BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32215_g1_i1 len=978 path=[956:0-977]

Length=978
                                                                      Score     E

ref|XP_002612785.1|  hypothetical protein BRAFLDRAFT_233058           63.5    8e-09   Branchiostoma floridae
ref|WP_037612161.1|  hypothetical protein                             54.7    4e-06   
ref|WP_037599135.1|  hypothetical protein                             58.5    4e-06   
ref|YP_073671.1|  major outer envelope glycoprotein-like protein      56.6    2e-05   Lymphocystis disease virus - isolate China
ref|XP_009052852.1|  hypothetical protein LOTGIDRAFT_99061            52.8    3e-05   
ref|XP_002787764.1|  hypothetical protein Pmar_PMAR012541             55.5    4e-05   Perkinsus marinus ATCC 50983
ref|XP_010790276.1|  PREDICTED: spectrin beta chain, non-erythroc...  52.8    3e-04   



>ref|XP_002612785.1| hypothetical protein BRAFLDRAFT_233058 [Branchiostoma floridae]
 gb|EEN68794.1| hypothetical protein BRAFLDRAFT_233058 [Branchiostoma floridae]
Length=154

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  568  FDTSGDAEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPA  389
              TSG   +P A      A E P++S +G   E P++S + T  E P++S +GT  E P+
Sbjct  7    IPTSGTVCEPPALPPGGTACEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPS  66

Query  388  ISSTGTAAERPVVSSAGTVAEAPAVWSTNT  299
            +S +GT  E P +S +GTV E P++  + T
Sbjct  67   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGT  96


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  568  FDTSGDAEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPA  389
                G A +P + S +    E P++S +G   E P++S + T  E P++S +GT  E P+
Sbjct  19   LPPGGTACEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPS  78

Query  388  ISSTGTAAERPVVSSAGTVAEAPAVWSTNT  299
            +S +GT  E P +S +GTV E P++  + T
Sbjct  79   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGT  108


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  568  FDTSGDAEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPA  389
               SG   +P + S +    E P++S +G   E P++S + T  E P++S +GT  E P+
Sbjct  31   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPS  90

Query  388  ISSTGTAAERPVVSSAGTVAEAPAVWSTNT  299
            +S +GT  E P +S +GTV E P++  + T
Sbjct  91   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGT  120


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -3

Query  568  FDTSGDAEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPA  389
               SG   +P + S +    E P++S +G   E P++S + T  E P++S +GT  E P+
Sbjct  43   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPS  102

Query  388  ISSTGTAAERPVVSSAGTVAEAPAV  314
            +S +GT  E P +S +GTV E P++
Sbjct  103  LSPSGTVCEPPSLSPSGTVCEPPSL  127


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  568  FDTSGDAEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPA  389
               SG   +P + S +    E P++S +G   E P++S + T  E P++S +GT  E P+
Sbjct  55   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPS  114

Query  388  ISSTGTAAERPVVSSAGTVAEAPAVWSTNT  299
            +S +GT  E P +   GTV E P++  + T
Sbjct  115  LSPSGTVCEPPSLPLGGTVCEPPSLSPSGT  144


 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -3

Query  544  KPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAA  365
            +P +   +    E PA+   G A E P++S + T  E P++S +GT  E P++S +GT  
Sbjct  3    EPPSIPTSGTVCEPPALPPGGTACEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVC  62

Query  364  ERPVVSSAGTVAEAPAVWSTNT  299
            E P +S +GTV E P++  + T
Sbjct  63   EPPSLSPSGTVCEPPSLSPSGT  84


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = -3

Query  568  FDTSGDAEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPA  389
               SG   +P + S +    E P++S +G   E P++S + T  E P++S +GT  E P+
Sbjct  67   LSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPSLSPSGTVCEPPS  126

Query  388  ISSTGTAAERPVVSSAGTVAEAPAVWST  305
            +   GT  E P +S +GTV E P++  T
Sbjct  127  LPLGGTVCEPPSLSPSGTVCEPPSLTRT  154



>ref|WP_037612161.1| hypothetical protein, partial [Streptococcus salivarius]
Length=85

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  535  AFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERP  356
            A S T A +E PAVS+  A +E PAVS+T  T+E PA+S T    E PA+S+T   +E P
Sbjct  5    AVSVTPATSEAPAVSTAPATSEAPAVSTTPATSEAPAVSMTPATSEAPAVSTTPATSEAP  64

Query  355  VVSSAGTVAEAPAV  314
             VS+   ++EAPAV
Sbjct  65   AVSTTPVISEAPAV  78


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  508  EKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGTVA  329
            E PAVS T A +E PAVS+   T+E PA+S+T    E PA+S T   +E P VS+    +
Sbjct  2    EAPAVSVTPATSEAPAVSTAPATSEAPAVSTTPATSEAPAVSMTPATSEAPAVSTTPATS  61

Query  328  EAPAVWST  305
            EAPAV +T
Sbjct  62   EAPAVSTT  69



>ref|WP_037599135.1| hypothetical protein [Streptococcus sp. ACS2]
 gb|EUC64598.1| LPXTG cell wall anchor domain protein [Streptococcus sp. ACS2]
Length=662

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  535  AFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERP  356
            A S T A +E PAVS+T A +E PAVS+T  T+E PA+S+T    E PA+S+    +E P
Sbjct  437  AVSTTPATSEAPAVSTTPATSEAPAVSTTPATSEAPAVSTTPATSEAPAVSTAPATSETP  496

Query  355  VVSSAGTVAEAPAVWST  305
             VS+    +EAPAV +T
Sbjct  497  AVSTTPATSEAPAVSTT  513


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  535  AFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERP  356
            A S T A +E PAVS+T A +E PAVS+   T+E PA+S+T    E PA+S+T   +E P
Sbjct  461  AVSTTPATSEAPAVSTTPATSEAPAVSTAPATSETPAVSTTPATSEAPAVSTTPATSEAP  520

Query  355  VVSSAGTVAEAPAVWST  305
             VS+A   +E PAV +T
Sbjct  521  AVSTAPATSETPAVSTT  537


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -3

Query  508  EKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGTVA  329
            E PAVS+T A +E PAVS+T  T+E PA+S+T    E PA+S+T   +E P VS+A   +
Sbjct  434  EAPAVSTTPATSEAPAVSTTPATSEAPAVSTTPATSEAPAVSTTPATSEAPAVSTAPATS  493

Query  328  EAPAVWST  305
            E PAV +T
Sbjct  494  ETPAVSTT  501


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  535  AFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERP  356
            A S T A +E PAVS+  A +E PAVS+T  T+E PA+S+T    E PA+S+    +E P
Sbjct  473  AVSTTPATSEAPAVSTAPATSETPAVSTTPATSEAPAVSTTPATSEAPAVSTAPATSETP  532

Query  355  VVSSAGTVAEAPAVWST  305
             VS+    +EA AV +T
Sbjct  533  AVSTTPATSEASAVSTT  549


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  535  AFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERP  356
            A S T A +E PAVS+  A +E PAVS+T  T+E  A+S+T    E PA S+T   +E P
Sbjct  509  AVSTTPATSEAPAVSTAPATSETPAVSTTPATSEASAVSTTPATSEAPANSTTPATSETP  568

Query  355  VVSSAGTVAEAPAVWST  305
             VS+    +EAPAV +T
Sbjct  569  TVSTTPATSEAPAVSTT  585



>ref|YP_073671.1| major outer envelope glycoprotein-like protein [Lymphocystis 
disease virus - isolate China]
 gb|AAU11010.1| major outer envelope glycoprotein-like protein [Lymphocystis 
disease virus - isolate China]
Length=801

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -3

Query  514  AAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGT  335
            A +KP V+    A +KP V+   T T+KP ++   TA +KP ++   TA ++PVV+ A T
Sbjct  337  ATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPT  396

Query  334  VAEAPAVWSTNT  299
              + P V  T+T
Sbjct  397  ATQKPVVTQTST  408


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  514  AAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGT  335
            A +KP V+    A +KP V+   T T+KP ++   TA +KP ++   TA ++PVV+ A T
Sbjct  289  ATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPT  348

Query  334  VAEAPAV  314
              + P V
Sbjct  349  ATQKPVV  355


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  514  AAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGT  335
            A +KP V+    A +KP V+   T T+KP ++   TA +KP ++   TA ++PVV+ A T
Sbjct  301  ATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPT  360

Query  334  VAEAPAV  314
              + P V
Sbjct  361  ATQKPVV  367


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  514  AAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGT  335
            A +KP V+    A +KP V+   T T+KP ++   TA +KP ++   TA ++PVV+ A T
Sbjct  313  ATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPT  372

Query  334  VAEAPAV  314
              + P V
Sbjct  373  ATQKPVV  379


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  514  AAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGT  335
            A +KP V+    A +KP V+   T T+KP ++   TA +KP ++   TA ++PVV+ A T
Sbjct  325  ATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPTATQKPVVTQAPT  384

Query  334  VAEAPAV  314
              + P V
Sbjct  385  ATQKPVV  391



>ref|XP_009052852.1| hypothetical protein LOTGIDRAFT_99061, partial [Lottia gigantea]
 gb|ESO96498.1| hypothetical protein LOTGIDRAFT_99061, partial [Lottia gigantea]
Length=133

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 5/102 (5%)
 Frame = -3

Query  604  TISSSVIPQNGIFDTSGDAEKPDAFSCTNAA-----AEKPAVSSTGAAAEKPAVSSTDTT  440
            T+  +V  +  + D     E+P+  +  N++     +EKP VS     +EKP VS   T 
Sbjct  3    TLKPTVSEETTVTDKHNVTEEPNVTNEPNSSDRPTVSEKPTVSEKPTVSEKPTVSEKPTV  62

Query  439  TEKPAISSTGTAIEKPAISSTGTAAERPVVSSAGTVAEAPAV  314
            +EKP +S   T  EKP +S   T +E+P VS    V+E PAV
Sbjct  63   SEKPTVSEKTTVSEKPTVSEKTTVSEKPNVSEKPAVSEKPAV  104



>ref|XP_002787764.1| hypothetical protein Pmar_PMAR012541 [Perkinsus marinus ATCC 
50983]
 gb|EER19560.1| hypothetical protein Pmar_PMAR012541 [Perkinsus marinus ATCC 
50983]
Length=1430

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 10/128 (8%)
 Frame = -3

Query  550  AEKPDAFSCTNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGTAIEKPAISSTGT  371
            A++P   +      E+P+V + G  AE+P+V +  T  E+P++ + GT  E+P++ + G 
Sbjct  403  AKEPSKPAVGTEVEEEPSVPAAGTKAEEPSVPAAGTKAEEPSVPAAGTKAEEPSVPA-GA  461

Query  370  AAERPVVSSAGTVAEAPAVWSTNTEETNFGNPYS*IEESVRPCMHAAFLLSVERDICLKE  191
             AE P   +AGT AE P+V +  T+          +EE  RP +   F++        +E
Sbjct  462  KAEEPSAPAAGTKAEEPSVPAVGTKV---------VEEPSRPALEKEFVVPAAGSGVEEE  512

Query  190  PFLLCCNL  167
            P +    +
Sbjct  513  PLVSAAKV  520



>ref|XP_010790276.1| PREDICTED: spectrin beta chain, non-erythrocytic 4-like [Notothenia 
coriiceps]
 ref|XP_010790277.1| PREDICTED: spectrin beta chain, non-erythrocytic 4-like [Notothenia 
coriiceps]
Length=1561

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 21/161 (13%)
 Frame = -3

Query  703   SGSSPSSAEKRCHKRCSSGRGVSLFSGAIGAAHTI----------SSSVIPQNGIFDTSG  554
             +GS+ SS        C  G    L SG +G +  I          S   +PQ  +  +  
Sbjct  932   AGSAESSGYYGLTTGCVGGTPNHLGSGRLGNSGNIAQHPSSGGMGSPGYLPQQNMGSSGY  991

Query  553   DAEKPDAFSC-----------TNAAAEKPAVSSTGAAAEKPAVSSTDTTTEKPAISSTGT  407
              A+ P+  S            T   A++P + STG  A +P + ST    ++P + S+G 
Sbjct  992   LAQSPNMGSSGYLGHQPNLGSTGYLAQQPNLGSTGYLAPQPNLGSTGYLAQQPNMGSSGY  1051

Query  406   AIEKPAISSTGTAAERPVVSSAGTVAEAPAVWSTNTEETNF  284
               + P + STG  A++P + S+G +A+ P + S+     N+
Sbjct  1052  LAQPPNLGSTGYLAQQPNMGSSGYLAQQPNMVSSGYLAQNY  1092



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145275583018