BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32222_g1_i1 len=1201 path=[1179:0-1200]

Length=1201
                                                                      Score     E

ref|XP_009614440.1|  PREDICTED: lysine-rich arabinogalactan prote...  62.8    7e-08   
ref|XP_006348590.1|  PREDICTED: lysine-rich arabinogalactan prote...  61.2    2e-07   
ref|XP_009791195.1|  PREDICTED: lysine-rich arabinogalactan prote...  61.6    2e-07   
ref|XP_004238980.1|  PREDICTED: lysine-rich arabinogalactan prote...  57.8    4e-06   
ref|XP_011070858.1|  PREDICTED: lysine-rich arabinogalactan prote...  50.8    0.001   



>ref|XP_009614440.1| PREDICTED: lysine-rich arabinogalactan protein 19 [Nicotiana 
tomentosiformis]
Length=261

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = +1

Query  862   QESVDVTPAPSPSLNLNGGVSFVLQAGGRSRIWTSAGLAVTIFMAMI  1002
             QESV+VTPAPSP+LNLNG    VL  G RSR+WT+AGLA+TI + +I
Sbjct  216   QESVEVTPAPSPTLNLNGAT--VLLQGSRSRMWTNAGLAMTILLTII  260



>ref|XP_006348590.1| PREDICTED: lysine-rich arabinogalactan protein 19-like [Solanum 
tuberosum]
Length=233

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = +1

Query  862   QESVDVTPAPSPSLNLNGGVSFVLQAGGRSRIWTSAGLAVTIFMAMI  1002
             Q+SVDVTPAPSP+LNLNG  +F+LQ G  SR+W +AGLA+TI +A+I
Sbjct  188   QDSVDVTPAPSPTLNLNGA-TFLLQ-GSASRMWMNAGLAMTILLAII  232



>ref|XP_009791195.1| PREDICTED: lysine-rich arabinogalactan protein 19 [Nicotiana 
sylvestris]
Length=272

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = +1

Query  862   QESVDVTPAPSPSLNLNGGVSFVLQAGGRSRIWTSAGLAVTIFMAMI  1002
             QESV+VTPAPSP++NLNG    VL  G RSR+W +AGLA+TI +A+I
Sbjct  227   QESVEVTPAPSPTMNLNGAT--VLLQGSRSRMWMNAGLAMTILLAII  271



>ref|XP_004238980.1| PREDICTED: lysine-rich arabinogalactan protein 19 [Solanum lycopersicum]
Length=263

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  862   QESVDVTPAPSPSLNLNGGVSFVLQAGGRSRIWTSAGLAVTIFMAMI  1002
             Q+SVDVTPAPSP+LNLNG  +F+LQ G  S +W +AGLA+TI +A+I
Sbjct  218   QDSVDVTPAPSPTLNLNGA-TFLLQ-GSASGMWMNAGLAMTILLAII  262



>ref|XP_011070858.1| PREDICTED: lysine-rich arabinogalactan protein 19 [Sesamum indicum]
Length=260

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +1

Query  859  VQESVDVTPAPSPSLNLNGGVSFVLQAGGRSRIWTSAGLAVTIFMAM  999
            VQ++   TPAPSP+L+LNGGVS   Q G R+R+  +AGLAV  F+A+
Sbjct  210  VQDTEGTTPAPSPTLDLNGGVSLDQQ-GRRTRMQVTAGLAVATFLAI  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2989120234566