PREDICTED: derlin-3                                135   2e-33    
ref|XP_010396456.1|  PREDICTED: derlin-3 isoform X2                     135   2e-33    
ref|XP_004887561.1|  PREDICTED: derlin-3 isoform X1                     135   2e-33    
ref|XP_006140267.1|  PREDICTED: derlin-3 isoform X1                     135   2e-33    
ref|XP_008416022.1|  PREDICTED: derlin-2-like isoform X1                135   2e-33    
ref|XP_006029210.1|  PREDICTED: derlin-2                                135   3e-33    
emb|CCI49833.1|  unnamed protein product                                134   3e-33    
ref|XP_004075080.1|  PREDICTED: derlin-2-like isoform 2                 134   3e-33    
ref|XP_010953758.1|  PREDICTED: derlin-3                                134   3e-33    
ref|XP_010748961.1|  PREDICTED: derlin-2-like                           134   3e-33    
ref|XP_004932146.1|  PREDICTED: derlin-2-like                           134   3e-33    
ref|NP_001069791.1|  derlin-3                                           134   4e-33    
ref|XP_006514142.1|  PREDICTED: derlin-3 isoform X1                     136   4e-33    
ref|XP_003995031.1|  PREDICTED: derlin-3 isoform X1                     134   4e-33    
tpg|DAA20405.1|  TPA: derlin-3                                          134   4e-33    
ref|XP_009523839.1|  hypothetical protein PHYSODRAFT_490756             134   4e-33    
ref|XP_007091150.1|  PREDICTED: derlin-3                                134   4e-33    
ref|XP_002908459.1|  Der1-like family, putative                         134   5e-33    
ref|XP_004680988.1|  PREDICTED: derlin-3                                133   5e-33    
ref|XP_002503215.1|  derlin-like protein                                135   6e-33    
ref|XP_007547487.1|  PREDICTED: derlin-2-like                           133   6e-33    
ref|XP_002126903.1|  PREDICTED: derlin-2-like                           134   6e-33    
ref|XP_004742552.1|  PREDICTED: derlin-3 isoform X3                     133   7e-33    
ref|XP_010347522.1|  PREDICTED: derlin-3 isoform X3                     134   7e-33    
ref|XP_003938571.1|  PREDICTED: derlin-3 isoform X1                     133   7e-33    
ref|XP_006938805.1|  PREDICTED: derlin-3 isoform X2                     134   8e-33    
ref|XP_004742554.1|  PREDICTED: derlin-3 isoform X5                     132   9e-33    
ref|NP_940842.2|  derlin-3 isoform 3                                    132   9e-33    
ref|XP_006177087.1|  PREDICTED: derlin-2 isoform X1                     133   1e-32    
ref|XP_004592079.1|  PREDICTED: derlin-3                                133   1e-32    
ref|NP_001129223.1|  derlin-3 isoform 1                                 133   1e-32    
ref|XP_004607501.1|  PREDICTED: derlin-3                                132   1e-32    
dbj|BAM18582.1|  conserved hypothetical protein                         132   1e-32    
ref|XP_007451085.1|  PREDICTED: derlin-3                                132   1e-32    
ref|XP_005906151.1|  PREDICTED: derlin-2                                133   1e-32    
ref|XP_002925095.1|  PREDICTED: derlin-3-like                           132   1e-32    
ref|NP_001278077.1|  derlin-2 isoform c                                 132   2e-32    
ref|NP_001002862.1|  derlin-3 isoform 2                                 132   2e-32    
ref|XP_005670961.1|  PREDICTED: derlin-3 isoform X2                     132   2e-32    
ref|XP_008960375.1|  PREDICTED: derlin-3 isoform X10                    132   2e-32    
ref|XP_007189241.1|  PREDICTED: derlin-2-like isoform X2                132   2e-32    
ref|XP_001929449.3|  PREDICTED: derlin-3 isoform X1                     131   2e-32    
ref|XP_006746426.1|  PREDICTED: derlin-3 isoform X1                     132   2e-32    
ref|XP_005256729.1|  PREDICTED: derlin-2 isoform X1                     132   2e-32    
ref|XP_001639604.1|  predicted protein                                  132   2e-32    
ref|XP_008571678.1|  PREDICTED: derlin-2 isoform X2                     132   2e-32    
ref|XP_007196367.1|  PREDICTED: derlin-3                                132   2e-32    
ref|XP_004276089.1|  PREDICTED: derlin-3                                132   3e-32    
ref|XP_001169796.1|  PREDICTED: derlin-3 isoform X8                     132   3e-32    
ref|XP_003804677.1|  PREDICTED: derlin-3 isoform X7                     132   3e-32    
ref|XP_001169907.1|  PREDICTED: derlin-3 isoform X9                     132   3e-32    
ref|XP_006746427.1|  PREDICTED: derlin-3 isoform X2                     131   3e-32    
ref|XP_008064645.1|  PREDICTED: derlin-3                                131   3e-32    
ref|XP_008960351.1|  PREDICTED: derlin-3 isoform X5                     132   3e-32    
emb|CBJ32387.1|  conserved unknown protein                              132   3e-32    
ref|XP_005334527.1|  PREDICTED: derlin-3                                132   3e-32    
gb|EFB19457.1|  hypothetical protein PANDA_014529                       130   3e-32    
ref|XP_003286550.1|  hypothetical protein DICPUDRAFT_31114              130   4e-32    
ref|XP_005875549.1|  PREDICTED: derlin-3 isoform X1                     131   4e-32    
ref|XP_002735994.1|  PREDICTED: derlin-2-like                           132   4e-32    
ref|XP_005803929.1|  PREDICTED: derlin-2-like                           131   4e-32    
ref|XP_008008219.1|  PREDICTED: derlin-2 isoform X2                     132   4e-32    
ref|XP_003803337.1|  PREDICTED: derlin-3                                131   4e-32    
ref|XP_007513824.1|  Derlin-2                                           133   5e-32    
ref|XP_003281777.1|  PREDICTED: derlin-3                                131   5e-32    
emb|CDS03800.1|  hypothetical protein LRAMOSA06755                      131   6e-32    
gb|KFM25473.1|  Derlin-2.1                                              130   7e-32    
gb|ELR48855.1|  Derlin-2                                                131   7e-32    
gb|EDM05071.1|  rCG34415, isoform CRA_b                                 131   7e-32    
emb|CDH49316.1|  der1like family                                        131   9e-32    
ref|XP_004901333.1|  PREDICTED: derlin-2                                130   1e-31    
gb|EFX85354.1|  hypothetical protein DAPPUDRAFT_300294                  130   1e-31    
ref|XP_003630695.1|  Derlin-1                                           127   1e-31    
ref|XP_005451548.1|  PREDICTED: derlin-2-like isoform X2                130   1e-31    
ref|XP_004817165.1|  PREDICTED: derlin-3 isoform X1                     132   2e-31    
gb|KDR23092.1|  Derlin-2                                                130   2e-31    
gb|KDD73838.1|  Der1-like family protein                                130   2e-31    
ref|XP_010003149.1|  PREDICTED: derlin-3                                130   2e-31    
ref|XP_008251219.1|  PREDICTED: derlin-3 isoform X3                     129   2e-31    
ref|XP_010602234.1|  PREDICTED: derlin-3 isoform X4                     128   2e-31    
ref|XP_005007295.1|  PREDICTED: derlin-3 isoform X2                     128   2e-31    
ref|XP_971047.1|  PREDICTED: derlin-2                                   129   3e-31    
gb|KFW86369.1|  Derlin-2                                                129   3e-31    
ref|XP_008566792.1|  PREDICTED: derlin-3                                129   3e-31    
ref|XP_008927846.1|  PREDICTED: derlin-2-like                           129   3e-31    
ref|XP_010602232.1|  PREDICTED: derlin-3 isoform X2                     129   4e-31    
ref|XP_008140873.1|  PREDICTED: derlin-3                                129   4e-31    
ref|XP_005851277.1|  hypothetical protein CHLNCDRAFT_19312              129   4e-31    
ref|XP_004063203.1|  PREDICTED: derlin-3 isoform 1                      129   4e-31    
ref|XP_009839412.1|  hypothetical protein H257_13556                    129   4e-31    
gb|ELU04051.1|  hypothetical protein CAPTEDRAFT_159615                  129   4e-31    
ref|XP_003478002.1|  PREDICTED: derlin-3 isoform X1                     129   4e-31    
ref|XP_004063204.1|  PREDICTED: derlin-3 isoform 2                      129   4e-31    
ref|XP_397412.2|  PREDICTED: derlin-2-like                              129   4e-31    
ref|XP_003401638.1|  PREDICTED: derlin-2-like                           129   5e-31    
gb|ETE64508.1|  Derlin-2                                                129   5e-31    
gb|EFA77668.1|  derlin-2                                                129   5e-31    
ref|XP_001421000.1|  predicted protein                                  129   5e-31    
ref|XP_002165412.2|  PREDICTED: derlin-2-like                           127   6e-31    
ref|XP_001374300.2|  PREDICTED: derlin-3 isoform X1                     128   6e-31    
ref|XP_004400584.1|  PREDICTED: derlin-3 isoform 1                      128   7e-31    
ref|XP_008838841.1|  PREDICTED: derlin-3 isoform X2                     127   7e-31    
ref|XP_008548806.1|  PREDICTED: derlin-2                                128   7e-31    
ref|XP_005445374.1|  PREDICTED: derlin-2-like                           128   7e-31    
ref|XP_001951584.1|  PREDICTED: derlin-2                                128   8e-31    
ref|XP_009497742.1|  hypothetical protein H696_05649                    127   9e-31    
ref|XP_003701146.1|  PREDICTED: derlin-2-like                           128   9e-31    
ref|XP_008838839.1|  PREDICTED: derlin-3 isoform X1                     127   9e-31    
ref|XP_002830970.1|  PREDICTED: derlin-3                                128   1e-30    
ref|XP_004742550.1|  PREDICTED: derlin-3 isoform X1                     127   1e-30    
gb|EXX54153.1|  hypothetical protein RirG_237220                        128   1e-30    
ref|XP_004319712.1|  PREDICTED: LOW QUALITY PROTEIN: derlin-2           127   1e-30    
ref|XP_002167929.1|  PREDICTED: derlin-2-like                           127   1e-30    
ref|XP_003061234.1|  predicted protein                                  126   1e-30    
ref|XP_005218307.1|  PREDICTED: derlin-3 isoform X1                     127   1e-30    
ref|XP_007956963.1|  PREDICTED: derlin-3                                127   2e-30    
emb|CEI89232.1|  hypothetical protein RMCBS344292_03598                 126   2e-30    
gb|KFP07092.1|  Derlin-2                                                126   2e-30    
ref|XP_002434732.1|  membrane protein, putative                         126   2e-30    
ref|XP_005261881.1|  PREDICTED: derlin-3 isoform X5                     127   2e-30    
ref|XP_004817166.1|  PREDICTED: derlin-3 isoform X2                     126   2e-30    
ref|XP_004443161.1|  PREDICTED: derlin-3-like                           126   2e-30    
ref|XP_005396473.1|  PREDICTED: derlin-3 isoform X1                     126   4e-30    
ref|XP_009039935.1|  hypothetical protein AURANDRAFT_5820               124   4e-30    
ref|XP_007973295.1|  PREDICTED: derlin-3 isoform X4                     126   4e-30    
ref|XP_005670962.1|  PREDICTED: derlin-3 isoform X3                     125   4e-30    
gb|EZA48102.1|  Derlin-2                                                126   4e-30    
ref|XP_002137754.1|  GA26359                                            126   5e-30    
gb|EPB88351.1|  hypothetical protein HMPREF1544_04817                   128   5e-30    
ref|XP_001417109.1|  predicted protein                                  125   5e-30    
ref|XP_007536496.1|  PREDICTED: derlin-3                                125   5e-30    
ref|XP_006019960.1|  PREDICTED: derlin-2-like                           125   5e-30    
ref|XP_010143781.1|  PREDICTED: LOW QUALITY PROTEIN: derlin-3           124   7e-30    
ref|XP_008695827.1|  PREDICTED: derlin-3                                124   7e-30    
ref|XP_010538802.1|  PREDICTED: derlin-2.2                              125   8e-30    
emb|CCA16495.1|  Der1like family putative                               125   8e-30    
ref|XP_002291637.1|  hypothetical protein THAPSDRAFT_6534               124   8e-30    
ref|XP_009891535.1|  PREDICTED: derlin-3                                125   8e-30    
ref|XP_006903080.1|  PREDICTED: derlin-3                                125   9e-30    
ref|XP_005187306.1|  PREDICTED: derlin-2-like                           125   9e-30    
gb|EFN85654.1|  Derlin-2                                                125   9e-30    
ref|XP_004386216.1|  PREDICTED: derlin-3                                125   9e-30    
ref|XP_005107863.1|  PREDICTED: derlin-2-like                           125   1e-29    
ref|XP_009908595.1|  PREDICTED: derlin-3                                125   1e-29    
ref|XP_004636369.1|  PREDICTED: derlin-3                                124   1e-29    
ref|XP_001998676.1|  GI23500                                            125   2e-29    
ref|XP_002968796.1|  hypothetical protein SELMODRAFT_146006             124   2e-29    
ref|XP_001764435.1|  predicted protein                                  124   2e-29    
gb|EFZ23157.1|  hypothetical protein SINV_03823                         124   2e-29    
ref|XP_002953487.1|  hypothetical protein VOLCADRAFT_82188              124   2e-29    
ref|XP_004716399.1|  PREDICTED: derlin-3                                123   2e-29    
ref|XP_003093984.1|  hypothetical protein CRE_16357                     124   2e-29    
gb|AAX33654.1|  Dbuz\CG14899-PA                                         124   2e-29    
ref|XP_011065420.1|  PREDICTED: derlin-2                                124   2e-29    
ref|XP_002041205.1|  GM15426                                            124   3e-29    
ref|XP_006858130.1|  hypothetical protein AMTR_s00062p00115640          124   3e-29    
ref|NP_650553.1|  Derlin-2                                              124   3e-29    
ref|XP_002097594.1|  GE26308                                            124   3e-29    
ref|XP_007973299.1|  PREDICTED: derlin-3 isoform X8                     123   3e-29    
gb|ERZ99882.1|  hypothetical protein GLOINDRAFT_328996                  124   4e-29    
ref|NP_498590.4|  Protein R151.6                                        123   4e-29    
ref|XP_002596717.1|  hypothetical protein BRAFLDRAFT_280199             124   4e-29    
ref|XP_009278298.1|  PREDICTED: derlin-2-like                           124   4e-29    
gb|ABM55620.1|  putative Der1-like domain family, member 2              123   4e-29    
ref|XP_009582255.1|  PREDICTED: derlin-3                                122   5e-29    
gb|KFU95021.1|  Derlin-2                                                122   5e-29    
ref|XP_009481960.1|  PREDICTED: derlin-2-like                           122   5e-29    
ref|XP_001954903.1|  GF16510                                            123   5e-29    
ref|XP_002056389.1|  GJ10254                                            123   5e-29    
ref|XP_001990339.1|  GH19287                                            123   6e-29    
ref|XP_005775262.1|  hypothetical protein EMIHUDRAFT_420318             122   6e-29    
ref|XP_008944464.1|  PREDICTED: derlin-2-like                           122   6e-29    
ref|XP_010185889.1|  PREDICTED: derlin-2-like                           122   6e-29    
ref|XP_008630353.1|  PREDICTED: derlin-3                                124   6e-29    
ref|XP_001777782.1|  predicted protein                                  122   6e-29    
gb|KFO04959.1|  Derlin-2                                                122   6e-29    
ref|XP_007063828.1|  PREDICTED: derlin-2-like                           122   7e-29    
gb|KFO57923.1|  Derlin-2                                                122   7e-29    
ref|XP_005503985.1|  PREDICTED: derlin-2-like                           122   7e-29    
gb|KFW10449.1|  Derlin-2                                                122   7e-29    
gb|EMC88602.1|  Derlin-2                                                122   7e-29    
ref|XP_010301005.1|  PREDICTED: derlin-2-like                           122   8e-29    
gb|KGL79179.1|  Derlin-2                                                121   8e-29    
ref|XP_010538704.1|  PREDICTED: derlin-2.2-like                         122   8e-29    
emb|CDW57893.1|  PrmA and DER1 domain containing protein                129   8e-29    
ref|XP_010057939.1|  PREDICTED: derlin-2.2 isoform X1                   122   9e-29    
ref|XP_009819880.1|  PREDICTED: derlin-3                                121   9e-29    
ref|XP_004232723.1|  PREDICTED: derlin-2.2                              122   9e-29    
ref|XP_010152025.1|  PREDICTED: derlin-2-like                           121   9e-29    
gb|KFV11296.1|  Derlin-2                                                121   9e-29    
gb|KFM07989.1|  Derlin-2                                                121   9e-29    
gb|KFV87729.1|  Derlin-2                                                121   9e-29    
ref|XP_009978284.1|  PREDICTED: derlin-3                                121   1e-28    
gb|KFP12708.1|  Derlin-2                                                121   1e-28    
gb|KFV48739.1|  Derlin-2                                                121   1e-28    
gb|KFP81700.1|  Derlin-2                                                121   1e-28    
gb|KFW85708.1|  Derlin-2                                                121   1e-28    
ref|XP_010602233.1|  PREDICTED: derlin-3 isoform X3                     122   1e-28    
ref|XP_002103170.1|  GD20283                                            124   1e-28    
ref|XP_010007554.1|  PREDICTED: derlin-2-like                           121   1e-28    
ref|XP_010197512.1|  PREDICTED: derlin-2-like                           121   1e-28    
gb|KGL99839.1|  Derlin-2                                                121   1e-28    
ref|XP_010073907.1|  PREDICTED: derlin-3                                121   1e-28    
ref|XP_010215721.1|  PREDICTED: derlin-2-like                           122   1e-28    
ref|XP_010276046.1|  PREDICTED: derlin-2.2                              122   1e-28    
ref|XP_786599.1|  PREDICTED: derlin-2-like                              122   1e-28    
ref|XP_002070095.1|  GK11211                                            122   1e-28    
gb|KFV62769.1|  Derlin-2                                                121   1e-28    
gb|KFU98311.1|  Derlin-2                                                121   1e-28    
gb|KFQ41674.1|  Derlin-2                                                121   1e-28    
ref|XP_009090784.1|  PREDICTED: derlin-2-like                           123   1e-28    
ref|XP_009602630.1|  PREDICTED: derlin-2.2                              122   1e-28    
ref|XP_009928875.1|  PREDICTED: derlin-3                                120   1e-28    
ref|XP_009685800.1|  PREDICTED: derlin-3                                122   1e-28    
ref|XP_008771140.1|  PREDICTED: derlin-3 isoform X3                     124   1e-28    
gb|KFR09629.1|  Derlin-2                                                121   1e-28    
ref|XP_010573802.1|  PREDICTED: derlin-3 isoform X2                     121   1e-28    
ref|XP_009402130.1|  PREDICTED: derlin-2.2                              122   2e-28    
ref|XP_009762340.1|  PREDICTED: derlin-2.2                              122   2e-28    
ref|XP_005055273.1|  PREDICTED: derlin-2-like                           123   2e-28    
gb|KFP98218.1|  Derlin-2                                                120   2e-28    
ref|XP_009074588.1|  PREDICTED: derlin-3                                120   2e-28    
gb|KFP48376.1|  Derlin-2                                                120   2e-28    
ref|XP_001980197.1|  GG19906                                            122   2e-28    
ref|XP_002518504.1|  Derlin-2, putative                                 121   2e-28    
ref|XP_004359157.1|  derlin-2                                           125   2e-28    
emb|CDJ82372.1|  Der1 domain containing protein                         121   2e-28    
ref|XP_007506079.1|  PREDICTED: derlin-3 isoform X2                     120   2e-28    



>ref|XP_002534670.1| Derlin-2, putative [Ricinus communis]
 gb|EEF27712.1| Derlin-2, putative [Ricinus communis]
Length=277

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYYNSLPPV+KTY V C MT AAY L LYDVWNIALFY DV +RFQ+WRL++NFF
Sbjct  1     MSTPAEYYNSLPPVSKTYGVACLMTTAAYYLGLYDVWNIALFYEDVIKRFQIWRLISNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II RYGV LERG FDKRTAD+VWMF FGA+ LL M+  P LWSPFM
Sbjct  61    FLGPFSFPFAFRLIIIARYGVSLERGTFDKRTADFVWMFFFGALSLLAMAAIPMLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIW REFPN RIN+YGLV  KGFYLPW ML +D+I GNPLKPD+LG+ AGH
Sbjct  121   GVSLVFMIVYIWSREFPNARINIYGLVSLKGFYLPWAMLALDLIFGNPLKPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             IYYFLTVLHPL+ GK    TP WVHKLVA+WGKG Q+NSP + DPSAG AF
Sbjct  181   IYYFLTVLHPLSGGKFVLKTPFWVHKLVAFWGKGTQINSPVQRDPSAGVAF  231



>ref|XP_002266374.1| PREDICTED: derlin-1.1-like [Vitis vinifera]
Length=276

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C +T  AY L+LY  WNIAL Y  VF+RFQVWRLVTNFF
Sbjct  1     MSTPAEYYRSLPPVSKVYGVACLLTTTAYYLQLYHPWNIALSYELVFKRFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS +FA RLLII RYGV LERGPFDKRTADYVWM + GA+ LLVM++ P+LWS FM
Sbjct  61    FLGPFSLSFALRLLIIARYGVSLERGPFDKRTADYVWMLISGALSLLVMAVVPYLWSWFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             GASLVFMIVY+WGREFPN +IN YGLV FKGFYLPW  L +D++LGNPLKPD+LG+ AGH
Sbjct  121   GASLVFMIVYVWGREFPNAQINFYGLVSFKGFYLPWIYLTVDLLLGNPLKPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GKN   TP WVHKLVA+WGKG QVNSP + DP+AG AF
Sbjct  181   LYYFLTVLHPLAGGKNILKTPLWVHKLVAFWGKGTQVNSPVQQDPNAGVAF  231



>gb|KDP22457.1| hypothetical protein JCGZ_26288 [Jatropha curcas]
Length=276

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY+SLPPV+K Y V C MT +AY L LY++ NIALFY DV +RFQVWRL+TNFF
Sbjct  1     MSTPAEYYHSLPPVSKAYGVACLMTTSAYYLGLYNLGNIALFYEDVIKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II +YGV LERGPFDKR+AD+VWMFLFGA+ LLVM+  P LWSPFM
Sbjct  61    FLGPFSFPFAFRLIIIAKYGVSLERGPFDKRSADFVWMFLFGALSLLVMAAIPLLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMI+YIWGREFPN RIN+YG+V  KGFYLPW ML +D+I GNPLKPD+LG+ AGH
Sbjct  121   GVSLVFMIIYIWGREFPNARINLYGVVSLKGFYLPWAMLALDLIFGNPLKPDILGMIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK    TP WVHKLVA+WG+G QVN+P +SDP AG AF
Sbjct  181   LYYFLTVLHPLSGGKYILKTPFWVHKLVAFWGEGTQVNAPVQSDPYAGVAF  231



>ref|XP_011028466.1| PREDICTED: derlin-1-like [Populus euphratica]
Length=276

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V C MT AAY L LY   +IAL+Y DV +RFQVWRL+TNFF
Sbjct  1     MSTPGEYYRSLPPVSKTYGVACLMTTAAYYLGLYQASSIALYYDDVIKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II RYGVQLERGPFDKRTAD+VWMF FGA+ LLVM+  PFLWS FM
Sbjct  61    FLGPFSFPFAFRLIIIARYGVQLERGPFDKRTADFVWMFFFGALSLLVMAAVPFLWSGFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN ++++YGLV  KGFYLPW ML +D+I GNPL PD+LG+ AGH
Sbjct  121   GVSLVFMIVYIWGREFPNAQVSIYGLVSLKGFYLPWAMLALDLIFGNPLMPDILGMLAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK  F TP WVHKLVA+WG+G QVN+P + DPSAGTAF
Sbjct  181   LYYFLTVLHPLSGGKFIFKTPFWVHKLVAFWGEGTQVNAPVQRDPSAGTAF  231



>gb|KEH32845.1| derlin-2 protein [Medicago truncatula]
Length=280

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EY+ SLPPV+KT+ V CFMT AAY L LYD  +IALFY  VF+R QVWRL+TNFF
Sbjct  1     MSTPAEYFWSLPPVSKTFGVACFMTTAAYYLNLYDAESIALFYGLVFKRLQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FA RL++I +YGV LERGPFDKRTAD+VWM +FGA+ LLVM++ P+LWSPFM
Sbjct  61    FLGPFSFPFAVRLIMIAKYGVSLERGPFDKRTADFVWMLIFGALSLLVMAVVPYLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVY+W REFP+ RIN+YGLV  KGFYLPW MLG+D+I GNPLKPD+LG+ AGH
Sbjct  121   GISLVFMIVYVWSREFPDARINIYGLVSLKGFYLPWAMLGLDLIFGNPLKPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK  FNTP  VHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  181   LYYFLTVLHPLAGGKFKFNTPLLVHKIVAYWGEGTQINAPVQSNPSAGIIF  231



>ref|XP_006385123.1| hypothetical protein POPTR_0004s24140g [Populus trichocarpa]
 gb|ERP62920.1| hypothetical protein POPTR_0004s24140g [Populus trichocarpa]
Length=276

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C MT AAY L LY   +IAL+Y DV +RFQVWRL+TNFF
Sbjct  1     MSTPGEYYRSLPPVSKAYGVACLMTTAAYYLGLYQASSIALYYDDVIKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II RYGVQLERGPFDKRTAD+VWMF FGA+ LLVM+  PFLWS FM
Sbjct  61    FLGPFSFPFAFRLIIIARYGVQLERGPFDKRTADFVWMFFFGALSLLVMAAVPFLWSGFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN ++++YGLV  KGFYLPW ML +D+I G+PL PD+LG+ AGH
Sbjct  121   GVSLVFMIVYIWGREFPNAQVSIYGLVSLKGFYLPWAMLALDLIFGDPLMPDILGMLAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK  F TP WVHKLVA+WG+G QVN+P + DPSAGTAF
Sbjct  181   LYYFLTVLHPLSGGKFIFKTPIWVHKLVAFWGEGTQVNAPVQRDPSAGTAF  231



>ref|XP_006385124.1| hypothetical protein POPTR_0004s24145g [Populus trichocarpa]
 gb|ERP62921.1| hypothetical protein POPTR_0004s24145g [Populus trichocarpa]
Length=276

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C MT AAY L LY   +IAL+Y DV +RFQVWRL+TNFF
Sbjct  1     MSTPGEYYRSLPPVSKAYGVACLMTTAAYYLGLYQASSIALYYDDVIKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II RYGVQLERGPFDKRTAD+VWMF FGA+ LLVM+  PFLWS FM
Sbjct  61    FLGPFSFPFAFRLIIIARYGVQLERGPFDKRTADFVWMFFFGALSLLVMAAVPFLWSGFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VYIWGREFPN ++++YGLV  KGFYLPW ML +D+I G+PL PD+LG+ AGH
Sbjct  121   GVSLVFMLVYIWGREFPNAQVSIYGLVSLKGFYLPWAMLALDLIFGDPLMPDILGMLAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK  F TP WVHKLVA+WG+G QVN+P + DPSAGTAF
Sbjct  181   LYYFLTVLHPLSGGKFIFKTPIWVHKLVAFWGEGTQVNAPVQRDPSAGTAF  231



>emb|CAN79229.1| hypothetical protein VITISV_027074 [Vitis vinifera]
Length=281

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
              YY SLPPV+K Y V C +T  AY L+LY  WNIAL Y  VF+RFQVWRLVTNFFF+G F
Sbjct  11    RYYRSLPPVSKVYGVACLLTTTAYYLQLYHPWNIALSYELVFKRFQVWRLVTNFFFLGPF  70

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
             S +FA RLLII RYGV LERGPFDKRTADYVWM + GA+ LLVM++ P+LWS FMGASLV
Sbjct  71    SLSFALRLLIIARYGVSLERGPFDKRTADYVWMLISGALSLLVMAVVPYLWSXFMGASLV  130

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
             FMIVY+WGREFPN +IN YGLV FKGFYLPW  L +D++LGNPLKPD+LG+ AGH+YYFL
Sbjct  131   FMIVYVWGREFPNAQINFYGLVSFKGFYLPWIYLTVDLLLGNPLKPDILGMVAGHLYYFL  190

Query  486   TVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             TVLHPLA GKN   TP WVHKLVA+WGKG QVNSP + DP+AG AF
Sbjct  191   TVLHPLAGGKNILKTPLWVHKLVAFWGKGTQVNSPVQQDPNAGVAF  236



>ref|XP_008234433.1| PREDICTED: derlin-1.1-like [Prunus mume]
Length=276

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V CFMTAAA  L+LY+ WNIAL Y  V +RFQVWRL+T+FF
Sbjct  1     MSTPAEYYRSLPPVSKTYGVACFMTAAALYLQLYNPWNIALDYGLVIKRFQVWRLITSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II RYGV LERGPFDKRTADYVWM +FGAI LLVM++ P+L SPFM
Sbjct  61    FLGPFSFPFAFRLIIIARYGVGLERGPFDKRTADYVWMLVFGAISLLVMAVVPYLLSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G S+VFMIVY+W REFPN RIN+YGLV  KGFYLPW +LG+D+I G+PLKPD+LG+ AGH
Sbjct  121   GPSVVFMIVYVWSREFPNARINIYGLVSLKGFYLPWALLGLDLIFGDPLKPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK    TP WVHKLV++WG+G Q+NSP   +P AG AF
Sbjct  181   LYYFLTVLHPLAGGKLMLKTPLWVHKLVSFWGEGTQINSPVERNPHAGVAF  231



>ref|XP_010062513.1| PREDICTED: derlin-1.2-like [Eucalyptus grandis]
Length=281

 Score =   325 bits (833),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP +YY SLPPV+KTY V C MT AA  L LY+ W IAL Y  VF+RFQVWRL+TNFF
Sbjct  1     MSTPGDYYRSLPPVSKTYGVACLMTTAALYLGLYNHWTIALEYELVFKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II +YGV LERGPFDKRTADYVWMF+FGA+ LLVM+  P L+ PFM
Sbjct  61    FLGPFSFPFAFRLIIIAKYGVSLERGPFDKRTADYVWMFIFGALSLLVMAAIPPLYIPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN RI++YG+V  KGFYLPW +L +++I GNPL PD+LG+ AGH
Sbjct  121   GPSLVFMIVYIWGREFPNARISIYGVVSLKGFYLPWALLALNLIFGNPLMPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA G+N   TPRWVHK+VAYWG+GFQVN+P  SDPSAG AF
Sbjct  181   LYYFLTVLHPLAGGRNLLKTPRWVHKVVAYWGEGFQVNAPVPSDPSAGIAF  231



>ref|XP_010042305.1| PREDICTED: derlin-1.2-like [Eucalyptus grandis]
Length=281

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V C MT AA  L LY+ W IAL Y  VF+RFQVWRL+TNFF
Sbjct  1     MSTPGEYYRSLPPVSKTYGVACLMTTAALYLGLYNHWTIALEYELVFKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF+FAFRL+II +YGV LERGPFDKRTADYVWMF+FGA+ LLVM+  P L+  FM
Sbjct  61    FLGPFSFSFAFRLIIIAKYGVSLERGPFDKRTADYVWMFIFGALSLLVMAAIPPLYIRFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN RI++YG+V  KGFYLPW +L +++I GNPL PD+LG+ AGH
Sbjct  121   GPSLVFMIVYIWGREFPNARISIYGVVSLKGFYLPWALLALNLIFGNPLMPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA G+N   TPRWVHK+VAYWG+GFQVN+P  SDPSAG AF
Sbjct  181   LYYFLTVLHPLAGGRNLLKTPRWVHKVVAYWGEGFQVNAPVPSDPSAGIAF  231



>ref|XP_010042306.1| PREDICTED: derlin-1.2-like [Eucalyptus grandis]
Length=281

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V C MT AA  L LY  W IAL Y  VF+RFQVWRL+TNFF
Sbjct  1     MSTPGEYYRSLPPVSKTYGVACLMTTAALYLGLYKRWTIALEYELVFKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF+FAFRL+II +YGV LERGPFDKRTADYVWMF+FGA+ LLVM+  P L+  FM
Sbjct  61    FLGPFSFSFAFRLIIIAKYGVSLERGPFDKRTADYVWMFIFGALSLLVMAAIPPLYIRFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN RI++YG+V  KGFYLPW +L +++I GNPL PD+LG+ AGH
Sbjct  121   GPSLVFMIVYIWGREFPNARISIYGVVSLKGFYLPWALLALNLIFGNPLMPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA G+N   TPRWVHK+VAYWG+GFQVN+P  SDPSAG AF
Sbjct  181   LYYFLTVLHPLAGGRNLLKTPRWVHKVVAYWGEGFQVNAPVPSDPSAGIAF  231



>ref|XP_003527555.1| PREDICTED: derlin-1-like [Glycine max]
Length=281

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V C MT +AY L+LYD  NIAL Y  VF+  QVWRL+TNFF
Sbjct  1     MSTPAEYYRSLPPVSKTYGVACLMTTSAYYLQLYDARNIALDYGPVFKSLQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G+FS  FA RL++I +YGV LERGPFDKRTADYVWMF+FGA  LLV++  PF W PFM
Sbjct  61    FLGSFSLPFAVRLIMIAKYGVSLERGPFDKRTADYVWMFIFGAFSLLVIAAVPFFWYPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVY+W REFPN RIN+YG+V  KGFYLPW +L +D+I GNP+KPD++G+ AGH
Sbjct  121   GISLVFMIVYVWSREFPNARINIYGVVSLKGFYLPWALLALDLIFGNPIKPDIVGMIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK  F TP WVHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  181   LYYFLTVLHPLAGGKFKFKTPLWVHKIVAYWGEGTQINAPVQSNPSAGIVF  231



>gb|KHN32503.1| Derlin-1 [Glycine soja]
Length=281

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C MT AA+ L+ YD WNIAL Y  VF+R QVWRL+TNFF
Sbjct  1     MSTPAEYYRSLPPVSKAYGVACLMTTAAFYLQFYDAWNIALDYGSVFKRLQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FA RL+II +YGV LERGPFD RTADYVWMF+FGA+ LLV++  PF W PFM
Sbjct  61    FLGPFSFPFAIRLIIIAKYGVSLERGPFDNRTADYVWMFIFGALSLLVIAAVPFFWYPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVY+W REFPN RIN+YG+V  KGFYLPW +L +D+I G+P+KPD++G+ AGH
Sbjct  121   GISLVFMIVYVWSREFPNARINIYGVVSLKGFYLPWALLALDLIFGDPIKPDIVGMIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK  F TP WVHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  181   LYYFLTVLHPLAGGKFRFKTPLWVHKIVAYWGEGTQINAPVQSNPSAGIVF  231



>emb|CBI38648.3| unnamed protein product [Vitis vinifera]
Length=327

 Score =   324 bits (830),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -1

Query  1023  YYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafs  844
             YY SLPPV+K Y V C +T  AY L+LY  WNIAL Y  VF+RFQVWRLVTNFFF+G FS
Sbjct  58    YYRSLPPVSKVYGVACLLTTTAYYLQLYHPWNIALSYELVFKRFQVWRLVTNFFFLGPFS  117

Query  843   ftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVF  664
              +FA RLLII RYGV LERGPFDKRTADYVWM + GA+ LLVM++ P+LWS FMGASLVF
Sbjct  118   LSFALRLLIIARYGVSLERGPFDKRTADYVWMLISGALSLLVMAVVPYLWSWFMGASLVF  177

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             MIVY+WGREFPN +IN YGLV FKGFYLPW  L +D++LGNPLKPD+LG+ AGH+YYFLT
Sbjct  178   MIVYVWGREFPNAQINFYGLVSFKGFYLPWIYLTVDLLLGNPLKPDILGMVAGHLYYFLT  237

Query  483   VLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             VLHPLA GKN   TP WVHKLVA+WGKG QVNSP + DP+AG AF
Sbjct  238   VLHPLAGGKNILKTPLWVHKLVAFWGKGTQVNSPVQQDPNAGVAF  282



>ref|XP_003522846.1| PREDICTED: derlin-1-like isoform X1 [Glycine max]
Length=281

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C MT AA+ L+ YD WNIAL Y  VF+R QVWRL+TNFF
Sbjct  1     MSTPAEYYRSLPPVSKAYGVACLMTTAAFYLQFYDAWNIALDYGSVFKRLQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FA RL+II +YGV LERGPFD RTADYVWMF+FGA+ LLV++  PF W PFM
Sbjct  61    FLGPFSFPFAIRLIIIAKYGVSLERGPFDNRTADYVWMFIFGALSLLVIAAVPFFWYPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN RIN+YG+V  KGFYLPW +L +D+I G+P+KPD++G+ AGH
Sbjct  121   GISLVFMLVYVWSREFPNARINIYGVVSLKGFYLPWALLALDLIFGDPIKPDIVGMIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK  F TP WVHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  181   LYYFLTVLHPLAGGKFRFKTPLWVHKIVAYWGEGTQINAPVQSNPSAGIVF  231



>ref|XP_007148719.1| hypothetical protein PHAVU_005G008800g [Phaseolus vulgaris]
 gb|ESW20713.1| hypothetical protein PHAVU_005G008800g [Phaseolus vulgaris]
Length=279

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C MT +AY LE YD WNIAL Y  VF+R QVWRL+TNFF
Sbjct  1     MSTPAEYYRSLPPVSKFYGVACLMTTSAYYLEFYDAWNIALDYGLVFKRLQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G+FSF FA RL++I +YGV LERGPFDKRTADYVWMF+FGA+ LLV+S  P+   PFM
Sbjct  61    FLGSFSFPFAMRLIMIAKYGVSLERGPFDKRTADYVWMFVFGALSLLVISAVPYFRYPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVY+W REFPN RIN+YG+V  KGFYLPW +L +D+I GNPLKPD++G+ AGH
Sbjct  121   GVSLVFMIVYVWSREFPNARINIYGVVSLKGFYLPWALLALDLIFGNPLKPDIVGMLAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             IYYFLTVLHPLA G+  F TP WV K+VAYWG+G Q+NSP +SDPSAG  F
Sbjct  181   IYYFLTVLHPLAGGRFKFKTPLWVQKIVAYWGEGTQINSPVQSDPSAGIVF  231



>ref|XP_007218677.1| hypothetical protein PRUPE_ppa014581mg [Prunus persica]
 gb|EMJ19876.1| hypothetical protein PRUPE_ppa014581mg [Prunus persica]
Length=276

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             M+TP EYY SLPPV+KTY V CFMTAAA  L+LY+  NI L Y  V +RFQVWRL+T+FF
Sbjct  1     MATPAEYYRSLPPVSKTYGVACFMTAAALYLQLYNPSNIELDYGLVIKRFQVWRLITSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II RYGV LERGPFDKRTADYVWM +FGAI LLVM++ P+L+SPFM
Sbjct  61    FLGPFSFPFAFRLIIIARYGVGLERGPFDKRTADYVWMLVFGAISLLVMAVVPYLFSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G S+VFMIVY+W REFPN RIN+YGLV  KGFYLPW  LG+D+I G+PLKPD+LG+ AGH
Sbjct  121   GPSVVFMIVYVWSREFPNARINIYGLVSLKGFYLPWAFLGLDLIFGDPLKPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK    TP WVHKLV++WG+G Q+NSP   +P AG AF
Sbjct  181   LYYFLTVLHPLAGGKLMLKTPLWVHKLVSFWGEGTQINSPVERNPHAGVAF  231



>ref|XP_008453882.1| PREDICTED: derlin-1.1-like isoform X1 [Cucumis melo]
Length=286

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 192/232 (83%), Gaps = 1/232 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP+EYY+SLPPV+K Y V C MT AAY L+LY + +IAL YS V ++FQ+WRL+TNFF
Sbjct  1     MSTPLEYYHSLPPVSKLYGVSCLMTTAAYYLQLYHLESIALDYSLVIKKFQLWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II +YGV LERGPFDKRTADYVWM LFGA+ LLVM++ P+ W+PFM
Sbjct  61    FLGPFSFPFAFRLIIIAKYGVSLERGPFDKRTADYVWMLLFGALSLLVMAVVPYFWTPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN RIN+YG+V  KGFYLPW ML +D+I G+ L PD+LG+ AGH
Sbjct  121   GRSLVFMIVYIWGREFPNARINIYGVVSLKGFYLPWAMLALDLIFGHRLMPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKL-VAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK    TP W+HKL VAYWG+G Q NSP + DPSAGTAF
Sbjct  181   LYYFLTVLHPLAGGKFILKTPFWIHKLVVAYWGEGIQFNSPVQRDPSAGTAF  232



>ref|XP_007038301.1| DERLIN-1 isoform 1 [Theobroma cacao]
 gb|EOY22802.1| DERLIN-1 isoform 1 [Theobroma cacao]
Length=282

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 183/231 (79%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP +YY SLPPV+K Y V C MT +A  L LYD WNIAL Y DVF+RFQVWRL+ NFF
Sbjct  1     MSTPAQYYESLPPVSKFYGVACLMTTSALYLGLYDPWNIALSYEDVFKRFQVWRLIINFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
              +G FS +FA  L++I RYGV LE+GPFDKRTADYVWM +FGA+ LLVM   PFLW+PFM
Sbjct  61    LLGPFSPSFAIHLIMIARYGVLLEKGPFDKRTADYVWMLIFGALSLLVMGAIPFLWTPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               SLVFMIVY+W REFPN +I++YG+V  KGFYLPW  L +D+I G+ L PD++G+ AGH
Sbjct  121   AGSLVFMIVYVWSREFPNAQISIYGIVTLKGFYLPWAFLALDLIFGSRLMPDIIGMIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK  F TP WVHKLVAYWGKG QVNSP + DPSAG AF
Sbjct  181   LYYFLTVLHPLAGGKYVFKTPLWVHKLVAYWGKGIQVNSPVQRDPSAGVAF  231



>ref|XP_004499635.1| PREDICTED: derlin-1-like [Cicer arietinum]
Length=265

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+K Y V C MT+AAY L LY+  NIALFY  VF+R QVWRL+TNFF
Sbjct  1     MSTPAEYYRSLPPVSKIYGVTCLMTSAAYYLNLYNEENIALFYGLVFKRLQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL++I RYGV LERG FDKRTADY WM +FGA+ LLVM++ P+LWSPFM
Sbjct  61    FLGPFSFPFAFRLIMIARYGVSLERGTFDKRTADYAWMLIFGALSLLVMAVVPYLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVY+W REFPN  IN+YGLV  KGFYLPW  L +D+I GNPLKPD+LG+ AGH
Sbjct  121   GISLVFMIVYVWSREFPNALINIYGLVSLKGFYLPWAFLALDLIFGNPLKPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK   +TP  VHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  181   LYYFLTVLHPLAGGKFKLSTPFLVHKIVAYWGEGTQINAPVQSNPSAGIIF  231



>ref|XP_004146908.1| PREDICTED: derlin-1.1-like isoform 2 [Cucumis sativus]
 ref|XP_004161586.1| PREDICTED: derlin-1.1-like isoform 2 [Cucumis sativus]
 gb|KGN53160.1| hypothetical protein Csa_4G022960 [Cucumis sativus]
Length=285

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP+EYY SLPPV+K Y V C MT AA  L+LYD  +I L YS V ++FQVWRL+TNFF
Sbjct  1     MSTPLEYYRSLPPVSKLYGVSCLMTTAALYLDLYDPESIDLNYSLVIKKFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II +YGV LERGPFDKRTADYVWM  FGA+ LL M+I P+ W+PFM
Sbjct  61    FLGPFSFPFAFRLIIIAKYGVSLERGPFDKRTADYVWMLFFGALSLLAMAIVPYCWTPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN RIN+YG+V  KGFYLPW ML +D+I G+ LKPD+LG+  GH
Sbjct  121   GRSLVFMIVYIWGREFPNARINIYGVVSLKGFYLPWAMLALDLIFGHHLKPDILGMVVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK    TP W+HKLV+YWG+G Q NSP + DPSAGTAF
Sbjct  181   LYYFLTVLHPLAGGKFILKTPYWIHKLVSYWGEGIQFNSPVQRDPSAGTAF  231



>emb|CDP05367.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 183/223 (82%), Gaps = 0/223 (0%)
 Frame = -1

Query  1017  NSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsft  838
              SLPPVAKTY V C MT  A+ +ELY+V NIAL+YSDVF+RFQVWRL+TNFFF+G FS  
Sbjct  20    RSLPPVAKTYTVACLMTTVAFHMELYEVSNIALYYSDVFKRFQVWRLITNFFFLGGFSLP  79

Query  837   faFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMI  658
             F FR+L IL YGV LERG FDKRTADYVWMF+FGAI LLVM+  P LWSPF G ++VFMI
Sbjct  80    FGFRILTILYYGVSLERGAFDKRTADYVWMFVFGAISLLVMAAIPLLWSPFKGPAMVFMI  139

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W RE PN R+N+ GLV+ KGFYLPW MLGID ILG+P  P + GIAAGHIYYF TVL
Sbjct  140   VYVWSRENPNARVNIQGLVEIKGFYLPWVMLGIDTILGHPWMPAIQGIAAGHIYYFCTVL  199

Query  477   HPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +PL+TGKNYF TP WVHKLVA+WG+G+Q+N+P R DP AG AF
Sbjct  200   YPLSTGKNYFKTPLWVHKLVAFWGEGYQLNAPVRQDPDAGVAF  242



>ref|XP_006421587.1| hypothetical protein CICLE_v10006512mg [Citrus clementina]
 gb|ESR34827.1| hypothetical protein CICLE_v10006512mg [Citrus clementina]
Length=281

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYYNSLPPV+KTY V CFM  AA+ L+LY+  NIAL Y DV +RFQVWR+VTNFF
Sbjct  1     MSTPAEYYNSLPPVSKTYGVACFMATAAFYLQLYNPKNIALKYEDVIKRFQVWRVVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II +YGV LERGPFDKRTADY+WM +FGA+ LLVM+  P L +PFM
Sbjct  61    FLGPFSFRFAFRLIIIAKYGVSLERGPFDKRTADYLWMLMFGALSLLVMAAIPPLRTPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VYIWGREFPN RI++YG+V  KGFYLPW ML +++I GNPL P +LG+ AGH
Sbjct  121   GPSLVFMMVYIWGREFPNARISIYGVVSLKGFYLPWAMLALELIFGNPLLPAILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK  F TP +VHKLVA+WG+G QVNSP   +P AG AF
Sbjct  181   LYYFLTVLHPLAGGKYIFKTPLFVHKLVAFWGEGTQVNSPVPRNPQAGVAF  231



>gb|KDO45280.1| hypothetical protein CISIN_1g021348mg [Citrus sinensis]
Length=313

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 189/233 (81%), Gaps = 0/233 (0%)
 Frame = -1

Query  1047  IKMSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTN  868
             I MSTP EYYNSLPPV+KTY V C M  AA+ L+LY+  NIAL Y DV +RFQVWR+VTN
Sbjct  31    IAMSTPAEYYNSLPPVSKTYGVACLMATAAFYLQLYNPKNIALKYEDVIKRFQVWRVVTN  90

Query  867   fffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSP  688
             FFF+G FSF FAFRL+II +YGV LERGPFDKRTADY+WM +FGA+ LLVM+  P L +P
Sbjct  91    FFFLGPFSFRFAFRLIIIAKYGVSLERGPFDKRTADYLWMLMFGALSLLVMAAIPPLRTP  150

Query  687   FMGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAA  508
             FMG SLVFM+VYIWGREFPN RI++YG+V  KGFYLPW ML +++I GNPL P +LG+ A
Sbjct  151   FMGPSLVFMMVYIWGREFPNARISIYGVVSLKGFYLPWAMLALELIFGNPLLPAILGMVA  210

Query  507   GHIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             GH+YYFLTVLHPLA GK  F TP +VHKLVA+WG+G QVNSP   +P AG AF
Sbjct  211   GHLYYFLTVLHPLAGGKYIFKTPLFVHKLVAFWGEGTQVNSPVPRNPQAGVAF  263



>ref|XP_007038302.1| DERLIN-1 isoform 2 [Theobroma cacao]
 gb|EOY22803.1| DERLIN-1 isoform 2 [Theobroma cacao]
Length=283

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 183/232 (79%), Gaps = 1/232 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQ-VWRLVTNf  865
             MSTP +YY SLPPV+K Y V C MT +A  L LYD WNIAL Y DVF+RFQ VWRL+ NF
Sbjct  1     MSTPAQYYESLPPVSKFYGVACLMTTSALYLGLYDPWNIALSYEDVFKRFQQVWRLIINF  60

Query  864   ffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF  685
             F +G FS +FA  L++I RYGV LE+GPFDKRTADYVWM +FGA+ LLVM   PFLW+PF
Sbjct  61    FLLGPFSPSFAIHLIMIARYGVLLEKGPFDKRTADYVWMLIFGALSLLVMGAIPFLWTPF  120

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
             M  SLVFMIVY+W REFPN +I++YG+V  KGFYLPW  L +D+I G+ L PD++G+ AG
Sbjct  121   MAGSLVFMIVYVWSREFPNAQISIYGIVTLKGFYLPWAFLALDLIFGSRLMPDIIGMIAG  180

Query  504   HIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             H+YYFLTVLHPLA GK  F TP WVHKLVAYWGKG QVNSP + DPSAG AF
Sbjct  181   HLYYFLTVLHPLAGGKYVFKTPLWVHKLVAYWGKGIQVNSPVQRDPSAGVAF  232



>ref|XP_006490169.1| PREDICTED: derlin-1-like [Citrus sinensis]
Length=340

 Score =   314 bits (805),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -1

Query  1047  IKMSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTN  868
             I MSTP EYYNSLPPV+KTY V C M  AA+ L+LY+  NIAL Y DV +RFQVWR+VTN
Sbjct  58    IAMSTPAEYYNSLPPVSKTYGVACLMATAAFYLQLYNPHNIALKYEDVIKRFQVWRVVTN  117

Query  867   fffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSP  688
             FFF+G FSF FAFRL+II +YGV LERGPFDKRTADY+WM +FGA+ LLVM+  P L +P
Sbjct  118   FFFLGPFSFRFAFRLIIIAKYGVSLERGPFDKRTADYLWMLMFGALSLLVMAAIPPLRTP  177

Query  687   FMGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAA  508
             FMG SLVFM+VYIWGREFPN RI++YG+V  KGFYLPW ML +++I GNPL P +LG+  
Sbjct  178   FMGPSLVFMMVYIWGREFPNARISIYGVVSLKGFYLPWAMLALELIFGNPLLPAILGMVT  237

Query  507   GHIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             GH+YYFLTVLHPLA GK  F TP +VHKLVA+WG+G QVNSP   +P AG AF
Sbjct  238   GHLYYFLTVLHPLAGGKYIFKTPLFVHKLVAFWGEGTQVNSPVPRNPQAGVAF  290



>gb|KHN42778.1| Derlin-1 [Glycine soja]
Length=285

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = -1

Query  1047  IKMS-TPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVT  871
             IK+S     YY SLPPV+KTY V C MT +AY L+LYD  NI+L Y  VF+  QVWRL+T
Sbjct  2     IKISLCCFRYYRSLPPVSKTYGVACLMTTSAYYLQLYDARNISLDYGPVFKSLQVWRLIT  61

Query  870   NfffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWS  691
             NFFF+G+FS  FA RL++I +YGV LERGPFDKRTADYVWMF+FGA  LLV++  PF W 
Sbjct  62    NFFFLGSFSLPFAVRLIMIAKYGVSLERGPFDKRTADYVWMFIFGAFSLLVIAAVPFFWY  121

Query  690   PFMGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIA  511
             PFMG SLVFMIVY+W REFPN RIN+YG+V  KGFYLPW +L +D+I GNP+KPD++G+ 
Sbjct  122   PFMGISLVFMIVYVWSREFPNARINIYGVVSLKGFYLPWALLALDLIFGNPIKPDIVGMI  181

Query  510   AGHIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             AGH+YYFLTVLHPLA GK  F TP WVHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  182   AGHLYYFLTVLHPLAGGKFKFKTPLWVHKIVAYWGEGTQINAPVQSNPSAGIVF  235



>ref|XP_009370435.1| PREDICTED: derlin-1.1-like [Pyrus x bretschneideri]
Length=278

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V CFM AAA   ELY+ WNIAL Y  V +RFQVWRLVTNFF
Sbjct  1     MSTPGEYYRSLPPVSKTYGVGCFMFAAALYFELYNPWNIALDYGLVIKRFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FA  L++I RYGV LERGPFDKRTAD++WM +FGA+ LL M+  P+LWSPFM
Sbjct  61    FLGPFSFPFACDLILIARYGVALERGPFDKRTADFMWMLMFGALSLLAMAAVPYLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G S+VFMIVY+W REFPN R+N+ G+V FKGFYLP+ +L +D++ G PLKPD++G+ AGH
Sbjct  121   GTSVVFMIVYVWSREFPNSRVNIAGVVTFKGFYLPYALLTLDLMFGVPLKPDIMGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK    TP WVHKLVA+WG+G QVNSP   +P AG AF
Sbjct  181   LYYFLTVLHPLSGGKFTLKTPLWVHKLVAFWGQGIQVNSPVERNPQAGVAF  231



>gb|KCW90867.1| hypothetical protein EUGRSUZ_A02914 [Eucalyptus grandis]
Length=313

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 191/263 (73%), Gaps = 32/263 (12%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP +YY SLPPV+KTY V C MT AA  L LY+ W IAL Y  VF+RFQVWRL+TNFF
Sbjct  1     MSTPGDYYRSLPPVSKTYGVACLMTTAALYLGLYNHWTIALEYELVFKRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FAFRL+II +YGV LERGPFDKRTADYVWMF+FGA+ LLVM+  P L+ PFM
Sbjct  61    FLGPFSFPFAFRLIIIAKYGVSLERGPFDKRTADYVWMFIFGALSLLVMAAIPPLYIPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFMIVYIWGREFPN RI++YG+V  KGFYLPW +L +++I GNPL PD+LG+ AGH
Sbjct  121   GPSLVFMIVYIWGREFPNARISIYGVVSLKGFYLPWALLALNLIFGNPLMPDILGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWV--------------------------------HKLV  418
             +YYFLTVLHPLA G+N   TPRW                                 HK+V
Sbjct  181   LYYFLTVLHPLAGGRNLLKTPRWANKVRLLILSAVMALYNTLGVNHVCVQSLNVRSHKVV  240

Query  417   AYWGKGFQVNSPFRSDPSAGTAF  349
             AYWG+GFQVN+P  SDPSAG AF
Sbjct  241   AYWGEGFQVNAPVPSDPSAGIAF  263



>ref|XP_008376384.1| PREDICTED: derlin-1.1-like [Malus domestica]
Length=286

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V CFM AAA   +LY+ WNIAL Y  V +RFQVWRLVTNFF
Sbjct  1     MSTPGEYYRSLPPVSKTYGVGCFMFAAALYFQLYNPWNIALDYGLVIKRFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FA  L++I RYGV LERGPFDKRTAD++WM +FGA+ LL M+  P+LWSPFM
Sbjct  61    FLGPFSFPFACDLIMIARYGVALERGPFDKRTADFLWMLMFGALSLLAMAAVPYLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G S+VFMIVY+W REFPN R+N+ G+V FKGFYLP+ +L +D++ G PLKPD++G+ AGH
Sbjct  121   GTSVVFMIVYVWSREFPNSRVNIAGVVSFKGFYLPYVLLTLDLMFGVPLKPDIMGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK    TP WVHKLVA+WG+G QVNSP   +P AG AF
Sbjct  181   LYYFLTVLHPLSGGKFTLKTPLWVHKLVAFWGQGIQVNSPVERNPQAGVAF  231



>ref|XP_009372842.1| PREDICTED: derlin-1.1-like [Pyrus x bretschneideri]
Length=278

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KTY V CFM AAA   +LY+ WNIAL Y  V +RFQVWRLVTNFF
Sbjct  1     MSTPGEYYRSLPPVSKTYGVGCFMFAAALYFQLYNPWNIALDYGLVIKRFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FSF FA  L++I RYGV LERGPFDKRTAD++WM +FGA+ LL M+  P+LWSPFM
Sbjct  61    FLGPFSFPFACDLILIARYGVALERGPFDKRTADFMWMLMFGALSLLAMAAVPYLWSPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G S+VFMIVY+W REFPN R+N+ G+V FKGFYLP+ +L +D++ G PLKPD++G+ AGH
Sbjct  121   GTSVVFMIVYVWSREFPNSRVNIAGVVTFKGFYLPYALLTLDLMFGVPLKPDIMGMVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+ GK    TP WVHKLVA+WG+G QVNSP   +P AG AF
Sbjct  181   LYYFLTVLHPLSGGKFTLKTPLWVHKLVAFWGQGIQVNSPVERNPQAGVAF  231



>ref|XP_004146907.1| PREDICTED: derlin-1.1-like isoform 1 [Cucumis sativus]
 ref|XP_004161585.1| PREDICTED: derlin-1.1-like isoform 1 [Cucumis sativus]
Length=291

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 182/229 (79%), Gaps = 0/229 (0%)
 Frame = -1

Query  1035  TPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffi  856
             T   YY SLPPV+K Y V C MT AA  L+LYD  +I L YS V ++FQVWRL+TNFFF+
Sbjct  9     TYFRYYRSLPPVSKLYGVSCLMTTAALYLDLYDPESIDLNYSLVIKKFQVWRLITNFFFL  68

Query  855   gafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGA  676
             G FSF FAFRL+II +YGV LERGPFDKRTADYVWM  FGA+ LL M+I P+ W+PFMG 
Sbjct  69    GPFSFPFAFRLIIIAKYGVSLERGPFDKRTADYVWMLFFGALSLLAMAIVPYCWTPFMGR  128

Query  675   SLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIY  496
             SLVFMIVYIWGREFPN RIN+YG+V  KGFYLPW ML +D+I G+ LKPD+LG+  GH+Y
Sbjct  129   SLVFMIVYIWGREFPNARINIYGVVSLKGFYLPWAMLALDLIFGHHLKPDILGMVVGHLY  188

Query  495   YFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             YFLTVLHPLA GK    TP W+HKLV+YWG+G Q NSP + DPSAGTAF
Sbjct  189   YFLTVLHPLAGGKFILKTPYWIHKLVSYWGEGIQFNSPVQRDPSAGTAF  237



>emb|CBI38645.3| unnamed protein product [Vitis vinifera]
Length=299

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -1

Query  1029  MEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffiga  850
             ++YY SLPPV+K Y V C +T  AY L+LY  WNIAL Y  VF+RFQVWRLVTNFFF+G 
Sbjct  88    LKYYRSLPPVSKVYGVACLLTTTAYYLQLYSPWNIALSYELVFKRFQVWRLVTNFFFLGP  147

Query  849   fsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASL  670
             FSF+FAFRLLII RYGV LER  FD+RTADYVWM +FGA+ LLVM++ P+LWS FMGASL
Sbjct  148   FSFSFAFRLLIIARYGVALERWSFDERTADYVWMLIFGALSLLVMAVVPYLWSRFMGASL  207

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
             VFMI Y+WGREFPN +IN +GLV FKGFYLPW  L +D++LGNPLKPD+LG+ AGH+YYF
Sbjct  208   VFMIFYVWGREFPNAQINFHGLVSFKGFYLPWIYLAVDLLLGNPLKPDILGMVAGHLYYF  267

Query  489   LTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             LTVLHPLA GKN   TP WVHKLVA+WGKG
Sbjct  268   LTVLHPLAGGKNILKTPLWVHKLVAFWGKG  297



>ref|XP_009404549.1| PREDICTED: derlin-1 [Musa acuminata subsp. malaccensis]
Length=244

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 177/230 (77%), Gaps = 1/230 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPPV+K Y  +CF+T AA+QL L+D+  I L Y  VF +FQVWRL TNFF
Sbjct  1     MSSPAEFYNSLPPVSKAYGTLCFLTTAAFQLNLFDLGTILLLYQPVFTQFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPFDKRTAD++WM LFGA  LLV+S  PF WSPF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGPFDKRTADFLWMMLFGAFFLLVLSAIPFFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             GAS+VFM++Y+W REFP  +IN+YGLV  K FYLPW ML +D I G+P+ P +LGI AGH
Sbjct  121   GASMVFMLLYLWSREFPTTQINIYGLVTLKAFYLPWAMLMLDTIFGSPIMPSLLGIVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYFLTVLHPLATG+N   TP WVHKLVA  G G Q NS  R + SA TA
Sbjct  181   LYYFLTVLHPLATGRNLLRTPIWVHKLVALLGWGVQSNSGLRPN-SANTA  229



>ref|XP_010267104.1| PREDICTED: derlin-1 [Nelumbo nucifera]
Length=239

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLP V+K Y  +C +   A+ L LY   NIAL Y  V  RFQVWRLVTNFF
Sbjct  1     MSSPAEFYKSLPSVSKAYGTLCLLATTAFHLGLYHPANIALIYQLVLFRFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLERGPF++RTAD++WM +FGAI LLV+S  P LW+PF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLERGPFERRTADFLWMMIFGAISLLVLSAIPLLWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLKAFYLPWTMLALDVIFGSPLMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYF+TVLHPL+ GKN   TP WVHKLVA WG G Q +   +SD +AG AF
Sbjct  181   LYYFITVLHPLSGGKNILKTPIWVHKLVARWGIGHQPSMSSQSDRAAGVAF  231



>ref|XP_010249470.1| PREDICTED: derlin-1-like [Nelumbo nucifera]
Length=240

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 173/231 (75%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPPV+K Y  +C +   A+ L LY   +IAL Y  VF  FQVWRLVTNFF
Sbjct  1     MSSPAEFYKSLPPVSKAYGTLCLLATTAFHLGLYHHEDIALVYPLVFSHFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLERGPF++RTAD++WM +FGA+ LLV+S+ P LW+PF+
Sbjct  61    FLGKFSVNFGIRLLMIARYGVQLERGPFERRTADFLWMIIFGALSLLVLSVIPLLWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW M  +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLKAFYLPWAMFALDVIFGSPLMPDLLGILAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             IYYF TVLHPLA GKN   TP WV+KLVA W  G   NS  + D +AG AF
Sbjct  181   IYYFFTVLHPLAGGKNILKTPVWVNKLVARWNVGPNANSSSQPDRAAGVAF  231



>ref|XP_010914944.1| PREDICTED: derlin-1 [Elaeis guineensis]
Length=241

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 176/232 (76%), Gaps = 1/232 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP E+YNSLPP++K Y  +C +T AAYQL +    +IALFY  V  RFQVWRL+TNFF
Sbjct  1     MSTPAEFYNSLPPISKAYGTLCLLTTAAYQLGILSPESIALFYPFVVSRFQVWRLLTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLERGPFDKRTAD++WM +FGA  LL +S  P LWSPF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLERGPFDKRTADFLWMMMFGAFSLLALSAIPPLWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFP+ +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPDAQINIYGLVTLKAFYLPWVMLSLDVIFGSPLMPDLLGIVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWG-KGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GKN   TP WVH++VA W  +    +S   +D +AG AF
Sbjct  181   LYYFLTVLHPLAGGKNILKTPNWVHRVVARWAIRSPAFSSARPNDTTAGVAF  232



>ref|XP_010047297.1| PREDICTED: derlin-1 [Eucalyptus grandis]
Length=240

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 176/231 (76%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP++K +  IC  T AA+ L L+D + +AL Y+ +F++FQVWRLVTNFF
Sbjct  1     MSSPAEFYNSLPPISKAFGTICVATTAAFHLGLFDPYYVALLYAPIFKQFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPFD+RTAD++WM +FGA  LLV++  P LW+PF+
Sbjct  61    FLGKFSVNFGIRLLMIARYGVQLEKGPFDRRTADFLWMMIFGAFSLLVLAAIPMLWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++YIW REFPN ++++YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GVSLVFMLLYIWSREFPNAQVSIYGLVALKAFYLPWAMLALDVIFGSPLLPDLLGIVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GK+   TPRWVHKLVA    G         + S GTAF
Sbjct  181   LYYFLTVLHPLAGGKDILRTPRWVHKLVARLRLGQPARVRSEPERSTGTAF  231



>ref|XP_004307787.1| PREDICTED: derlin-1.1-like [Fragaria vesca subsp. vesca]
Length=278

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 176/231 (76%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV+KT    C MT +AY L+L+D  NI+L Y  +F+ +QVWRL TNF 
Sbjct  1     MSTPAEYYRSLPPVSKTILAACLMTTSAYYLQLFDYMNISLDYGLIFKHYQVWRLFTNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  +A  +LII +YGV LE+GPFDKRTADYVWMF+FGA+ LLV+S  P++   F+
Sbjct  61    FLGPFSLPYAMEILIIAKYGVSLEKGPFDKRTADYVWMFIFGAMSLLVLSAVPYMRPYFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G+SLVFMIVY+W RE P+ RINVYGLV FKGFYLP+ M+ ID++LGN L+  + GI  GH
Sbjct  121   GSSLVFMIVYVWSRELPDARINVYGLVHFKGFYLPYVMMAIDLLLGNSLRSAIRGIIVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVL+PLA G     TP WVHK+VAYWG+G Q+N+P +S P AG  F
Sbjct  181   LYYFLTVLYPLAGGNFTLKTPLWVHKVVAYWGEGTQINAPVQSSPYAGVVF  231



>ref|XP_008453883.1| PREDICTED: derlin-1.1-like isoform X2 [Cucumis melo]
Length=263

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 173/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  972  MTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftfaFRLLIILRYGVQL  793
            MT AAY L+LY + +IAL YS V ++FQ+WRL+TNFFF+G FSF FAFRL+II +YGV L
Sbjct  1    MTTAAYYLQLYHLESIALDYSLVIKKFQLWRLITNFFFLGPFSFPFAFRLIIIAKYGVSL  60

Query  792  ERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFPNERINV  613
            ERGPFDKRTADYVWM LFGA+ LLVM++ P+ W+PFMG SLVFMIVYIWGREFPN RIN+
Sbjct  61   ERGPFDKRTADYVWMLLFGALSLLVMAVVPYFWTPFMGRSLVFMIVYIWGREFPNARINI  120

Query  612  YGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRW  433
            YG+V  KGFYLPW ML +D+I G+ L PD+LG+ AGH+YYFLTVLHPLA GK    TP W
Sbjct  121  YGVVSLKGFYLPWAMLALDLIFGHRLMPDILGMVAGHLYYFLTVLHPLAGGKFILKTPFW  180

Query  432  VHKL-VAYWGKGFQVNSPFRSDPSAGTAF  349
            +HKL VAYWG+G Q NSP + DPSAGTAF
Sbjct  181  IHKLVVAYWGEGIQFNSPVQRDPSAGTAF  209



>ref|XP_004146909.1| PREDICTED: derlin-1.1-like isoform 3 [Cucumis sativus]
 ref|XP_004161587.1| PREDICTED: derlin-1.1-like isoform 3 [Cucumis sativus]
Length=262

 Score =   281 bits (718),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  972  MTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftfaFRLLIILRYGVQL  793
            MT AA  L+LYD  +I L YS V ++FQVWRL+TNFFF+G FSF FAFRL+II +YGV L
Sbjct  1    MTTAALYLDLYDPESIDLNYSLVIKKFQVWRLITNFFFLGPFSFPFAFRLIIIAKYGVSL  60

Query  792  ERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFPNERINV  613
            ERGPFDKRTADYVWM  FGA+ LL M+I P+ W+PFMG SLVFMIVYIWGREFPN RIN+
Sbjct  61   ERGPFDKRTADYVWMLFFGALSLLAMAIVPYCWTPFMGRSLVFMIVYIWGREFPNARINI  120

Query  612  YGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRW  433
            YG+V  KGFYLPW ML +D+I G+ LKPD+LG+  GH+YYFLTVLHPLA GK    TP W
Sbjct  121  YGVVSLKGFYLPWAMLALDLIFGHHLKPDILGMVVGHLYYFLTVLHPLAGGKFILKTPYW  180

Query  432  VHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
            +HKLV+YWG+G Q NSP + DPSAGTAF
Sbjct  181  IHKLVSYWGEGIQFNSPVQRDPSAGTAF  208



>ref|XP_002275238.1| PREDICTED: derlin-1 [Vitis vinifera]
 ref|XP_010648294.1| PREDICTED: derlin-1 [Vitis vinifera]
 emb|CBI20596.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP E+YNSLPP++K Y  +C +   A+ L L+     AL Y  VF+ FQVWRLVTNFF
Sbjct  1     MSTPAEFYNSLPPISKAYGTMCLVATTAFHLGLFPPMYTALIYELVFKHFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F++RTAD++WM +FGA+ LLV+S  P LW+PF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGVFERRTADFLWMMIFGALTLLVLSAIPLLWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLVQ K FY PW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GVSLVFMLLYVWSREFPNAQINLYGLVQLKAFYFPWAMLALDVIFGSQILPDLLGIVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPL+TGKN   TPRWVHKLVA +  G+   +P + + +AG AF
Sbjct  181   LYYFLTVLHPLSTGKNILKTPRWVHKLVARFRIGYPTTAPAQPERAAGVAF  231



>ref|XP_009605271.1| PREDICTED: derlin-1-like [Nicotiana tomentosiformis]
Length=278

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 173/231 (75%), Gaps = 1/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPPV+K Y   C +   A QL L+D+ +IAL Y  VF  FQVWRL+TNFF
Sbjct  1     MSSPAEFYKSLPPVSKAYGTACLVLTTACQLGLFDLVDIALLYELVFSHFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FGA+ LL +S+ PF  SPF+
Sbjct  61    FLGRFSINFGIRLLMIARYGVQLESGPFQRRTADFLWMMIFGALTLLALSLIPFFRSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G S+VFM++YIW REFPN  IN+YGLV  K FYLPW MLG+D+I G+P+ PD+LGI AGH
Sbjct  121   GISIVFMLLYIWSREFPNANINIYGLVTLKAFYLPWAMLGLDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGKN+  TP WVHKLV  W  G    +P + D +AG AF
Sbjct  181   LYYFLTVLHPLATGKNFLKTPIWVHKLVMRWKIGAPTATPAQPD-NAGAAF  230



>ref|XP_008799776.1| PREDICTED: LOW QUALITY PROTEIN: derlin-1-like [Phoenix dactylifera]
Length=241

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP E+YNSLPP++K Y  +C +T  A QL +    +IAL+Y  V   FQVWRL+TNFF
Sbjct  1     MSTPAEFYNSLPPISKGYGTLCLLTTVACQLGILPPASIALYYPFVLSHFQVWRLLTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F G FS  F  RLL+I RYGVQLERGPFDKRTAD++WM +FGA  LL +S  P LWSPF+
Sbjct  61    FXGKFSINFGIRLLMIARYGVQLERGPFDKRTADFLWMMMFGAFSLLALSAIPPLWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFP+ +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPDAQINIYGLVTLKAFYLPWAMLALDVIFGSPLMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFR-SDPSAGTAF  349
             +YYFLTVLHPLA GKN   TP WVH+LVA W    Q  S  R +D +AG AF
Sbjct  181   LYYFLTVLHPLAGGKNILKTPNWVHRLVARWAIRSQAYSSARPNDTTAGVAF  232



>ref|XP_007202495.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica]
 gb|EMJ03694.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica]
Length=242

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y  IC +   A+QL LYD  +IAL +  VF  FQVWRL+TNFF
Sbjct  1     MSSPAEFYRSLPPISKAYGTICVLATTAFQLGLYDFRSIALVHKLVFSHFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  WSPF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALTLLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN  +N+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNANVNIYGLVALKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +YYFLTVLHPLA GKN   TPRWVHK+VA W  G
Sbjct  181   LYYFLTVLHPLAGGKNILQTPRWVHKVVARWRIG  214



>gb|KCW79180.1| hypothetical protein EUGRSUZ_C00616 [Eucalyptus grandis]
Length=279

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 182/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  1131  KLRT*VVDYELP*SLSKQDQRTANC*YHIKMSTPMEYYNSLPPVAKTYAVICFMTAAAYQ  952
             K R     +E   SLS  +Q      Y I       +YNSLPP++K +  IC  T AA+ 
Sbjct  11    KYRQNCTSFEWIISLSDFNQCLGRTCY-ISFCICFRFYNSLPPISKAFGTICVATTAAFH  69

Query  951   LELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftfaFRLLIILRYGVQLERGPFDK  772
             L L+D + +AL Y+ +F++FQVWRLVTNFFF+G FS  F  RLL+I RYGVQLE+GPFD+
Sbjct  70    LGLFDPYYVALLYAPIFKQFQVWRLVTNFFFLGKFSVNFGIRLLMIARYGVQLEKGPFDR  129

Query  771   RTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFPNERINVYGLVQFK  592
             RTAD++WM +FGA  LLV++  P LW+PF+G SLVFM++YIW REFPN ++++YGLV  K
Sbjct  130   RTADFLWMMIFGAFSLLVLAAIPMLWTPFLGVSLVFMLLYIWSREFPNAQVSIYGLVALK  189

Query  591   GFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRWVHKLVAY  412
              FYLPW ML +D+I G+PL PD+LGI AGH+YYFLTVLHPLA GK+   TPRWVHKLVA 
Sbjct  190   AFYLPWAMLALDVIFGSPLLPDLLGIVAGHLYYFLTVLHPLAGGKDILRTPRWVHKLVAR  249

Query  411   WGKGFQVNSPFRSDPSAGTAF  349
                G         + S GTAF
Sbjct  250   LRLGQPARVRSEPERSTGTAF  270



>ref|XP_007012984.1| DERLIN-1 [Theobroma cacao]
 gb|EOY30603.1| DERLIN-1 [Theobroma cacao]
Length=242

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 174/233 (75%), Gaps = 2/233 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP+ K Y   C +  AA++L+LY++ +IAL Y  VF+ FQVWRL+TNFF
Sbjct  1     MSSPAEFYNSLPPICKAYGTACLLATAAFELKLYNIMHIALIYEYVFKHFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P   S F+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFQSGFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV+ K FYLPW ML +D I G+   PD+LGI AGH
Sbjct  121   GVSLVFMLLYVWSREFPNAQINIYGLVRLKAFYLPWAMLALDAIFGSSPIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYW--GKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGK    TP WVHKLVA W  G   Q +S  + D S G +F
Sbjct  181   LYYFLTVLHPLATGKVILKTPMWVHKLVARWRIGAPTQPSSRAQPDRSTGVSF  233



>ref|XP_004287492.1| PREDICTED: derlin-1-like [Fragaria vesca subsp. vesca]
Length=247

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP E+Y SLPP++K Y  IC +  AA+ L LYD   IAL Y  VF +FQVWRL+TNFF
Sbjct  1     MSTPAEFYQSLPPISKAYGTICVVATAAFHLGLYDPRTIALLYGPVFSQFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  WSPF+
Sbjct  61    FLGKFSVNFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALTLLVLSAIPMFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W RE+PN  IN+YGLVQ K FY PW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREYPNAVINLYGLVQLKAFYFPWAMLALDVIFGSPIWPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +Y+FLTVLHPLA GKN   TPRWVHK+VA +  G
Sbjct  181   LYHFLTVLHPLAGGKNILKTPRWVHKIVARYRIG  214



>gb|KDP33776.1| hypothetical protein JCGZ_07347 [Jatropha curcas]
Length=243

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 173/234 (74%), Gaps = 3/234 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +C +   A QL ++D+++IAL Y     RFQVWRL+TNFF
Sbjct  1     MSSPAEYYNSLPPISKVYGTLCLLFTVAIQLGVFDLFHIALIYKLALTRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPFD+RTAD++WM +FGA+ +LV++  P  ++PF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGPFDRRTADFLWMMIFGALSMLVLAAIPLFYTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN +IN+YGLV  K FYLPW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNAQINIYGLVTLKAFYLPWAMLALDVIFGSHIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQV---NSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGK    TPRWVHKLVA +  G      N   + +   G AF
Sbjct  181   LYYFLTVLHPLATGKTLLKTPRWVHKLVARYRIGAPAPTNNRAAQPERPTGAAF  234



>ref|XP_002514197.1| Derlin-3, putative [Ricinus communis]
 gb|EEF48151.1| Derlin-3, putative [Ricinus communis]
Length=206

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C    AAYQL ++D+ +IAL Y  VF RFQVWRL TNFF
Sbjct  1     MSSPAEYYNSLPPITKAYGTLCLFFTAAYQLGVFDLVHIALIYQLVFSRFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPFD+RTAD++WM +FGA+ +L++S  PF W+PF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGPFDRRTADFLWMVIFGALSMLILSAIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +I++YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GTSLVFMLLYVWSREFPNAQISIYGLVTLKAFYLPWTMLALDVIFGSPLMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVH  427
             +YYFLTVLHPLATGK    TPRWV+
Sbjct  181   LYYFLTVLHPLATGKILLKTPRWVY  205



>ref|XP_003630693.1| Derlin-1 [Medicago truncatula]
 gb|AET05169.1| derlin-2 protein [Medicago truncatula]
 gb|AFK36527.1| unknown [Medicago truncatula]
Length=245

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +  A YQL LY+  +IAL Y  VF RFQVWRL TNFF
Sbjct  1     MSSPGEFYKSLPPISKAYGTACLVATAVYQLGLYNPVHIALLYERVFFRFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  PF W+PF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+ L PD+LGI AGH
Sbjct  121   AISLVFMLLYVWSREFPNAQINLYGLVALKAFYLPWAMLALDVIFGSALMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +YYFLTVLHPLA GKN   TP WVHKLVA W  G
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMWVHKLVARWRIG  214



>ref|XP_003530537.1| PREDICTED: derlin-1-like [Glycine max]
 gb|KHN16656.1| Derlin-1 [Glycine soja]
Length=246

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 164/227 (72%), Gaps = 3/227 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y+SLPP+ K Y  +C +  A Y L LY    IALFY  VF  FQVWRL TN F
Sbjct  1     MSSPAEFYHSLPPITKAYGTVCLLATATYHLGLYHPAYIALFYDKVFYGFQVWRLFTNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  P  WSPF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
                LVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   AVPLVFMLLYVWSREFPNAQINIYGLVALKAFYLPWAMLALDVIFGSPLIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSA  361
             +YYF TVLHPLA GKN   TP WVHKL+A W  G Q   P    P+A
Sbjct  181   LYYFFTVLHPLAGGKNILKTPMWVHKLIARWRIGVQ---PISRGPAA  224



>ref|XP_006338200.1| PREDICTED: derlin-1-like [Solanum tuberosum]
Length=278

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 168/231 (73%), Gaps = 1/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +   AYQL LY   +IAL Y  V  RFQVWRL+TNFF
Sbjct  1     MSSPAEFYKSLPPISKAYGTACLLFTVAYQLGLYHPDDIALLYELVLSRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FGA+ LL +S  PF  SPF+
Sbjct  61    FLGEFSINFGIRLLMIARYGVQLESGPFQRRTADFLWMMIFGALTLLALSAIPFFRSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFP   IN+YGLV  K FYLPW MLG+D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYVWSREFPTANINIYGLVTLKAFYLPWAMLGLDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGKN   TP WVHKLV  W  G    +P + D + G AF
Sbjct  181   LYYFLTVLHPLATGKNLLKTPIWVHKLVMRWRIGAPTGTPAQPD-NPGAAF  230



>ref|NP_194662.2| derlin-1 [Arabidopsis thaliana]
 sp|Q8VZU9.1|DERL1_ARATH RecName: Full=Derlin-1; AltName: Full=AtDerlin1-1 [Arabidopsis 
thaliana]
 gb|AAL36173.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20097.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85618.1| derlin-1 [Arabidopsis thaliana]
Length=266

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 168/219 (77%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP+ K Y  +CF T  A QL L    +IAL    V ++FQ+WRL+TN F
Sbjct  1     MSSPGEFYNSLPPITKAYGTLCFFTTVATQLGLVAPVHIALIPELVLKQFQIWRLITNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG+  LLV+S+ PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TP+WV+K+VA W  G  V S
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVAS  219



>ref|XP_010541005.1| PREDICTED: derlin-1 [Tarenaya hassleriana]
Length=254

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C +   AYQL L +  ++AL      ++FQVWRL+TNFF
Sbjct  1     MSSPAEYYNSLPPITKAYGTLCVLATTAYQLGLLNHVHLALIPELAIKQFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG++ LLV+S  PF WSPF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSLTLLVLSFIPFFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  IN+YGLV  K FYLPW ML +D+I G+ + PD++GI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANINIYGLVSLKAFYLPWAMLALDVIFGSKIMPDLIGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYW  409
             +YYFLTVLHPLATGKNY  TP+WVH LVA W
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVHNLVAKW  211



>ref|XP_004503500.1| PREDICTED: derlin-1-like [Cicer arietinum]
Length=245

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +  A YQL LY   +IAL Y  VF RFQVWRL TNFF
Sbjct  1     MSSPGEFYKSLPPISKAYGTACLLATAVYQLGLYQPVHIALIYELVFFRFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM LFGA  LLV+S  PF W+PF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMLFGAFALLVLSAIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+ L PD+LGI AGH
Sbjct  121   AISLVFMLLYVWSREFPNAQINIYGLVSLKAFYLPWAMLALDVIFGSSLMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDP  367
             +YYFLTVLHPLA GK    TP WV KLVA W  G Q  S  R +P
Sbjct  181   LYYFLTVLHPLAGGKTILKTPMWVRKLVARWRIGAQPIS--RGEP  223



>ref|XP_002869440.1| hypothetical protein ARALYDRAFT_491823 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45699.1| hypothetical protein ARALYDRAFT_491823 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 169/219 (77%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C  T  A QL L    +IALF   V ++FQ+WRL++NFF
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLFTTIANQLGLVAPVHIALFPQLVLKQFQIWRLISNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG+  LLV+S+ PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TP+WV+K+VA W  G  V S
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVAS  219



>ref|XP_004239327.1| PREDICTED: derlin-1 [Solanum lycopersicum]
Length=278

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 168/231 (73%), Gaps = 1/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +   AYQL  Y   +IAL Y  V  RFQVWRL+TNFF
Sbjct  1     MSSPAEFYKSLPPISKAYGTACLLFTIAYQLGFYHPADIALLYELVLYRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FGA+ LL +S+ PF  SPF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLESGPFQRRTADFLWMMIFGALTLLALSVIPFFRSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFP   IN+YGLV  K FYLPW MLG+D+I G+P+ PD+ GI AGH
Sbjct  121   GVSLVFMLLYVWSREFPTANINIYGLVTLKAFYLPWAMLGLDVIFGSPIMPDLTGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGKN+  TP WVHKLV  W  G    +P + D + G AF
Sbjct  181   LYYFLTVLHPLATGKNFLKTPIWVHKLVMRWRIGAPTGTPAQPD-NPGAAF  230



>ref|XP_008242542.1| PREDICTED: derlin-1 [Prunus mume]
Length=233

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y+SLPP++K Y  IC +   AYQL LYD  +IAL +  VF  FQVWRL+TNFF
Sbjct  1     MSSPAEFYHSLPPISKAYGTICVLATTAYQLGLYDFRSIALVHKLVFSHFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  WSPF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALTLLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN  IN+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNANINIYGLVALKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVH  427
             +YYFLTVLHPLA GKN   TPRWV+
Sbjct  181   LYYFLTVLHPLAGGKNILQTPRWVY  205



>ref|XP_007160273.1| hypothetical protein PHAVU_002G307400g [Phaseolus vulgaris]
 gb|ESW32267.1| hypothetical protein PHAVU_002G307400g [Phaseolus vulgaris]
Length=246

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 169/238 (71%), Gaps = 8/238 (3%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y+SLPP+ K Y  +C +  A Y L LY   +IAL Y  VF  FQVWRL TN F
Sbjct  1     MSSPAEFYHSLPPITKAYGTVCLLATATYHLGLYHPIHIALLYERVFYGFQVWRLFTNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPF++RTAD++WM +FG+  LLV+S  PFLWSPF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFERRTADFLWMMIFGSFALLVLSAIPFLWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
                LVFM++YIW REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   AVPLVFMLLYIWSREFPNAQINIYGLVALKAFYLPWAMLALDVIFGSPLIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQ-------VNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GKN   TP WV KLV  W  G Q        N+P + +  +G  F
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMWVRKLVGRWRIGMQPINRAQPANNP-QQESGSGVVF  237



>ref|XP_010433107.1| PREDICTED: derlin-1-like [Camelina sativa]
Length=266

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 168/219 (77%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C  T  A QL L     IAL    V ++FQ+WRL+TNFF
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLFTTVANQLGLVAPVFIALIPELVIKQFQIWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG++ L+V+S+ PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSLTLVVLSLIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TPRWV+K+VA W  G  V S
Sbjct  181   LYYFLTVLHPLATGKNYLKTPRWVNKIVARWRIGAPVAS  219



>ref|XP_009798903.1| PREDICTED: derlin-1-like [Nicotiana sylvestris]
Length=278

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 169/231 (73%), Gaps = 1/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPPV+K Y   C +   A QL L+D+ +IAL Y  VF  FQVWRL+TNFF
Sbjct  1     MSSPAEFYKSLPPVSKAYGTACLVLTTACQLGLFDLVDIALLYELVFSHFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF ++TAD++WM +FGA+ LL +S+ PF  SPF+
Sbjct  61    FLGKFSINFGIRLLVIARYGVQLESGPFQRQTADFLWMMIFGALTLLALSLIPFFRSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  IN+YGLV  K FYLPW MLG+D+I G+ + PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNANINIYGLVTLKAFYLPWAMLGLDVIFGSLIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGK    TP WVHKLV     G    +P + D +AG AF
Sbjct  181   LYYFLTVLHPLATGKKLLKTPIWVHKLVMRLKIGAPTATPAQPD-NAGAAF  230



>ref|XP_006451340.1| hypothetical protein CICLE_v10009327mg [Citrus clementina]
 ref|XP_006475348.1| PREDICTED: derlin-1-like [Citrus sinensis]
 gb|ESR64580.1| hypothetical protein CICLE_v10009327mg [Citrus clementina]
 gb|KDO55856.1| hypothetical protein CISIN_1g022636mg [Citrus sinensis]
Length=240

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 168/231 (73%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY+SLPP+ K Y  +C   A    L L D+  +AL Y  VF +FQVWRL+TNFF
Sbjct  1     MSSPAEYYHSLPPICKAYGTLCVAVATVCSLGLLDLSILALEYKLVFSKFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FGA+ LLV+S  P   S F+
Sbjct  61    FLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGKN   TP+WV KLVA W  G    +  + + + G AF
Sbjct  181   LYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIGAPAINRAQPERTTGVAF  231



>gb|AFK48055.1| unknown [Lotus japonicus]
Length=246

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 170/237 (72%), Gaps = 9/237 (4%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YN+LPP++K Y   C    AAYQL LY   +IAL Y  VF  FQVWRL TNFF
Sbjct  1     MSSPAEWYNTLPPISKAYGTACLAATAAYQLGLYQPVHIALSYPQVFYGFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLERGPFD+RTAD++WM +FG   LLV+S  PFLW+PF+
Sbjct  61    FLGPFSINFGIRLLMIARYGVQLERGPFDRRTADFLWMMIFGGFALLVLSAIPFLWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               S+VFM++YIW REFP  +IN+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   AISVVFMLLYIWSREFPIAQINIYGLVSLKAFYLPWAMLALDVIFGSPIIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYW--------GKGFQVNSPFRSDPSAGT  355
             +YYF TVLHPLA GKN   TP WVHKLVA W        G+   VN+  R + S+G 
Sbjct  181   LYYFSTVLHPLAGGKNILKTPMWVHKLVARWRIGAPAVVGRAQPVNNA-RQESSSGV  236



>gb|AFK44105.1| unknown [Lotus japonicus]
Length=246

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YN+LPP++K Y   C    AAYQL LY   +IAL Y  VF  FQVWRL TNFF
Sbjct  1     MSSPAEWYNTLPPISKAYGTTCLAATAAYQLGLYQPVHIALLYPQVFYGFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPFD+RTAD++WM +FG   LLV+S  PFLW+PF+
Sbjct  61    FLGPFSINFGIRLLMIARYGVQLEKGPFDRRTADFLWMMIFGGFALLVLSAIPFLWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               S+VFM++YIW REFP  +IN+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   AISVVFMLLYIWSREFPIAQINIYGLVSLKAFYLPWAMLALDVIFGSPIIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +YYFLTVLHPLA GKN   TP WVHK VA W  G
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMWVHKSVARWRIG  214



>gb|KHG24854.1| Derlin-1 -like protein [Gossypium arboreum]
Length=254

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 167/231 (72%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP+ K Y  IC MT  A  L LY + NIAL +  VF  FQVWRL+TNFF
Sbjct  1     MSSPAEFYKSLPPITKAYGTICLMTTVASHLGLYRLENIALIHELVFSEFQVWRLLTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF +RTAD++WM +FGAI LL +SI P L   F+
Sbjct  61    FLGNFSMNFGIRLLMIARYGVQLEQGPFQRRTADFLWMMIFGAISLLALSIVPILRGAFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++YIW REFPN ++N+YGLV  K FYLPW ML +D+I G+PL PD++GI AGH
Sbjct  121   GISLVFMLLYIWSREFPNAQVNIYGLVALKAFYLPWAMLALDVIFGSPLVPDLMGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA G N  +TPR VHKLVA     +  N+    + + G AF
Sbjct  181   LYYFLTVLHPLAGGMNIISTPRLVHKLVARARFEYPTNARVPQERTTGVAF  231



>ref|XP_010438311.1| PREDICTED: derlin-1 [Camelina sativa]
Length=266

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 168/219 (77%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C  T  A QL L     IAL    V ++FQ+WRL+TNFF
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLFTTVANQLGLVAPVFIALIPELVIKQFQIWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG++ L+V+S+ PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSLTLVVLSLIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TP+WV+K+VA W  G  V S
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVAS  219



>ref|XP_009352574.1| PREDICTED: derlin-1 [Pyrus x bretschneideri]
Length=243

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 171/234 (73%), Gaps = 3/234 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y  +C +   A+QL  YD  +IAL +  VF  FQVWRL TNFF
Sbjct  1     MSSPAEWYQSLPPISKAYGSLCVIATTAFQLGFYDWKSIALEHKLVFSHFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  R+L+I RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  P  +SPF+
Sbjct  61    FLGNFSINFGIRILMIARYGVQLEKGPFDRRTADFLWMMVFGATTLLVLSAIPIFYSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN  +N+YGLVQ K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNANVNIYGLVQLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDP---SAGTAF  349
             ++YFLTVLHPLA GKN   TPRWV K+VA W  G    +    +P   +AG AF
Sbjct  181   LFYFLTVLHPLAGGKNILQTPRWVRKIVARWRIGAPPPTSRTQEPAPAAAGVAF  234



>ref|XP_011007263.1| PREDICTED: derlin-1 [Populus euphratica]
Length=249

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 166/230 (72%), Gaps = 0/230 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +C     A Q  L+++ +IAL Y  VF  FQVWRL+T FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCLFLTTAVQFGLFNLPDIALIYKPVFSSFQVWRLITTFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  W+PF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFWNPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLKAFYLPWAMLALDVIFGAPLMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYFLTVLHPLATG     TPRWV+KLVA W  G       R+ P   T 
Sbjct  181   LYYFLTVLHPLATGNIILRTPRWVNKLVARWRIGAPTPMYNRAQPDRTTG  230



>ref|XP_007202494.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica]
 gb|EMJ03693.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica]
Length=214

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y  IC +   A+QL LYD  +IAL +  VF  FQVWRL+TNFF
Sbjct  1     MSSPAEFYRSLPPISKAYGTICVLATTAFQLGLYDFRSIALVHKLVFSHFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  WSPF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALTLLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN  +N+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNANVNIYGLVALKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVH  427
             +YYFLTVLHPLA GKN   TPRWV+
Sbjct  181   LYYFLTVLHPLAGGKNILQTPRWVY  205



>ref|XP_010447866.1| PREDICTED: derlin-1-like [Camelina sativa]
Length=266

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 168/219 (77%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C  T  A QL +     IAL    V ++FQ+WRL+TNFF
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLFTTVANQLGIVAPVFIALIPELVIKQFQIWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG++ L+V+S+ PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSLTLVVLSLIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TP+WV+K+VA W  G  V S
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVAS  219



>ref|XP_003525291.1| PREDICTED: derlin-1-like isoform X1 [Glycine max]
 gb|KHM99819.1| Derlin-1 [Glycine soja]
Length=246

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 166/238 (70%), Gaps = 8/238 (3%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y+SLPP+ K Y  +C +  A Y L L     IAL Y  VF  FQ WRL TN F
Sbjct  1     MSSPAEFYHSLPPITKAYGTVCLLATATYHLGLDHPAYIALLYDKVFYGFQAWRLFTNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  P  WSPF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
                LVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   AVPLVFMLLYVWSREFPNAQINIYGLVALKAFYLPWAMLALDIIFGSPLIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQ-------VNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA GKN   TP WVHKLVA W  G Q        N P + +  +G AF
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMWVHKLVARWIIGVQPISRGQAANDP-QQERGSGVAF  237



>ref|XP_010919662.1| PREDICTED: derlin-1-like [Elaeis guineensis]
Length=240

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 172/231 (74%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             M+TP EYY SLPPV K Y V C MT+AA +L L++V +I L+Y  V ++FQVWRLVTNFF
Sbjct  1     MATPGEYYRSLPPVTKAYGVFCLMTSAADRLRLFNVVHILLYYDLVLKQFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  R L++ RYGV LE+GPF +RTAD++WM +FGA+ LLV+ + P L  PFM
Sbjct  61    FLGRFSIYFGLRFLMLARYGVMLEKGPFKQRTADFLWMMIFGALSLLVIGLIPQLRFPFM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W RE PN +I + GLV  KG YLPW M+ +D+I  +PL PD+LGI +GH
Sbjct  121   GPSLVFMMLYVWSREVPNSQIRIAGLVTMKGVYLPWAMIALDLIFNDPLVPDILGILSGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFL VL+PL+  +N   TP WVHKLV YWG+G Q+NSP + +  AG AF
Sbjct  181   LYYFLAVLYPLSGRQNILKTPLWVHKLVVYWGEGAQMNSPVQPNQHAGIAF  231



>ref|XP_008337606.1| PREDICTED: derlin-1 [Malus domestica]
Length=243

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 169/234 (72%), Gaps = 3/234 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y  +C +   A+QL  YD  +IAL +  VF  FQVWRL TNFF
Sbjct  1     MSSPAEWYXSLPPISKAYGTLCVIATTAFQLGFYDWKSIALVHKLVFLHFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  P   SPF+
Sbjct  61    FLGNFSVNFGIRLLMIARYGVQLEKGPFDRRTADFLWMMVFGATTLLVLSAIPIFXSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN   N+YGLVQ K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLVYVWSREFPNANXNIYGLVQLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDP---SAGTAF  349
             ++YFLTVLHPLA GKN   TPRWV K+VA W  G    +    +P   +AG AF
Sbjct  181   LFYFLTVLHPLAGGKNILQTPRWVRKIVARWRIGAPPPTSRTQEPAPAAAGVAF  234



>gb|KHF99830.1| Derlin-1 -like protein [Gossypium arboreum]
Length=243

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 3/234 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP++K Y   C +T  A QL L +++ IAL +  VF+ FQVWRL TNFF
Sbjct  1     MSSPAEFYNSLPPISKAYGTACLLTTTAVQLGLLNIFYIALLHEYVFKYFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+  FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P   +PF+
Sbjct  61    FLEKFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALTLLVLSAIPIFRTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+ L PD+LGI AGH
Sbjct  121   GVSLVFMLLYVWSREFPNAQINIYGLVTLKSFYLPWAMLALDVIFGSKLIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVN---SPFRSDPSAGTAF  349
             +YYFLTVLHPLATGK +  TP WV+KLVA +  G       S  +SD   G AF
Sbjct  181   LYYFLTVLHPLATGKVFLKTPMWVNKLVARYRIGAPSQPSRSAAQSDRPTGVAF  234



>ref|XP_002309232.2| hypothetical protein POPTR_0006s15780g [Populus trichocarpa]
 gb|EEE92755.2| hypothetical protein POPTR_0006s15780g [Populus trichocarpa]
Length=249

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +C     A Q  L  + +IAL Y  VF  FQVWRL+T FF
Sbjct  1     MSSPAEYYKSLPPISKVYGTLCLFLTTAVQFGLLYLPDIALMYKPVFSSFQVWRLITTFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  WSPF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLKAFYLPWAMLALDVIFGAPLVPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +YYFLTVLHPLATG     TPRWV+KLVA W  G
Sbjct  181   LYYFLTVLHPLATGNILLRTPRWVNKLVARWRIG  214



>ref|XP_006412852.1| hypothetical protein EUTSA_v10025986mg [Eutrema salsugineum]
 gb|ESQ54305.1| hypothetical protein EUTSA_v10025986mg [Eutrema salsugineum]
Length=266

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 165/219 (75%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C +     QL L    +IAL    V ++FQVWRL+TN F
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLLATTLSQLGLVAPVHIALIPELVIKQFQVWRLITNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG++ LLV+S  PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSLTLLVLSAIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSKIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TP+WV+KLVA W  G  V +
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKLVARWRIGAPVAA  219



>ref|XP_009760788.1| PREDICTED: derlin-1-like [Nicotiana sylvestris]
Length=240

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 164/231 (71%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +   A QL L    +IAL Y  +   FQVWRL+TNF 
Sbjct  1     MSSPAEFYKSLPPISKAYGTACLLLTTACQLGLCHPVHIALLYQPLISHFQVWRLITNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FGA  LLV+S  PF  SPF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLENGPFQRRTADFLWMMIFGAFTLLVLSAIPFFSSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFP+  IN+YGLV  K FYLPW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPDANINIYGLVTLKAFYLPWAMLCLDVIFGSSIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATGKN+  TP WVHKLV  W  G    +  + D S+G AF
Sbjct  181   LYYFLTVLHPLATGKNFLKTPMWVHKLVTRWRIGVPPINRAQPDRSSGVAF  231



>emb|CDY06822.1| BnaC01g09210D [Brassica napus]
Length=241

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 169/230 (73%), Gaps = 4/230 (2%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C +     QL L    +IAL    VF+ FQVWRL+TN F
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLLATTLAQLGLLAPIHIALIPEFVFKHFQVWRLITNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FG++ LLV+S  PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVLLEKGPFERRTADFLWMMIFGSLTLLVLSFIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVNLKAFYLPWAMLALDVIFGSKIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYFLTVLHPLATGKNY  TP+WV+KLVA     F++ +P  +   AG +
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKLVAR----FRIGAPVAAVRQAGES  226



>ref|XP_010688360.1| PREDICTED: derlin-1 [Beta vulgaris subsp. vulgaris]
Length=245

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP++K Y  IC +   A QL L + + IAL Y  VF+  +VWRL TNFF
Sbjct  1     MSSPAEWYNSLPPISKGYGTICLLFTVASQLGL-EPFYIALIYERVFKNLEVWRLFTNFF  59

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF +RTAD++WM +FGA+ LL +S  PFL++P  
Sbjct  60    FLGGFSINFGIRLLMIARYGVQLEQGPFQRRTADFLWMMIFGALSLLALSAIPFLYTPLC  119

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  IN+YGLV  K FYLPW ML +D+I G+ L PD LGI AGH
Sbjct  120   GISLVFMLLYVWSREFPNANINIYGLVSLKAFYLPWAMLALDVIFGSRLLPDFLGIVAGH  179

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYFLTVLHPLA GKN   TP WVHK+VA W    ++ +P  S P+AGTA
Sbjct  180   LYYFLTVLHPLAGGKNILKTPAWVHKIVARW----RIGAPVPSRPAAGTA  225



>ref|XP_004960894.1| PREDICTED: derlin-1-like [Setaria italica]
Length=242

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 167/228 (73%), Gaps = 0/228 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +CF T    QL + D   IAL+Y  VF+ F++WRL TNFF
Sbjct  1     MSSPAEYYNSLPPISKAYGTLCFFTTVLVQLRILDPKFIALYYPWVFKNFEIWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F+KRTAD++WM +FGAI LLV+S  P     F+
Sbjct  61    FLGPFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLVVSAIPLFEFSFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +IN+YGLVQ + FYLPW MLG+D+I G+PL P +LGI  GH
Sbjct  121   GIPMVSMLLYVWSREYPNSQINMYGLVQLRSFYLPWAMLGLDVIFGSPLLPGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAG  358
             +YYFL VLHPLATGKNY  TP+WVH +VA +  G Q NSP R   + G
Sbjct  181   LYYFLAVLHPLATGKNYLKTPKWVHSIVARFRIGVQANSPVRPPANTG  228



>emb|CAB79691.1| putative protein [Arabidopsis thaliana]
Length=281

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
              +YNSLPP+ K Y  +CF T  A QL L    +IAL    V ++FQ+WRL+TN FF+G F
Sbjct  21    RFYNSLPPITKAYGTLCFFTTVATQLGLVAPVHIALIPELVLKQFQIWRLITNLFFLGGF  80

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
             S  F  RLL+I RYGVQLE+GPF++RTAD++WM +FG+  LLV+S+ PF W+PF+G SLV
Sbjct  81    SINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFLGVSLV  140

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
             FM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH+YYFL
Sbjct  141   FMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGHLYYFL  200

Query  486   TVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             TVLHPLATGKNY  TP+WV+K+VA W  G  V S
Sbjct  201   TVLHPLATGKNYLKTPKWVNKIVARWRIGAPVAS  234



>ref|XP_009613361.1| PREDICTED: derlin-1-like [Nicotiana tomentosiformis]
Length=240

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 164/231 (71%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +   A QL L    +IAL Y  +   FQVWRL+TNF 
Sbjct  1     MSSPAEFYKSLPPISKAYGTACLLLTTACQLGLCHPVHIALLYEPLISHFQVWRLITNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FGA  LLV+S  PF  SPF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLENGPFQRRTADFLWMMIFGAFTLLVLSAIPFFSSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFP+  IN+YGLV  K FYLPW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPDANINIYGLVTLKAFYLPWAMLCLDVIFGSSIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLATG+N+  TP WVHKLV  W  G    +  + D S+G AF
Sbjct  181   LYYFLTVLHPLATGRNFLKTPMWVHKLVTRWRIGVPPINRAQPDRSSGVAF  231



>emb|CDY48611.1| BnaA01g07540D [Brassica napus]
Length=289

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 169/231 (73%), Gaps = 4/231 (2%)
 Frame = -1

Query  1044  KMSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNf  865
              MS+P EYYNSLPP+ K Y  +C +     QL L    +IAL    VF+ FQVWRL+TN 
Sbjct  48    NMSSPGEYYNSLPPITKAYGTLCLLATTLAQLGLLAPIHIALIPEFVFKHFQVWRLITNL  107

Query  864   ffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF  685
             FF+G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FG++ LLV+S  PF W+PF
Sbjct  108   FFLGGFSINFGIRLLMIARYGVLLEKGPFERRTADFLWMMIFGSLTLLVLSFIPFFWTPF  167

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
             +G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+ + PD+LGI AG
Sbjct  168   LGVSLVFMLLYLWSREFPNANISLYGLVNLKAFYLPWAMLALDVIFGSKIMPDLLGIIAG  227

Query  504   HIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             H+YYFLTVLHPLATGKNY  TP+WV+KLVA     F++ +P  +   AG +
Sbjct  228   HLYYFLTVLHPLATGKNYLKTPKWVNKLVAR----FRIGAPVAAVRQAGES  274



>ref|XP_006284336.1| hypothetical protein CARUB_v10005507mg [Capsella rubella]
 gb|EOA17234.1| hypothetical protein CARUB_v10005507mg [Capsella rubella]
Length=266

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 166/219 (76%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +CF T  A QL L     IAL    V ++FQ+WRLVT FF
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCFFTTVAKQLGLLSPAYIALLPELVIKQFQIWRLVTTFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             ++G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FG+  LLV+S+ PF W+PF+
Sbjct  61    YLGGFSINFGIRLLMIARYGVLLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLATGKNY  TP+WV+++VA +  G  V S
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNRIVARYRIGGPVAS  219



>gb|AET05171.2| derlin-2 protein [Medicago truncatula]
Length=233

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 160/219 (73%), Gaps = 0/219 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +  A YQL LY+  +IAL Y  VF RFQVWRL TNFF
Sbjct  1     MSSPGEFYKSLPPISKAYGTACLVATAVYQLGLYNPVHIALLYERVFFRFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  PF W+PF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+ L PD+LGI AGH
Sbjct  121   AISLVFMLLYVWSREFPNAQINLYGLVALKAFYLPWAMLALDVIFGSALMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             +YYFLTVLHPLA GKN   TP WV+       K   +  
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMWVYPFCRLLHKALSICC  219



>ref|XP_008803830.1| PREDICTED: derlin-1.2-like [Phoenix dactylifera]
Length=240

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 169/231 (73%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MSTP EYY SLPPV K Y V C MT+AA +L L +   I LFY  V ++FQVWRLVTNFF
Sbjct  1     MSTPGEYYRSLPPVTKAYGVFCLMTSAACRLHLLNARYILLFYDLVLKQFQVWRLVTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  R L++ RYGV LE+G F +RTAD++WM +FGA+ LLV+ +      P+M
Sbjct  61    FLGPFSIYFGLRFLMLARYGVLLEKGAFKQRTADFLWMMIFGALSLLVIGLISQFHFPYM  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W RE P+ +I++ GLV  KG YLPW ML +D+I  NPL PD+LGI AGH
Sbjct  121   GPSLVFMMLYVWSREVPDSQISIAGLVTIKGVYLPWAMLVLDLIFNNPLVPDILGILAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFL VL+PL+ GKN   TP WVHKLVAYWG+G Q+NSP + +  AG AF
Sbjct  181   LYYFLAVLYPLSGGKNILKTPLWVHKLVAYWGEGAQMNSPVQPNRHAGIAF  231



>ref|XP_009128855.1| PREDICTED: derlin-1 [Brassica rapa]
Length=262

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 4/220 (2%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +C +     QL L    +IAL    VF+ FQVWRL+TN F
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCLLATTLAQLGLLAPIHIALIPEFVFKHFQVWRLITNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FG++ LLV+S  PF W+PF+
Sbjct  61    FLGGFSINFGIRLLMIARYGVLLEKGPFERRTADFLWMMIFGSLTLLVLSFIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+ + PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVNLKAFYLPWAMLALDVIFGSKIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSP  382
             +YYFLTVLHPLATGKNY  TP+WV+KLVA     F++ +P
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVNKLVAR----FRIGAP  216



>ref|XP_003630694.1| Derlin-1 [Medicago truncatula]
 gb|AET05170.1| derlin-2 protein [Medicago truncatula]
Length=204

 Score =   258 bits (659),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPP++K Y   C +  A YQL LY+  +IAL Y  VF RFQVWRL TNFF
Sbjct  1     MSSPGEFYKSLPPISKAYGTACLVATAVYQLGLYNPVHIALLYERVFFRFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  PF W+PF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
               SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+ L PD+LGI AGH
Sbjct  121   AISLVFMLLYVWSREFPNAQINLYGLVALKAFYLPWAMLALDVIFGSALMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRW  433
             +YYFLTVLHPLA GKN   TP W
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMW  203



>ref|XP_004135679.1| PREDICTED: derlin-1-like [Cucumis sativus]
 ref|XP_004158425.1| PREDICTED: derlin-1-like [Cucumis sativus]
 gb|KGN66192.1| hypothetical protein Csa_1G575080 [Cucumis sativus]
Length=242

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP++K Y  +CF+   A+QL LYD   IAL Y  VF+ FQVWRL TNFF
Sbjct  1     MSSPAEFYNSLPPISKAYGTLCFLATTAFQLGLYDPMLIALDYGLVFKHFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FG++ LLV++  P    P +
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLENGPFQRRTADFLWMMIFGSLTLLVLAAIPIFQFPVL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGILAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +YYFLTVLHPLA GKN   TP W+ +LV+ W  G
Sbjct  181   LYYFLTVLHPLAGGKNILRTPFWIQRLVSRWRIG  214



>ref|XP_006284337.1| hypothetical protein CARUB_v10005507mg [Capsella rubella]
 gb|EOA17235.1| hypothetical protein CARUB_v10005507mg [Capsella rubella]
Length=206

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP+ K Y  +CF T  A QL L     IAL    V ++FQ+WRLVT FF
Sbjct  1     MSSPGEYYNSLPPITKAYGTLCFFTTVAKQLGLLSPAYIALLPELVIKQFQIWRLVTTFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             ++G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FG+  LLV+S+ PF W+PF+
Sbjct  61    YLGGFSINFGIRLLMIARYGVLLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  I++YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVH  427
             +YYFLTVLHPLATGKNY  TP+WV+
Sbjct  181   LYYFLTVLHPLATGKNYLKTPKWVY  205



>ref|XP_003568781.1| PREDICTED: derlin-1 [Brachypodium distachyon]
Length=240

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 169/231 (73%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +CF T    QL++ D   I L Y  VF+RFQ+WRL T+FF
Sbjct  1     MSSPAEYYNSLPPISKAYGTLCFFTTVLVQLQILDPTLIFLDYPFVFKRFQIWRLFTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F+KRTAD++WM +FGAI LLV+S  P+L + F+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGSFEKRTADFLWMMIFGAISLLVLSAIPYLQTAFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +I++YGLVQ + FYLPW ML +D++ G+ + P +LGI  GH
Sbjct  121   GVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLALDVVFGSKILPGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYF  VLHPLA+GKNY  TP WVH++VA +  G Q NSP R   +  +AF
Sbjct  181   LYYFFAVLHPLASGKNYLKTPVWVHRIVARFRFGVQANSPVRPTNTGPSAF  231



>ref|XP_011093654.1| PREDICTED: derlin-1 [Sesamum indicum]
Length=240

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 167/232 (72%), Gaps = 2/232 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIA-LFYSDVFRRFQVWRLVTNf  865
             MS+P EYY SLPP+ K Y   CF+   A QL +     IA + Y  +F  FQVWRL+TNF
Sbjct  1     MSSPAEYYKSLPPITKAYGTACFLVTVACQLGILSPGLIAHVPYLSIFH-FQVWRLITNF  59

Query  864   ffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF  685
             FF+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM LFGA  LLV+S  P+ WSPF
Sbjct  60    FFLGKFSINFGIRLLMIARYGVQLENGPFQRRTADFLWMMLFGAFSLLVLSSIPYFWSPF  119

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
             +G SLVFM++Y+W RE+PN  IN+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AG
Sbjct  120   LGISLVFMLLYLWSREYPNATINIYGLVALKAFYLPWAMLCLDVIFGSPIVPDLLGIVAG  179

Query  504   HIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             H+YYFLTVLHPLA G+N   TP  +HKLVA W  G  VN+  + D ++G AF
Sbjct  180   HLYYFLTVLHPLAGGRNILRTPALIHKLVARWRIGAPVNNVPQPDRTSGVAF  231



>gb|AAS88720.1| putative Der1-like family protein [Cynodon dactylon]
Length=260

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 167/231 (72%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP++K +  +C +TA   QL + D + I L+Y  VF++FQ+WRL T F 
Sbjct  1     MSSPAEWYNSLPPISKAFGTLCVVTATLLQLNILDGYFIVLYYPLVFKKFQIWRLFTTFI  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
              +G FS  F  RLL+I RYGVQLE+G F++RTAD++WM +FGAI LLV+S  P+L  P +
Sbjct  61    CLGGFSMNFGIRLLMIARYGVQLEKGVFERRTADFLWMMIFGAISLLVLSAIPYLQLPLL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +IN+YGL+  + FYLPW ML +D+I G+ + P ++GI  GH
Sbjct  121   GIPMVSMLLYVWSREYPNAQINIYGLILLRSFYLPWVMLALDVIFGSSIIPGLMGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYF TVLHPLATGKNY  TP+WVH +VA +G G Q NSP R   +   AF
Sbjct  181   LYYFFTVLHPLATGKNYLKTPKWVHWIVARFGIGVQANSPVRPASTGSGAF  231



>ref|XP_008450797.1| PREDICTED: derlin-1 [Cucumis melo]
Length=242

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP++K Y  +C +   A+QL LYD   IAL Y  VF+ FQVWRL TNFF
Sbjct  1     MSSPAEFYNSLPPISKAYGTLCLLATTAFQLGLYDPMLIALDYGLVFKHFQVWRLFTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM +FG + LLV++  P    P +
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLENGPFQRRTADFLWMMIFGGLTLLVLAAIPIFRFPVL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGILAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             +YYFLTVLHPLA GKN   TP W+ +LV+ W  G
Sbjct  181   LYYFLTVLHPLAGGKNILRTPFWIQRLVSRWRIG  214



>dbj|BAJ96246.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93196.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 169/231 (73%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +CF T    QL++ +   + L Y  VF+ FQ+WRL T+FF
Sbjct  1     MSSPGEYYNSLPPISKAYGTLCFFTTVLVQLQILNPGLLILSYPHVFKSFQIWRLFTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F+KRTAD++WM +FGA+ LLV+S  P+L +  +
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGSFEKRTADFLWMMIFGAVSLLVLSAIPYLETYLL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +I++YGLVQ + FYLPW MLG+D+I G+P+ P +LGI  GH
Sbjct  121   GIPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSPILPGLLGILVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYF TVLHPLA+GKNY  TP WVHK+VA +  G Q NS  R   +  +AF
Sbjct  181   LYYFFTVLHPLASGKNYLKTPMWVHKIVARFRLGVQANSLARQANTGPSAF  231



>sp|Q06397.2|DERL1_ORYSJ RecName: Full=Derlin-1; AltName: Full=18 kDa cold-induced protein; 
AltName: Full=DER1-like protein 1; AltName: Full=OsDerlin 
1-1 [Oryza sativa Japonica Group]
 dbj|BAH01528.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78652.1| hypothetical protein OsI_18749 [Oryza sativa Indica Group]
 gb|EEE62589.1| hypothetical protein OsJ_17392 [Oryza sativa Japonica Group]
Length=242

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 169/230 (73%), Gaps = 2/230 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +CF      QL++ +   +AL+Y  VF++FQ+WRL T+FF
Sbjct  1     MSSPAEYYNSLPPISKAYGTLCFFATVLCQLQILNPPFLALYYPFVFKKFQIWRLFTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F+KRTAD++WM +FGAI LL +S  PFL   F+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDIYFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +I++YGLVQ + FYLPW MLG+D+I G+ + P +LGI  GH
Sbjct  121   GVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGILVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
              YYFL+VLHPLATGKNY  TP WVHK+VA +  G Q N+P R  P+A   
Sbjct  181   TYYFLSVLHPLATGKNYLKTPMWVHKIVARFRIGVQANAPVR--PAAANT  228



>gb|EYU27250.1| hypothetical protein MIMGU_mgv1a012777mg [Erythranthe guttata]
Length=240

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 163/231 (71%), Gaps = 0/231 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP+ K Y   C M   A Q+ L     I       F RFQVWRL+TNFF
Sbjct  1     MSSPAEYYQSLPPITKAYGTACLMVTVACQIGLLHPELIGHAPEVTFWRFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF +RTAD++WM LFGA+ LLV+S  PF  S F+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLETGPFQRRTADFLWMMLFGALSLLVLSAIPFFESAFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++YIW REFPN  IN+YGL+  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLLYIWSREFPNATINLYGLLALKAFYLPWAMLCLDVIFGSPIVPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             +YYFLTVLHPLA G+N   TP ++ K+VA W  G  VN+  ++D ++G AF
Sbjct  181   LYYFLTVLHPLAGGRNILKTPYFIQKIVARWRIGAPVNNAPQADRTSGVAF  231



>ref|XP_006580484.1| PREDICTED: derlin-1-like isoform X2 [Glycine max]
Length=219

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 150/204 (74%), Gaps = 0/204 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y+SLPP+ K Y  +C +  A Y L L     IAL Y  VF  FQ WRL TN F
Sbjct  1     MSSPAEFYHSLPPITKAYGTVCLLATATYHLGLDHPAYIALLYDKVFYGFQAWRLFTNLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  P  WSPF+
Sbjct  61    FLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
                LVFM++Y+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   AVPLVFMLLYVWSREFPNAQINIYGLVALKAFYLPWAMLALDIIFGSPLIPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWV  430
             +YYFLTVLHPLA GKN   TP WV
Sbjct  181   LYYFLTVLHPLAGGKNILKTPMWV  204



>gb|KDO55857.1| hypothetical protein CISIN_1g022636mg [Citrus sinensis]
Length=294

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 156/205 (76%), Gaps = 0/205 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY+SLPP+ K Y  +C   A    L L D+  +AL Y  VF +FQVWRL+TNFF
Sbjct  1     MSSPAEYYHSLPPICKAYGTLCVAVATVCSLGLLDLSILALEYKLVFSKFQVWRLITNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGV LE+GPF++RTAD++WM +FGA+ LLV+S  P   S F+
Sbjct  61    FLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM+VY+W REFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH
Sbjct  121   GISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVH  427
             +YYFLTVLHPLATGKN   TP+WV+
Sbjct  181   LYYFLTVLHPLATGKNLLKTPKWVY  205



>ref|XP_006654127.1| PREDICTED: derlin-1-like [Oryza brachyantha]
Length=242

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 164/222 (74%), Gaps = 0/222 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +CF T    QL++     +AL+Y  VF++F++WRL T+FF
Sbjct  1     MSSPGEYYNSLPPISKAYGTLCFFTTVLCQLQILSPSFLALYYPFVFKKFEIWRLFTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F+KRTAD++WM +FGAI LL +S  PFL   F+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDIYFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +I++YGLVQ + FYLPW MLG+D+I G+ + P +LGI  GH
Sbjct  121   GVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGIIVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFR  376
              YYF +VLHPLATGKNY  TP WVHK+V  +  G Q N+P R
Sbjct  181   TYYFFSVLHPLATGKNYLKTPMWVHKIVGRFRLGVQANAPVR  222



>ref|XP_002440740.1| hypothetical protein SORBIDRAFT_09g005900 [Sorghum bicolor]
 gb|EES19170.1| hypothetical protein SORBIDRAFT_09g005900 [Sorghum bicolor]
Length=244

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 164/230 (71%), Gaps = 0/230 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF+T    +L + D   + L+Y  VF++FQVWRL T+F 
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFLTTVLVRLHIVDGGFLVLYYPWVFKKFQVWRLFTSFI  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGV LE+G FD+RTAD++WM +FGAI LLV+S+ P L +  +
Sbjct  61    FLGPFSINFGIRLLMIARYGVMLEKGAFDRRTADFLWMMIFGAISLLVVSVIPLLNTYTL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M+VY+W RE PN +IN+YGLVQ + FYLPW ML +D+I G+PL   +LGI  GH
Sbjct  121   GVPMVNMLVYVWSRENPNAQINIYGLVQLRAFYLPWVMLLLDVIFGSPLMGGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYF  VLHPLATGKNY  TP+WVHK+VA +  G Q N+P R   +  T 
Sbjct  181   LYYFFAVLHPLATGKNYLKTPKWVHKIVARYRIGVQANAPVRPQANGNTG  230



>ref|XP_010109598.1| hypothetical protein L484_002163 [Morus notabilis]
 gb|EXC23404.1| hypothetical protein L484_002163 [Morus notabilis]
Length=816

 Score =   266 bits (679),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -1

Query  939  DVWNI--ALFYSDVFRRFQVWRLVTNfffigafsftfaFRLLIILRYGVQLERGPFDKRT  766
             VWN+   LF +      QVWRL+TNFFF+G FSF FAFRL+II +YGV LER PFDKRT
Sbjct  571  SVWNLDGELFQAHQLST-QVWRLITNFFFLGPFSFPFAFRLIIIAKYGVSLERAPFDKRT  629

Query  765  ADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFPNERINVYGLVQFKGF  586
            ADYVWM  FGA+ LLVM++ P  WSPF+G+SLVFMIVY+WGREFPN RI++YGLV FKGF
Sbjct  630  ADYVWMLTFGALSLLVMAVVPSFWSPFLGSSLVFMIVYVWGREFPNARISIYGLVSFKGF  689

Query  585  YLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWG  406
            YLPW ML +D++ GNPL PD+ GI AGH+YYFLTVL+PL++GKN   TPRW+HKLVAYWG
Sbjct  690  YLPWAMLALDLLFGNPLMPDIQGIIAGHLYYFLTVLYPLSSGKNILKTPRWIHKLVAYWG  749

Query  405  KGFQVNSPFRSDPSAGTAF  349
            +G Q+NSP + DPS G AF
Sbjct  750  EGAQINSPVQRDPSVGVAF  768



>gb|ACG43860.1| derlin-3 [Zea mays]
Length=243

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 165/230 (72%), Gaps = 1/230 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+  FS  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LLV+SI P   S F+
Sbjct  61    FLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE PN +IN+YGLVQ + FYLPW ML +D+I G+ L P +LGI  GH
Sbjct  121   GIPMVSMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYF  VLHPLATGKNY  TP+WVHK+V+ +  G Q NSP R  P+ G +
Sbjct  181   LYYFFAVLHPLATGKNYLKTPKWVHKIVSRFRIGMQANSPVR-PPANGNS  229



>ref|NP_001105797.1| derlin-1.2 [Zea mays]
 sp|Q4G2J5.1|DER12_MAIZE RecName: Full=Derlin-1.2; AltName: Full=ZmDerlin1-2 [Zea mays]
 gb|AAY41609.1| derlin1-2 [Zea mays]
 gb|AAY41613.1| derlin1-2 [Zea mays]
 gb|ACG36100.1| derlin-3 [Zea mays]
 gb|AFW77374.1| derlin-1.2 [Zea mays]
Length=243

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 168/230 (73%), Gaps = 1/230 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF T    +L + +   + L+Y  VF++F+VWR+ T+FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFFTTVLVRLHILNPLFLYLYYPRVFKKFEVWRIFTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LLV+S+ P L +  +
Sbjct  61    FLGPFSINFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSVIPQLNTYVL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M+VY+W RE PN +IN+YG++Q K FYLPW ML +D+I G+PL P +LGI  GH
Sbjct  121   GLPMVSMLVYVWSRENPNAQINIYGILQLKAFYLPWVMLLLDVIFGSPLMPGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YY+  VLHPLATGKNY  TP+WVHK+VA +  G Q N+P R+ P+ G A
Sbjct  181   LYYYFAVLHPLATGKNYLKTPKWVHKIVARFRIGMQANAPVRA-PANGNA  229



>ref|NP_001105945.1| derlin-1.1 [Zea mays]
 sp|Q4G2J6.2|DER11_MAIZE RecName: Full=Derlin-1.1; AltName: Full=ZmDerlin1-1 [Zea mays]
 gb|AAY41608.1| derlin1-1 [Zea mays]
 gb|ACN27325.1| unknown [Zea mays]
 gb|AFW82013.1| derlin-1.1 isoform 1 [Zea mays]
 gb|AFW82014.1| derlin-1.1 isoform 2 [Zea mays]
Length=243

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 165/230 (72%), Gaps = 1/230 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+  FS  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LLV+SI P   S F+
Sbjct  61    FLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE PN +IN+YGLVQ + FYLPW ML +D+I G+ L P +LGI  GH
Sbjct  121   GIPMVSMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYF  VLHPLATGK+Y  TP+WVHK+VA +  G Q NSP R  P+ G +
Sbjct  181   LYYFFAVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVR-PPANGNS  229



>ref|XP_010110870.1| hypothetical protein L484_006985 [Morus notabilis]
 gb|EXC28689.1| hypothetical protein L484_006985 [Morus notabilis]
Length=236

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 155/213 (73%), Gaps = 2/213 (1%)
 Frame = -1

Query  1023  YYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafs  844
             YY SLPP++K Y  +C +T   YQL LYD  ++AL+Y  VF RFQVWRL+T  FF+G FS
Sbjct  4     YYKSLPPISKAYGTLCLLTTVGYQLGLYDKLDLALYYPYVFHRFQVWRLITTLFFLGGFS  63

Query  843   ftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVF  664
               F  RLL+I RYGVQLE+GPFD+RTAD++WM +FGA+ LLV+SI P   S ++G SLVF
Sbjct  64    INFGIRLLMIARYGVQLEKGPFDRRTADFLWMMIFGALTLLVLSIIPIFQSFYLGISLVF  123

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M+VY+W REFP+  IN+YGLV  K FYLPW ML +D++ G+P+  D+LGI AGH+YYFLT
Sbjct  124   MLVYVWSREFPSANINIYGLVTLKAFYLPWAMLALDVLFGSPIMQDLLGIIAGHLYYFLT  183

Query  483   VLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             VLHPLA GKN   TP  V   V  W   F  N+
Sbjct  184   VLHPLAGGKNILKTPTGVK--VRIWPAVFADNA  214



>ref|XP_006853718.1| hypothetical protein AMTR_s00056p00158870 [Amborella trichopoda]
 gb|ERN15185.1| hypothetical protein AMTR_s00056p00158870 [Amborella trichopoda]
Length=243

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 164/225 (73%), Gaps = 1/225 (0%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
              +Y SLPPV+K Y  IC +T  A QL L D+  I L  + VFR FQ+WRL+TNFFF+G F
Sbjct  9     RFYRSLPPVSKAYGTICLLTTTAVQLGLIDLDYIVLIPNRVFRNFQIWRLITNFFFLGNF  68

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
             S  F  RLL+I RYGVQLERGPFD+RTAD++WM LFG+  LL++S+ P L S  +G S V
Sbjct  69    SINFGIRLLMIARYGVQLERGPFDRRTADFLWMMLFGSFSLLILSLIPPLNSLCLGISSV  128

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
             FM+VY+W REFPN +IN+YGLVQ + FYLPW +L +D+I G+PL PD++GI AGH+YYFL
Sbjct  129   FMLVYVWSREFPNAQINIYGLVQLRAFYLPWAILVLDVIFGSPLLPDLMGIVAGHLYYFL  188

Query  486   TVLHPLATGKNYFNTPRWVHKLV-AYWGKGFQVNSPFRSDPSAGT  355
              VLHPLA G+N   TP WVHKL  + W  G QVN+P    P+ G 
Sbjct  189   AVLHPLAGGRNILKTPVWVHKLARSLWVLGPQVNAPAEQSPTTGA  233



>ref|XP_008654203.1| PREDICTED: derlin-1.1 isoform X1 [Zea mays]
Length=280

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 160/225 (71%), Gaps = 1/225 (0%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
              YY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FFF+  F
Sbjct  43    RYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFFFLAPF  102

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
             S  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LLV+SI P   S F+G  +V
Sbjct  103   SMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFLGIPMV  162

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M++Y+W RE PN +IN+YGLVQ + FYLPW ML +D+I G+ L P +LGI  GH+YYF 
Sbjct  163   SMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGHLYYFF  222

Query  486   TVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
              VLHPLATGK+Y  TP+WVHK+VA +  G Q NSP R  P+ G +
Sbjct  223   AVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVR-PPANGNS  266



>ref|XP_006578365.1| PREDICTED: derlin-1-like isoform X2 [Glycine max]
Length=214

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  810  RYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFP  631
            +YGV LERGPFD RTADYVWMF+FGA+ LLV++  PF W PFMG SLVFM+VY+W REFP
Sbjct  11   KYGVSLERGPFDNRTADYVWMFIFGALSLLVIAAVPFFWYPFMGISLVFMLVYVWSREFP  70

Query  630  NERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNY  451
            N RIN+YG+V  KGFYLPW +L +D+I G+P+KPD++G+ AGH+YYFLTVLHPLA GK  
Sbjct  71   NARINIYGVVSLKGFYLPWALLALDLIFGDPIKPDIVGMIAGHLYYFLTVLHPLAGGKFR  130

Query  450  FNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
            F TP WVHK+VAYWG+G Q+N+P +S+PSAG  F
Sbjct  131  FKTPLWVHKIVAYWGEGTQINAPVQSNPSAGIVF  164



>ref|XP_006450745.1| hypothetical protein CICLE_v10010701mg [Citrus clementina]
 gb|ESR63985.1| hypothetical protein CICLE_v10010701mg [Citrus clementina]
Length=295

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 155/256 (61%), Gaps = 38/256 (15%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+YNSLPP+ K Y  IC    AA  L LY   +IALFY  VF +FQ         
Sbjct  1     MSSPAEFYNSLPPITKAYGTICVAATAALHLGLYSPLSIALFYEPVFSQFQ---------  51

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
                 FS  F   LL++ RYGVQLE+  F++RTAD++WM +FGAI LL +S  P LW+PF+
Sbjct  52    ----FSVNFGIHLLMLARYGVQLEKSTFERRTADFLWMMIFGAISLLALSAIPMLWTPFL  107

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFK-------------------------GFYLP  577
             G SLVFM++Y+W REFP  +I++YG    +                          FYLP
Sbjct  108   GVSLVFMLLYVWSREFPTAQISIYGRSPLRCFVSCHVVLSGLVDNIHVLLLFGSLAFYLP  167

Query  576   WYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGF  397
             W ML +D+I G+PL P+ LGI AGH+YYFLTVLHPLA G+N   TPRWVHKLVA+W  G 
Sbjct  168   WAMLALDVIFGSPLLPNFLGIIAGHLYYFLTVLHPLAGGRNILATPRWVHKLVAFWRLGH  227

Query  396   QVNSPFRSDPSAGTAF  349
               N+  + +  AG  F
Sbjct  228   PTNASVQPERGAGGGF  243



>ref|NP_001105128.1| sor protein [Zea mays]
 emb|CAB97005.1| putative NADH oxidoreductase [Zea mays]
Length=259

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 160/225 (71%), Gaps = 1/225 (0%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
              YY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FFF+  F
Sbjct  22    RYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFFFLAPF  81

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
             S  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LLV+S+ P L +  +G  +V
Sbjct  82    SMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSVIPQLNTYVLGLPMV  141

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W RE PN +IN+YG++Q K FYLPW ML +D+I G+PL P +LGI  GH+YY+ 
Sbjct  142   SMLVYVWSRENPNAQINIYGILQLKAFYLPWVMLLLDVIFGSPLMPGLLGIMVGHLYYYF  201

Query  486   TVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
              VL PLATGK+Y  TP+WVHK+VA +  G Q NSP R  P+ G +
Sbjct  202   AVLDPLATGKSYLKTPKWVHKIVARFRIGMQANSPVR-PPANGNS  245



>emb|CDP03237.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 148/208 (71%), Gaps = 0/208 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E+Y SLPPV K Y   C +   A Q+ L   ++ A     VF  FQV +L T  F
Sbjct  1     MSSPAEWYKSLPPVTKIYGTACLVCTVACQIGLLTPFDFAYIPRLVFFNFQVHKLFTTLF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE GPF  RTAD++WM +FGA  LLV++  P L SPF+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLESGPFQGRTADFLWMMIFGAFSLLVLAAIPPLQSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVFM++Y+W REFPN  IN+YGLV  K FYLPW ML +D+I G+P+ PD+LGI AGH
Sbjct  121   GISLVFMLLYVWSREFPNASINIYGLVNLKAFYLPWAMLCLDVIFGSPIIPDLLGIVAGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLV  418
             ++YFLTVLHPLATG+N   TP+WV KLV
Sbjct  181   LFYFLTVLHPLATGRNILKTPQWVQKLV  208



>gb|AAS86403.1| putative Der1 protein [Oryza sativa Japonica Group]
 gb|AAV31196.1| unknow protein [Oryza sativa Japonica Group]
Length=310

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 152/201 (76%), Gaps = 0/201 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYYNSLPP++K Y  +CF      QL++ +   +AL+Y  VF++FQ+WRL T+FF
Sbjct  1     MSSPAEYYNSLPPISKAYGTLCFFATVLCQLQILNPPFLALYYPFVFKKFQIWRLFTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+G F+KRTAD++WM +FGAI LL +S  PFL   F+
Sbjct  61    FLGKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDIYFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE+PN +I++YGLVQ + FYLPW MLG+D+I G+ + P +LGI  GH
Sbjct  121   GVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGILVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTP  439
              YYFL+VLHPLATGKNY  TP
Sbjct  181   TYYFLSVLHPLATGKNYLKTP  201



>gb|EPS66230.1| hypothetical protein M569_08547, partial [Genlisea aurea]
Length=236

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 151/226 (67%), Gaps = 2/226 (1%)
 Frame = -1

Query  1023  YYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafs  844
             YY SLPP+ K Y   C     A QL L    NIA      F  F+VWRL+TNFFF+G FS
Sbjct  1     YYKSLPPITKAYGTACLFVTVACQLGLLYPGNIAHVPELSFMHFEVWRLITNFFFLGKFS  60

Query  843   ftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVF  664
               F  RLL+I RYGVQLE GPF  RTAD++WM LFGA+ LLV S  P LWSPF+G S+VF
Sbjct  61    MNFGIRLLMIARYGVQLETGPFQGRTADFLWMMLFGALSLLVFSSIPPLWSPFLGISVVF  120

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M++Y+W RE+PN  +++YGL+  K FYLPW ML +D+I G+P  PD+LGI AGH+YYFLT
Sbjct  121   MLLYVWSREYPNASVSIYGLLTMKAFYLPWAMLCLDVIFGSPFLPDLLGIVAGHLYYFLT  180

Query  483   VLHPLATGKNYFNTPRWVHKLVAYWGKGFQV--NSPFRSDPSAGTA  352
             VLHPL+ G N   TP  +H++V     G  V  +S  R D + G A
Sbjct  181   VLHPLSGGSNILKTPALIHRVVRRLRIGVAVGNDSRRRDDETTGGA  226



>gb|AFW82015.1| hypothetical protein ZEAMMB73_273794 [Zea mays]
Length=204

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 148/203 (73%), Gaps = 0/203 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+  FS  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LLV+SI P   S F+
Sbjct  61    FLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G  +V M++Y+W RE PN +IN+YGLVQ + FYLPW ML +D+I G+ L P +LGI  GH
Sbjct  121   GIPMVSMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGH  180

Query  501   IYYFLTVLHPLATGKNYFNTPRW  433
             +YYF  VLHPLATGK+Y  TP+W
Sbjct  181   LYYFFAVLHPLATGKSYLKTPKW  203



>gb|EMS65096.1| hypothetical protein TRIUR3_27036 [Triticum urartu]
Length=306

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 149/199 (75%), Gaps = 0/199 (0%)
 Frame = -1

Query  1023  YYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafs  844
             YYNSLPP++K Y  +CF T    QL++ D   + L Y  VF+ FQ+WRL T+FFF+G FS
Sbjct  33    YYNSLPPISKAYGTLCFFTTVLVQLQILDPGLLYLSYPYVFKSFQIWRLFTSFFFLGKFS  92

Query  843   ftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVF  664
               F  RLL+I RYGVQLE+G F+KR AD++WM +FGAI LLV+S  P+L +  +G  +V 
Sbjct  93    INFGIRLLMIARYGVQLEKGSFEKRAADFLWMMIFGAISLLVLSAIPYLETYLLGIPMVS  152

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M++Y+W RE+PN +I++YGLVQ + FYLPW MLG+D+I G+P+ P +LGI  GH+YYF T
Sbjct  153   MLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSPILPGLLGIMVGHLYYFFT  212

Query  483   VLHPLATGKNYFNTPRWVH  427
             VL+PLA+GKNY  TP WV+
Sbjct  213   VLYPLASGKNYLKTPMWVY  231



>ref|XP_007012198.1| DERLIN-1, putative [Theobroma cacao]
 gb|EOY29817.1| DERLIN-1, putative [Theobroma cacao]
Length=340

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 159/272 (58%), Gaps = 45/272 (17%)
 Frame = -1

Query  1029  MEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffiga  850
             + +Y SLPP+ K Y  IC +   A+ L  Y + +IA  +  V   FQVWRL+TNFFF+G 
Sbjct  65    LSFYKSLPPITKAYGSICVVANVAFHLGPYRLEHIAFLHKLVISDFQVWRLLTNFFFLGN  124

Query  849   fsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASL  670
             FS  F  RLL+I RYGVQLE+GPF++ TAD++WM + GA+ LL +S  P L SPF+G SL
Sbjct  125   FSVNFGIRLLMIARYGVQLEKGPFERWTADFLWMMIVGALSLLALSAIPMLRSPFLGISL  184

Query  669   VFMIVYIWGREFPNERINVYGLVQFK----------------------------------  592
             VFM++YIW REFPN ++NVYGLV  K                                  
Sbjct  185   VFMLLYIWSREFPNAQVNVYGLVALKAHISYKSVSRLCLNSAIFFHLLLLVVWVCWCKCL  244

Query  591   -------GFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRW  433
                     FYLPW ML +D++ G+PLKPD++GI AGHIYYFLTVL PLA G+N   TP  
Sbjct  245   YVTAGTQAFYLPWAMLALDVLFGSPLKPDLMGIIAGHIYYFLTVLQPLAGGRNILATPTC  304

Query  432   V----HKLVAYWGKGFQVNSPFRSDPSAGTAF  349
             V    HKLV     G   N+  + D + G AF
Sbjct  305   VYPFMHKLVEGGRLGDPTNAHVQQDRATGVAF  336



>ref|XP_001776950.1| predicted protein [Physcomitrella patens]
 gb|EDQ58199.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 149/213 (70%), Gaps = 1/213 (0%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P E++ SLPPV+KTY  +CF+T  A+ L L     + L ++ V + FQ+WRL+TNFF
Sbjct  1     MSSPGEWFYSLPPVSKTYGTLCFLTTIAFTLHLVSPAWLYLDFALVTKNFQIWRLLTNFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSI-FPFLWSPF  685
             F+G+FS  F  RL++I RYGVQLE+GPF  RTAD++WM +   I  LV+S+  PF  S F
Sbjct  61    FLGSFSIPFGVRLMMIARYGVQLEQGPFKDRTADFLWMMIVSVISFLVLSLTVPFFKSFF  120

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
             +G SLVFM++Y+W REFP   +++ GLV  +GF+LPW ML ++ I G P+  D+LGI  G
Sbjct  121   LGPSLVFMLLYVWSREFPTSTVSIMGLVNLQGFWLPWAMLLVNTIFGMPIMSDLLGIIVG  180

Query  504   HIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWG  406
             H+YYFLTVLHP A G+ Y  TP WV KL   W 
Sbjct  181   HVYYFLTVLHPRAGGQEYLKTPTWVRKLATKWS  213



>gb|ACU23590.1| unknown [Glycine max]
Length=172

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = -1

Query  819  IILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGR  640
            +I+RYGVQLE+GPFD+RTAD++WM +FGA  LLV+S  P  WSPF+   LVFM++Y+W R
Sbjct  1    MIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPIFWSPFLAVPLVFMLLYVWSR  60

Query  639  EFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATG  460
            EFPN +IN+YGLV  K FYLPW ML +D+I G+PL PD+LGI AGH+YYF TVLHPLA G
Sbjct  61   EFPNAQINIYGLVALKAFYLPWAMLALDVIFGSPLIPDLLGIIAGHLYYFFTVLHPLAGG  120

Query  459  KNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSA  361
            KN   TP WVHKL+A W  G Q   P    P+A
Sbjct  121  KNILKTPMWVHKLIARWRIGVQ---PISRGPAA  150



>gb|KDO79933.1| hypothetical protein CISIN_1g035602mg, partial [Citrus sinensis]
Length=194

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 116/170 (68%), Gaps = 16/170 (9%)
 Frame = -1

Query  810  RYGVQLERGPFDKRTADYVWMFLFGAI----------------GLLVMSIFPFLWSPFMG  679
            RYGVQLE+  F++RTAD++WM +F +                  LL +S  P LW+PF+G
Sbjct  2    RYGVQLEKSTFERRTADFLWMMIFSSYIIAEFFFSSWDFYVLSELLALSAIPMLWTPFLG  61

Query  678  ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
             SLVFM++Y+W REFP  +I++YGLV  K FYLPW ML +D+I G+PL P+ LGI AGH+
Sbjct  62   VSLVFMLLYVWSREFPTAQISIYGLVTLKAFYLPWAMLALDVIFGSPLLPNFLGIIAGHL  121

Query  498  YYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTAF  349
            YYFLTVLHPLA G+N   TPRWVHKLVA+W  G   N+  + +  AG AF
Sbjct  122  YYFLTVLHPLAGGRNILATPRWVHKLVAFWRLGHPTNASVQPERGAGGAF  171



>gb|ACN34963.1| unknown [Zea mays]
 gb|AFW82011.1| hypothetical protein ZEAMMB73_273794 [Zea mays]
Length=162

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -1

Query  795  LERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFPNERIN  616
            LE+G FDKRTAD++WM +FGAI LLV+SI P   S F+G  +V M++Y+W RE PN +IN
Sbjct  2    LEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFLGIPMVSMLLYVWSRENPNAQIN  61

Query  615  VYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPR  436
            +YGLVQ + FYLPW ML +D+I G+ L P +LGI  GH+YYF  VLHPLATGK+Y  TP+
Sbjct  62   IYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGHLYYFFAVLHPLATGKSYLKTPK  121

Query  435  WVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
            WVHK+VA +  G Q NSP R  P+ G +
Sbjct  122  WVHKIVARFRIGMQANSPVR-PPANGNS  148



>ref|XP_008654204.1| PREDICTED: derlin-1.1 isoform X2 [Zea mays]
Length=200

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 134/230 (58%), Gaps = 44/230 (19%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+  FS  F  RLL+I RYGV LE+G FDKRTAD++WM +FGAI LL             
Sbjct  61    FLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLL-------------  107

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
                                            FYLPW ML +D+I G+ L P +LGI  GH
Sbjct  108   ------------------------------SFYLPWAMLLLDVIFGSSLMPGLLGIMVGH  137

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYF  VLHPLATGK+Y  TP+WVHK+VA +  G Q NSP R  P+ G +
Sbjct  138   LYYFFAVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVR-PPANGNS  186



>ref|XP_008390846.1| PREDICTED: derlin-1-like, partial [Malus domestica]
Length=153

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -1

Query  771  RTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVYIWGREFPNERINVYGLVQFK  592
            RTAD++WM +FGA  LLV+S  P  +SPF+G SLVFM+VY+W REFPN  +N+YGLVQ K
Sbjct  1    RTADFLWMMIFGATTLLVLSAIPIFYSPFLGISLVFMLVYVWSREFPNANVNIYGLVQLK  60

Query  591  GFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHPLATGKNYFNTPRWVHKLVAY  412
             FYLPW ML +D+I G+P+ PD+LGI AGH++YFLTVLHPLA GKN   TPRWV K+VA 
Sbjct  61   AFYLPWAMLALDVIFGSPIMPDLLGIIAGHLFYFLTVLHPLAGGKNILQTPRWVRKIVAR  120

Query  411  WGKGFQVNSPFRSDPSAGTA  352
            W  G    +     P    A
Sbjct  121  WRIGAPPPTSRTQPPPPAAA  140



>ref|XP_003054796.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60048.1| predicted protein [Micromonas pusilla CCMP1545]
Length=251

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 143/218 (66%), Gaps = 11/218 (5%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDV----WNIALFYSDVFRRFQVWRLVT  871
             S+P ++Y SLPPV K +   C  +A A QL + D+    W++ L    V ++FQ+WRLVT
Sbjct  3     SSPGDWYQSLPPVCKAWGTACMASAVASQLGMIDLSMFHWSLPL----VIKKFQIWRLVT  58

Query  870   NfffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLF-GAIGLLVMSIFPFL-  697
             NF F+G FSF F  R+++I RYGV LE+  F  RTAD++WM L  G + L V ++FP + 
Sbjct  59    NFCFLGRFSFPFVVRMMMIARYGVFLEQQTFAGRTADFLWMLLITGGVLLPVPTLFPSVS  118

Query  696   WSPFMGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLG  517
             +SPF GASL F ++Y+W RE PN   ++ G+V  K FYLPW M+ + M++G  + PD LG
Sbjct  119   FSPFAGASLAFALLYLWSRENPNANTSIMGMVSMKAFYLPWGMMALTMVMGGSVVPDFLG  178

Query  516   IAAGHIYYFLTVLHPLATGKNYFNTPRWVHKLV-AYWG  406
             + AGH+YYFL VL+P A G     TP ++H LV A WG
Sbjct  179   VMAGHLYYFLAVLNPAAGGPRVVRTPGFIHALVKAVWG  216



>ref|XP_002507057.1| derlin-like protein [Micromonas sp. RCC299]
 gb|ACO68315.1| derlin-like protein [Micromonas sp. RCC299]
Length=269

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 132/208 (63%), Gaps = 1/208 (0%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
             ++P ++YNSLPPV K +   CF      Q  L D+ N+ L ++ V  +F VWRL+TNF F
Sbjct  5     ASPSDWYNSLPPVCKAWGTACFACTLFSQFGLVDLRNLYLDWALVSSKFHVWRLLTNFCF  64

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLL-VMSIFPFLWSPFM  682
             +G FSF F  R+++I RYGV LE+  F  R AD+VWM +   + L+ + ++ P +  PF 
Sbjct  65    LGKFSFPFLMRMMMIARYGVFLEQHTFAGRIADFVWMVMLCVLVLVPIPALVPSIQIPFF  124

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G SLVF ++Y+W RE PN   ++ G++  K FYLPW MLG+ +++G    PD+LGI AGH
Sbjct  125   GPSLVFTLLYLWSRENPNANTSIMGMITMKAFYLPWGMLGMGLVMGQDPVPDLLGIVAGH  184

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLV  418
             +YYFL VLHP A G     TP WV  L 
Sbjct  185   LYYFLAVLHPRAGGARLIKTPDWVRALC  212



>gb|ABK93254.1| unknown [Populus trichocarpa]
Length=176

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 118/169 (70%), Gaps = 5/169 (3%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +C     A Q  L  + +IAL Y  VF  FQVWRL+T FF
Sbjct  1     MSSPAEYYKSLPPISKVYGTLCLFLTTAVQFGLLYLPDIALMYKPVFSSFQVWRLITTFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+G FS  F  RLL+I RYGVQLE+GPF++RTAD++WM +FGA+ LLV+S  P  WSPF+
Sbjct  61    FLGNFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFWSPFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFK-----GFYLPWYMLGIDMI  550
             G SLVFM++Y+W REFPN +IN+YGLV  +     G  L W +  + ++
Sbjct  121   GISLVFMLLYVWSREFPNAQINIYGLVTLRPSICHGRCLLWMLFSVHLL  169



>ref|XP_002964485.1| hypothetical protein SELMODRAFT_266761 [Selaginella moellendorffii]
 ref|XP_002975310.1| hypothetical protein SELMODRAFT_415487 [Selaginella moellendorffii]
 gb|EFJ23511.1| hypothetical protein SELMODRAFT_415487 [Selaginella moellendorffii]
 gb|EFJ34818.1| hypothetical protein SELMODRAFT_266761 [Selaginella moellendorffii]
Length=256

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 144/215 (67%), Gaps = 7/215 (3%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSD--VFRRFQVWRLVTN  868
             MS+P E+Y+SLPP+ K Y   C +     +L L  V  + L++S    F++ Q+WR VTN
Sbjct  1     MSSPAEFYHSLPPIIKFYGTTCLLLTTVERLGL--VSGMLLYFSPELAFKKLQLWRAVTN  58

Query  867   fffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLL-VMSIFPFLWS  691
             FFF+G FS  FA +L+++ RYGVQLER      T  +VWM +  A+ LL + ++FP L  
Sbjct  59    FFFLGTFSMNFAIQLIMLARYGVQLERSFVS--TGQFVWMMVVSALTLLGIATVFPSLNF  116

Query  690   PFMGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIA  511
              FMG+ LVFM+VY+W REFPN  +++ GLV  +GFY+PW ML I+ + G     D+LGI 
Sbjct  117   WFMGSVLVFMLVYLWSREFPNASVSMLGLVTIQGFYVPWAMLFINTMFGGSFLHDLLGIV  176

Query  510   AGHIYYFLTVLHPLATGKNYFNTPRWVHKLVAYWG  406
              GH+Y+FLTVL+P + G+++   PR+VHKL+A +G
Sbjct  177   MGHLYHFLTVLYPRSGGRDFLRAPRFVHKLLAKYG  211



>gb|AAY41612.1| derlin1-1 [Zea mays]
Length=197

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 131/231 (57%), Gaps = 49/231 (21%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             MS+P EYY SLPP++K Y  +CF T    QL++     + L Y  VF++F++WRL+T+FF
Sbjct  1     MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F+  FS  F  RLL+I RYGV LE+G FDKRTAD++WM +FGA                 
Sbjct  61    FLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGA-----------------  103

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
                                            FYLPW ML +D+I G+ L P +LGI  GH
Sbjct  104   ------------------------------SFYLPWAMLLLDVIFGSSLMPGLLGIMVGH  133

Query  501   IYYFLTVLHPLATGKNYFNTPRWV-HKLVAYWGKGFQVNSPFRSDPSAGTA  352
             +YYF  VLHPLATGK+Y  TP+WV HK+VA +  G Q NSP R  P+ G +
Sbjct  134   LYYFFAVLHPLATGKSYLKTPKWVRHKIVARFRIGMQANSPVR-PPANGNS  183



>ref|XP_007512331.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66419.1| predicted protein [Bathycoccus prasinos]
Length=243

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 130/209 (62%), Gaps = 1/209 (0%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
             ++P E+Y SLPP+ K +   C +     Q  L    N+ L Y  ++ +FQ+WRL+ NF F
Sbjct  3     NSPGEWYASLPPICKAWGTACVLITFGTQFGLPLPVNLYLDYKLIWEKFQIWRLIGNFCF  62

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMS-IFPFLWSPFM  682
             IG F F F FR L+I RYGV LE+  F+ RT+D+VWM +   + LL +  I P +  PF 
Sbjct  63    IGGFGFPFVFRTLMIARYGVHLEQKTFENRTSDFVWMLMINMMILLPLKFIVPSVSQPFY  122

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
              +SL+F ++Y+W RE P +  ++ G+++   FYLPW M+ + +++G    PD LG+ +GH
Sbjct  123   SSSLIFAMLYLWSRENPTQNTSIMGMIRMPAFYLPWGMMALTVLMGGDPVPDFLGVLSGH  182

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVA  415
             +YYF +VL+P  +G ++  TP+WV   V 
Sbjct  183   VYYFFSVLYPRQSGVHFLKTPQWVEAAVG  211



>ref|XP_006908733.1| PREDICTED: derlin-3 [Pteropus alecto]
Length=231

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 124/201 (62%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRLVTNF F G   F+F
Sbjct  12    QVPTVTRAYTAACILTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  RTAD+V+MFLFG I   +M++  FL S F +G +LV M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGI---LMTLLGFLGSLFFLGQALVAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  +
Sbjct  129   VYVWSRRSPQVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPSFLKLLL  209



>ref|XP_002955525.1| hypothetical protein VOLCADRAFT_33117 [Volvox carteri f. nagariensis]
 gb|EFJ43378.1| hypothetical protein VOLCADRAFT_33117 [Volvox carteri f. nagariensis]
Length=213

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 120/202 (59%), Gaps = 2/202 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             E+Y SLP V +TY  + F+T A   LE+   +NI      VF++ Q+WRLVTNF F G  
Sbjct  5     EWYKSLPIVTRTYVTMAFLTTAGCALEIITPFNIYFNSKLVFKKLQLWRLVTNFLFFGNL  64

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
                F F +  +++Y   LE G F  R+AD++WM +FG  G L+  I PF+   F+G+SL 
Sbjct  65    GLDFVFHMFFLIKYCKSLEEGSFRGRSADFLWMLIFG--GTLLTCIAPFVNIQFLGSSLT  122

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
             FM+VY+WGR      ++  G+  F   YLPW +L   ++LG+    D++G+AAGH+YYFL
Sbjct  123   FMMVYVWGRRHQYVNLSFLGIFNFTAPYLPWVLLAFSLMLGSSPVVDLMGMAAGHVYYFL  182

Query  486   TVLHPLATGKNYFNTPRWVHKL  421
               ++P  +G+    TP  V  +
Sbjct  183   EDVYPRISGRRPLKTPALVRMM  204



>ref|XP_007973300.1| PREDICTED: derlin-3 isoform X9 [Chlorocebus sabaeus]
Length=220

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 119/194 (61%), Gaps = 5/194 (3%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  RTAD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNILFVFRYCRMLEEGSFRGRTADFVFMFLFGGV---LMTLLGFLGSLFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P  R+N +GL  F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  +
Sbjct  129   VYVWSRRSPRVRVNFFGLFTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTP  439
              P    GK    TP
Sbjct  189   FPNQPGGKRLLLTP  202



>ref|XP_001084965.2| PREDICTED: derlin-3 isoform 1 [Macaca mulatta]
 ref|XP_003919177.1| PREDICTED: derlin-3 [Papio anubis]
 ref|XP_005595416.1| PREDICTED: derlin-3 [Macaca fascicularis]
 ref|XP_007973298.1| PREDICTED: derlin-3 isoform X7 [Chlorocebus sabaeus]
 gb|EHH25437.1| hypothetical protein EGK_21209 [Macaca mulatta]
Length=235

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  RTAD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNILFVFRYCRMLEEGSFRGRTADFVFMFLFGGV---LMTLLGFLGSLFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P  R+N +GL  F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  +
Sbjct  129   VYVWSRRSPRVRVNFFGLFTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPGFLKLLL  209



>ref|XP_004466478.1| PREDICTED: derlin-3 [Dasypus novemcinctus]
Length=235

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 122/200 (61%), Gaps = 3/200 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQ+WRL+TNF F G   F+F
Sbjct  12    QVPAVTRVYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQIWRLITNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIV  655
              F +L + RY   LE G F  RTAD+V+MFLFG   ++++     L+  F+G +L+ M+V
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGFLMILLGFLGSLF--FLGQALMAMLV  129

Query  654   YIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLH  475
             Y+W R  P  R+N +GL+ F+  +LPW ++G  M+LGN +  D+LGIA GHIYYFL  + 
Sbjct  130   YVWSRRSPQIRVNFFGLLTFQAPFLPWALMGFSMLLGNSILVDLLGIAVGHIYYFLEDVF  189

Query  474   P-LATGKNYFNTPRWVHKLV  418
             P    GK    TP ++  L+
Sbjct  190   PNQPGGKRLLLTPGFLKLLL  209



>ref|XP_002724059.1| PREDICTED: derlin-3 isoform X1 [Oryctolagus cuniculus]
Length=234

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 123/201 (61%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+ QVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKLQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  RTAD+V+MFLFG +   +M++  FL S F +G +L  M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGV---LMTLLGFLGSLFFLGQALTAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  +
Sbjct  129   VYVWSRRSPHVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPGFLKLLL  209



>ref|XP_006999087.1| PREDICTED: LOW QUALITY PROTEIN: derlin 3 [Peromyscus maniculatus 
bairdii]
Length=235

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSLFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P  R+N +GL+ F+  +LPW ++G  M+LGN +  D+LGI  GHIYYFL  +
Sbjct  129   VYVWSRRSPQVRVNFFGLLNFQAPFLPWALMGFSMLLGNSVLTDLLGIVVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPSFLKLLL  209



>ref|XP_005360262.1| PREDICTED: LOW QUALITY PROTEIN: derlin-3 [Microtus ochrogaster]
Length=235

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  12    QVPAVTRAYTTACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSLFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P  R+N +GL+ F+  +LPW ++G  M+LGN +  D+LGI  GHIYYFL  +
Sbjct  129   VYVWSRRSPQVRVNFFGLLNFQAPFLPWALMGFSMLLGNSVLTDLLGIVVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPGFLKLLL  209



>gb|AAI67034.1| Derl3 protein [Rattus norvegicus]
Length=222

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 121/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  6     QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  65

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  66    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSMFFLGQALMAML  122

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL  +
Sbjct  123   VYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVITDLLGIIVGHIYYFLEDV  182

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  183   FPNQPGGKRLLLTPSFLKLLL  203



>ref|NP_001103047.2| derlin-3 [Rattus norvegicus]
 ref|XP_006256387.1| PREDICTED: derlin-3 isoform X1 [Rattus norvegicus]
 ref|XP_008772062.1| PREDICTED: derlin-3 isoform X8 [Rattus norvegicus]
 ref|XP_008772063.1| PREDICTED: derlin-3 isoform X8 [Rattus norvegicus]
 gb|EDL97173.1| rCG60881, isoform CRA_a [Rattus norvegicus]
Length=228

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 121/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSMFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL  +
Sbjct  129   VYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVITDLLGIIVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPSFLKLLL  209



>ref|XP_005070802.1| PREDICTED: derlin-3 [Mesocricetus auratus]
Length=228

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 121/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  12    QVPTVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MF+FG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFIFGGV---LMTLLGFLGSLFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  M+LGN +  D++GI  GHIYYFL  +
Sbjct  129   VYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSMLLGNSVLTDLIGIVVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  189   FPNQPGGKRLLLTPNFLKLLL  209



>gb|EKC32336.1| Derlin-2 [Crassostrea gigas]
Length=245

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 121/204 (59%), Gaps = 2/204 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PP+ + Y   C +T  A QL++     I L  + VF ++QVWRLVTNF ++G+ 
Sbjct  7     QEYMEMPPITRAYTTACVLTTIAVQLDIISPLQIYLDPTAVFSKYQVWRLVTNFTYLGSI  66

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFMGASL  670
              F F F ++   RY   LE G F  +TAD+ +M LFG   L V ++  P +   F+G++L
Sbjct  67    GFNFLFNIIFAYRYCRMLEEGSFRNKTADFFFMILFGCTLLTVTTMLVPMVNLVFLGSAL  126

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F   YLPW +LG  ++LGN +  D+LGIAAGHIYYF
Sbjct  127   TIMLVYLWSRRNPYVRMNFFGLMTFHAPYLPWVLLGFSVLLGNSVITDLLGIAAGHIYYF  186

Query  489   LTVLHPLATGK-NYFNTPRWVHKL  421
             L  + P   G      TPR++  L
Sbjct  187   LEDVFPQQPGGFKILKTPRFLTYL  210



>ref|XP_001696906.1| hypothetical protein CHLREDRAFT_184920 [Chlamydomonas reinhardtii]
 gb|EDP00598.1| predicted protein [Chlamydomonas reinhardtii]
Length=257

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 138/219 (63%), Gaps = 5/219 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
              ++ SLPP+ +TYA   F+    ++L   +V  IAL +  V   F+VWRLVTNFFF+G F
Sbjct  17    AWFESLPPITRTYAASLFIVTLLWRLGFVNVMWIALLWPRVATHFEVWRLVTNFFFMGKF  76

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPF--LWSP--FMG  679
             SF +  ++L +L YG  LER  F    AD+++M LFGA  +L +S+     L  P  FM 
Sbjct  77    SFNWVIKILWLLSYGTTLERETFAFEPADFLFMMLFGAGCMLGLSLVLLFGLGIPMFFMA  136

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLK-PDMLGIAAGH  502
              SL+FM++Y+W R+FP +++++YGL +   F++P+  +GI+ ++   +  P +LGI  GH
Sbjct  137   DSLIFMLLYVWSRQFPQQQVSIYGLFKVLAFHVPFVFVGIEFLMAGAIPYPSLLGIVVGH  196

Query  501   IYYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNS  385
             ++Y+LTVL+P   G     TPR++  L+A  G G +VN+
Sbjct  197   MHYYLTVLYPAIGGPRLLATPRFLKNLLADAGVGRRVNT  235



>ref|XP_006277064.1| PREDICTED: derlin-2-like [Alligator mississippiensis]
Length=242

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 119/201 (59%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLEL   + +      +FRRFQVWRL+TNF F G  
Sbjct  8     QEYMGIPAVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFRRFQVWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F +  + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMXFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPGFLR  206



>ref|NP_077760.1| derlin-3 [Mus musculus]
 sp|Q9D8K3.1|DERL3_MOUSE RecName: Full=Derlin-3; AltName: Full=Degradation in endoplasmic 
reticulum protein 3; AltName: Full=Der1-like protein 3; 
AltName: Full=Protein IZP6 [Mus musculus]
 dbj|BAB25367.1| unnamed protein product [Mus musculus]
 dbj|BAB32788.1| IZP6 [Mus musculus musculus]
 dbj|BAE43003.1| unnamed protein product [Mus musculus]
 gb|AAI15467.1| Der1-like domain family, member 3 [Mus musculus]
 gb|AAI15468.1| Der1-like domain family, member 3 [Mus musculus]
 gb|EDL31877.1| Der1-like domain family, member 3, isoform CRA_c [Mus musculus]
Length=228

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSLFFLGQALMAML  128

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL  +
Sbjct  129   VYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGHIYYFLEDV  188

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP  +  L+
Sbjct  189   FPNQPGGKRLLLTPSVLKLLL  209



>ref|XP_005649415.1| Derlin-1 [Coccomyxa subellipsoidea C-169]
 gb|EIE24871.1| Derlin-1 [Coccomyxa subellipsoidea C-169]
Length=249

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 125/213 (59%), Gaps = 3/213 (1%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
             S+P ++Y SLPPV + Y   C  T AA  L L +  ++ L +  VF+  Q++RLV +F F
Sbjct  11    SSPADWYYSLPPVIRLYGTACVATTAAVTLGLINPMSLLLHWPSVFKG-QIFRLVASFIF  69

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMG  679
             +G  S  F  ++L +++YGV LE+  +   TAD+ +M   G + LL  S+   +    +G
Sbjct  70    LGKPSINFLMKMLWMIQYGVPLEKSTYQFSTADFAYMLFVGMVSLLGASVV--VPVQLLG  127

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
              SL+FM+VY+W R F +  I++ GLV  + FYLP+ +L +D+ +G     D+LGI  GH+
Sbjct  128   PSLIFMMVYVWSRNFASSNISLMGLVSIQAFYLPFALLALDLAMGGDWMSDLLGIIVGHL  187

Query  498   YYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKG  400
             YYFL  LHP A G     TP W+ + +   G G
Sbjct  188   YYFLKELHPAAGGGRLLETPMWLKRALLSAGIG  220



>gb|AAH04729.1| Derl3 protein, partial [Mus musculus]
Length=231

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  15    QVPTVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  74

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  75    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSLFFLGQALMAML  131

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL  +
Sbjct  132   VYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGHIYYFLEDV  191

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP  +  L+
Sbjct  192   FPNQPGGKRLLLTPSVLKLLL  212



>ref|XP_006922293.1| PREDICTED: derlin-2 [Pteropus alecto]
 gb|ELK03748.1| Derlin-2 [Pteropus alecto]
Length=239

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 115/188 (61%), Gaps = 4/188 (2%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWS-PFMGASLVF  664
              F F ++ + RY   LE G F  RTAD+V+MFLFG     +M+IF    S  F+G +   
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---FLMTIFGLFVSLVFLGQAFTI  126

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL 
Sbjct  127   MLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYYFLE  186

Query  483   VLHPLATG  460
              + P+  G
Sbjct  187   DVFPIQPG  194



>ref|XP_005233323.1| PREDICTED: derlin-2-like isoform X1 [Falco peregrinus]
Length=242

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 120/201 (60%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V +TY   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRTYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPGFLK  206



>gb|ACQ57961.1| Derlin-2 [Anoplopoma fimbria]
Length=239

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + R +QVWRL+TNF F
Sbjct  4     QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++GI ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGISLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP  +  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPSIIKML  208



>ref|XP_001362900.1| PREDICTED: derlin-2 [Monodelphis domestica]
Length=239

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 120/202 (59%), Gaps = 5/202 (2%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +FR FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFRHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWS-PFMGASLVF  664
              F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F    S  F+G +   
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVSLVFLGQAFTI  126

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL 
Sbjct  127   MLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLE  186

Query  483   VLHP-LATGKNYFNTPRWVHKL  421
              + P    G     TP ++  +
Sbjct  187   DVFPNQPGGARILKTPAFLKAI  208



>ref|XP_010396455.1| PREDICTED: derlin-3 isoform X1 [Corvus cornix cornix]
Length=242

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 120/201 (60%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N++GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNLFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPSFLK  206



>ref|XP_004684800.1| PREDICTED: derlin-2 [Condylura cristata]
Length=239

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P+  G
Sbjct  188   IFPIQPG  194



>ref|XP_008988450.1| PREDICTED: derlin-3 isoform X3 [Callithrix jacchus]
Length=217

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 120/201 (60%), Gaps = 3/201 (1%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIV  655
              F +L + RY   LE G F  RTAD+V+MFLFG  G+++  +       F+G +LV M+V
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFG--GVVMTLLGLLGSLFFLGQALVAMLV  129

Query  654   YIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLH  475
             Y+W R  P  R+N +GLV F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  + 
Sbjct  130   YVWSRRSPRVRVNFFGLVTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVF  189

Query  474   P-LATGKNYFNTPRWVHKLVA  415
             P    GK    TP ++    A
Sbjct  190   PNQPGGKRLLLTPGFLDSRTA  210



>ref|NP_001019566.1| derlin-2 [Danio rerio]
 gb|AAH95262.1| Zgc:110436 [Danio rerio]
 gb|AAI65145.1| Zgc:110436 protein [Danio rerio]
Length=239

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 121/208 (58%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWRL+TNF F
Sbjct  4     QTIRQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVNLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VYIW R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYIWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +YYFL  + P    G  +  TP  +  L
Sbjct  181   VYYFLEDVFPNQPGGGRWLRTPSILKML  208



>ref|XP_007245328.1| PREDICTED: derlin-2 [Astyanax mexicanus]
Length=256

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 123/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V +TY   C +T AA QLEL   + +      + + +QVWRLVTNF F
Sbjct  21    QTFQQEYLQIPVVTRTYTTACVLTTAAVQLELITPFQLYFNPDLILKHYQVWRLVTNFLF  80

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  81    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGMFVSLVFL  137

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  138   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  197

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  198   VYFFLEDVFPNQPGGGRWLRTPSFLKML  225



>ref|NP_001232219.1| derlin-3 [Taeniopygia guttata]
 gb|ACH44405.1| putative carcinoma related gene variant 3 [Taeniopygia guttata]
Length=242

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 119/201 (59%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPNFLK  206



>ref|XP_010284371.1| PREDICTED: derlin-2-like [Phaethon lepturus]
 gb|KFQ73989.1| Derlin-2 [Phaethon lepturus]
Length=242

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 119/201 (59%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPSFLK  206



>ref|XP_010740552.1| PREDICTED: derlin-2 [Larimichthys crocea]
Length=239

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 121/208 (58%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + R +QVWRL+TNF F
Sbjct  4     QTLQQEYFQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +YYFL  + P    G  +  TP  +  L
Sbjct  181   VYYFLEDVFPNQPGGGRWLRTPSIIKML  208



>ref|XP_008854175.1| PREDICTED: derlin-2 [Nannospalax galili]
Length=239

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 119/205 (58%), Gaps = 13/205 (6%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG-----------KNYFNTP  439
             + P   G           +N F+TP
Sbjct  188   IFPNQPGGIRILKTPSILRNIFDTP  212



>ref|XP_003226631.1| PREDICTED: derlin-2 [Anolis carolinensis]
Length=239

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 117/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + YA  C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYATACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYF
Sbjct  125   TIMLVYVWSRRNPFVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYYF  184

Query  489   LTVLHPLATG  460
             L  + P   G
Sbjct  185   LEDVFPNQPG  194



>ref|XP_005288618.1| PREDICTED: derlin-3 isoform X1 [Chrysemys picta bellii]
Length=245

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 122/204 (60%), Gaps = 4/204 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGIPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVHKLV  418
               + P    GK    TP ++ KLV
Sbjct  186   EDVFPNQPGGKKLLLTPGFL-KLV  208



>ref|XP_008988449.1| PREDICTED: derlin-3 isoform X2 [Callithrix jacchus]
Length=221

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 117/193 (61%), Gaps = 3/193 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIV  655
              F +L + RY   LE G F  RTAD+V+MFLFG  G+++  +       F+G +LV M+V
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFG--GVVMTLLGLLGSLFFLGQALVAMLV  129

Query  654   YIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLH  475
             Y+W R  P  R+N +GLV F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  + 
Sbjct  130   YVWSRRSPRVRVNFFGLVTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVF  189

Query  474   P-LATGKNYFNTP  439
             P    GK    TP
Sbjct  190   PNQPGGKRLLLTP  202



>ref|XP_005524546.1| PREDICTED: derlin-2-like isoform X1 [Pseudopodoces humilis]
Length=242

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 119/200 (60%), Gaps = 3/200 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWV  430
               + P    GK    TP ++
Sbjct  186   EDVFPNQPGGKKLLLTPSFL  205



>ref|XP_008170229.1| PREDICTED: derlin-3 isoform X2 [Chrysemys picta bellii]
Length=205

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 119/200 (60%), Gaps = 3/200 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGIPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWV  430
               + P    GK    TP ++
Sbjct  186   EDVFPNQPGGKKLLLTPGFL  205



>emb|CEF97386.1| Derlin [Ostreococcus tauri]
Length=248

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 125/212 (59%), Gaps = 4/212 (2%)
 Frame = -1

Query  1035  TPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffi  856
             +P  +Y SLPP++K +   C      Y   L D   + L ++ V R+FQ WR+VTNFFF+
Sbjct  4     SPGAWYASLPPISKFWFTACGGCTVGYHCSLIDPRALMLSWTIVRRKFQPWRVVTNFFFL  63

Query  855   gafsftfaFRLLIILRYGVQLERGPFD--KRTADYVWMFLFGAIGLLVMS-IFPFLWSPF  685
             G FS  FA R+++I +Y V LE+  F     TAD++   LFG   L  +  + P L   F
Sbjct  64    GKFSLGFAMRMVMIAQYAVSLEKQSFTGASATADFLTFLLFGVALLTPLELVVPSLAQAF  123

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
              G SL+FM +Y+W RE P  R+++ G+V+   FY PW ML + +++G    PD LGI AG
Sbjct  124   YGDSLIFMCLYLWSRENPRARVSLMGVVRVGAFYFPWAMLAMTVLMGGDPVPDFLGIVAG  183

Query  504   HIYYFLTVLHPLATG-KNYFNTPRWVHKLVAY  412
             H YYF T L+PL  G +++  TP++V  +  Y
Sbjct  184   HTYYFFTRLYPLRYGCRSFIRTPKFVRAIADY  215



>ref|XP_008874664.1| hypothetical protein H310_10163 [Aphanomyces invadans]
 gb|ETV96887.1| hypothetical protein H310_10163 [Aphanomyces invadans]
Length=242

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 120/190 (63%), Gaps = 2/190 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             M+ P+E+Y+ +P +++ Y    F+T  A  LEL   +++   ++ +F R QVWRLVTNF 
Sbjct  1     MNDPLEWYHEIPVISRLYLTGAFLTTVACALELISPFSLYFNFNLIFYRGQVWRLVTNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F G FS  + F +  ++RY   LE G F  RTAD+++M L GA+ +++++  PF+   F+
Sbjct  61    FFGLFSLDYIFHMYFLVRYSRMLEEGSFRGRTADFLYMLLLGAVSMILVA--PFVSVHFL  118

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G+SL FM+VY+WGR   + R++  GL  F   YLPW +L   M+LGN    D++GI  GH
Sbjct  119   GSSLTFMMVYVWGRRNEHTRLSFLGLFPFTAPYLPWVLLLFSMVLGNSATIDLIGIVVGH  178

Query  501   IYYFLTVLHP  472
             +YYF   ++P
Sbjct  179   VYYFFEDVYP  188



>ref|XP_005815935.1| PREDICTED: derlin-2-like [Xiphophorus maculatus]
Length=239

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 119/207 (57%), Gaps = 3/207 (1%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + + +QVWRL+TNF F
Sbjct  4     QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILKNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMG  679
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  IF  L   F+G
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGLLMTIFGIFVSL--VFLG  121

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
              +   M+VYIW R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH+
Sbjct  122   QAFTIMLVYIWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHV  181

Query  498   YYFLTVLHP-LATGKNYFNTPRWVHKL  421
             YYFL  + P    G  +  TP  +  L
Sbjct  182   YYFLEDVFPNQPGGGRWLRTPSIIKML  208



>ref|XP_008154958.1| PREDICTED: derlin-2 [Eptesicus fuscus]
Length=239

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + V  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTVFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>gb|AHG98170.1| Derlin-2 variant 1, partial [Thymallus thymallus]
Length=230

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWRL+TNF F
Sbjct  4     QTFQQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPFFLKML  208



>ref|XP_010573794.1| PREDICTED: derlin-3 isoform X1 [Haliaeetus leucocephalus]
Length=242

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 119/201 (59%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPGFLK  206



>gb|AHG98172.1| Derlin-2 variant 1, partial [Coregonus lavaretus]
Length=230

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWRL+TNF F
Sbjct  4     QTFQQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPIGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPFFLKML  208



>ref|XP_008060177.1| PREDICTED: derlin-2 [Tarsius syrichta]
Length=239

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 115/188 (61%), Gaps = 4/188 (2%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWS-PFMGASLVF  664
              F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F    S  F+G +   
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVSLVFLGQAFTI  126

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL 
Sbjct  127   MLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLE  186

Query  483   VLHPLATG  460
              + P   G
Sbjct  187   DVFPNQPG  194



>ref|XP_003439537.1| PREDICTED: derlin-2-like [Oreochromis niloticus]
 ref|XP_004564710.1| PREDICTED: derlin-2-like [Maylandia zebra]
 ref|XP_005751355.1| PREDICTED: derlin-2-like [Pundamilia nyererei]
 ref|XP_005943135.1| PREDICTED: derlin-2-like [Haplochromis burtoni]
 ref|XP_006797381.1| PREDICTED: derlin-2-like [Neolamprologus brichardi]
Length=239

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 121/208 (58%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + R +QVWRL+TNF F
Sbjct  4     QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP  +  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPSIIKML  208



>gb|ACO10173.1| Derlin-2 [Osmerus mordax]
Length=239

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWR++TNF F
Sbjct  4     QTFQQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRIITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPSFLKML  208



>gb|KDO32535.1| hypothetical protein SPRG_03010 [Saprolegnia parasitica CBS 223.65]
Length=243

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 120/190 (63%), Gaps = 2/190 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             M+ P+E+Y  +P +++ Y    F+T AA  LEL   +++   ++ +F R QVWRL+TNF 
Sbjct  1     MNDPLEWYYEIPVISRLYLTGAFLTTAACALELISPFSLYFNFNLIFYRGQVWRLLTNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F G FS  F F +  ++RY   LE G F  RTAD+++M LFGA  +++++  PF+   F+
Sbjct  61    FFGLFSLDFLFHMYFLVRYSRMLEEGSFRGRTADFLYMILFGAAFMILVA--PFVSVHFL  118

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G+SL FM+VYIWGR   + R++  GL  F   YLPW +L   M+LGN    D++GI  GH
Sbjct  119   GSSLTFMMVYIWGRRNEHTRLSFLGLFPFTAPYLPWVLLLFSMVLGNSATIDLIGIVVGH  178

Query  501   IYYFLTVLHP  472
             IYYF   ++P
Sbjct  179   IYYFFEDVYP  188



>ref|XP_007102876.1| PREDICTED: derlin-2 isoform X2 [Physeter catodon]
Length=239

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 124/220 (56%), Gaps = 4/220 (2%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSL--VFLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHP-LATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDPS  364
             + P    G     TP  + +     GK  +  +   SD S
Sbjct  188   VFPNQPGGVRILKTPSILFRF-CICGKNIREVTLRSSDCS  226



>ref|XP_003791281.1| PREDICTED: derlin-2 [Otolemur garnettii]
Length=239

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPTQPG  194



>ref|XP_008621042.1| hypothetical protein SDRG_16604 [Saprolegnia diclina VS20]
 gb|EQC25521.1| hypothetical protein SDRG_16604 [Saprolegnia diclina VS20]
Length=242

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 120/190 (63%), Gaps = 2/190 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             M+ P+E+Y  +P +++ Y    F+T AA  LEL   +++   ++ +F R QVWRL+TNF 
Sbjct  1     MNDPLEWYYEIPVISRLYLTGAFLTTAACALELISPFSLYFNFNLIFYRGQVWRLLTNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F G FS  F F +  ++RY   LE G F  RTAD+++M LFGA  +++++  PF+   F+
Sbjct  61    FFGLFSLDFLFHMYFLVRYSRMLEEGSFRGRTADFLYMILFGAAFMILVA--PFVSVHFL  118

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G+SL FM+VYIWGR   + R++  GL  F   YLPW +L   M+LGN    D++GI  GH
Sbjct  119   GSSLTFMMVYIWGRRNEHTRLSFLGLFPFTAPYLPWVLLLFSMVLGNSATIDLIGIVVGH  178

Query  501   IYYFLTVLHP  472
             IYYF   ++P
Sbjct  179   IYYFFEDVYP  188



>ref|XP_002763528.1| PREDICTED: derlin-3 isoform X1 [Callithrix jacchus]
Length=235

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 121/200 (61%), Gaps = 3/200 (2%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA QLEL   + +      VFR+FQVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIV  655
              F +L + RY   LE G F  RTAD+V+MFLFG  G+++  +       F+G +LV M+V
Sbjct  72    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFG--GVVMTLLGLLGSLFFLGQALVAMLV  129

Query  654   YIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLH  475
             Y+W R  P  R+N +GLV F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  + 
Sbjct  130   YVWSRRSPRVRVNFFGLVTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVF  189

Query  474   P-LATGKNYFNTPRWVHKLV  418
             P    GK    TP ++  L+
Sbjct  190   PNQPGGKRLLLTPGFLKLLL  209



>gb|AHG98171.1| Derlin-2 variant 2, partial [Thymallus thymallus]
Length=230

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWRL+TNF F
Sbjct  4     QTFQQEYLQIPVVTRAYTTACVITTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPFFLKML  208



>ref|XP_008281421.1| PREDICTED: derlin-2 [Stegastes partitus]
 ref|XP_010776808.1| PREDICTED: derlin-2 [Notothenia coriiceps]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 121/208 (58%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + R +QVWRL+TNF F
Sbjct  4     QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP  +  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLRTPSIIKML  208



>ref|NP_001016097.1| derlin 2 [Xenopus (Silurana) tropicalis]
 emb|CAJ81565.1| Der1-like domain family, member 3derlin-3 [Xenopus (Silurana) 
tropicalis]
 gb|AAI35881.1| hypothetical protein LOC548851 [Xenopus (Silurana) tropicalis]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 114/189 (60%), Gaps = 2/189 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T A  QLEL   + +      +FR +Q+WRLVTNF F G  
Sbjct  8     QEYMQIPPVTRAYTTACVLTTAVVQLELITPFQLYFNPELIFRHYQIWRLVTNFLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F F F ++ + RY   LE G F  RTAD+V+MFLFG + +++  +F  L   F+G +  
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGLLMVIFGLFVNLV--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL
Sbjct  126   IMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFL  185

Query  486   TVLHPLATG  460
               + P   G
Sbjct  186   EDVFPNQPG  194



>gb|ACM08454.1| Derlin-2 [Salmo salar]
 gb|AHG98257.1| Derlin-2 variant 2, partial [Oncorhynchus mykiss]
 emb|CDQ66008.1| unnamed protein product [Oncorhynchus mykiss]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWRL+TNF F
Sbjct  4     QTFQQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPFFLKML  208



>ref|XP_006899844.1| PREDICTED: derlin-2 [Elephantulus edwardii]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQVWRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   IFPNQPG  194



>gb|AHG98256.1| Derlin-2 variant 1, partial [Oncorhynchus mykiss]
 emb|CDQ68747.1| unnamed protein product [Oncorhynchus mykiss]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R +QVWRL+TNF F
Sbjct  4     QTVQQEYLQIPFVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPFFLKML  208



>ref|XP_008995525.1| PREDICTED: derlin-2 isoform X2 [Callithrix jacchus]
Length=205

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSL--VFLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_009954320.1| PREDICTED: derlin-2-like isoform X1 [Leptosomus discolor]
Length=231

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 117/196 (60%), Gaps = 3/196 (2%)
 Frame = -1

Query  1011  LPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftfa  832
             +P V + Y   C +T AA QLE    + +      +FR+FQ+WRL+TNF F G   F+F 
Sbjct  1     MPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKFQIWRLITNFLFFGPLGFSFF  60

Query  831   FRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFMIVY  652
             F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +   M+VY
Sbjct  61    FNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFTIMLVY  118

Query  651   IWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVLHP  472
             +W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  + P
Sbjct  119   VWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFLEDVFP  178

Query  471   -LATGKNYFNTPRWVH  427
                 GK    TP ++ 
Sbjct  179   NQPGGKKLLLTPSFLK  194



>ref|XP_007054210.1| PREDICTED: derlin-2 [Chelonia mydas]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 119/198 (60%), Gaps = 5/198 (3%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHP-LATGKNYFNTP  439
             L  + P    G+    TP
Sbjct  185   LEDIFPNQPGGRRLLKTP  202



>ref|XP_005882642.1| PREDICTED: derlin-2 [Myotis brandtii]
 ref|XP_006102796.1| PREDICTED: derlin-2 [Myotis lucifugus]
 ref|XP_006771943.1| PREDICTED: derlin-2 [Myotis davidii]
 gb|ELK24070.1| Derlin-2 [Myotis davidii]
 gb|EPQ17880.1| Derlin-2 [Myotis brandtii]
Length=239

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTIFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_007091703.1| PREDICTED: derlin-2 [Panthera tigris altaica]
Length=205

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSL--VFLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSVIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_010221597.1| PREDICTED: derlin-2 isoform X2 [Tinamus guttatus]
Length=207

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 115/186 (62%), Gaps = 4/186 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHP  472
             L  + P
Sbjct  185   LEDVFP  190



>ref|XP_005649417.1| Derlin-1 [Coccomyxa subellipsoidea C-169]
 gb|EIE24873.1| Derlin-1 [Coccomyxa subellipsoidea C-169]
Length=249

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 127/224 (57%), Gaps = 6/224 (3%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
             S+P ++Y SLPP+ + Y   C  T  A  L L +  ++ L +  VF+  Q++RLV +F F
Sbjct  11    SSPADWYYSLPPIIRLYGTACVATTMAVTLGLINPMSLLLDWPSVFKG-QIFRLVASFIF  69

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMG  679
             +G  S  F  ++L +++YGV LE+  +   TAD+ +M LFG + +L  S+   +    +G
Sbjct  70    LGKPSINFLMKMLWMIQYGVPLEKSTYQFSTADFAYMLLFGMVSMLGASLV--VPVQLLG  127

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
              SL+FM+VY+W R   +  I+  GLV  + FYLP+ +L +D+ +G     D+LGI  GH+
Sbjct  128   PSLIFMMVYVWSRNLTSSNISQMGLVSIQAFYLPFALLALDLAMGGDWMSDLLGIIVGHL  187

Query  498   YYFLTVLHPLATGKNYFNTPRWVHKLVAYWGKGFQVNSPFRSDP  367
             YYFL  LHP A G     TP W+ + +   G G     P R  P
Sbjct  188   YYFLKELHPAAGGGRLLETPMWLKRALLSAGIG---TVPAREVP  228



>ref|XP_004638372.1| PREDICTED: derlin-2 [Octodon degus]
Length=239

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPSQPG  194



>ref|XP_003274617.1| PREDICTED: derlin-2 [Nomascus leucogenys]
Length=239

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 118/205 (58%), Gaps = 13/205 (6%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG-----------KNYFNTP  439
             + P   G           K  F+TP
Sbjct  188   VFPNQPGGIRILKTPSILKTIFDTP  212



>gb|EDM05070.1| rCG34415, isoform CRA_a [Rattus norvegicus]
Length=239

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   IFPNQPG  194



>gb|AAL14868.1|AF208064_1 F-LANa [Mus musculus]
Length=239

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   IFPNQPG  194



>ref|XP_004483566.1| PREDICTED: derlin-2 [Dasypus novemcinctus]
Length=239

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 118/205 (58%), Gaps = 13/205 (6%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG-----------KNYFNTP  439
             + P   G           K  F+TP
Sbjct  188   VFPNQPGGIRILKTPSILKTIFDTP  212



>ref|NP_291040.1| derlin-2 isoform a [Mus musculus]
 ref|XP_005067508.1| PREDICTED: derlin-2 [Mesocricetus auratus]
 ref|XP_005349698.1| PREDICTED: derlin-2 [Microtus ochrogaster]
 ref|XP_006220770.1| PREDICTED: derlin-2 isoform X1 [Rattus norvegicus]
 ref|XP_007607127.1| PREDICTED: derlin-2 isoform X1 [Cricetulus griseus]
 ref|XP_007624497.1| PREDICTED: derlin-2 isoform X2 [Cricetulus griseus]
 ref|XP_008766124.1| PREDICTED: derlin-2 isoform X1 [Rattus norvegicus]
 sp|Q8BNI4.2|DERL2_MOUSE RecName: Full=Derlin-2; AltName: Full=Degradation in endoplasmic 
reticulum protein 2; AltName: Full=Der1-like protein 2; 
AltName: Full=F-LANa [Mus musculus]
 gb|AAH05682.1| Der1-like domain family, member 2 [Mus musculus]
 dbj|BAC33399.1| unnamed protein product [Mus musculus]
 dbj|BAC36934.1| unnamed protein product [Mus musculus]
 dbj|BAC38533.1| unnamed protein product [Mus musculus]
 gb|EDL12640.1| Der1-like domain family, member 2, isoform CRA_d [Mus musculus]
 gb|EDM05072.1| rCG34415, isoform CRA_c [Rattus norvegicus]
Length=239

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   IFPNQPG  194



>ref|XP_006994163.1| PREDICTED: derlin-2 [Peromyscus maniculatus bairdii]
Length=239

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   IFPNQPG  194



>ref|NP_001134187.1| derlin-2 [Salmo salar]
 gb|ACI66530.1| Derlin-2 [Salmo salar]
Length=244

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 3/203 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE+   + +      + RR+Q+WRL+TNF F G+ 
Sbjct  7     QEYFQIPSVTRAYTTACVLTTAAVQLEVITPFQLYFNPDLIIRRYQIWRLITNFLFFGSL  66

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  +F  L+  F+G +  
Sbjct  67    GFSFLFNIIFLYRYCRMLEEGSFRGRTADFVYMFLFGGVLMTLFGLFANLF--FLGQAFT  124

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL
Sbjct  125   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIVVDLLGIGVGHIYYFL  184

Query  486   TVLHP-LATGKNYFNTPRWVHKL  421
               + P    G+    TP  +  +
Sbjct  185   EDVFPNQPGGRKLLMTPELLRTV  207



>emb|CDQ67098.1| unnamed protein product [Oncorhynchus mykiss]
Length=244

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 3/203 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE+   + +      + RR+Q+WRL+TNF F G+ 
Sbjct  7     QEYFQIPSVTRAYTTACVLTTAAVQLEVITPFQLYFNPDLIIRRYQIWRLITNFLFFGSL  66

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  +F  L+  F+G +  
Sbjct  67    GFSFLFNIIFLYRYCRMLEEGSFRGRTADFVYMFLFGGVLMTLFGLFANLF--FLGQAFT  124

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL
Sbjct  125   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIVVDLLGIGVGHIYYFL  184

Query  486   TVLHP-LATGKNYFNTPRWVHKL  421
               + P    G+    TP  +  +
Sbjct  185   EDVFPNQPGGRKLLMTPELLRTV  207



>dbj|BAC38974.1| unnamed protein product [Mus musculus]
Length=239

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   IFPNQPG  194



>ref|XP_008251218.1| PREDICTED: derlin-3 isoform X2 [Oryctolagus cuniculus]
Length=233

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 122/201 (61%), Gaps = 6/201 (3%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA  LEL   + +      VFR+ QVWRLVTNF F G   F+F
Sbjct  12    QVPAVTRAYTAACVLTTAAV-LELLSPFQLYFNPHLVFRKLQVWRLVTNFLFFGPLGFSF  70

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  RTAD+V+MFLFG +   +M++  FL S F +G +L  M+
Sbjct  71    FFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGV---LMTLLGFLGSLFFLGQALTAML  127

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL  +
Sbjct  128   VYVWSRRSPHVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDV  187

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  188   FPNQPGGKRLLLTPGFLKLLL  208



>ref|XP_004666948.1| PREDICTED: derlin-2 [Jaculus jaculus]
Length=239

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNEPG  194



>ref|XP_008008224.1| PREDICTED: derlin-2 isoform X7 [Chlorocebus sabaeus]
Length=230

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSL--VFLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_001504789.1| PREDICTED: derlin-2 [Equus caballus]
Length=239

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_004946518.1| PREDICTED: derlin-2 isoform X4 [Gallus gallus]
Length=207

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 115/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG     +M+IF  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---FLMTIFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATG  460
             L  + P   G
Sbjct  185   LEDVFPNQPG  194



>ref|XP_007102875.1| PREDICTED: derlin-2 isoform X1 [Physeter catodon]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>gb|EDL12637.1| Der1-like domain family, member 2, isoform CRA_a [Mus musculus]
Length=248

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  19    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  78

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  79    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  136

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  137   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  196

Query  480   LHPLATG  460
             + P   G
Sbjct  197   IFPNQPG  203



>emb|CCA13929.1| Der1like family putative [Albugo laibachii Nc14]
Length=273

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 119/191 (62%), Gaps = 2/191 (1%)
 Frame = -1

Query  1044  KMSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNf  865
             KM+ P+E+Y  +P +++ Y   CF+T A+  L+L   +++   ++ +F + QVWRLV+NF
Sbjct  35    KMNDPLEWYYDIPIISRLYLTGCFLTTASCALDLISPFSLYYNFNLIFYKGQVWRLVSNF  94

Query  864   ffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF  685
              F G FS  F F +  ++RY   LE G F  R ADYV+M LFGA   L++ + PF+   F
Sbjct  95    LFFGLFSLDFLFHMYFVVRYCRLLEEGSFRNRPADYVYMLLFGAA--LMILVAPFVSVHF  152

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
             +G+SL FM+VYIWGR   + R++  GL  F   YLPW +L   + LGN    D++GI  G
Sbjct  153   LGSSLTFMMVYIWGRRNSDVRMSFLGLFPFTAPYLPWVLLSFSIALGNSATTDLIGIFVG  212

Query  504   HIYYFLTVLHP  472
             H YYFL  ++P
Sbjct  213   HTYYFLEDIYP  223



>ref|XP_007189240.1| PREDICTED: derlin-2-like isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F+G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFLGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_006177088.1| PREDICTED: derlin-2 isoform X2 [Camelus ferus]
 ref|XP_006217651.1| PREDICTED: derlin-2 isoform X2 [Vicugna pacos]
 ref|XP_010952953.1| PREDICTED: derlin-2 [Camelus bactrianus]
 ref|XP_010996844.1| PREDICTED: derlin-2 [Camelus dromedarius]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 118/206 (57%), Gaps = 13/206 (6%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG-----------KNYFNTPR  436
             + P   G           K  F+TP 
Sbjct  188   VFPNQPGGIRILKTPSILKAIFDTPE  213



>ref|NP_057125.2| derlin-2 [Homo sapiens]
 ref|NP_001127312.1| derlin-2 [Pongo abelii]
 ref|NP_001030231.2| derlin-2 [Bos taurus]
 ref|NP_001181116.1| derlin-2 [Macaca mulatta]
 ref|XP_848354.1| PREDICTED: derlin-2 isoformX1 [Canis lupus familiaris]
 ref|XP_002718887.1| PREDICTED: derlin-2 [Oryctolagus cuniculus]
 ref|XP_002748350.1| PREDICTED: derlin-2 isoform X1 [Callithrix jacchus]
 ref|XP_002929077.1| PREDICTED: derlin-2-like [Ailuropoda melanoleuca]
 ref|XP_003912232.1| PREDICTED: derlin-2 isoform X1 [Papio anubis]
 ref|XP_003931399.1| PREDICTED: derlin-2 [Saimiri boliviensis boliviensis]
 ref|XP_004012636.1| PREDICTED: derlin-2 [Ovis aries]
 ref|XP_004058454.1| PREDICTED: derlin-2 [Gorilla gorilla gorilla]
 ref|XP_004267053.1| PREDICTED: derlin-2 [Orcinus orca]
 ref|XP_004398656.1| PREDICTED: derlin-2 [Odobenus rosmarus divergens]
 ref|XP_004433288.1| PREDICTED: derlin-2 [Ceratotherium simum simum]
 ref|XP_004605003.1| PREDICTED: derlin-2 [Sorex araneus]
 ref|XP_005582709.1| PREDICTED: derlin-2 isoform X1 [Macaca fascicularis]
 ref|XP_005968018.1| PREDICTED: derlin-2 isoform X2 [Pantholops hodgsonii]
 ref|XP_006151946.1| PREDICTED: derlin-2 [Tupaia chinensis]
 ref|XP_006060093.1| PREDICTED: derlin-2 [Bubalus bubalis]
 ref|XP_007166593.1| PREDICTED: derlin-2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007451649.1| PREDICTED: derlin-2 [Lipotes vexillifer]
 ref|XP_007521318.1| PREDICTED: derlin-2 [Erinaceus europaeus]
 ref|XP_008008222.1| PREDICTED: derlin-2 isoform X5 [Chlorocebus sabaeus]
 ref|XP_010354142.1| PREDICTED: derlin-2 [Rhinopithecus roxellana]
 ref|XP_010845728.1| PREDICTED: derlin-2 isoform X4 [Bison bison bison]
 sp|Q9GZP9.1|DERL2_HUMAN RecName: Full=Derlin-2; AltName: Full=Degradation in endoplasmic 
reticulum protein 2; Short=DERtrin-2; AltName: Full=Der1-like 
protein 2; AltName: Full=F-LAN-1; AltName: Full=F-LANa 
[Homo sapiens]
 sp|Q5RC74.1|DERL2_PONAB RecName: Full=Derlin-2; AltName: Full=Degradation in endoplasmic 
reticulum protein 2; AltName: Full=Der1-like protein 2 [Pongo 
abelii]
 gb|AAF99603.1|AF242523_1 hypothetical transmembrane protein SBBI53 [Homo sapiens]
 gb|AAG43049.1|AF132289_1 F-LAN-1 [Homo sapiens]
 gb|AAL14869.1|AF208065_1 F-LANa [Homo sapiens]
 gb|AAH10890.1| Der1-like domain family, member 2 [Homo sapiens]
 emb|CAG33483.1| F-LANa [Homo sapiens]
 emb|CAH90633.1| hypothetical protein [Pongo abelii]
 dbj|BAG11045.1| derlin-2 [synthetic construct]
 gb|EFB18900.1| hypothetical protein PANDA_019170 [Ailuropoda melanoleuca]
 tpg|DAA18909.1| TPA: Der1-like domain family, member 2 [Bos taurus]
 gb|ADQ32689.1| Der1-like domain family, member 2 [synthetic construct]
 gb|EHH24422.1| Der1-like protein 2 [Macaca mulatta]
 gb|EHH57630.1| Der1-like protein 2 [Macaca fascicularis]
 gb|AIC51360.1| DERL2, partial [synthetic construct]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_005647558.1| DER1-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23014.1| DER1-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=240

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 117/202 (58%), Gaps = 2/202 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             ++Y  LP V + Y   CF+  AA  LE+   +NI      ++++ ++WRL+TNF F G+ 
Sbjct  5     DWYKQLPVVTRLYVTSCFLVTAACALEIITPFNIYFNARLIYQKLELWRLLTNFLFFGSL  64

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
                F F +  +++Y   LE   F  R+AD++WM LFGA  LLV++  PF+   F+G+SL 
Sbjct  65    GLDFVFHMFFLIKYSKSLEEESFRGRSADFLWMLLFGAGLLLVIA--PFVNIQFLGSSLT  122

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
             FM+VY+WGR  P   ++  G+  F   YLPW +L   + L +    D+LGI AGH YYFL
Sbjct  123   FMMVYVWGRRHPYVNLSFLGIFNFTAPYLPWVLLAFSVTLRSNAAVDLLGIVAGHCYYFL  182

Query  486   TVLHPLATGKNYFNTPRWVHKL  421
               ++P  TG+    TP  V  L
Sbjct  183   EDVYPRMTGRRPLRTPGLVKAL  204



>ref|XP_003416910.1| PREDICTED: derlin-2 [Loxodonta africana]
 ref|XP_004376163.1| PREDICTED: derlin-2 [Trichechus manatus latirostris]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_008571677.1| PREDICTED: derlin-2 isoform X1 [Galeopterus variegatus]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_007935704.1| PREDICTED: derlin-2 [Orycteropus afer afer]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_004716205.1| PREDICTED: derlin-2 [Echinops telfairi]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPDQPG  194



>ref|XP_003466351.1| PREDICTED: derlin-2 [Cavia porcellus]
 ref|XP_004857398.1| PREDICTED: derlin-2 [Heterocephalus glaber]
 ref|XP_005337392.1| PREDICTED: derlin-2 [Ictidomys tridecemlineatus]
 ref|XP_010604142.1| PREDICTED: derlin-2 isoform X2 [Fukomys damarensis]
 gb|KFO22938.1| Derlin-2 [Fukomys damarensis]
Length=239

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_007542973.1| PREDICTED: derlin-2 [Poecilia formosa]
Length=239

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 118/207 (57%), Gaps = 3/207 (1%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + + +QVWRL TNF F
Sbjct  4     QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILKNYQVWRLFTNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMG  679
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  IF  L   F+G
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGLLMTIFGIFVSL--VFLG  121

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
              +   M+VYIW R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH+
Sbjct  122   QAFTIMLVYIWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHV  181

Query  498   YYFLTVLHP-LATGKNYFNTPRWVHKL  421
             YYFL  + P    G  +  TP  +  L
Sbjct  182   YYFLEDVFPNQPGGGRWLRTPSIIKML  208



>ref|NP_001257645.1| Der1-like domain family, member 3 [Gallus gallus]
Length=241

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 118/201 (59%), Gaps = 3/201 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +FR+ Q+WRL+TNF F G  
Sbjct  8     QEYLGMPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFRKLQIWRLITNFLFFGPL  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L+  F+G +  
Sbjct  68    GFSFFFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFASLF--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIYYFL
Sbjct  126   IMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIIDLLGIAVGHIYYFL  185

Query  486   TVLHP-LATGKNYFNTPRWVH  427
               + P    GK    TP ++ 
Sbjct  186   EDVFPNQPGGKKLLLTPSFLK  206



>ref|XP_009841117.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV69260.1| hypothetical protein, variant [Aphanomyces astaci]
Length=241

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 119/190 (63%), Gaps = 2/190 (1%)
 Frame = -1

Query  1041  MSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNff  862
             M+ P+E+Y  +P +++ Y    F+T  A  LEL   +++   ++ +F R QVWRLVTNF 
Sbjct  1     MNDPLEWYYEIPIISRLYLTGAFLTTVACALELISPFSLYFNFNLIFYRGQVWRLVTNFL  60

Query  861   figafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFM  682
             F G FS  F F +  ++RY   LE G F  RTAD+++M L GA+ +++++  PF+   F+
Sbjct  61    FFGLFSLDFIFHMYFLVRYSRMLEEGSFRGRTADFLYMLLLGALTMILVA--PFVSVHFL  118

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G+SL FM+VY+WGR   + R++  GL  F   YLPW +L   M+LGN    D++GI  GH
Sbjct  119   GSSLTFMMVYVWGRRNEHTRLSFLGLFPFTAPYLPWVLLLFSMVLGNSATIDLIGIVVGH  178

Query  501   IYYFLTVLHP  472
             IYYF   ++P
Sbjct  179   IYYFFEDVYP  188



>ref|XP_003996191.1| PREDICTED: derlin-2 [Felis catus]
Length=239

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSVIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_006874998.1| PREDICTED: derlin-3 [Chrysochloris asiatica]
Length=235

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 122/202 (60%), Gaps = 7/202 (3%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V +TY   C  T AA QL+L   + +      VFR+FQVWRLVT+FFF G   F+F
Sbjct  12    QVPAVTRTYTAACVFTTAAVQLDLLSPFQLYFNPHLVFRKFQVWRLVTSFFFFGPLGFSF  71

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF--PFLWSPFMGASLVFM  661
              F +L + RY   LE G F  RTAD+V+M LFG + + ++ +F  PF    F+  +LV M
Sbjct  72    FFNMLFVFRYCRLLEEGSFRGRTADFVFMLLFGGVLVTLLGLFGSPF----FLSQALVTM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P+ R+N++GL+  +  +LPW + G  ++LGN +  D+LGI  GHIYYFL  
Sbjct  128   LVYVWSRRSPSVRVNLFGLLTLQAPFLPWALTGFSLLLGNSVLVDLLGITVGHIYYFLED  187

Query  480   LHP-LATGKNYFNTPRWVHKLV  418
             + P    GK    TP ++  L+
Sbjct  188   VFPNQPGGKRLLLTPSFLKLLL  209



>ref|XP_005284455.1| PREDICTED: derlin-2 isoform X1 [Chrysemys picta bellii]
Length=239

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 121/209 (58%), Gaps = 15/209 (7%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATG-----------KNYFNTPR  436
             L  + P   G           K  F+TP 
Sbjct  185   LEDIFPNQPGGGRLLKTPSILKAMFDTPE  213



>ref|XP_008285267.1| PREDICTED: derlin-2-like [Stegastes partitus]
Length=246

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 123/204 (60%), Gaps = 5/204 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE+   + +      + RR+Q+WRL+T+F F G+ 
Sbjct  20    QEYFQIPVVTRAYTTACVLTTAAVQLEVITPFQLYFNPDLIIRRYQIWRLITSFLFFGSL  79

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASL  670
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG I   VMS+F    + F +G + 
Sbjct  80    GFSFVFNIIFLYRYCRMLEEGSFRGRTADFVFMFLFGGI---VMSLFGLFANIFFLGQAF  136

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
             + M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI+ GH+YYF
Sbjct  137   IIMLVYVWSRRHPLIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIVVDLLGISVGHMYYF  196

Query  489   LTVLHP-LATGKNYFNTPRWVHKL  421
             L  + P L  G+    TP  +  +
Sbjct  197   LEDVFPNLPGGRKLLMTPELLRMM  220



>ref|XP_010604141.1| PREDICTED: derlin-2 isoform X1 [Fukomys damarensis]
Length=261

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|NP_001290910.1| derlin 2 [Esox lucius]
 gb|ACO14163.1| Derlin-2 [Esox lucius]
Length=239

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 121/208 (58%), Gaps = 5/208 (2%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLEL   + +      + R  QVWRL+TNF F
Sbjct  4     QTFQQEYLQIPVVTRAYTTACVLTTAAVQLELITPFQLYFNPDLILRNCQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFM  682
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFL  120

Query  681   GASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGH  502
             G +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH
Sbjct  121   GQAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH  180

Query  501   IYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             +Y+FL  + P    G  +  TP ++  L
Sbjct  181   VYFFLEDVFPNQPGGGRWLKTPFFLKML  208



>ref|XP_006752394.1| PREDICTED: LOW QUALITY PROTEIN: derlin 2 [Leptonychotes weddellii]
Length=262

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSL--VFLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_007421633.1| PREDICTED: derlin-2 [Python bivittatus]
Length=239

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 120/204 (59%), Gaps = 4/204 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPFVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATGKNYFNTPRWVHKLV  418
             L  + P   G         + KL+
Sbjct  185   LEDVFPNQPGGGRLLKTPSILKLI  208



>ref|XP_005141430.1| PREDICTED: derlin-2 [Melopsittacus undulatus]
Length=239

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATG  460
             L  + P   G
Sbjct  185   LEDVFPNQPG  194



>ref|XP_511992.3| PREDICTED: derlin-2 isoform X1 [Pan troglodytes]
 ref|XP_003810210.1| PREDICTED: derlin-2 [Pan paniscus]
Length=251

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  22    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  81

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  82    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  139

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  140   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  199

Query  480   LHPLATG  460
             + P   G
Sbjct  200   VFPNQPG  206



>ref|XP_010874547.1| PREDICTED: derlin-3 [Esox lucius]
Length=244

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 123/210 (59%), Gaps = 4/210 (2%)
 Frame = -1

Query  1047  IKMSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTN  868
             +  S   EY+  +P V + Y   C +T AA QLE+   + +      + RR+Q+WRL+TN
Sbjct  1     MAQSFTQEYFQ-IPSVTRAYTTACVLTTAAVQLEVITPFQLYFNPDLIIRRYQIWRLITN  59

Query  867   fffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSP  688
             F F G+  F+F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  +F  L+  
Sbjct  60    FLFFGSLGFSFLFNIIFLYRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLFGLFANLF--  117

Query  687   FMGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAA  508
             F+G +   M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  
Sbjct  118   FLGQAFTIMLVYVWSRRNPYIRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIVVDLLGIGV  177

Query  507   GHIYYFLTVLHP-LATGKNYFNTPRWVHKL  421
             GHIYYFL  + P    G+    TP  +  +
Sbjct  178   GHIYYFLEDVFPNQPGGRKLLITPELLRTV  207



>ref|XP_008323682.1| PREDICTED: derlin-2 [Cynoglossus semilaevis]
Length=239

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 119/202 (59%), Gaps = 5/202 (2%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +P V + Y   C +T AA QLE+   + +      + R +QVWRL+TNF F G   F
Sbjct  10    YLQIPIVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILRNYQVWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIF-PFLWSPFMGASLVF  664
              F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+G +   
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGTFVSLVFLGQAFTI  126

Query  663   MIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLT  484
             M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH+Y+FL 
Sbjct  127   MLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSVIVDLLGIAVGHVYFFLE  186

Query  483   VLHP-LATGKNYFNTPRWVHKL  421
              + P    G  +  TP  +  L
Sbjct  187   DVFPNQPGGGRWLKTPSIIKML  208



>ref|XP_010186109.1| PREDICTED: derlin-2 [Mesitornis unicolor]
 gb|KFQ38239.1| Derlin-2 [Mesitornis unicolor]
Length=239

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATG  460
             L  + P   G
Sbjct  185   LEDVFPNQPG  194



>ref|XP_010221596.1| PREDICTED: derlin-2 isoform X1 [Tinamus guttatus]
 ref|XP_010571813.1| PREDICTED: derlin-2 isoform X1 [Haliaeetus leucocephalus]
 gb|KGL83211.1| Derlin-2 [Tinamus guttatus]
Length=239

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATG  460
             L  + P   G
Sbjct  185   LEDVFPNQPG  194



>ref|XP_004946517.1| PREDICTED: derlin-2 isoform X3 [Gallus gallus]
Length=239

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 113/189 (60%), Gaps = 2/189 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQVWRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +  
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTIFGLFVNLV--FLGQAFT  125

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL
Sbjct  126   IMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFL  185

Query  486   TVLHPLATG  460
               + P   G
Sbjct  186   EDVFPNQPG  194



>ref|XP_008533841.1| PREDICTED: derlin-2 [Equus przewalskii]
Length=257

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  28    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  87

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  88    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  145

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  146   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  205

Query  480   LHPLATG  460
             + P   G
Sbjct  206   VFPNQPG  212



>emb|CCA13928.1| Der1like family putative [Albugo laibachii Nc14]
Length=296

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 119/191 (62%), Gaps = 2/191 (1%)
 Frame = -1

Query  1044  KMSTPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNf  865
             KM+ P+E+Y  +P +++ Y   CF+T A+  L+L   +++   ++ +F + QVWRLV+NF
Sbjct  58    KMNDPLEWYYDIPIISRLYLTGCFLTTASCALDLISPFSLYYNFNLIFYKGQVWRLVSNF  117

Query  864   ffigafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF  685
              F G FS  F F +  ++RY   LE G F  R ADYV+M LFGA   L++ + PF+   F
Sbjct  118   LFFGLFSLDFLFHMYFVVRYCRLLEEGSFRNRPADYVYMLLFGAA--LMILVAPFVSVHF  175

Query  684   MGASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAG  505
             +G+SL FM+VYIWGR   + R++  GL  F   YLPW +L   + LGN    D++GI  G
Sbjct  176   LGSSLTFMMVYIWGRRNSDVRMSFLGLFPFTAPYLPWVLLSFSIALGNSATTDLIGIFVG  235

Query  504   HIYYFLTVLHP  472
             H YYFL  ++P
Sbjct  236   HTYYFLEDIYP  246



>ref|XP_004594923.1| PREDICTED: derlin-2 [Ochotona princeps]
Length=239

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 112/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C  T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVFTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_008008218.1| PREDICTED: derlin-2 isoform X1 [Chlorocebus sabaeus]
Length=280

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_002192688.1| PREDICTED: derlin-2-like [Taeniopygia guttata]
 ref|XP_005525919.1| PREDICTED: derlin-2 [Pseudopodoces humilis]
 ref|XP_009092918.1| PREDICTED: derlin-2 [Serinus canaria]
Length=239

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +PPV + Y   C +T AA QLEL   + +      +F+ FQ+WRL+TN+ F G  
Sbjct  8     QEYLQVPPVTRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNYLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M++F  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTLFGLFVNLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+F
Sbjct  125   TIMLVYVWSRRNPYVRMNFFGLLIFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFF  184

Query  489   LTVLHPLATG  460
             L  + P   G
Sbjct  185   LEDVFPNQPG  194



>ref|XP_006640468.1| PREDICTED: derlin-2-like [Lepisosteus oculatus]
Length=256

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 114/189 (60%), Gaps = 2/189 (1%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C +T AA QLE    + +      +F+R+Q+WRL+TNF F G  
Sbjct  7     QEYLQIPAVTRAYTTACVLTTAAVQLEFITPFQLYFNPDLIFKRYQIWRLITNFLFFGPL  66

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLV  667
              F+F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  +F  L+  F+G +  
Sbjct  67    GFSFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGMLMTLFGLFASLF--FLGQAFT  124

Query  666   FMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFL  487
              M+VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL
Sbjct  125   IMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIVIDLLGIGVGHIYYFL  184

Query  486   TVLHPLATG  460
               + P   G
Sbjct  185   EDVFPNQPG  193



>ref|XP_008422997.1| PREDICTED: derlin-2 [Poecilia reticulata]
Length=276

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 118/207 (57%), Gaps = 3/207 (1%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + + +Q+WRL TNF F
Sbjct  41    QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILKNYQIWRLFTNFLF  100

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMG  679
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG + + +  IF  L   F+G
Sbjct  101   FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGLLMTIFGIFVSLV--FLG  158

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
              +   M+VYIW R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH+
Sbjct  159   QAFTIMLVYIWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHV  218

Query  498   YYFLTVLHP-LATGKNYFNTPRWVHKL  421
             YYFL  + P    G  +  TP  +  L
Sbjct  219   YYFLEDVFPNQPGGGRWLRTPSIIKML  245



>ref|XP_006640887.1| PREDICTED: derlin-2-like [Lepisosteus oculatus]
Length=239

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 118/198 (60%), Gaps = 5/198 (3%)
 Frame = -1

Query  1026  EYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigaf  847
             + Y  +P V + Y   C  T AA QLE+   + +      +F+ +QVWRL+TNF F G  
Sbjct  8     QEYLQIPVVTRAYTTACVFTTAAVQLEVITPFQLYFNPDLIFKHYQVWRLITNFLFFGPV  67

Query  846   sftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFP-FLWSPFMGASL  670
              F F F ++ + RY   LE G F  RTAD+V+MFLFG    L+M+IF  F+   F+G + 
Sbjct  68    GFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGG---LLMTIFGMFVSLVFLGQAF  124

Query  669   VFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYF  490
               M+VYIW R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GH+Y+F
Sbjct  125   TIMLVYIWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHVYFF  184

Query  489   LTVLHPLAT-GKNYFNTP  439
             L  + P    G  +  TP
Sbjct  185   LEDVFPHQPGGTRWLKTP  202



>ref|XP_005619945.1| PREDICTED: derlin-2 isoform X2 [Canis lupus familiaris]
Length=294

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -1

Query  1020  YNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsf  841
             Y  +PPV++ Y   C +T AA QLEL   + +      +F+ FQ+WRL+TNF F G   F
Sbjct  10    YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGF  69

Query  840   tfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMGASLVFM  661
              F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  +F  L   F+G +   M
Sbjct  70    NFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV--FLGQAFTIM  127

Query  660   IVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTV  481
             +VY+W R  P  R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGIA GHIY+FL  
Sbjct  128   LVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLED  187

Query  480   LHPLATG  460
             + P   G
Sbjct  188   VFPNQPG  194



>ref|XP_003965159.1| PREDICTED: derlin-2-like [Takifugu rubripes]
Length=239

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 117/207 (57%), Gaps = 3/207 (1%)
 Frame = -1

Query  1038  STPMEYYNSLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfff  859
              T  + Y  +P V + Y   C +T AA QLE+   + +      + R +QVWRL+TNF F
Sbjct  4     QTLQQEYLQIPVVTRAYTTACVLTTAAVQLEIITPFQLYFNPDLILRNYQVWRLITNFLF  63

Query  858   igafsftfaFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPFMG  679
              G   F F F ++ + RY   LE G F  RTAD+V+MFLFG   + +  IF  L   F+G
Sbjct  64    FGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTIFGIFVSL--VFLG  121

Query  678   ASLVFMIVYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHI  499
              +   M+VY+W R  PN R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GH+
Sbjct  122   QAFTIMLVYVWSRRNPNVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIVVGHV  181

Query  498   YYFLTVLHP-LATGKNYFNTPRWVHKL  421
             Y+FL  + P    G  +  TP  +  L
Sbjct  182   YFFLEDVFPNQPGGGRWLKTPSIIKML  208



>ref|XP_006256388.1| PREDICTED: derlin-3 isoform X9 [Rattus norvegicus]
 ref|XP_008772064.1| PREDICTED: derlin-3 isoform X9 [Rattus norvegicus]
Length=227

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 120/201 (60%), Gaps = 6/201 (3%)
 Frame = -1

Query  1014  SLPPVAKTYAVICFMTAAAYQLELYDVWNIALFYSDVFRRFQVWRLVTNfffigafsftf  835
              +P V + Y   C +T AA  LEL   + +      VFR+FQVWRL+T F F G   F F
Sbjct  12    QVPAVTRAYTAACVLTTAAV-LELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGF  70

Query  834   aFRLLIILRYGVQLERGPFDKRTADYVWMFLFGAIGLLVMSIFPFLWSPF-MGASLVFMI  658
              F +L + RY   LE G F  R AD+V+MFLFG +   +M++  FL S F +G +L+ M+
Sbjct  71    FFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGV---LMTLLGFLGSMFFLGQALMAML  127

Query  657   VYIWGREFPNERINVYGLVQFKGFYLPWYMLGIDMILGNPLKPDMLGIAAGHIYYFLTVL  478
             VY+W R  P+ R+N +GL+ F+  +LPW ++G  ++LGN +  D+LGI  GHIYYFL  +
Sbjct  128   VYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVITDLLGIIVGHIYYFLEDV  187

Query  477   HP-LATGKNYFNTPRWVHKLV  418
              P    GK    TP ++  L+
Sbjct  188   FPNQPGGKRLLLTPSFLKLLL  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2725021258018