BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32158_g1_i1 len=934 path=[912:0-933]

Length=934
                                                                      Score     E

ref|XP_007202474.1|  hypothetical protein PRUPE_ppa010268mg             189   1e-54   
ref|XP_008242463.1|  PREDICTED: acid phosphatase 1                      189   2e-54   
ref|XP_007012979.1|  HAD superfamily isoform 2                          189   3e-54   
ref|XP_010047662.1|  PREDICTED: acid phosphatase 1-like                 188   7e-54   
ref|XP_007012978.1|  HAD superfamily isoform 1                          189   1e-53   
ref|XP_010267101.1|  PREDICTED: acid phosphatase 1-like                 184   2e-52   
ref|XP_009352576.1|  PREDICTED: acid phosphatase 1                      184   2e-52   
gb|KDO55859.1|  hypothetical protein CISIN_1g024820mg                   184   3e-52   
ref|XP_006451342.1|  hypothetical protein CICLE_v10009222mg             184   3e-52   
ref|XP_011078233.1|  PREDICTED: acid phosphatase 1-like                 184   3e-52   
ref|XP_007152955.1|  hypothetical protein PHAVU_004G174200g             183   4e-52   
gb|KDP33773.1|  hypothetical protein JCGZ_07344                         183   4e-52   
ref|XP_004141030.1|  PREDICTED: acid phosphatase 1-like                 183   4e-52   
ref|XP_008367917.1|  PREDICTED: acid phosphatase 1-like                 182   1e-51   
ref|XP_002514195.1|  Acid phosphatase 1 precursor, putative             181   2e-51   Ricinus communis
ref|XP_008459051.1|  PREDICTED: acid phosphatase 1-like                 181   2e-51   
ref|XP_004157899.1|  PREDICTED: acid phosphatase 1-like                 179   1e-50   
ref|XP_004141031.1|  PREDICTED: acid phosphatase 1-like                 179   1e-50   
ref|XP_004513069.1|  PREDICTED: acid phosphatase 1-like                 178   3e-50   
ref|XP_008387412.1|  PREDICTED: acid phosphatase 1-like                 177   7e-50   
ref|XP_006359744.1|  PREDICTED: acid phosphatase 1-like                 177   1e-49   
ref|XP_010688366.1|  PREDICTED: acid phosphatase 1-like                 176   2e-49   
ref|XP_010110867.1|  Acid phosphatase 1                                 175   5e-49   
ref|XP_003620757.1|  Acid phosphatase-like protein                      175   5e-49   
ref|XP_004245159.1|  PREDICTED: acid phosphatase 1-like                 176   6e-49   
ref|NP_194656.1|  HAD superfamily, subfamily IIIB acid phosphatase      175   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459056.1|  PREDICTED: acid phosphatase 1-like                 174   7e-49   
ref|XP_010548683.1|  PREDICTED: acid phosphatase 1-like                 174   1e-48   
ref|XP_002867418.1|  predicted protein                                  173   2e-48   
ref|XP_010688365.1|  PREDICTED: acid phosphatase 1-like                 173   2e-48   
ref|XP_006656617.1|  PREDICTED: acid phosphatase 1-like                 172   3e-48   
gb|AFK34288.1|  unknown                                                 173   3e-48   
ref|XP_004141163.1|  PREDICTED: acid phosphatase 1-like                 173   3e-48   
ref|XP_002867417.1|  predicted protein                                  173   5e-48   
ref|XP_004287494.1|  PREDICTED: acid phosphatase 1-like                 172   5e-48   
ref|XP_003529064.1|  PREDICTED: acid phosphatase 1-like                 171   1e-47   
emb|CDP03233.1|  unnamed protein product                                171   2e-47   
ref|XP_010662272.1|  PREDICTED: acid phosphatase 1                      171   3e-47   
ref|XP_010249468.1|  PREDICTED: acid phosphatase 1-like                 169   1e-46   
ref|XP_009795729.1|  PREDICTED: acid phosphatase 1-like                 169   1e-46   
ref|XP_006284398.1|  hypothetical protein CARUB_v10005568mg             168   2e-46   
ref|XP_006853740.1|  hypothetical protein AMTR_s00056p00177520          169   2e-46   
ref|XP_009109048.1|  PREDICTED: acid phosphatase 1-like isoform X2      169   2e-46   
ref|XP_011076425.1|  PREDICTED: acid phosphatase 1-like                 168   3e-46   
ref|XP_002309231.2|  hypothetical protein POPTR_0006s15760g             167   3e-46   Populus trichocarpa [western balsam poplar]
gb|ABK92831.1|  unknown                                                 167   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002283385.2|  PREDICTED: acid phosphatase 1-like                 169   5e-46   Vitis vinifera
ref|XP_010548682.1|  PREDICTED: acid phosphatase 1-like                 167   5e-46   
ref|XP_006837335.1|  hypothetical protein AMTR_s00111p00084650          168   7e-46   
ref|XP_007038298.1|  HAD superfamily, subfamily IIIB acid phospha...    167   1e-45   
gb|EYU30686.1|  hypothetical protein MIMGU_mgv1a011950mg                167   1e-45   
gb|EAZ35770.1|  hypothetical protein OsJ_20061                          167   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010448471.1|  PREDICTED: acid phosphatase 1-like                 166   1e-45   
ref|NP_001056747.1|  Os06g0139800                                       167   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799767.1|  PREDICTED: acid phosphatase 1-like                 166   3e-45   
ref|XP_010925513.1|  PREDICTED: acid phosphatase 1-like isoform X1      165   3e-45   
ref|XP_010433115.1|  PREDICTED: acid phosphatase 1-like                 165   4e-45   
ref|XP_011007264.1|  PREDICTED: acid phosphatase 1                      164   6e-45   
ref|XP_009109046.1|  PREDICTED: acid phosphatase 1-like isoform X1      165   6e-45   
ref|XP_010914845.1|  PREDICTED: acid phosphatase 1-like                 164   7e-45   
ref|XP_006284235.1|  hypothetical protein CARUB_v10005397mg             165   8e-45   
ref|NP_001234071.1|  acid phosphatase 1 precursor                       164   1e-44   
ref|XP_011101105.1|  PREDICTED: acid phosphatase 1-like                 164   1e-44   
gb|AHC69831.1|  acid phosphatase                                        164   1e-44   
ref|XP_010941067.1|  PREDICTED: acid phosphatase 1-like                 164   1e-44   
prf||1908418A  acid phosphatase 1                                       164   1e-44
ref|XP_010438922.1|  PREDICTED: acid phosphatase 1-like                 164   1e-44   
ref|XP_010541004.1|  PREDICTED: acid phosphatase 1                      164   1e-44   
ref|XP_010447874.1|  PREDICTED: acid phosphatase 1-like                 164   1e-44   
ref|XP_010925515.1|  PREDICTED: acid phosphatase 1-like isoform X2      163   1e-44   
ref|XP_010438317.1|  PREDICTED: acid phosphatase 1-like                 163   2e-44   
gb|EYU30687.1|  hypothetical protein MIMGU_mgv1a011950mg                163   2e-44   
ref|XP_007133483.1|  hypothetical protein PHAVU_011G182400g             164   2e-44   
ref|XP_002867419.1|  acid phosphatase class B family protein            163   2e-44   
ref|XP_009137842.1|  PREDICTED: acid phosphatase 1                      163   2e-44   
ref|XP_006357920.1|  PREDICTED: acid phosphatase 1-like                 162   3e-44   
ref|XP_010433112.1|  PREDICTED: acid phosphatase 1-like                 163   3e-44   
emb|CDY14217.1|  BnaA08g13480D                                          163   3e-44   
ref|XP_006412859.1|  hypothetical protein EUTSA_v10026000mg             162   4e-44   
ref|NP_194655.1|  HAD superfamily, subfamily IIIB acid phosphatase      162   4e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47773.1|  BnaC07g41870D                                          162   5e-44   
gb|KFK29483.1|  hypothetical protein AALP_AA7G140100                    162   5e-44   
gb|KCW90870.1|  hypothetical protein EUGRSUZ_A02919                     162   6e-44   
emb|CDP05370.1|  unnamed protein product                                162   6e-44   
ref|XP_006358226.1|  PREDICTED: acid phosphatase 1-like                 162   7e-44   
ref|XP_009800382.1|  PREDICTED: acid phosphatase 1-like                 162   8e-44   
ref|XP_010915367.1|  PREDICTED: acid phosphatase 1-like isoform X1      161   9e-44   
gb|KHG01291.1|  Acid phosphatase 1                                      162   9e-44   
ref|XP_010433681.1|  PREDICTED: acid phosphatase 1-like                 162   1e-43   
ref|XP_010693738.1|  PREDICTED: acid phosphatase 1                      161   2e-43   
ref|XP_009362705.1|  PREDICTED: acid phosphatase 1                      161   2e-43   
ref|XP_004964489.1|  PREDICTED: acid phosphatase 1-like isoform X2      163   2e-43   
ref|XP_004964488.1|  PREDICTED: acid phosphatase 1-like isoform X1      163   2e-43   
ref|XP_010258799.1|  PREDICTED: acid phosphatase 1                      160   3e-43   
ref|XP_010062554.1|  PREDICTED: acid phosphatase 1                      163   3e-43   
gb|KDP22459.1|  hypothetical protein JCGZ_26290                         160   4e-43   
ref|XP_006412858.1|  hypothetical protein EUTSA_v10025999mg             160   5e-43   
ref|XP_009138920.1|  PREDICTED: acid phosphatase 1                      159   5e-43   
emb|CDY34346.1|  BnaA01g14490D                                          159   7e-43   
ref|XP_004143740.1|  PREDICTED: acid phosphatase 1-like                 159   7e-43   
ref|XP_009588519.1|  PREDICTED: acid phosphatase 1-like                 159   8e-43   
emb|CDY03376.1|  BnaC01g17060D                                          159   9e-43   
ref|XP_006284361.1|  hypothetical protein CARUB_v10005533mg             159   9e-43   
ref|XP_010536549.1|  PREDICTED: acid phosphatase 1-like                 159   1e-42   
ref|XP_008376378.1|  PREDICTED: acid phosphatase 1                      159   1e-42   
ref|XP_006285610.1|  hypothetical protein CARUB_v10007060mg             157   1e-42   
ref|NP_194245.1|  HAD superfamily, subfamily IIIB acid phosphatase      158   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532228.1|  PREDICTED: acid phosphatase 1-like isoform X1      158   2e-42   
gb|KFK26738.1|  acid phosphatase                                        157   3e-42   
ref|XP_004158153.1|  PREDICTED: acid phosphatase 1-like                 157   4e-42   
ref|XP_009602496.1|  PREDICTED: acid phosphatase 1-like isoform X2      157   4e-42   
ref|XP_008367296.1|  PREDICTED: acid phosphatase 1-like                 157   5e-42   
ref|XP_004235180.1|  PREDICTED: acid phosphatase 1                      157   6e-42   
ref|XP_010438316.1|  PREDICTED: acid phosphatase 1-like                 157   7e-42   
ref|XP_002510996.1|  Acid phosphatase 1 precursor, putative             157   7e-42   Ricinus communis
ref|XP_009602493.1|  PREDICTED: acid phosphatase 1-like isoform X1      157   8e-42   
gb|KFK39517.1|  hypothetical protein AALP_AA3G254300                    156   1e-41   
gb|EYU20188.1|  hypothetical protein MIMGU_mgv1a011800mg                156   1e-41   
ref|XP_009372837.1|  PREDICTED: acid phosphatase 1-like                 156   1e-41   
ref|XP_008798586.1|  PREDICTED: acid phosphatase 1-like                 155   1e-41   
ref|XP_004307784.1|  PREDICTED: acid phosphatase 1-like                 156   2e-41   
ref|XP_002867623.1|  hypothetical protein ARALYDRAFT_329150             155   2e-41   
ref|XP_003557220.2|  PREDICTED: acid phosphatase 1-like                 155   2e-41   
ref|XP_008437018.1|  PREDICTED: acid phosphatase 1                      155   2e-41   
ref|XP_009797620.1|  PREDICTED: acid phosphatase 1-like                 154   5e-41   
ref|NP_001240054.1|  uncharacterized protein LOC100802126 precursor     154   6e-41   
ref|XP_009128910.1|  PREDICTED: acid phosphatase 1                      154   6e-41   
ref|XP_002436441.1|  hypothetical protein SORBIDRAFT_10g002690          155   7e-41   Sorghum bicolor [broomcorn]
gb|KDO45271.1|  hypothetical protein CISIN_1g023192mg                   154   8e-41   
ref|XP_006413336.1|  hypothetical protein EUTSA_v10026026mg             154   8e-41   
ref|XP_008794092.1|  PREDICTED: acid phosphatase 1-like                 153   1e-40   
emb|CDY48606.1|  BnaA01g07590D                                          153   1e-40   
ref|NP_001150931.1|  acid phosphatase 1 precursor                       154   1e-40   Zea mays [maize]
ref|XP_009388590.1|  PREDICTED: acid phosphatase 1-like                 153   2e-40   
gb|AFW75455.1|  hypothetical protein ZEAMMB73_076415                    154   2e-40   
ref|XP_006490172.1|  PREDICTED: acid phosphatase 1-like                 153   2e-40   
ref|XP_010433111.1|  PREDICTED: acid phosphatase 1-like                 153   2e-40   
ref|XP_008801792.1|  PREDICTED: acid phosphatase 1-like                 152   3e-40   
ref|XP_009370433.1|  PREDICTED: acid phosphatase 1-like                 152   3e-40   
gb|EYU31308.1|  hypothetical protein MIMGU_mgv1a011623mg                152   3e-40   
ref|XP_009127318.1|  PREDICTED: acid phosphatase 1                      152   3e-40   
ref|NP_199939.1|  HAD superfamily, subfamily IIIB acid phosphatase      152   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401998.1|  hypothetical protein EUTSA_v10014448mg             152   4e-40   
ref|XP_009109045.1|  PREDICTED: acid phosphatase 1-like                 152   4e-40   
ref|XP_011028463.1|  PREDICTED: acid phosphatase 1                      151   7e-40   
ref|XP_006421584.1|  hypothetical protein CICLE_v10005566mg             152   7e-40   
emb|CDY62035.1|  BnaC03g77680D                                          151   9e-40   
emb|CDY14216.1|  BnaA08g13470D                                          150   2e-39   
ref|XP_003531798.1|  PREDICTED: acid phosphatase 1-like                 150   2e-39   
gb|AFW85941.1|  acid phosphatase 1                                      151   3e-39   
gb|ABL85037.1|  acid phosphatase                                        149   3e-39   Brachypodium sylvaticum
ref|NP_001151681.1|  acid phosphatase 1 precursor                       150   3e-39   Zea mays [maize]
ref|XP_004511128.1|  PREDICTED: acid phosphatase 1-like                 149   5e-39   
ref|XP_009415369.1|  PREDICTED: acid phosphatase 1-like                 149   6e-39   
ref|XP_002865848.1|  hypothetical protein ARALYDRAFT_495196             149   7e-39   
ref|XP_010442941.1|  PREDICTED: acid phosphatase 1-like                 149   7e-39   
ref|XP_010438315.1|  PREDICTED: acid phosphatase 1-like                 148   1e-38   
ref|XP_006385121.1|  acid phosphatase family protein                    148   1e-38   
ref|XP_010482458.1|  PREDICTED: acid phosphatase 1-like                 148   1e-38   
ref|XP_008234437.1|  PREDICTED: acid phosphatase 1                      148   1e-38   
ref|XP_006280976.1|  hypothetical protein CARUB_v10026976mg             147   2e-38   
ref|XP_010227605.1|  PREDICTED: acid phosphatase 1-like isoform X2      147   2e-38   
ref|XP_010447870.1|  PREDICTED: acid phosphatase 1-like                 147   3e-38   
emb|CBI27978.3|  unnamed protein product                                144   6e-38   
ref|XP_007218818.1|  hypothetical protein PRUPE_ppa010063mg             145   1e-37   
gb|ADE77538.1|  unknown                                                 145   1e-37   
ref|NP_001130101.1|  acid phosphatase 1 precursor                       145   1e-37   Zea mays [maize]
gb|ACJ84626.1|  unknown                                                 145   2e-37   Medicago truncatula
gb|AFK42878.1|  unknown                                                 145   2e-37   
ref|XP_002438575.1|  hypothetical protein SORBIDRAFT_10g022110          144   5e-37   Sorghum bicolor [broomcorn]
dbj|BAJ34931.1|  hypothetical protein                                   142   2e-36   
dbj|BAD53728.1|  putative Acid phosphatase precursor 1                  142   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003632911.1|  PREDICTED: acid phosphatase 1-like                 142   2e-36   
gb|EAZ01337.1|  hypothetical protein OsI_23372                          142   2e-36   Oryza sativa Indica Group [Indian rice]
gb|ABK23358.1|  unknown                                                 142   3e-36   Picea sitchensis
gb|ADE76411.1|  unknown                                                 140   5e-36   
dbj|BAJ97988.1|  predicted protein                                      140   1e-35   
ref|XP_010088387.1|  Stem 28 kDa glycoprotein                           139   3e-35   
ref|XP_004302846.1|  PREDICTED: stem 28 kDa glycoprotein-like           139   3e-35   
ref|XP_002515949.1|  Stem 28 kDa glycoprotein precursor, putative       139   3e-35   Ricinus communis
gb|ABK22580.1|  unknown                                                 139   4e-35   Picea sitchensis
ref|XP_004965618.1|  PREDICTED: acid phosphatase 1-like                 138   5e-35   
ref|XP_003563756.1|  PREDICTED: acid phosphatase 1-like isoform X1      138   1e-34   
ref|XP_008228404.1|  PREDICTED: acid phosphatase 1-like                 136   3e-34   
gb|ABK27105.1|  unknown                                                 136   4e-34   Picea sitchensis
ref|XP_007215831.1|  hypothetical protein PRUPE_ppa010152mg             135   6e-34   
gb|ACN40193.1|  unknown                                                 136   7e-34   Picea sitchensis
ref|XP_007024338.1|  Stem 28 kDa glycoprotein, putative                 135   1e-33   
ref|XP_010033825.1|  PREDICTED: acid phosphatase 1-like                 135   1e-33   
ref|XP_010033711.1|  PREDICTED: acid phosphatase 1-like                 134   2e-33   
gb|ABK21277.1|  unknown                                                 134   2e-33   Picea sitchensis
gb|ABK21327.1|  unknown                                                 134   2e-33   Picea sitchensis
gb|ACN40876.1|  unknown                                                 134   3e-33   Picea sitchensis
gb|KDP40846.1|  hypothetical protein JCGZ_24845                         134   3e-33   
ref|XP_008798588.1|  PREDICTED: acid phosphatase 1-like                 134   3e-33   
ref|XP_007201377.1|  hypothetical protein PRUPE_ppa010275mg             133   4e-33   
dbj|BAJ85799.1|  predicted protein                                      134   4e-33   
gb|KHN40364.1|  Acid phosphatase 1                                      131   4e-33   
emb|CDY06827.1|  BnaC01g09260D                                          133   5e-33   
ref|XP_002439412.1|  hypothetical protein SORBIDRAFT_09g005960          133   6e-33   Sorghum bicolor [broomcorn]
gb|EPS70753.1|  hypothetical protein M569_04009                         131   7e-33   
ref|XP_004959893.1|  PREDICTED: acid phosphatase 1-like                 132   7e-33   
ref|XP_008235609.1|  PREDICTED: acid phosphatase 1-like isoform X2      132   8e-33   
ref|XP_010936027.1|  PREDICTED: acid phosphatase 1 isoform X2           132   1e-32   
ref|XP_011080101.1|  PREDICTED: acid phosphatase 1-like                 132   1e-32   
ref|XP_010915365.1|  PREDICTED: acid phosphatase 1-like                 132   2e-32   
ref|XP_010033712.1|  PREDICTED: acid phosphatase 1-like                 131   2e-32   
ref|XP_010033826.1|  PREDICTED: acid phosphatase 1-like                 131   2e-32   
ref|XP_009776612.1|  PREDICTED: acid phosphatase 1-like                 131   2e-32   
ref|XP_006857494.1|  hypothetical protein AMTR_s00067p00205850          131   2e-32   
gb|EMS54945.1|  Acid phosphatase 1                                      130   3e-32   
ref|XP_007135620.1|  hypothetical protein PHAVU_010G144200g             131   3e-32   
emb|CDO97963.1|  unnamed protein product                                131   3e-32   
ref|XP_004241952.1|  PREDICTED: acid phosphatase 1-like                 130   5e-32   
ref|XP_007135625.1|  hypothetical protein PHAVU_010G144600g             130   5e-32   
gb|AGV54493.1|  acid phosphatase                                        130   6e-32   
ref|NP_001242215.1|  uncharacterized protein LOC100795218 precursor     130   7e-32   
ref|XP_010936026.1|  PREDICTED: acid phosphatase 1 isoform X1           130   9e-32   
ref|XP_010258709.1|  PREDICTED: acid phosphatase 1-like                 129   9e-32   
ref|XP_004960899.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    130   1e-31   
ref|XP_003530059.1|  PREDICTED: stem 28 kDa glycoprotein-like           129   1e-31   
ref|XP_007045549.1|  Stem 28 kDa glycoprotein, putative                 129   1e-31   
ref|XP_010033713.1|  PREDICTED: acid phosphatase 1-like                 129   1e-31   
ref|XP_002299744.2|  hypothetical protein POPTR_0001s19180g             129   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_009787591.1|  PREDICTED: acid phosphatase 1-like                 129   2e-31   
gb|KHN39260.1|  Stem 28 kDa glycoprotein                                128   2e-31   
ref|XP_004302847.1|  PREDICTED: stem 28 kDa glycoprotein-like           129   3e-31   
ref|XP_010033828.1|  PREDICTED: acid phosphatase 1-like                 128   3e-31   
ref|XP_009622654.1|  PREDICTED: acid phosphatase 1-like                 129   3e-31   
ref|XP_010264908.1|  PREDICTED: acid phosphatase 1                      128   3e-31   
ref|NP_001148296.1|  stem 28 kDa glycoprotein precursor                 128   3e-31   Zea mays [maize]
gb|AFW77368.1|  stem glycoprotein                                       128   3e-31   
ref|XP_006443754.1|  hypothetical protein CICLE_v10021795mg             128   4e-31   
gb|AFK40440.1|  unknown                                                 128   4e-31   
ref|XP_004235637.1|  PREDICTED: acid phosphatase 1-like                 127   5e-31   
ref|XP_004960900.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    128   5e-31   
ref|XP_003521307.1|  PREDICTED: acid phosphatase 1-like                 128   6e-31   
ref|XP_011000941.1|  PREDICTED: acid phosphatase 1-like                 127   6e-31   
ref|XP_009795136.1|  PREDICTED: acid phosphatase 1-like                 127   7e-31   
ref|XP_010091790.1|  Acid phosphatase 1                                 127   7e-31   
ref|XP_010098162.1|  Stem 28 kDa glycoprotein                           127   9e-31   
ref|XP_009625321.1|  PREDICTED: acid phosphatase 1-like                 127   1e-30   
ref|XP_004984487.1|  PREDICTED: acid phosphatase 1-like isoform X1      127   1e-30   
ref|XP_010322861.1|  PREDICTED: acid phosphatase 1-like                 127   1e-30   
ref|XP_002273448.1|  PREDICTED: acid phosphatase 1                      126   1e-30   Vitis vinifera
ref|XP_008235608.1|  PREDICTED: acid phosphatase 1-like isoform X1      126   2e-30   
gb|AFW77369.1|  hypothetical protein ZEAMMB73_279889                    126   2e-30   
ref|XP_009133169.1|  PREDICTED: acid phosphatase 1-like                 126   3e-30   
ref|XP_009381186.1|  PREDICTED: acid phosphatase 1-like                 125   3e-30   
ref|XP_006465744.1|  PREDICTED: acid phosphatase 1-like                 125   3e-30   
ref|XP_002301854.1|  hypothetical protein POPTR_0002s25950g             125   4e-30   Populus trichocarpa [western balsam poplar]
emb|CAN82027.1|  hypothetical protein VITISV_000612                     125   5e-30   Vitis vinifera
gb|ACU24349.1|  unknown                                                 124   7e-30   Glycine max [soybeans]
emb|CAN74377.1|  hypothetical protein VITISV_039733                     120   9e-30   Vitis vinifera
ref|XP_006603734.1|  PREDICTED: uncharacterized protein LOC100811...    124   1e-29   
ref|XP_006356134.1|  PREDICTED: acid phosphatase 1-like                 124   1e-29   
gb|KHN02475.1|  Acid phosphatase 1                                      124   1e-29   
gb|KCW88400.1|  hypothetical protein EUGRSUZ_A00788                     124   1e-29   
ref|XP_010043667.1|  PREDICTED: acid phosphatase 1-like isoform X2      124   1e-29   
gb|ACA04886.1|  acid phosphatase                                        121   1e-29   Picea abies
ref|XP_010043658.1|  PREDICTED: acid phosphatase 1-like isoform X1      124   1e-29   
dbj|BAA19152.1|  pod storage protein                                    123   2e-29   Phaseolus vulgaris [French bean]
ref|XP_007135621.1|  hypothetical protein PHAVU_010G144300g             123   2e-29   
ref|XP_011024457.1|  PREDICTED: acid phosphatase 1                      123   2e-29   
ref|XP_004510320.1|  PREDICTED: stem 28 kDa glycoprotein-like           123   2e-29   
ref|XP_010654601.1|  PREDICTED: acid phosphatase 1                      123   3e-29   
gb|AHA84282.1|  pod storage protein                                     123   3e-29   
ref|XP_008796365.1|  PREDICTED: acid phosphatase 1                      123   3e-29   
ref|XP_006354440.1|  PREDICTED: acid phosphatase 1-like                 123   3e-29   
gb|KGN54464.1|  Acid phosphatase 1                                      123   3e-29   
ref|XP_008459027.1|  PREDICTED: acid phosphatase 1-like                 122   3e-29   
ref|XP_004142728.1|  PREDICTED: acid phosphatase 1-like                 122   3e-29   
ref|XP_003627057.1|  Acid phosphatase                                   123   3e-29   
ref|XP_002526558.1|  Acid phosphatase 1 precursor, putative             123   3e-29   Ricinus communis
gb|ACU19087.1|  unknown                                                 123   3e-29   Glycine max [soybeans]
gb|EMT13951.1|  Acid phosphatase 1                                      123   4e-29   
gb|KHN05326.1|  Stem 28 kDa glycoprotein                                123   4e-29   
gb|AFX66999.1|  putative acid phosphatase                               123   4e-29   
ref|XP_009773908.1|  PREDICTED: acid phosphatase 1-like                 122   4e-29   
emb|CDO98049.1|  unnamed protein product                                123   4e-29   
ref|XP_004247765.1|  PREDICTED: acid phosphatase 1-like                 122   5e-29   
ref|NP_001148494.1|  stem 28 kDa glycoprotein precursor                 122   7e-29   
ref|XP_006658138.1|  PREDICTED: acid phosphatase 1-like                 120   1e-28   
ref|XP_006654133.1|  PREDICTED: acid phosphatase 1-like                 122   1e-28   
emb|CAC84485.1|  putative acid phosphatase                              120   1e-28   
emb|CDP03785.1|  unnamed protein product                                121   1e-28   
gb|KHG02415.1|  Acid phosphatase 1                                      121   1e-28   
ref|XP_004241953.1|  PREDICTED: acid phosphatase 1                      121   2e-28   
ref|XP_007050188.1|  HAD superfamily, subfamily IIIB acid phospha...    120   2e-28   
dbj|BAJ94050.1|  predicted protein                                      121   2e-28   
ref|XP_007162590.1|  hypothetical protein PHAVU_001G164000g             121   2e-28   
gb|EMT20409.1|  Acid phosphatase 1                                      120   2e-28   
gb|AFK46217.1|  unknown                                                 120   3e-28   
dbj|BAJ94494.1|  predicted protein                                      120   3e-28   
emb|CBI38657.3|  unnamed protein product                                118   3e-28   
ref|XP_008463285.1|  PREDICTED: acid phosphatase 1                      120   3e-28   
ref|XP_009614482.1|  PREDICTED: acid phosphatase 1                      120   4e-28   
ref|XP_010690146.1|  PREDICTED: acid phosphatase 1-like                 120   4e-28   
gb|KCW79606.1|  hypothetical protein EUGRSUZ_C00961                     121   5e-28   
ref|XP_002461220.1|  hypothetical protein SORBIDRAFT_02g043120          119   9e-28   
ref|NP_001236180.1|  acid phosphatase precursor                         119   9e-28   
ref|XP_011091248.1|  PREDICTED: acid phosphatase 1-like                 119   9e-28   
ref|XP_004305256.1|  PREDICTED: acid phosphatase 1-like                 118   1e-27   
ref|XP_002531803.1|  Acid phosphatase 1 precursor, putative             118   1e-27   
ref|XP_010098159.1|  Acid phosphatase 1                                 118   1e-27   
ref|XP_003628249.1|  Acid phosphatase                                   118   1e-27   
emb|CAA39369.1|  APS-AA2                                                114   1e-27   
ref|NP_001237136.1|  syringolide-induced protein B15-3-5                117   2e-27   
ref|XP_003627058.1|  Stem 28 kDa glycoprotein                           118   2e-27   
gb|AGV54632.1|  stem 28 kDa glycoprotein                                118   2e-27   
gb|KDP40845.1|  hypothetical protein JCGZ_24844                         118   2e-27   
gb|KCW88403.1|  hypothetical protein EUGRSUZ_A00791                     117   2e-27   
emb|CBI25273.3|  unnamed protein product                                115   3e-27   
ref|XP_010043643.1|  PREDICTED: acid phosphatase 1-like isoform X2      118   3e-27   
gb|KDO55860.1|  hypothetical protein CISIN_1g024820mg                   116   3e-27   
ref|XP_010023859.1|  PREDICTED: acid phosphatase 1-like isoform X2      117   3e-27   
ref|XP_002879756.1|  acid phosphatase class B family protein            117   3e-27   
gb|KDP21846.1|  hypothetical protein JCGZ_00633                         117   3e-27   
ref|XP_006599745.1|  PREDICTED: acid phosphatase 1-like                 117   3e-27   
gb|KDO51839.1|  hypothetical protein CISIN_1g036571mg                   117   3e-27   
ref|XP_010043635.1|  PREDICTED: acid phosphatase 1-like isoform X1      117   3e-27   
ref|XP_006418175.1|  hypothetical protein EUTSA_v10008462mg             117   3e-27   
ref|XP_010244565.1|  PREDICTED: acid phosphatase 1                      117   4e-27   
ref|XP_004161712.1|  PREDICTED: acid phosphatase 1-like                 119   4e-27   
ref|XP_006426853.1|  hypothetical protein CICLE_v10027566mg             117   4e-27   
ref|XP_004960901.1|  PREDICTED: stem 28 kDa glycoprotein-like           117   4e-27   
ref|XP_010482978.1|  PREDICTED: acid phosphatase 1-like                 117   5e-27   
ref|XP_008355740.1|  PREDICTED: acid phosphatase 1-like                 116   5e-27   
ref|XP_008370281.1|  PREDICTED: acid phosphatase 1                      116   6e-27   
ref|XP_008363936.1|  PREDICTED: acid phosphatase 1-like                 116   6e-27   
gb|AGV54742.1|  pod storage protein                                     116   6e-27   
ref|XP_004960902.1|  PREDICTED: acid phosphatase 1-like                 117   7e-27   
ref|XP_010023858.1|  PREDICTED: acid phosphatase 1-like isoform X1      116   7e-27   
ref|XP_009405905.1|  PREDICTED: acid phosphatase 1-like                 116   8e-27   
ref|XP_010457427.1|  PREDICTED: acid phosphatase 1-like                 116   9e-27   
ref|XP_010043653.1|  PREDICTED: acid phosphatase 1-like                 116   9e-27   
ref|XP_010043623.1|  PREDICTED: acid phosphatase 1-like isoform X2      116   1e-26   
gb|ACU23922.1|  unknown                                                 115   1e-26   
ref|XP_010043614.1|  PREDICTED: acid phosphatase 1-like isoform X1      116   1e-26   
gb|EMT03894.1|  Stem 28 kDa glycoprotein                                116   1e-26   
ref|XP_004960903.1|  PREDICTED: acid phosphatase 1-like                 116   1e-26   
ref|XP_009370888.1|  PREDICTED: acid phosphatase 1-like                 115   1e-26   
gb|AGG23547.1|  acid phosphatase-like protein 1                         115   1e-26   
ref|XP_006426852.1|  hypothetical protein CICLE_v10026223mg             116   2e-26   
ref|XP_006304095.1|  hypothetical protein CARUB_v10010000mg             115   2e-26   
ref|XP_007033479.1|  Acid phosphatase 1, putative isoform 1             115   2e-26   
gb|KDP26481.1|  hypothetical protein JCGZ_17639                         115   2e-26   
ref|XP_009143372.1|  PREDICTED: acid phosphatase 1-like                 115   2e-26   
ref|XP_007033481.1|  Acid phosphatase 1, putative isoform 3             115   2e-26   
ref|XP_004960898.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    115   2e-26   
ref|XP_006426854.1|  hypothetical protein CICLE_v10027612mg             115   2e-26   
ref|XP_010529940.1|  PREDICTED: acid phosphatase 1-like                 115   2e-26   
emb|CDX86654.1|  BnaC08g00490D                                          115   2e-26   
emb|CDY60756.1|  BnaA05g34800D                                          114   2e-26   
gb|EYU36713.1|  hypothetical protein MIMGU_mgv1a012835mg                114   2e-26   
ref|XP_010475042.1|  PREDICTED: acid phosphatase 1-like                 115   2e-26   
gb|EYU42050.1|  hypothetical protein MIMGU_mgv1a013101mg                114   2e-26   
ref|XP_002892194.1|  acid phosphatase class B family protein            115   2e-26   
ref|XP_006429635.1|  hypothetical protein CICLE_v10012544mg             114   3e-26   
ref|XP_003517633.1|  PREDICTED: acid phosphatase 1-like                 111   3e-26   
gb|EAY89880.1|  hypothetical protein OsI_11424                          114   3e-26   
dbj|BAH01612.1|  unnamed protein product                                114   3e-26   
gb|ABF95774.1|  plant acid phosphatase family protein, expressed        115   4e-26   
emb|CDX91480.1|  BnaC04g06700D                                          114   4e-26   
gb|KFK42749.1|  hypothetical protein AALP_AA1G034500                    114   4e-26   
ref|NP_563698.1|  HAD superfamily, subfamily IIIB acid phosphatase      114   4e-26   
ref|XP_006465709.1|  PREDICTED: acid phosphatase 1-like                 114   5e-26   
ref|XP_009133272.1|  PREDICTED: acid phosphatase 1                      114   5e-26   
ref|XP_009111130.1|  PREDICTED: acid phosphatase 1-like                 114   5e-26   
emb|CDY15485.1|  BnaA08g27690D                                          114   5e-26   
gb|EMT19717.1|  Acid phosphatase 1                                      114   5e-26   
ref|XP_009783330.1|  PREDICTED: acid phosphatase 1 isoform X2           114   6e-26   
ref|XP_010542903.1|  PREDICTED: acid phosphatase 1-like                 114   6e-26   
ref|XP_010505497.1|  PREDICTED: acid phosphatase 1-like                 113   6e-26   
emb|CDY14447.1|  BnaC03g21480D                                          113   7e-26   
ref|XP_006654134.1|  PREDICTED: stem 28 kDa glycoprotein-like           113   8e-26   
ref|XP_009338743.1|  PREDICTED: acid phosphatase 1-like                 113   8e-26   
ref|XP_010921196.1|  PREDICTED: acid phosphatase 1                      114   9e-26   
ref|XP_009783329.1|  PREDICTED: acid phosphatase 1 isoform X1           113   9e-26   
gb|EAY72856.1|  hypothetical protein OsI_00725                          114   1e-25   
ref|XP_006465710.1|  PREDICTED: acid phosphatase 1-like                 114   1e-25   
gb|KDO64169.1|  hypothetical protein CISIN_1g025360mg                   113   1e-25   
ref|XP_010553191.1|  PREDICTED: acid phosphatase 1                      112   1e-25   
gb|AFK46111.1|  unknown                                                 113   1e-25   
ref|XP_003626652.1|  Syringolide-induced protein B15-3-5                113   1e-25   
gb|KCW60246.1|  hypothetical protein EUGRSUZ_H02960                     113   1e-25   
ref|XP_009419864.1|  PREDICTED: acid phosphatase 1-like                 112   1e-25   
ref|XP_009118876.1|  PREDICTED: acid phosphatase 1                      113   1e-25   
ref|XP_008380842.1|  PREDICTED: acid phosphatase 1-like                 113   1e-25   
emb|CDY32525.1|  BnaA09g50710D                                          113   1e-25   
ref|XP_009337802.1|  PREDICTED: acid phosphatase 1-like                 112   2e-25   
ref|NP_001242245.1|  uncharacterized protein LOC100811100 precursor     113   2e-25   
ref|XP_009357986.1|  PREDICTED: acid phosphatase 1-like                 113   2e-25   
gb|EAZ26809.1|  hypothetical protein OsJ_10720                          112   2e-25   
ref|XP_006654131.1|  PREDICTED: acid phosphatase 1-like                 112   2e-25   
ref|XP_010517161.1|  PREDICTED: acid phosphatase 1-like                 112   2e-25   
gb|EAZ05161.1|  hypothetical protein OsI_27357                          112   2e-25   
ref|XP_010509146.1|  PREDICTED: acid phosphatase 1-like                 112   2e-25   
ref|NP_001042269.1|  Os01g0191200                                       113   2e-25   
ref|XP_002440748.1|  hypothetical protein SORBIDRAFT_09g006010          112   2e-25   
gb|AAS07026.1|  vegetative storage protein                              112   3e-25   
ref|XP_009344485.1|  PREDICTED: acid phosphatase 1-like                 112   3e-25   
ref|XP_006411076.1|  hypothetical protein EUTSA_v10017121mg             112   3e-25   
ref|NP_199215.1|  HAD superfamily, subfamily IIIB acid phosphatase      112   3e-25   
ref|XP_009410837.1|  PREDICTED: acid phosphatase 1-like                 112   3e-25   
ref|XP_008653476.1|  PREDICTED: acid phosphatase 1 isoform X2           112   3e-25   
ref|XP_004963522.1|  PREDICTED: stem 28 kDa glycoprotein-like           112   4e-25   
ref|NP_001150932.1|  LOC100284565 precursor                             112   4e-25   
ref|NP_001242155.1|  uncharacterized protein LOC100802885 precursor     111   4e-25   
ref|XP_008358084.1|  PREDICTED: acid phosphatase 1-like                 111   4e-25   
ref|XP_007145821.1|  hypothetical protein PHAVU_007G270800g             112   4e-25   
gb|AAM63804.1|  vegetative storage protein-like                         111   4e-25   
ref|XP_010654600.1|  PREDICTED: acid phosphatase 1-like                 111   5e-25   
ref|XP_003535883.1|  PREDICTED: acid phosphatase 1-like                 111   5e-25   
ref|XP_007226669.1|  hypothetical protein PRUPE_ppa021353mg             110   5e-25   
ref|XP_010683443.1|  PREDICTED: acid phosphatase 1                      112   5e-25   
ref|XP_004510091.1|  PREDICTED: acid phosphatase 1-like isoform X1      112   5e-25   
ref|XP_003559787.1|  PREDICTED: acid phosphatase 1-like                 111   5e-25   
emb|CDY10082.1|  BnaC08g43690D                                          111   5e-25   
ref|XP_006341307.1|  PREDICTED: acid phosphatase 1-like                 111   5e-25   
ref|XP_008348489.1|  PREDICTED: acid phosphatase 1-like                 111   6e-25   
ref|NP_001054846.1|  Os05g0189300                                       111   6e-25   
gb|EEE62601.1|  hypothetical protein OsJ_17404                          110   6e-25   
gb|KHN24673.1|  Acid phosphatase 1                                      111   6e-25   
gb|ACU23890.1|  unknown                                                 109   6e-25   
ref|XP_003590156.1|  Stem 28 kDa glycoprotein                           110   6e-25   
gb|EMS66285.1|  Stem 28 kDa glycoprotein                                111   7e-25   
emb|CDO99288.1|  unnamed protein product                                110   7e-25   
ref|XP_008224179.1|  PREDICTED: acid phosphatase 1-like                 111   8e-25   
ref|NP_001238459.1|  stem 28 kDa glycoprotein precursor                 110   8e-25   
ref|XP_008244569.1|  PREDICTED: acid phosphatase 1                      110   9e-25   
ref|XP_006296330.1|  hypothetical protein CARUB_v10025510mg             110   9e-25   
ref|NP_001060651.1|  Os07g0681200                                       110   1e-24   
ref|XP_002465316.1|  hypothetical protein SORBIDRAFT_01g036310          110   1e-24   
ref|XP_010481786.1|  PREDICTED: acid phosphatase 1-like                 110   1e-24   
ref|XP_011095174.1|  PREDICTED: acid phosphatase 1                      110   1e-24   
gb|EMS67586.1|  Acid phosphatase 1                                      110   1e-24   
ref|XP_002865388.1|  hypothetical protein ARALYDRAFT_917224             110   1e-24   
gb|KHG06095.1|  Acid phosphatase 1                                      110   2e-24   
ref|NP_181394.1|  HAD superfamily, subfamily IIIB acid phosphatase      109   2e-24   
ref|XP_002960188.1|  hypothetical protein SELMODRAFT_139413             110   2e-24   
ref|XP_010494401.1|  PREDICTED: acid phosphatase 1-like                 110   2e-24   
ref|XP_003561667.2|  PREDICTED: acid phosphatase 1                      110   2e-24   
ref|XP_010522559.1|  PREDICTED: acid phosphatase 1-like                 109   2e-24   
sp|P10742.2|S25K_SOYBN  RecName: Full=Stem 31 kDa glycoprotein; A...    110   2e-24   
gb|KEH18204.1|  plant acid phosphatase                                  109   2e-24   
gb|KHN24883.1|  Acid phosphatase 1                                      109   2e-24   
gb|ACU19317.1|  unknown                                                 109   2e-24   
ref|XP_004497819.1|  PREDICTED: acid phosphatase 1-like                 109   3e-24   
gb|EPS59737.1|  hypothetical protein M569_15067                         109   3e-24   
gb|EAY96836.1|  hypothetical protein OsI_18758                          108   3e-24   
emb|CDX94751.1|  BnaC07g17600D                                          109   3e-24   
emb|CDY22316.1|  BnaA06g36380D                                          109   3e-24   
ref|XP_010441940.1|  PREDICTED: acid phosphatase 1-like                 109   3e-24   
ref|XP_003555748.1|  PREDICTED: acid phosphatase 1-like                 109   3e-24   
ref|XP_002315584.1|  acid phosphatase class B family protein            108   3e-24   
ref|XP_009101743.1|  PREDICTED: acid phosphatase 1                      109   4e-24   
gb|AFK41939.1|  unknown                                                 107   4e-24   
ref|XP_008388379.1|  PREDICTED: acid phosphatase 1-like                 108   4e-24   
emb|CBI36038.3|  unnamed protein product                                111   5e-24   
ref|XP_006356133.1|  PREDICTED: acid phosphatase 1-like                 106   5e-24   
ref|XP_009123928.1|  PREDICTED: acid phosphatase 1-like                 108   6e-24   
ref|XP_002967517.1|  hypothetical protein SELMODRAFT_144839             109   6e-24   
ref|XP_009415619.1|  PREDICTED: acid phosphatase 1-like                 108   6e-24   
gb|KFK31670.1|  hypothetical protein AALP_AA6G143700                    108   7e-24   
ref|XP_003568779.1|  PREDICTED: stem 28 kDa glycoprotein                108   8e-24   
gb|ACU23829.1|  unknown                                                 107   8e-24   
ref|XP_008438471.1|  PREDICTED: acid phosphatase 1-like                 107   8e-24   
ref|XP_006403150.1|  hypothetical protein EUTSA_v10003258mg             108   9e-24   
ref|XP_010653128.1|  PREDICTED: acid phosphatase 1 isoform X2           107   9e-24   
ref|XP_006645592.1|  PREDICTED: stem 28 kDa glycoprotein-like           108   9e-24   
ref|XP_011013440.1|  PREDICTED: acid phosphatase 1-like                 107   1e-23   
ref|XP_010653127.1|  PREDICTED: acid phosphatase 1 isoform X1           107   1e-23   
ref|XP_006284397.1|  hypothetical protein CARUB_v10005568mg             105   1e-23   
gb|KEH42677.1|  plant acid phosphatase                                  107   1e-23   
ref|XP_011041430.1|  PREDICTED: acid phosphatase 1-like                 107   1e-23   
ref|XP_009113955.1|  PREDICTED: acid phosphatase 1-like                 107   1e-23   
ref|XP_007206281.1|  hypothetical protein PRUPE_ppa016173mg             107   1e-23   
ref|XP_004516313.1|  PREDICTED: acid phosphatase 1-like                 107   1e-23   
gb|KHN33255.1|  Stem 31 kDa glycoprotein                                106   1e-23   
ref|XP_011001652.1|  PREDICTED: acid phosphatase 1-like                 107   2e-23   
ref|XP_007134577.1|  hypothetical protein PHAVU_010G058800g             107   2e-23   
gb|KHN01772.1|  Acid phosphatase 1                                      107   2e-23   
gb|ACU24345.1|  unknown                                                 107   2e-23   
ref|XP_001768840.1|  predicted protein                                  105   2e-23   
ref|XP_006842584.1|  hypothetical protein AMTR_s00077p00160000          106   2e-23   
ref|NP_001241536.1|  stem 31 kDa glycoprotein precursor                 106   2e-23   
ref|XP_006654132.1|  PREDICTED: stem 28 kDa glycoprotein-like           106   2e-23   
ref|XP_002323092.1|  hypothetical protein POPTR_0016s14650g             106   2e-23   
gb|EMS46715.1|  Stem 28 kDa glycoprotein                                107   2e-23   
emb|CDY05398.1|  BnaC02g41060D                                          107   2e-23   
ref|XP_004134400.1|  PREDICTED: acid phosphatase 1-like                 106   3e-23   
ref|XP_004302520.1|  PREDICTED: acid phosphatase 1-like                 106   3e-23   
gb|AFK47047.1|  unknown                                                 106   4e-23   
prf||1609232A  31kD glycoprotein                                        106   4e-23
ref|XP_002308264.1|  hypothetical protein POPTR_0006s11150g             105   4e-23   
ref|XP_011072446.1|  PREDICTED: acid phosphatase 1-like                 104   4e-23   
gb|AAS07027.1|  vegetative storage protein                              105   4e-23   
gb|AGV54508.1|  defense associated acid phosphatase                     105   5e-23   
dbj|BAJ94870.1|  predicted protein                                      105   5e-23   



>ref|XP_007202474.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
 gb|EMJ03673.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
Length=256

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 145/229 (63%), Gaps = 8/229 (3%)
 Frame = -2

Query  798  EPIIELPAG---VGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSM  634
            + II++P     + +D+ YC+SW+ +VE N+AG W      C  F + YMT  RYLSDS 
Sbjct  25   QSIIQMPPKRHRITDDNLYCDSWRFSVETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSA  84

Query  633  AVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldddd  460
            AVA+Y+  +A  V +    +DAW+FDID+TLLS   Y       S  F    +     D 
Sbjct  85   AVANYSLSFARGVQIGGDGKDAWVFDIDETLLSNFPYYQAHGFGSETFDEA-SFDEWVDL  143

Query  459  fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDE  280
               P+LPASL+LYK +Q+LGFKIFL++ R + Q N T KNL    YNNW++L+LR   D+
Sbjct  144  AKAPALPASLKLYKELQELGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQ  203

Query  279  DKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              ++ V+KSEKR +++ EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  204  GTTATVYKSEKRSDLINEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPM  252



>ref|XP_008242463.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=256

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 147/229 (64%), Gaps = 8/229 (3%)
 Frame = -2

Query  798  EPIIELPAG---VGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSM  634
            + II++P     + +D+ YC+SW+ ++E N+AG W      C  F + YMT  RYLSDS 
Sbjct  25   QSIIQMPPKRHRITDDNLYCDSWRFSIETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSA  84

Query  633  AVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldddd  460
            AV++Y+  +A  V +    +DAW+FDID+TLLS + Y +     S  F    +     D 
Sbjct  85   AVSNYSLSFARGVQIGGDGKDAWVFDIDETLLSNLPYYEAHGFGSETFDEA-SFDEWVDL  143

Query  459  fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDE  280
               P+LPASL+LYK +Q+LGFKIFL++ R + Q N T KNL    YNNW++L+LR   D+
Sbjct  144  AKAPALPASLKLYKELQQLGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQ  203

Query  279  DKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              ++ V+KSEKR +++ EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  204  GTTATVYKSEKRSDLINEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPM  252



>ref|XP_007012979.1| HAD superfamily isoform 2 [Theobroma cacao]
 gb|EOY30598.1| HAD superfamily isoform 2 [Theobroma cacao]
Length=258

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 147/231 (64%), Gaps = 10/231 (4%)
 Frame = -2

Query  798  EPIIELPAGVGE-----DHWYCESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSD  640
            +PII+LP    +     D  YC SW L+VE NNAG W Q    CE F + YMT  RY+SD
Sbjct  25   QPIIQLPTTTDQKSNVDDDLYCASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSD  84

Query  639  SMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
            S  VA+Y+  YA SV +    +DAW+FDID+TLL+ + Y       S  F    +  +  
Sbjct  85   SEIVANYSLAYASSVEIGRDGKDAWVFDIDETLLTNLPYYQAHGFGSEPFDE-NSWDVWV  143

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            D  + P++PASL+LY  ++++GFKIF+++ R ++Q N T KNL   GY +W++LILR   
Sbjct  144  DLAEAPAIPASLKLYNELKQMGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPS  203

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+   + V+KSEKR ++V EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  204  DDGTLATVYKSEKRSDLVNEGYRIHGSSGDQWSDLLGFAVAKRSFKLPNPM  254



>ref|XP_010047662.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
Length=270

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 145/238 (61%), Gaps = 14/238 (6%)
 Frame = -2

Query  807  SRPEPIIEL---PAGVGE------DHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMT  661
            S  +P+I L   P   G+      D  YCESW+LAVE NNAG WDQ    C+    +YM+
Sbjct  30   SPSQPLIRLYSKPPFAGDRKVLKDDGLYCESWRLAVETNNAGSWDQVPPRCQQLVAAYMS  89

Query  660  DYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNC  487
              RY SDS  VA+Y+ E+A +V +     DAW+FDID+TLLS + Y       S  F   
Sbjct  90   SDRYASDSAIVANYSSEFARAVEIAGDGSDAWVFDIDETLLSNLPYYKAHGFGSEVFDE-  148

Query  486  KNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDK  307
             +     D  + P+LP+S  LYK +Q+LGF IFL++ R + Q N T  NL   GY++W +
Sbjct  149  NSFDGWVDLAEAPALPSSFSLYKELQQLGFTIFLLTGRSEHQRNVTETNLLYAGYSDWKR  208

Query  306  LILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LILR+  D+ K + V+KSEKR E+  +GY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  209  LILRNATDQGKPATVYKSEKRSELESQGYTIHGSSGDQWSDLLGFAIAKRSFKLPNPM  266



>ref|XP_007012978.1| HAD superfamily isoform 1 [Theobroma cacao]
 gb|EOY30597.1| HAD superfamily isoform 1 [Theobroma cacao]
Length=323

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 147/231 (64%), Gaps = 10/231 (4%)
 Frame = -2

Query  798  EPIIELPAGVGE-----DHWYCESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSD  640
            +PII+LP    +     D  YC SW L+VE NNAG W Q    CE F + YMT  RY+SD
Sbjct  90   QPIIQLPTTTDQKSNVDDDLYCASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSD  149

Query  639  SMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
            S  VA+Y+  YA SV +    +DAW+FDID+TLL+ + Y       S  F    +  +  
Sbjct  150  SEIVANYSLAYASSVEIGRDGKDAWVFDIDETLLTNLPYYQAHGFGSEPFDE-NSWDVWV  208

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            D  + P++PASL+LY  ++++GFKIF+++ R ++Q N T KNL   GY +W++LILR   
Sbjct  209  DLAEAPAIPASLKLYNELKQMGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPS  268

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+   + V+KSEKR ++V EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  269  DDGTLATVYKSEKRSDLVNEGYRIHGSSGDQWSDLLGFAVAKRSFKLPNPM  319



>ref|XP_010267101.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 145/215 (67%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            +D  +C+SW+ +VE N+AG W Q  E C +F K Y+T  RY SDS+ VA  +  +A +V 
Sbjct  49   DDGMFCDSWRFSVETNDAGLWKQIPERCVNFVKEYVTGDRYASDSVVVAEDSLSFAKTVK  108

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            V+   +D W+FDID+TLLS + Y +     S  F + K+     +  + P+LPASL+LYK
Sbjct  109  VSGHGKDVWVFDIDETLLSNLPYYELHGFGSEEF-DEKSFDEWVELAEAPALPASLRLYK  167

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +Q+LGF + L++ R ++Q N T KNL   GY+NW++LILR   DE K +LV+KSEKR++
Sbjct  168  QLQQLGFTVVLLTGRTEAQRNVTEKNLLFAGYSNWERLILRGPSDEGKIALVYKSEKRMQ  227

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + EEGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  228  LEEEGYRIHGSSGDQWSDLLGFAMAKRSFKLPNPM  262



>ref|XP_009352576.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=258

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 144/231 (62%), Gaps = 10/231 (4%)
 Frame = -2

Query  798  EPIIELPA-----GVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSD  640
            + II++P         +D  +C+SW+ +VE N+AG W      C  F ++YMT  RYLSD
Sbjct  25   QSIIQMPTKRHRVSASDDSLFCDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGDRYLSD  84

Query  639  SMAVASYAREYA--VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
            S AVA+++  +A  V++    +DAW+FDID+TLLS + Y       S  F    +     
Sbjct  85   SAAVANFSLSFAKGVTIGGDGKDAWVFDIDETLLSNLPYYQAHGFGSETFDEA-SFDEWV  143

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            +  + P+LPASL LY  +++LGFKIFL++ R + Q N T KNL   GYNNW++L+LR   
Sbjct  144  ELAEAPALPASLNLYSQLERLGFKIFLLTGRSEYQRNATAKNLLVAGYNNWERLLLRGPS  203

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+   + VFKS+KR  ++ EGY + G+ GDQWSDL+G+A A RSFK PN M
Sbjct  204  DQGTLATVFKSQKRSNLINEGYRIHGSSGDQWSDLVGFAIAQRSFKLPNPM  254



>gb|KDO55859.1| hypothetical protein CISIN_1g024820mg [Citrus sinensis]
Length=262

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 137/215 (64%), Gaps = 6/215 (3%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV  589
            D  YC+SW+ +VE N+AG WD     C +F + YMT   YLSDS  V+ Y+ ++A S NV
Sbjct  45   DELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANV  104

Query  588  TH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            +    +DAW+FDID+TLLS + Y       S  F N        D    P+LPASL  YK
Sbjct  105  SAGDGKDAWVFDIDETLLSNLPYYAAHGFGSEIF-NEDAFDEWVDLAKAPALPASLTFYK  163

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +++LGFKIFL++ R + Q N T KNL   GY++W KL LR   D+ K + V+KSEKR+E
Sbjct  164  ELKQLGFKIFLLTGRNEFQRNTTEKNLLFAGYSDWKKLFLRGPSDQGKPATVYKSEKRLE  223

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +V EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  224  LVNEGYRIHGSSGDQWSDLLGFAKAERSFKLPNPM  258



>ref|XP_006451342.1| hypothetical protein CICLE_v10009222mg [Citrus clementina]
 ref|XP_006475349.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|ESR64582.1| hypothetical protein CICLE_v10009222mg [Citrus clementina]
Length=262

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 137/215 (64%), Gaps = 6/215 (3%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV  589
            D  YC+SW+ +VE N+AG WD     C +F + YMT   YLSDS  V+ Y+ ++A S NV
Sbjct  45   DELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANV  104

Query  588  TH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            +    +DAW+FDID+TLLS + Y       S  F N        D    P+LPASL  YK
Sbjct  105  SAGDGKDAWVFDIDETLLSNLPYYAAHGFGSEIF-NEDAFDEWVDLAKAPALPASLNFYK  163

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +++LGFKIFL++ R + Q N T KNL   GY++W KL LR   D+ K + V+KSEKR+E
Sbjct  164  ELKQLGFKIFLLTGRNEFQRNTTEKNLLFAGYSDWKKLFLRGPSDQGKPATVYKSEKRLE  223

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +V EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  224  LVNEGYRIHGSSGDQWSDLLGFAKAERSFKLPNPM  258



>ref|XP_011078233.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=265

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 139/211 (66%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+  VE N+AG W +    C DF K Y+T  RY S+S AVA  A E+A +V V+  
Sbjct  52   YCESWRFTVETNDAGIWTRIPRRCVDFVKDYITGERYRSESEAVADNALEHAKAVGVSGN  111

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS V Y       S  F    +     +  + P+L ASL+LYK +Q+
Sbjct  112  GKDAWVFDIDETLLSNVPYYAAHGFGSEIFDE-PSFDNWVNVAEAPALLASLRLYKNLQE  170

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GF IFL++ R + Q N TV+NL   GY+NW++LILR   D+ K + ++KSEKR E+ ++
Sbjct  171  CGFTIFLLTGRSEFQRNATVRNLQYAGYSNWERLILRGDADQGKPASIYKSEKRKEIEDD  230

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GYI++GN GDQWSDL+G+A A RSFK PN +
Sbjct  231  GYIIRGNSGDQWSDLMGFAVAQRSFKLPNPL  261



>ref|XP_007152955.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
 gb|ESW24949.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
Length=251

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 142/228 (62%), Gaps = 9/228 (4%)
 Frame = -2

Query  798  EPIIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVA  625
            EPI+ LP+       YC+SW+LAVE NNAGPW++    C DF   Y++  RY  D   V 
Sbjct  23   EPILRLPSEKAISSDYCDSWRLAVETNNAGPWERVPANCVDFVAEYISGERYRRDCEVVG  82

Query  624  SYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFK--NCKNsslddddf  457
            + +  +A SV +    RDAW+FDID+TLLS V Y +++     GF+  N  +     +  
Sbjct  83   NLSLAFARSVRLVGDGRDAWVFDIDETLLSNVPYYEDIGF---GFEIFNETSFDAWVNSA  139

Query  456  dlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDED  277
              P+L  +L LY  +++LGF+IFL++ R + Q N T  NL   GY NW++LILR++ D+ 
Sbjct  140  AAPALVPNLILYNELKELGFRIFLLTGRSEYQRNATEANLMLSGYRNWERLILRESYDKG  199

Query  276  KSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            K ++ +KSEKR E+  EGY + G+ GDQWSDL GYA A RSFK PN M
Sbjct  200  KPAISYKSEKREELENEGYRIHGSSGDQWSDLWGYAVAARSFKLPNPM  247



>gb|KDP33773.1| hypothetical protein JCGZ_07344 [Jatropha curcas]
Length=258

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 151/232 (65%), Gaps = 11/232 (5%)
 Frame = -2

Query  798  EPIIELPA------GVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLS  643
            + II LP+      G G+D  YC+SW+L+VE NNAG W      C  F + Y+T  RY+S
Sbjct  25   QSIIRLPSDHQTRGGGGDDDLYCDSWRLSVETNNAGYWTYVPSRCARFVELYVTGDRYVS  84

Query  642  DSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssld  469
            DS  VASYA  +A +VN+    +DAW+FDID+TLLS + Y +     S  F    +    
Sbjct  85   DSAVVASYAFAFAKTVNIAGDGKDAWVFDIDETLLSNLPYYELHGYGSEPFDEL-SFDKW  143

Query  468  dddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDT  289
             D  + P+L ASL+LYK +++LGF IFL++ R + Q N T KNL   GY++W+KLILR  
Sbjct  144  VDLAEAPALAASLKLYKKLKRLGFTIFLLTGRSEYQRNATAKNLVFAGYSDWEKLILRGV  203

Query  288  CDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             D+ K + ++KS+KR+E+V EGY + G+ GDQWSDLLG+ATA RSFK PN M
Sbjct  204  SDQGKPATLYKSQKRLELVNEGYRIHGSSGDQWSDLLGFATAERSFKIPNPM  255



>ref|XP_004141030.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 ref|XP_004157898.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN60565.1| hypothetical protein Csa_2G000730 [Cucumis sativus]
Length=257

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 14/215 (7%)
 Frame = -2

Query  750  CESWKLAVENNNAGPW--DQETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV---T  586
            CESWK ++E NNAG W    + C +F ++Y+   RYL+DS   A+++  +A SV V    
Sbjct  44   CESWKFSIEVNNAGTWYSIPQPCIEFVRTYIDTGRYLADSRNAAAFSLTFARSVKVGDGK  103

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlpslpasLQLYK  418
              DAWIFD+D+TLLS + Y      K+ GF     N  + +   +    P+LPA+L +YK
Sbjct  104  GMDAWIFDVDETLLSNMPYY-----KATGFGTEPYNVTSYNEWVETGLAPALPATLSVYK  158

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             ++KLGFKIF+++ R  SQ   T +NL   GY+ W+KLILR   DE K + VFKSEKR E
Sbjct  159  WVKKLGFKIFILTGRPVSQSAITAQNLIDAGYSGWEKLILRGPEDEGKKATVFKSEKRAE  218

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +V++GY +QGN GDQWSD+LGYA A RSFK PN M
Sbjct  219  LVKQGYTIQGNTGDQWSDILGYAVAKRSFKVPNPM  253



>ref|XP_008367917.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=259

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 144/231 (62%), Gaps = 10/231 (4%)
 Frame = -2

Query  798  EPIIELPAG-----VGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSD  640
            + II++P         +D  +C+SW+ +VE N+AG W      C  F ++YMT  RY SD
Sbjct  26   QSIIQMPKKRHRVYASDDSLFCDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGARYPSD  85

Query  639  SMAVASYAREYA--VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
            S AVA+++  +A  V++    +DAW+FDID+TLLS + Y       S  F    +     
Sbjct  86   SAAVANFSLSFAKGVTIGGDGKDAWVFDIDETLLSNLPYYQAHGFGSETFDEA-SFDEWV  144

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            +  + P+LPASL LY  +++LGFKIFL++ R + Q N T KNL   GYNNW++L+LR   
Sbjct  145  ELAEAPALPASLNLYSQLERLGFKIFLLTGRSEYQRNATAKNLLFAGYNNWERLLLRGPS  204

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+   + VFKS+KR +++ EGY + G+ GDQWSDL+G+A A RSFK PN M
Sbjct  205  DQGTLATVFKSQKRSDLINEGYRIHGSSGDQWSDLVGFAIAQRSFKLPNPM  255



>ref|XP_002514195.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF48149.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=251

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 154/257 (60%), Gaps = 15/257 (6%)
 Frame = -2

Query  888  MSAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELP-AGVGEDHWYCESWKLAVENNNA  712
            M++ +     V+  FL           +  + II++P A   +D  YC+SW+L+VE NNA
Sbjct  1    MASHSLSHIFVLFTFL---------PLTLSQSIIQIPTARSKDDDLYCDSWRLSVETNNA  51

Query  711  GPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLL  544
            G W      CE + + YMT  R+LSD   VAS +  +A SVN+T   +DAW+FDID+TLL
Sbjct  52   GYWVNVPSRCESYVQQYMTSDRFLSDFEVVASDSLSFAKSVNITGDGKDAWVFDIDETLL  111

Query  543  SRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
            S + Y +     S  F          D  + P+L ASL LYK ++ LGF IFL++ R ++
Sbjct  112  SNLPYYEVHGFGSQPFDE-NAFDQWVDLAEAPALQASLNLYKELKHLGFTIFLLTGRSEN  170

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
            Q + TVK+L   GY++W+ L LR   D+   + V+KS+KR+E+V EGY + G+ GDQWSD
Sbjct  171  QRDATVKDLLFAGYSDWEGLFLRGVTDQGTPATVYKSQKRMELVNEGYRIHGSSGDQWSD  230

Query  183  LLGYATAVRSFKFPNLM  133
            L+G+A A RSFK PN M
Sbjct  231  LVGFAVAKRSFKLPNPM  247



>ref|XP_008459051.1| PREDICTED: acid phosphatase 1-like [Cucumis melo]
Length=267

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 137/231 (59%), Gaps = 9/231 (4%)
 Frame = -2

Query  807  SRPEPIIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSM  634
            +RP P   +    G     CESWK AVE N AG W      C  F + Y    RYLSDS 
Sbjct  36   ARPYPRKHVVRAEGNPR--CESWKFAVEVNAAGSWKSVPRPCIAFVRDYFNGDRYLSDSR  93

Query  633  AVASYAREYAVSVNVTH----RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
             V +Y+  +A SVN+      R+AW+FD+D+TLLS + Y       S  + N    +   
Sbjct  94   TVVNYSLTFANSVNMAGKENGRNAWVFDVDETLLSNLPYYRVNGYGSEAYNNTA-FNEWV  152

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            +    P LP SL+LYK ++ LGFKIFL++ R +SQ N T +NL + GY  WD LI R   
Sbjct  153  NKGLAPPLPMSLRLYKKLKHLGFKIFLLTGRGESQRNVTQRNLLEAGYFGWDNLIFRGPA  212

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            DE K + V+KSEKR E+V+EGY++QG+ GDQWSDL+G+A   RSFK PN M
Sbjct  213  DEGKKAAVYKSEKRAELVKEGYVIQGSLGDQWSDLIGFALPNRSFKLPNPM  263



>ref|XP_004157899.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
Length=264

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 131/212 (62%), Gaps = 7/212 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            CESWK AVE N AG W     TC  F + Y    RYLSDS  V +Y+  +A SV    +D
Sbjct  50   CESWKFAVEVNAAGSWKSVPGTCIAFVRDYFNSDRYLSDSRTVVNYSLSFANSVKFNRKD  109

Query  576  ----AWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
                AW+FD+D+TLLS + Y       S  + N    +   +    P LP SL+LYK ++
Sbjct  110  KGRNAWVFDVDETLLSNLPYYRVNGYGSEAYNNTA-FNEWVNKGLAPPLPMSLRLYKKLK  168

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LGFKIFL++ R +SQ N T +NL + GY  WDKLI R   DE K + V+KSEKR E+V+
Sbjct  169  HLGFKIFLLTGRGESQRNVTQRNLLEAGYFGWDKLIFRGAADEGKKAAVYKSEKRGELVK  228

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGYI+QG+ GDQWSDL+G+A   +SFK PN M
Sbjct  229  EGYIIQGSLGDQWSDLIGFALPNQSFKLPNPM  260



>ref|XP_004141031.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN60564.1| hypothetical protein Csa_2G000720 [Cucumis sativus]
Length=264

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 131/212 (62%), Gaps = 7/212 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            CESWK AVE N AG W     TC  F + Y    RYLSDS  V +Y+  +A SV    +D
Sbjct  50   CESWKFAVEVNAAGSWKSVPGTCIAFVRDYFNSDRYLSDSRTVVNYSLSFANSVKFNRKD  109

Query  576  ----AWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
                AW+FD+D+TLLS + Y       S  + N    +   +    P LP SL+LYK ++
Sbjct  110  KGRNAWVFDVDETLLSNLPYYRVNGYGSEAYNNTA-FNEWVNKGLAPPLPMSLRLYKKLK  168

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LGFKIFL++ R +SQ N T +NL + GY  WDKLI R   DE K + V+KSEKR E+V+
Sbjct  169  HLGFKIFLLTGRGESQRNVTQRNLLEAGYFGWDKLIFRGAADEGKKAAVYKSEKRGELVK  228

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGYI+QG+ GDQWSDL+G+A   +SFK PN M
Sbjct  229  EGYIIQGSLGDQWSDLIGFALPNQSFKLPNPM  260



>ref|XP_004513069.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=250

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 136/226 (60%), Gaps = 5/226 (2%)
 Frame = -2

Query  798  EPIIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVA  625
            E II LP+       YC+SW+LAVE NN G W Q   +C D    YM   +Y  D   V 
Sbjct  22   ESIIRLPSEKKISGEYCDSWRLAVETNNVGAWKQIPASCVDSVAEYMIGEQYKRDCDVVG  81

Query  624  SYAREYA--VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdl  451
             Y+ E+A  V+     RDAW+FDID+TLLS V Y   +   S  F N  + +      D 
Sbjct  82   EYSYEFAKRVAFGGDGRDAWVFDIDETLLSNVPYYKTVGFGSE-FFNETSFNDWVKLADA  140

Query  450  pslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKS  271
            P+LP+SL LYK + +LGF+IFL++ R + Q N T  NL   GY NWD+LILR   D+ K 
Sbjct  141  PALPSSLSLYKKLLELGFRIFLLTGRSEYQRNATETNLLFSGYRNWDRLILRGPYDQGKP  200

Query  270  SLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            ++ FKSEKR E+V EGY + G+ GDQWSDL G+A A RSFK PN M
Sbjct  201  AIRFKSEKREELVSEGYRIHGSSGDQWSDLWGFAVASRSFKLPNPM  246



>ref|XP_008387412.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=257

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 142/231 (61%), Gaps = 10/231 (4%)
 Frame = -2

Query  798  EPIIELPA-----GVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSD  640
            + +I++P         +D  YC+SW+ ++E N+AG W      C  F + YMT  RY SD
Sbjct  24   QSVIQMPRKRHRFAASDDSLYCDSWRFSIETNDAGTWSNIPSRCXRFVQDYMTGDRYRSD  83

Query  639  SMAVASYAREYA--VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
              +VA+Y+  +A  V+     +DAW+FDID+TLLS ++Y       S  F N        
Sbjct  84   LASVANYSLSFAKGVTXGGDGKDAWVFDIDETLLSNLAYYQAHGFGSETF-NEAFFDEWV  142

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            D  + P+LPASL LYK ++ LGFK+FL++ R + Q N T +NL   GYNNW++L+LR   
Sbjct  143  DLAEAPALPASLNLYKELEXLGFKMFLLTGRSEHQRNATARNLLYAGYNNWERLLLRGPS  202

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+   + V+KS+KR +++ EGY + G+ GDQWSDL+G+A A RSFK PN M
Sbjct  203  DQGTPATVYKSQKRSDLINEGYRIHGSSGDQWSDLIGFAIAQRSFKLPNPM  253



>ref|XP_006359744.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=268

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 136/211 (64%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YC+SW+  VE NNAG W    E C  F + Y T  RY SDS AVA  +  +A +V V++ 
Sbjct  55   YCDSWRFTVETNNAGLWSIIPERCISFVQEYTTGDRYSSDSAAVADLSLAFANTVKVSND  114

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
              DAW+FDID+TLLS + Y  E    S  F          ++ + P++PASL+LYK +Q+
Sbjct  115  GMDAWVFDIDETLLSNLPYYVEHGFGSQIFDE-NAFDKWVNEANAPAIPASLKLYKELQQ  173

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GF IFL++ R + Q NNT KN+   GY+NW++LILR   D+ K +  +KSEKR E+ +E
Sbjct  174  RGFTIFLLTGRSEYQRNNTEKNMVHAGYSNWERLILRGPSDKGKLATQYKSEKRKELEDE  233

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDL+G+A A RSFK PN M
Sbjct  234  GYRIRGNSGDQWSDLMGFAVAQRSFKLPNPM  264



>ref|XP_010688366.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 141/230 (61%), Gaps = 8/230 (3%)
 Frame = -2

Query  801  PEPIIELPAGVG---EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDS  637
            PE  + LP+      +D  +CESW+ +VE N+AG W      C +F K+YM   RYLSDS
Sbjct  25   PENHLLLPSNRKLRQDDQLFCESWRFSVETNDAGLWYSVPSRCHNFVKNYMIGDRYLSDS  84

Query  636  MAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddd  463
              VA  + E+A SV V+   +DAW+FD+D+TLL  + Y +     S  F N  +      
Sbjct  85   NVVAGNSLEFAKSVKVSGDGKDAWVFDVDETLLFNLPYYEAHDFGSEVF-NEDSFDQYML  143

Query  462  dfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD  283
              + P LPASL LYK +Q+LGF IF+++ R +   N T  NL   GY+NW++LILR   D
Sbjct  144  LAESPVLPASLSLYKELQRLGFTIFILTGRSEPFRNATEANLQSAGYSNWERLILRGPSD  203

Query  282  EDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + K ++ +KSEKR E+ + GY ++GN GDQWSDLLGYA   RSFK PN M
Sbjct  204  KSKKAVEYKSEKRKELEDAGYRIRGNSGDQWSDLLGYAIGQRSFKLPNPM  253



>ref|XP_010110867.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXC28686.1| Acid phosphatase 1 [Morus notabilis]
Length=259

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 138/215 (64%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVA--SYAREYAVS  598
            +D  YC+SW+ +VE N+AG W    + CE++ ++Y+T  RY SDS  VA  S A   ++ 
Sbjct  42   QDLLYCDSWRFSVETNDAGFWPTIPKRCENYVENYVTGDRYRSDSEFVAGDSLAFVRSLQ  101

Query  597  VNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            +N   +DAWIFDID+TLLS + Y +     +  F          D  + P+L ASL LY 
Sbjct  102  MNDDGKDAWIFDIDETLLSNLPYYEAHGFGAEVFDETP-FDDWVDLAEAPALAASLSLYN  160

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +++LGFKIFL++ R + Q N T KNL   GY NW++LILR   D+ K ++V+KSEKR E
Sbjct  161  ELEQLGFKIFLLTGRSEYQRNATEKNLLYSGYKNWERLILRGPSDQHKPAIVYKSEKRSE  220

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +V EGY + G+ GDQWSDL+G+A A RSFK PN M
Sbjct  221  LVNEGYTIHGSSGDQWSDLMGFAVAQRSFKLPNPM  255



>ref|XP_003620757.1| Acid phosphatase-like protein [Medicago truncatula]
 gb|AES76975.1| plant acid phosphatase [Medicago truncatula]
Length=252

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 135/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query  789  IELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYA  616
            I LP+       YC+SW+LAVE NN G W Q    C +    YM   +Y SD   V  ++
Sbjct  27   IRLPSEASISTSYCDSWRLAVETNNVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFS  86

Query  615  REY--AVSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpsl  442
             E+   V+V    RDAW+FDID+TLLS V Y  ++   S  F N  + +   +  D P+L
Sbjct  87   AEFVKGVTVGGDGRDAWVFDIDETLLSNVPYYQDVGFGSKIF-NETSFNDWVNLADAPAL  145

Query  441  pasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV  262
            PASL  Y+ +Q+LGF IFL++ R + Q N T  NL   GY NW++LILR   D+ KS+  
Sbjct  146  PASLSFYRKLQELGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATS  205

Query  261  FKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +KSEKR E++ EGY + G+ GDQWSDL GYA + RSFK PN M
Sbjct  206  YKSEKRQELMSEGYRIHGSSGDQWSDLWGYAVSTRSFKLPNPM  248



>ref|XP_004245159.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=269

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 138/215 (64%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            +D  YC+SW+  VE NNAG W    + C  F + Y T  RY SDS AVA  +  +A +VN
Sbjct  52   DDALYCDSWRFTVETNNAGLWSMIPQRCISFVQDYTTGDRYSSDSAAVADLSLAFANTVN  111

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            V++   DAW+FDID+TLLS + Y  E    S  F          ++ + P++PASL+LYK
Sbjct  112  VSNDGMDAWVFDIDETLLSNLPYYVEHGFGSQIFDEI-TFDKWVNEANAPAIPASLKLYK  170

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +Q+ GF IFL++ R ++Q N T +N+   GY+NW++LILR   D+ K +  +KSEKR E
Sbjct  171  ELQQRGFTIFLLTGRIENQRNKTERNMVHAGYSNWERLILRGPSDKGKLATEYKSEKRKE  230

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + +EGY ++GN GDQWSDL G+A A RSFK PN M
Sbjct  231  LEDEGYRIRGNSGDQWSDLTGFAVAERSFKLPNPM  265



>ref|NP_194656.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79685.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAM61010.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAO44078.1| At4g29270 [Arabidopsis thaliana]
 dbj|BAE99747.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AEE85609.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=256

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 138/229 (60%), Gaps = 7/229 (3%)
 Frame = -2

Query  807  SRPEPIIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSM  634
            SR    I+LP        YCESW+LA E NN GPW      CE++ K+Y+   ++  D  
Sbjct  27   SRAASFIKLPRSSIAS--YCESWRLAAETNNVGPWKVIPSQCENYIKNYINGGQFDKDYD  84

Query  633  AVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldddd  460
             VASYA +YA +V V    +DAW+FDID+TLLS + Y       S  + + K  +   + 
Sbjct  85   VVASYAIDYAKTVKVGGDGKDAWVFDIDETLLSNIEYYKANGYGSEPYDSIK-YNEVVEK  143

Query  459  fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDE  280
               P   ASL+LYK ++KLGF I L++ R +   + T KNL   GY  W++L+LR   D+
Sbjct  144  GKDPGYDASLRLYKALKKLGFTIILLTGRDEGHRSVTEKNLRDAGYFGWNRLLLRGQNDQ  203

Query  279  DKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             K++  +KSE+R +VV+EGY + GN GDQWSDLLG+A A RSFK PN M
Sbjct  204  GKTATQYKSEQRSQVVKEGYTIHGNTGDQWSDLLGFAVASRSFKVPNPM  252



>ref|XP_008459056.1| PREDICTED: acid phosphatase 1-like [Cucumis melo]
Length=229

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 136/215 (63%), Gaps = 14/215 (7%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            CESWK ++E NNAG W      C +F + Y+    YL+DS + A+++  +A SV V    
Sbjct  16   CESWKYSIEVNNAGTWYSIPRPCIEFVREYINTGGYLADSRSAAAFSLTFARSVKVGEGK  75

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlpslpasLQLYK  418
              DAWIFD+D+TLLS + Y      K+ GF     N  + +   +    P+LPA+L +YK
Sbjct  76   GMDAWIFDVDETLLSNMPY-----YKATGFGTEPYNETSYNEWVETGLAPALPATLSVYK  130

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             ++KLGFKIF+++ R  S    T +NL   GY+ W+KLILR   DE K + V+KSEKR E
Sbjct  131  WVKKLGFKIFILTGRPTSLAAITQQNLIDAGYSGWEKLILRGPEDEGKKATVYKSEKRAE  190

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +V++GY +QGN GDQWSDL+GYA + RSFK PN M
Sbjct  191  IVKQGYTIQGNTGDQWSDLIGYAVSKRSFKLPNPM  225



>ref|XP_010548683.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=249

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 145/229 (63%), Gaps = 13/229 (6%)
 Frame = -2

Query  792  IIELPA-----GVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSM  634
            +I+LP+       GE   YCESW+LAVE NNAG W+     C+DF   Y+T  ++ SD  
Sbjct  21   VIKLPSDRSGSTAGE---YCESWRLAVETNNAGSWNVVPVACKDFVADYVTGGQFDSDYE  77

Query  633  AVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldddd  460
             +A YA E+A ++ +     DAW+FDID+TLL+ + Y       +  F + ++ +   + 
Sbjct  78   VMADYAVEFAKTLKIAGDGYDAWVFDIDETLLTNIDYYKAHGFGTEPF-DGESFNAWVES  136

Query  459  fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDE  280
               P+  ASL+LY  ++KLGF IFL++ R + Q + T KNL   GY+NW++LILR   D+
Sbjct  137  SAAPAFDASLRLYNELKKLGFTIFLLTGRDEGQRSCTEKNLQYAGYSNWERLILRGHEDQ  196

Query  279  DKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             K++  +KSEKR E+++EGY + G+ GDQWSDL+G+A A RSFK PN M
Sbjct  197  GKAATTYKSEKRSELIKEGYKIHGSTGDQWSDLVGFAVAKRSFKVPNPM  245



>ref|XP_002867418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43677.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 133/211 (63%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+LA E NNAG W      CE++ K+Y+++ ++  D   VASYA  YA +V +   
Sbjct  43   YCESWRLAAETNNAGTWKVVPSQCENYVKNYISEGQFDKDYDLVASYAIAYAKTVKLGRD  102

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS + Y       S  + N    +        P   ASL+LYK ++K
Sbjct  103  GKDAWVFDIDETLLSNIEYYKAHGYGSQPYDNTL-FNEWVVKGTAPGFDASLRLYKALKK  161

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF I L++ R +SQ + T KNL   GY  W++L+LR   D+ K++ ++KSE+R +VV+E
Sbjct  162  LGFTIILLTGRDESQRSITEKNLRDAGYFGWNRLLLRGKNDQGKAATLYKSEQRSKVVKE  221

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDL G+A A RSFK PN M
Sbjct  222  GYTIHGNTGDQWSDLQGFAVAARSFKVPNPM  252



>ref|XP_010688365.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=245

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 138/218 (63%), Gaps = 10/218 (5%)
 Frame = -2

Query  771  VGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVS  598
            V  D  +CESW+L+VE NNAG W    + C ++ K YMT  R++SDS  VA+ + ++A S
Sbjct  29   VDHDFLFCESWRLSVETNNAGNWSNIPDHCLEYVKEYMTSNRFVSDSKIVAANSLKFARS  88

Query  597  VNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQL  424
            VN++   +DAW+FDI +TL++ + Y       + GF + K+          P+L ASL L
Sbjct  89   VNISGDGKDAWVFDIAETLVTFLPY-----YITHGFGSSKDFREWTRRNKAPALQASLSL  143

Query  423  YKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKR  244
            YK +Q+LGF I L++   +     T++ L   GY+NW++LILR   DE KS+L FKS KR
Sbjct  144  YKELQQLGFSIVLLTGASEPDRKQTIEFLQYAGYSNWERLILRGASDEGKSALDFKSGKR  203

Query  243  IEVVEEGYILQGNCGDQWSDLLG-YATAVRSFKFPNLM  133
             E+ +EGY + GN GDQWSDLLG Y+ A RSFK PN M
Sbjct  204  KELEDEGYRIHGNSGDQWSDLLGHYSIATRSFKLPNPM  241



>ref|XP_006656617.1| PREDICTED: acid phosphatase 1-like, partial [Oryza brachyantha]
Length=226

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LA E NN  PW    E C  + + Y+T   Y SD   VA  A  YA +  V    
Sbjct  14   CASWRLAGEANNLAPWSAVPEECAAYVRGYVTGVAYRSDLEEVAREASTYARAARVAGDG  73

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            RDAW+FD+D+TLLS + Y  E       F + +      +  + P++P+SL+LYK ++ L
Sbjct  74   RDAWVFDVDETLLSNLPYYAEHGYGLELFDH-REFDKWVERGEAPAIPSSLKLYKEVRDL  132

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK FL++ R +     TV NL K GY+ WDKLILR   D  K++ ++KSEKR E+ EEG
Sbjct  133  GFKTFLLTGRSEGHQGVTVDNLKKQGYHEWDKLILRAPADRKKTATIYKSEKRKEMEEEG  192

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLGY+T+ RSFK PN M
Sbjct  193  YRILGNSGDQWSDLLGYSTSARSFKLPNPM  222



>gb|AFK34288.1| unknown [Medicago truncatula]
Length=252

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 135/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query  789  IELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYA  616
            I LP+       YC+SW+LAVE N+ G W Q    C +    YM   +Y SD   V  ++
Sbjct  27   IRLPSEASISTSYCDSWRLAVETNSVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFS  86

Query  615  REY--AVSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpsl  442
             E+   V+V    RDAW+FDID+TLLS V Y  ++   S  F N  + +   +  D P+L
Sbjct  87   AEFVKGVTVGGDGRDAWVFDIDETLLSNVPYYQDVGFGSKIF-NETSFNDWVNLADAPAL  145

Query  441  pasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV  262
            PASL  Y+ +Q+LGF IFL++ R + Q N T  NL   GY NW++LILR   D+ KS+  
Sbjct  146  PASLSFYRKLQELGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATS  205

Query  261  FKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +KSEKR E++ EGY + G+ GDQWSDL GYA + RSFK PN M
Sbjct  206  YKSEKRQELMSEGYRIHGSSGDQWSDLWGYAVSTRSFKLPNPM  248



>ref|XP_004141163.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 ref|XP_004157951.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN60566.1| hypothetical protein Csa_2G000740 [Cucumis sativus]
Length=250

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            CESWK ++E NNAG W     TC DF K Y    RYL+DS +VA+++  +A SV V+  D
Sbjct  41   CESWKFSIEVNNAGSWKSIPPTCIDFVKDYFNSGRYLADSRSVAAFSLNFARSVKVSEGD  100

Query  576  AWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGF  397
            AWIFD+D+TLLS + +  +       + N  +          P+LPASL +Y  ++KLGF
Sbjct  101  AWIFDVDETLLSNLPFYKDHEFGLQPY-NDTSFFEWVKKGSAPALPASLTVYNWLKKLGF  159

Query  396  KIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYI  217
            KIF+++ R +S    T +NL   GY+ W+KLILR   D DK ++ +KSEKR E+V +GY 
Sbjct  160  KIFILTGRDESLRAVTEQNLIDAGYSGWEKLILRGPND-DKKNIEYKSEKRAELVNQGYT  218

Query  216  LQGNCGDQWSDLLGYATAVRSFKFPN  139
            +QG+ GDQWSDL+G+A A RSFK PN
Sbjct  219  IQGSSGDQWSDLMGFALAKRSFKLPN  244



>ref|XP_002867417.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43676.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 140/232 (60%), Gaps = 8/232 (3%)
 Frame = -2

Query  807  SRPEPIIELPAGV---GEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLS  643
            SR    I+LP+ V     D  YCE W+LA E NNAG W      CE++ K+Y+   ++  
Sbjct  27   SRVSSFIKLPSSVESRSSDVSYCEGWRLAAETNNAGTWRVVPSQCENYVKNYINGGQFDK  86

Query  642  DSMAVASYAREYAVSVNVT--HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssld  469
            D   +ASYA  YA ++N++   +DAW+FDID+TLLS + Y       S  + N    +  
Sbjct  87   DYDVLASYAIAYAKTINLSGKDKDAWVFDIDETLLSNLEYYKAHGYGSEPYDNTL-FNDW  145

Query  468  dddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDT  289
                  P   ASL+LYK ++KLGF I L++ R +SQ + T KNL   GY  W++L+LR  
Sbjct  146  VVKGKAPGFDASLRLYKALKKLGFTIILLTGRDESQRSITEKNLRDAGYFGWNRLLLRGH  205

Query  288  CDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             D+ K++  +KSE+R +VV+EGY + G+ GDQWSDL G+A A RSFK PN M
Sbjct  206  EDQGKAATQYKSEQRAKVVKEGYTIHGSAGDQWSDLHGFAVATRSFKVPNPM  257



>ref|XP_004287494.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 137/216 (63%), Gaps = 5/216 (2%)
 Frame = -2

Query  768  GEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV  595
             +D+ YC+SW+ +VE N+AG WD     C  F + YMT  RY SDS  V++++  +   V
Sbjct  35   ADDNIYCDSWRFSVETNDAGSWDSIPSRCVAFVQDYMTGDRYASDSAIVSNFSLAFGQGV  94

Query  594  NVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLY  421
             +    +D+W+FDID+TLLS + Y  E    +  F    +     D  + P++PASL LY
Sbjct  95   KLGGDGKDSWVFDIDETLLSNLPYYQEHGFGAVTFDEV-SFDKWVDLAEAPAIPASLSLY  153

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
            K +Q+LGFKIFL++ R + Q N TV NL   GY++W++L+LR   D+   +  +KS+KR 
Sbjct  154  KGLQRLGFKIFLLTGRSEFQRNATVNNLVYSGYSDWERLLLRGPSDKGTLATEYKSKKRA  213

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            E++ EG+ + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  214  ELINEGFRIHGSSGDQWSDLLGFAVARRSFKLPNPM  249



>ref|XP_003529064.1| PREDICTED: acid phosphatase 1-like [Glycine max]
Length=253

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 146/257 (57%), Gaps = 13/257 (5%)
 Frame = -2

Query  888  MSAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGE-DHWYCESWKLAVENNNA  712
            M + A++  LV+     SG           E I+ LP+   E    YC+SW LAVE NNA
Sbjct  1    MDSGAWLLFLVVVAVSTSGHI-------HSEAILRLPSESEEISRDYCDSWMLAVETNNA  53

Query  711  GPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLL  544
            G W++   +C DF   Y+T  RY  D   + + +  +A SV +    RDAW+FD+D+TLL
Sbjct  54   GTWNRVPASCVDFVAEYITGDRYRRDCDVIRNLSAAFAKSVGLAGDGRDAWVFDVDETLL  113

Query  543  SRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
            S V Y   +   S  F N  +     D    P+LPA L LY  +++LGFKIF ++ R + 
Sbjct  114  SNVPYYQGVGFGSEIF-NETSFDNWVDLAAAPALPAILSLYNELKELGFKIFFLTGRSEF  172

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
            Q N T  NL   GY +W++LILR + D+ K +  +KSEKR E+  EGY + GN GDQWSD
Sbjct  173  QRNATETNLLLSGYRDWERLILRGSSDQGKPATTYKSEKRAELENEGYRIHGNSGDQWSD  232

Query  183  LLGYATAVRSFKFPNLM  133
            L GYA + RSFK PN M
Sbjct  233  LWGYAVSARSFKLPNPM  249



>emb|CDP03233.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 141/215 (66%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            +D+ YC+SW+  VE N+ GPW +    C  F + Y+T+ RY +DS AVA  + E+A +V 
Sbjct  50   DDNLYCDSWRFVVEANDVGPWARIPSRCVAFVQDYVTNDRYRADSEAVADASLEFAKTVK  109

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            V+   +DAW+FDID+TLLS V Y       S  F    +     D  + P+LPASL+L K
Sbjct  110  VSGDGKDAWVFDIDETLLSNVPYYAVHGFGSETFDE-NSFDEWVDLAEAPALPASLRLCK  168

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +++LGFKIFL++ R + Q + T KNL   GY++W++LILR   D+ K + V+KSE+R E
Sbjct  169  ELEQLGFKIFLLTGRTEFQRSATSKNLDYAGYSDWERLILRGPSDDGKPATVYKSERRKE  228

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + +EGY++ G+ GDQWSDL G+A A RSFK PN +
Sbjct  229  LEDEGYVIHGSSGDQWSDLNGFAVAERSFKLPNPL  263



>ref|XP_010662272.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=259

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 143/249 (57%), Gaps = 7/249 (3%)
 Frame = -2

Query  861  LVMCIFLISGGtttaaaTSRPEPII-ELPAGVGED-HWYCESWKLAVENNNAGPWD--QE  694
            L+  +F IS       +   P P+I E P    E+    C SW+  VE NN GPW     
Sbjct  8    LLFALFSISLSHEPFNSHLLPRPLILEYPQESSEEIQLECTSWRFGVEANNLGPWKTIPV  67

Query  693  TCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDE  520
             C ++ K YMT   Y  D   VA+ A  YA +V ++    D W+FD+D+TLLS + Y  E
Sbjct  68   ACAEYVKDYMTGRAYEIDLERVANEAAIYARTVELSADGNDVWVFDVDETLLSNLPYYAE  127

Query  519  LSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKN  340
                   F   +  +   +    P++ +SL+LY+ +Q LGFK FL++ R ++Q + TV+N
Sbjct  128  HGYGLEVFDEME-FAKWVEKATAPAIGSSLKLYEVVQSLGFKTFLLTGRSENQRSVTVEN  186

Query  339  LCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAV  160
            L   G+ NWDKLILR + D  K + V+KSEKR E+V+EGY + GN GDQWSDLLG   ++
Sbjct  187  LINAGFQNWDKLILRGSNDHGKQATVYKSEKRSEMVKEGYRIVGNSGDQWSDLLGSEMSL  246

Query  159  RSFKFPNLM  133
            RSFK PN M
Sbjct  247  RSFKLPNPM  255



>ref|XP_010249468.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 137/215 (64%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            +D  +C+SW+L+VE NN G W +  + C  F K Y++   Y SDS  VA  +  +A +V 
Sbjct  49   DDGLFCDSWRLSVETNNVGFWKKIPQRCASFMKEYISGDHYASDSDVVAQSSLAFAETVE  108

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            ++   +DAWIFDID+TLLS   Y +        F   +  ++  D  + P LP S +LYK
Sbjct  109  LSGDGKDAWIFDIDETLLSNFPYYELHDFGLQEFDE-RTFNVWVDMAEAPPLPPSQRLYK  167

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +Q+LGF + L++ R ++Q + T KNL   GY++W+KLILR   D+ K ++++KSEKR+E
Sbjct  168  QLQQLGFTLILLTGRSEAQRDATEKNLLVAGYHSWEKLILRGPSDQGKPAIIYKSEKRME  227

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +  EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  228  LEAEGYRIHGSSGDQWSDLLGFAMAKRSFKLPNPM  262



>ref|XP_009795729.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=267

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 133/211 (63%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+  VE N+AG W    E C  F + YM   RY SD  AVA  +  +A +V V++ 
Sbjct  54   YCESWRFTVETNDAGLWALIPERCASFVQDYMNGDRYSSDCGAVADLSLAFANTVKVSND  113

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS + Y       S  F          ++ + P++PASL+LYK +Q+
Sbjct  114  GKDAWVFDIDETLLSNLPYYVTHGFGSEIFDEIA-FDKWVNEAEAPAIPASLKLYKELQQ  172

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GFKIFL++ R + Q N T KNL   GY+NW++LILR   D+ K +  +KSEKR E+ +E
Sbjct  173  RGFKIFLLTGRSEFQRNYTEKNLVYAGYSNWERLILRGPSDKGKLATQYKSEKRKELEDE  232

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + G+ GDQWSDL G+A A RSFK PN M
Sbjct  233  GYRIHGSSGDQWSDLNGFAVATRSFKLPNPM  263



>ref|XP_006284398.1| hypothetical protein CARUB_v10005568mg [Capsella rubella]
 gb|EOA17296.1| hypothetical protein CARUB_v10005568mg [Capsella rubella]
Length=253

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 138/229 (60%), Gaps = 7/229 (3%)
 Frame = -2

Query  807  SRPEPIIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSM  634
            +R    I+LP   G    YC+SW+LA E NNAG WD     C D    Y+   ++LSD  
Sbjct  24   ARTTSFIKLPRSDGSR--YCDSWRLAAETNNAGTWDVIPSVCVDPVADYLNGDQFLSDYN  81

Query  633  AVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldddd  460
             +A YA  +A SV+++   +D W+FDID+TLL+ + Y       S  + +  + S     
Sbjct  82   VIADYALSFAKSVDISGDGKDVWVFDIDETLLTNIDYYKAHGYGSEPY-DSNSFSEWVLQ  140

Query  459  fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDE  280
               P+  ASL+LY  +QKLGF I L++ R + Q + T  NL   GY+ W++L+LR   D+
Sbjct  141  GTAPAFDASLKLYNALQKLGFTIILLTGRDEDQRSFTETNLRDAGYSGWERLLLRGPEDQ  200

Query  279  DKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             KS+  +KSE+R +++EEG+ ++GN GDQWSDLLG+A A RSFK PN M
Sbjct  201  GKSATDYKSEQRAKLIEEGFKIRGNTGDQWSDLLGFAVADRSFKVPNPM  249



>ref|XP_006853740.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
 gb|ERN15207.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
Length=287

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 142/225 (63%), Gaps = 8/225 (4%)
 Frame = -2

Query  786  ELPAG--VGEDHWY-CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVAS  622
            ++P G   G+D  + C+SW+ AVE NN   W +  + C+++   YMT  RY SDS  V+ 
Sbjct  60   DIPGGRETGKDTGFVCDSWRFAVETNNLREWKKVPDKCQEYVGVYMTGDRYESDSEIVSG  119

Query  621  YAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlp  448
             A  +A ++++    +D W+FDID+TLLS + Y  E    S  F N  + +      + P
Sbjct  120  EAENFARNISILGDGKDVWVFDIDETLLSNLPYYAENGFGSKDF-NEDSFNEWVVKAEAP  178

Query  447  slpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSS  268
            +LP SL+LY  ++KLGF++ L++ R++SQ   T +NL   GY++W++LILR   D  K +
Sbjct  179  ALPYSLKLYNELKKLGFRVILLTGREESQRTVTAENLIAAGYDSWERLILRGAKDSGKPA  238

Query  267  LVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +V+KSEKR+E+  EGY + GN GDQWSDLLG+A   RSFK PN M
Sbjct  239  VVYKSEKRMEIEGEGYRIHGNSGDQWSDLLGFAIGNRSFKLPNPM  283



>ref|XP_009109048.1| PREDICTED: acid phosphatase 1-like isoform X2 [Brassica rapa]
Length=262

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 137/228 (60%), Gaps = 9/228 (4%)
 Frame = -2

Query  792  IIELPAGVGEDHW----YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMA  631
            II+LP   G        YCESW+LAVE NNAG W     +C D    Y+   +Y SD   
Sbjct  32   IIKLPRSDGSRSTAADTYCESWRLAVETNNAGTWGVLPSSCVDSVARYLNGDQYGSDYDV  91

Query  630  VASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddf  457
            +  YA  +A +V ++   +D WIFDID+TLL+ + Y       S  F + K+ +      
Sbjct  92   IVDYALAFAKTVKISGDGKDVWIFDIDETLLTNIGYYKNHGYGSEPF-DSKSFNEWVVQG  150

Query  456  dlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDED  277
              P+  ASL++Y  ++KLGF I L++ R + Q N T KNL  VGY+ W++LILR   D+ 
Sbjct  151  TAPAFAASLRMYNALKKLGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERLILRGPDDQG  210

Query  276  KSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            KS+  +KSE+R +++++G+ + GN GDQWSDLLG+A A RSFK PN M
Sbjct  211  KSATNYKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPM  258



>ref|XP_011076425.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=269

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 130/215 (60%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            E H  C SW++AVE NN  PW    E C D+ K YMT   Y  D   V + A  YA SVN
Sbjct  52   EAHLQCTSWRVAVEANNLSPWKTIPEDCADYVKEYMTGNVYEFDLQRVYNEAGIYARSVN  111

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            +    +DAWIFD+D+TLLS + Y  E       F + K      +    P++ +SL+LY+
Sbjct  112  LNGDGKDAWIFDVDETLLSNLPYYAEHGYGLEMFNSTK-FDQWVETGTAPAVESSLKLYE  170

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +  LGFK+ L++ R +     TV+NL + G+  WDKLILR + D  K++ V+KS+KR E
Sbjct  171  EVLSLGFKVILLTGRSERHRGITVENLLRAGFREWDKLILRSSEDHGKTATVYKSDKRNE  230

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +VEEGY + GN GDQWSDLLG + + RSFK PN M
Sbjct  231  LVEEGYRILGNSGDQWSDLLGSSMSKRSFKLPNPM  265



>ref|XP_002309231.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
 gb|EEE92754.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
Length=247

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 130/211 (62%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YC  W+ +VE N+ G WD     C  + + YMT   Y SDS   ASYA  +A +V +   
Sbjct  34   YCNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTVEIAGD  93

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + Y       S  F    +     D    P+L ASL LYK +++
Sbjct  94   GKDAWVFDVDETLLSNLPYYAVHGFGSEPFDEL-SFDEWVDLAKAPALQASLNLYKELKQ  152

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF +F+++ R + Q N T KNL   GY++W++LILR++ D+ K +  +KS++R+E+V E
Sbjct  153  LGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRRLELVNE  212

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDL G+A + RSFK PN +
Sbjct  213  GYRIHGNSGDQWSDLFGFAVSERSFKLPNPL  243



>gb|ABK92831.1| unknown [Populus trichocarpa]
Length=247

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 131/211 (62%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YC  W+ +VE N+ G WD     C  + + YMT   Y SDS   ASYA  +A +V +   
Sbjct  34   YCNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTVEIAGD  93

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + Y       S  F    +     D  + P+L ASL LYK +++
Sbjct  94   GKDAWVFDVDETLLSNLPYYAVHGFGSEPFDEL-SFDEWVDLAEAPALQASLNLYKELKQ  152

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF +F+++ R + Q N T KNL   GY++W++LILR++ D+ K +  +KS++R+E+V E
Sbjct  153  LGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRRLELVNE  212

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDL G+A + RSFK PN +
Sbjct  213  GYRIHGNSGDQWSDLFGFAVSERSFKLPNPL  243



>ref|XP_002283385.2| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=307

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 133/215 (62%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            +D  +C+SW+  VE N+AG W    + C  + K YMT  RY SDS   A  +  +A +V 
Sbjct  90   DDVLFCDSWRFTVETNDAGVWVSVPDRCVQWVKDYMTGDRYRSDSEFAADDSLSFAKTVQ  149

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            +    +D W+FDID+TLLS + Y       S  F +        +  + P+L ASL+LY+
Sbjct  150  IAGDGKDVWVFDIDETLLSNLPYYAAHGFGSEAFDDS-TFDEWVNLAEAPALQASLRLYR  208

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             +++LGFKI LI+ R + Q N T KNL   GY+NW++L LR   D  K++LV+KSEKR E
Sbjct  209  EVEQLGFKIVLITGRIEPQRNVTEKNLVYAGYSNWERLFLRGRADSGKTALVYKSEKRRE  268

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + +EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  269  LEDEGYRIHGSSGDQWSDLLGFAIARRSFKLPNPM  303



>ref|XP_010548682.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=260

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 132/213 (62%), Gaps = 9/213 (4%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN--VT  586
            YCESWKLA+E NNAG W   ++ C DF + Y++  +Y +D   +A YA ++A +V     
Sbjct  47   YCESWKLAIETNNAGAWGLVRKECVDFVRIYISGKQYYADYELIADYAIDFAHTVKPLAD  106

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd--ddfdlpslpasLQLYKTI  412
             +DAW FD+D+TLLS +SY    + +  G +     S     +    P+  ASL+LY  +
Sbjct  107  GKDAWFFDVDETLLSHLSY---FATQGYGTEPMDEGSFYSWIEMAKAPAFDASLRLYNEL  163

Query  411  QKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVV  232
            +KLGF IFL++ R +   N T  NL + GY  W +L LR   D+ K + ++KSE+R E+V
Sbjct  164  KKLGFTIFLLTGRDEEYRNATETNLLRSGYFGWQRLFLRGPEDKGKPATIYKSERRSEIV  223

Query  231  EEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +EGY + GN GDQWSDLLG+A A RSFK PN +
Sbjct  224  KEGYRIHGNVGDQWSDLLGFAQAERSFKVPNPL  256



>ref|XP_006837335.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
 gb|ERN00189.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
Length=298

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 130/211 (62%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+ AVE NN   W      C  F K YM++  Y SD   VA  A  +A +V +   
Sbjct  85   YCESWRFAVETNNLQSWKVVPIECGGFVKKYMSERGYRSDLEMVAEVAGAFARNVELGQD  144

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
              DAWIFDID+TLLS + Y +E       F N        D  + P++   L+LY+ + +
Sbjct  145  GMDAWIFDIDETLLSNLVYYEENGFGLELF-NGNKFDEWVDLAEAPAISPFLKLYEEVLE  203

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +GFK+FL++ R +SQ + T+ NL   G+ NWD+LI+R   D+ KS++ +KSEKR+E+ +E
Sbjct  204  MGFKVFLLTGRSESQRSTTIHNLQNSGFQNWDRLIMRGAADQGKSAVFYKSEKRMEMEKE  263

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            G+ + GN GDQWSDLLG + A+RSFK PN M
Sbjct  264  GFRILGNSGDQWSDLLGSSMAIRSFKLPNPM  294



>ref|XP_007038298.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
 gb|EOY22799.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
Length=266

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 135/236 (57%), Gaps = 14/236 (6%)
 Frame = -2

Query  801  PEP-IIELPAGVG--------EDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDY  655
            P P II+ P G+         E    C SW+  VE NN  PW    E C  + K YMT  
Sbjct  28   PRPLIIQYPEGIETQFENFDEELQLQCTSWRFTVETNNLSPWKTIPEKCGGYVKDYMTGR  87

Query  654  RYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
             Y  D   VA+ A  YA SV ++   +D W+FDID+TLLS + Y  E       F   + 
Sbjct  88   GYTMDLERVANEAGVYAKSVELSGDGKDVWVFDIDETLLSNLPYYAEHGYGLEIFYPVE-  146

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
                      P++  SL+LY+ +  LGFK+FL++ R + Q + T++NL K G+ +WDKLI
Sbjct  147  FDKWVQRGMAPAIDPSLKLYEMVLDLGFKVFLLTGRSEEQRSVTIENLTKAGFQSWDKLI  206

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LRD+ D  K + VFKSEKR ++VEEG+ + GN GDQWSDLLG + + RSFK PN M
Sbjct  207  LRDSEDHGKLATVFKSEKRSKMVEEGFRILGNSGDQWSDLLGSSPSSRSFKLPNPM  262



>gb|EYU30686.1| hypothetical protein MIMGU_mgv1a011950mg [Erythranthe guttata]
Length=266

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 130/212 (61%), Gaps = 6/212 (3%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYA---VSVNV  589
            YCE W+  VE N+AG W Q  E C DF K Y+    Y  +S AVA  A  +A   V V+ 
Sbjct  52   YCEGWRFTVETNDAGSWTQVPEKCVDFVKEYLAGDWYRLESEAVADSAVAFAKTAVGVSG  111

Query  588  THRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
              ++AW+FDID+TLLS V Y  +    S  F    +     D    P+L ASL+L+  +Q
Sbjct  112  NGKNAWVFDIDETLLSNVPYYADHGFGSEVFDEL-SFDSWVDLAVGPALSASLRLFNELQ  170

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LGF +FL++ R + Q N T  NL   G+NNW++LILR   D+ K + V+KSEKR E+ +
Sbjct  171  DLGFTVFLLTGRSEFQRNVTEINLRFAGFNNWERLILRGDGDQGKLASVYKSEKRKEIED  230

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGYI++GN GDQWSDL G+A A RSFK PN +
Sbjct  231  EGYIIRGNSGDQWSDLTGFAVAERSFKLPNPL  262



>gb|EAZ35770.1| hypothetical protein OsJ_20061 [Oryza sativa Japonica Group]
Length=293

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LA E NN  PW    E C  + + Y+T   Y SD   VA  A  YA +  V    
Sbjct  81   CASWRLAGEANNLAPWKSLPEECAAYVREYLTGVAYRSDLEVVAREASAYARTARVGDDG  140

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            RDAW+FD+D+TLLS + Y  +       F + +      +  + P++P+SL+LY  ++ L
Sbjct  141  RDAWVFDVDETLLSNLPYYADHGYGLELFDH-REFDKWVERGEAPAIPSSLKLYNEVRDL  199

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK FL++ R +     TV NL K G+++WDKLILR   D  K++ ++KSEKR E+ EEG
Sbjct  200  GFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDKLILRAPADRKKTATIYKSEKRKEMEEEG  259

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG++T+ RSFK PN M
Sbjct  260  YRILGNSGDQWSDLLGFSTSARSFKLPNPM  289



>ref|XP_010448471.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=270

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ A E NN  PW      C D+ K Y+ D  Y+ D   V+  A  YA S   N  
Sbjct  57   HCTSWRFAAETNNLAPWKTIPVECADYVKDYLMDKGYVFDMERVSEEAEVYASSFESNGD  116

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLLS + Y  E       F + K      +    P++  SL+LY+ +Q 
Sbjct  117  GKDVWIFDIDETLLSNLPYYLEHGCGLEVFNHSK-FDKWVEKGIAPAIAPSLKLYQMVQD  175

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +G+KI L++ R+++    TV+NL   G++NWDKLILR   D+ K++ +FKSEKR E+++E
Sbjct  176  MGYKIILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKRDEMMDE  235

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDLLGYA + RSFK PN M
Sbjct  236  GYRIRGNSGDQWSDLLGYAMSERSFKLPNPM  266



>ref|NP_001056747.1| Os06g0139800 [Oryza sativa Japonica Group]
 dbj|BAD68673.1| putative acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF18661.1| Os06g0139800 [Oryza sativa Japonica Group]
 gb|EAY99585.1| hypothetical protein OsI_21563 [Oryza sativa Indica Group]
 dbj|BAG86750.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LA E NN  PW    E C  + + Y+T   Y SD   VA  A  YA +  V    
Sbjct  81   CASWRLAGEANNLAPWKSLPEECAAYVREYLTGVAYRSDLEVVAREASAYARTARVGDDG  140

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            RDAW+FD+D+TLLS + Y  +       F + +      +  + P++P+SL+LY  ++ L
Sbjct  141  RDAWVFDVDETLLSNLPYYADHGYGLELFDH-REFDKWVERGEAPAIPSSLKLYNEVRDL  199

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK FL++ R +     TV NL K G+++WDKLILR   D  K++ ++KSEKR E+ EEG
Sbjct  200  GFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDKLILRAPADRKKTATIYKSEKRKEMEEEG  259

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG++T+ RSFK PN M
Sbjct  260  YRILGNSGDQWSDLLGFSTSARSFKLPNPM  289



>ref|XP_008799767.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=256

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 129/226 (57%), Gaps = 18/226 (8%)
 Frame = -2

Query  774  GVGEDH--WYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREY  607
            G+ ED    YCESW+LAVE NNAG W +    C D    Y+   +YL DS  VA  +  Y
Sbjct  33   GLAEDPKVQYCESWRLAVETNNAGEWKKVPSRCVDVVADYIKGPQYLIDSKMVARLSHAY  92

Query  606  AVSVNVTH--RDAWIFDIDDTLLSRV------SYCDELSVKSAGFKNCKNsslddddfdl  451
            A +V +    +D W+FD+D+TL+S         Y   +S ++A +    NS         
Sbjct  93   AKTVKLAGDGKDLWVFDVDETLISNFLHYTMHGYDSRMSNETAAYDQWVNSGKATALPWS  152

Query  450  pslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKS  271
                    LY+ +Q LGF++ L++ RK+   N+T +NL  VGY +W KLILR++ D  K+
Sbjct  153  LW------LYRKLQSLGFQLVLLTGRKEHHRNSTEQNLMAVGYRSWKKLILRESLDATKT  206

Query  270  SLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            ++ +KSEKR E+  EGY + G+ GDQWSDLLG   A RSFK PN M
Sbjct  207  AMTYKSEKRAELEAEGYRIHGSSGDQWSDLLGPPMAKRSFKLPNPM  252



>ref|XP_010925513.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=256

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 136/226 (60%), Gaps = 9/226 (4%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASY  619
            + E PA    +  YC+SW+L+VE NNAG W+     C  F   YM   RY SDS  VA+ 
Sbjct  30   VSENPASGDTEDLYCDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAE  89

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFK--NCKNsslddddfdl  451
            +  +A +V V    +D WIFD+D+TLLS V Y D   V   G++  N        +    
Sbjct  90   SLAFAQTVQVAGDGKDVWIFDVDETLLSNVPYYD---VHGYGWEEFNETAFDEWVNLAKA  146

Query  450  pslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKS  271
            P+L ASL+LY+ +  LGF++ L++ R ++Q N T KNL  VGY++W + ILR+  D  K 
Sbjct  147  PALQASLRLYEELLGLGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKK  206

Query  270  SLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            ++ +KSE+R ++  +GY + GN GDQWSDLLG   A+RSFK PN M
Sbjct  207  AVTYKSERRAQLEAQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPM  252



>ref|XP_010433115.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=254

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 135/224 (60%), Gaps = 6/224 (3%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASY  619
             I+LP  V +   YC+SW+LA E NNAG WD     C D    Y+   ++LSD   +A Y
Sbjct  29   FIKLPGSV-DGSRYCDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADY  87

Query  618  AREYAVSVNVT--HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
               +A +V ++   +D WIFDID+TLL+ + Y       S  F +  + +        P+
Sbjct  88   VIAFAKTVEISGDDKDVWIFDIDETLLTNIDYYKAHGYGSEPF-DSNSYNEWVVQGTAPA  146

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
              ASL+LY  ++KLGF I L++ R + Q + T  NL  VGY+ W++L+LR   D+  S+ 
Sbjct  147  FDASLRLYNALKKLGFTIILLTGRDEDQRSFTETNLRDVGYSGWERLLLRGPKDQGTSAT  206

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R +++EEG+ ++GN GDQWSDLLG+A A RSFK PN M
Sbjct  207  NYKSEQRSKLIEEGFKIRGNTGDQWSDLLGFAVADRSFKVPNPM  250



>ref|XP_011007264.1| PREDICTED: acid phosphatase 1 [Populus euphratica]
Length=247

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 132/211 (63%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YC SW+ +VE N+ G WD     C  + + YMT   Y SDS   +SYA  +A +V +   
Sbjct  34   YCNSWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVASSYALGFAKTVEIAGD  93

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + Y       S  F    +     D  + P++ ASL LYK +++
Sbjct  94   GKDAWVFDVDETLLSNLPYYAVHGFGSEPFDEL-SFDDWVDLAEAPAIQASLNLYKGLKQ  152

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF +F+++ R + Q N T KNL   GY ++++LILR++ D+ K + ++KS++R+E+V E
Sbjct  153  LGFTVFMLTGRSEHQRNATAKNLQLEGYGDYERLILRESLDQGKPATLYKSQRRLELVNE  212

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDL G+A + RSFK PN +
Sbjct  213  GYRIHGNSGDQWSDLYGFAVSERSFKLPNPL  243



>ref|XP_009109046.1| PREDICTED: acid phosphatase 1-like isoform X1 [Brassica rapa]
Length=265

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 137/230 (60%), Gaps = 10/230 (4%)
 Frame = -2

Query  792  IIELPAGVGEDHW----YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMA  631
            II+LP   G        YCESW+LAVE NNAG W     +C D    Y+   +Y SD   
Sbjct  32   IIKLPRSDGSRSTAADTYCESWRLAVETNNAGTWGVLPSSCVDSVARYLNGDQYGSDYDV  91

Query  630  VASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDE--LSVKSAGFKNCKNsslddd  463
            +  YA  +A +V ++   +D WIFDID+TLL+ + Y       V  +   + K+ +    
Sbjct  92   IVDYALAFAKTVKISGDGKDVWIFDIDETLLTNIGYYKNHGYGVSRSEPFDSKSFNEWVV  151

Query  462  dfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD  283
                P+  ASL++Y  ++KLGF I L++ R + Q N T KNL  VGY+ W++LILR   D
Sbjct  152  QGTAPAFAASLRMYNALKKLGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERLILRGPDD  211

Query  282  EDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + KS+  +KSE+R +++++G+ + GN GDQWSDLLG+A A RSFK PN M
Sbjct  212  QGKSATNYKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPM  261



>ref|XP_010914845.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
 ref|XP_010914851.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=255

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 145/252 (58%), Gaps = 16/252 (6%)
 Frame = -2

Query  861  LVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDH---WYCESWKLAVENNNAGPWDQ--  697
            L++C FL++     A + +  E + E P+G   D     YCESW+LAVE NNAG W +  
Sbjct  7    LLLC-FLVAA---VATSQTHLEMVAEDPSGGLADDPKVQYCESWRLAVETNNAGEWKKVP  62

Query  696  ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVT--HRDAWIFDIDDTLLSRVSYCD  523
              C D    Y+   +YL+DS  VA  +  YA +V +    +D WIFD+D+TL+S   +  
Sbjct  63   SRCVDVVADYIKGPQYLTDSKMVARLSHAYAKTVQLAGDGKDVWIFDVDETLISNFLHYT  122

Query  522  ELSVKSAGFKNCKNsslddddfdlpslpasLQ--LYKTIQKLGFKIFLISERKQSQLNNT  349
                +S   + C  ++ D   +   +        LY+ +Q LGF++ L++ RK+   N+T
Sbjct  123  LHGYES---RMCNETAYDQWVYTGKATALPWSLWLYRKLQSLGFQLVLLTGRKEHHRNST  179

Query  348  VKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYA  169
             +NL  VGY +W KLILR++ D  K+++ +KSEKR E+  EGY + G+ GDQWSDLLG  
Sbjct  180  EQNLMAVGYRSWKKLILRESLDATKTAMTYKSEKRAELEAEGYTIHGSSGDQWSDLLGPP  239

Query  168  TAVRSFKFPNLM  133
             A RSFK PN M
Sbjct  240  MAKRSFKLPNPM  251



>ref|XP_006284235.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
 gb|EOA17133.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
Length=290

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            CESW+LA E NNAG W+     C +  K+Y+   ++ +D   VA YA  YA  +N+    
Sbjct  78   CESWRLASETNNAGSWNVVPSRCVNSVKNYINGGQFENDYNIVARYAIAYAKRINLGRDG  137

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAW+FDID+TLLS + Y       S  + N K  +         S   SL+LYK ++KL
Sbjct  138  KDAWVFDIDETLLSNLDYYKVHGYGSEPYDNAK-FNEWAVQGKASSFDGSLRLYKALKKL  196

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GF I L++ R ++Q + T KNL   GY  W++LILR   D+ K+++ +KSE+R +VV+EG
Sbjct  197  GFTIILLTGRDENQRSITEKNLRNAGYFGWNRLILRGKNDQGKTAIQYKSEQRSKVVKEG  256

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDL G+A A RSFK PN M
Sbjct  257  YKIHGNTGDQWSDLQGFAVATRSFKVPNPM  286



>ref|NP_001234071.1| acid phosphatase 1 precursor [Solanum lycopersicum]
 sp|P27061.1|PPA1_SOLLC RecName: Full=Acid phosphatase 1; AltName: Full=Apase-1(1); Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34134.1| acid phosphatase type 1 precursor [Solanum lycopersicum]
 gb|AAA34135.1| acid phosphatase type 5 [Solanum lycopersicum]
 emb|CAA39370.1| acid phosphatase [Solanum lycopersicum]
 prf||1908427A acid phosphatase 1
Length=255

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 144/252 (57%), Gaps = 7/252 (3%)
 Frame = -2

Query  870  MQCLVMCIFL-ISGGtttaaaTSRPEP-IIELPAGVGEDHWYCESWKLAVENNNAGPWD-  700
            M+  V  + L ++ GT    +   P P IIE P     D   C +W+  VE NN  PW  
Sbjct  1    MRIFVFLVLLTVAIGTENLNSHVFPRPLIIEYPEKQLRDELKCTTWRFVVETNNLSPWKT  60

Query  699  -QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSY  529
              E C D+ K YM    Y  +   V+  A EYA SV++    RD WIFD+D+TLLS + Y
Sbjct  61   IPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPY  120

Query  528  CDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNT  349
              +       F + +      ++   P+L +SL+LY+ + KLGFK+FL++ R +   + T
Sbjct  121  YSDHRYGLEVFDDVE-FDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVT  179

Query  348  VKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYA  169
            V+NL   G+++W KLILR + D  K++  +KSE+R  +VEEG+ + GN GDQWSDLLG +
Sbjct  180  VENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSDLLGSS  239

Query  168  TAVRSFKFPNLM  133
             + RSFK PN M
Sbjct  240  MSYRSFKLPNPM  251



>ref|XP_011101105.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=267

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/236 (40%), Positives = 141/236 (60%), Gaps = 14/236 (6%)
 Frame = -2

Query  801  PEPII---------ELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDY  655
            P+P+I         E P    E    C SW++AVE NN  PW++  E C D+ K YM   
Sbjct  29   PKPLIVEINEAQLKEWPVEEEEVQLQCTSWRVAVEANNLSPWEKIPEECADYVKEYMIGK  88

Query  654  RYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
             Y  D   V++ A+ +A SV ++   + AWIFD+D+TLLS + Y  +       F + K 
Sbjct  89   GYELDLQRVSNEAKAFARSVYLSGDGKSAWIFDVDETLLSNLPYYADHGFGLEVFDSTK-  147

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
                 +    P++ +SL+LY+ +  LGFK+ L++ R +   + TV+NL + G+  WDKL+
Sbjct  148  FGQWVEMGIAPAIESSLELYEEVLSLGFKVILLTGRSERHRSITVENLFQAGFREWDKLL  207

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LR + D +K++ ++KSEKR E+VE+GY + GN GDQWSDLLG + ++RSFK PN M
Sbjct  208  LRSSEDHEKTATIYKSEKRNELVEQGYQILGNSGDQWSDLLGSSMSIRSFKLPNPM  263



>gb|AHC69831.1| acid phosphatase [Nicotiana tabacum]
Length=263

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 143/255 (56%), Gaps = 19/255 (7%)
 Frame = -2

Query  855  MCIFLISGGtttaaaTSRPEP-IIELPAGVGEDHWY---------CESWKLAVENNNAGP  706
            + +F +  G     +   P P IIE P    E H +         C SW+ AVE NN GP
Sbjct  10   LVLFTLVTGHENLNSHMFPRPLIIEYP----EPHHHQLKDEVQLQCTSWRFAVETNNLGP  65

Query  705  WD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVS--VNVTHRDAWIFDIDDTLLSR  538
            W    E C ++ + Y+    Y  D   V+  A  YA S  +    +D W+FD+D+TLLS 
Sbjct  66   WKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLGADGKDVWVFDVDETLLSN  125

Query  537  VSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQL  358
            + Y  +       F + +      +    P++ +SL+LY+ + +LGFK+FL++ R +   
Sbjct  126  LPYYSDHGHGLEVFDSVE-FEKWVEKGMAPAIGSSLKLYQDVMRLGFKVFLLTGRSERHR  184

Query  357  NNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLL  178
              TV+NL   G+ +WDKLILR + D  KS+ ++KSEKR E+VEEG+ L GN GDQWSDLL
Sbjct  185  IVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEMVEEGFRLVGNSGDQWSDLL  244

Query  177  GYATAVRSFKFPNLM  133
            G +T++RSFK PN M
Sbjct  245  GSSTSIRSFKLPNPM  259



>ref|XP_010941067.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=271

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 134/242 (55%), Gaps = 20/242 (8%)
 Frame = -2

Query  801  PEPII-ELPAG-----------VGED---HWYCESWKLAVENNNAGPWD--QETCEDFAK  673
            P P+I E P+G           VG D   H  C SW+ A E NN  PW      C  + K
Sbjct  27   PRPLILEYPSGDDQIFQTPISNVGRDEEVHLRCASWRFAGEANNLAPWKTVPADCGAYVK  86

Query  672  SYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAG  499
             YMT   Y  D   VA  A  YA S+++     DAW+FD+D+TLLS + Y  +       
Sbjct  87   DYMTGKAYRFDLEMVADEAAAYARSISLVGDGMDAWVFDVDETLLSNLPYYADHGYGLEV  146

Query  498  FKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYN  319
            F N        D    P++ +SL+LY+ I +LGFKIFL++ R + Q   TV+NL KVG+ 
Sbjct  147  F-NSHEFDKWVDKAMAPAIQSSLKLYEEILRLGFKIFLLTGRSEGQKIVTVENLKKVGFQ  205

Query  318  NWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPN  139
            +W+KLILR   D  K +  +KSEKR E+  EGY + GN GDQWSDLLG +T  RSFK PN
Sbjct  206  DWEKLILRGVNDHGKLATTYKSEKRSEITAEGYRILGNSGDQWSDLLGSSTGNRSFKLPN  265

Query  138  LM  133
             M
Sbjct  266  PM  267



>prf||1908418A acid phosphatase 1
Length=255

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 144/252 (57%), Gaps = 7/252 (3%)
 Frame = -2

Query  870  MQCLVMCIFL-ISGGtttaaaTSRPEP-IIELPAGVGEDHWYCESWKLAVENNNAGPWD-  700
            M+  V  + L ++ GT    +   P P IIE P     D   C +W+  VE NN  PW  
Sbjct  1    MRIFVFLVLLTVAIGTENLNSHVFPRPLIIEYPEKQLRDELKCTTWRFVVETNNLSPWKT  60

Query  699  -QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSY  529
              E C D+ K YM    Y  +   V+  A EYA SV++    RD WIFD+D+TLLS + Y
Sbjct  61   IPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPY  120

Query  528  CDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNT  349
              +       F + +      ++   P+L +SL+LY+ + KLGFK+FL++ R +   + T
Sbjct  121  YSDHRYGLEVFDDVE-FDKWVENGIAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVT  179

Query  348  VKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYA  169
            V+NL   G+++W KLILR + D  K++  +KSE+R  +VEEG+ + GN GDQWSDLLG +
Sbjct  180  VENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSDLLGSS  239

Query  168  TAVRSFKFPNLM  133
             + RSFK PN M
Sbjct  240  MSYRSFKLPNPM  251



>ref|XP_010438922.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ A E NN  PW      C D+ K Y+    Y+ D   V+  A+ YA S   N  
Sbjct  54   HCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEAKIYASSFESNGD  113

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLLS + Y  E       F + K      +    P++  SL+LYK +Q 
Sbjct  114  GKDVWIFDIDETLLSNLPYYLEHGCGLEVFNHSK-FDKWVEKGIAPAIAPSLKLYKLVQD  172

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +G+K+ L++ R+++    TV+NL   G++NWDKLILR   D+ K++ +FKSEKR E+V E
Sbjct  173  MGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKRDEMVNE  232

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDLLG+A + RSFK PN M
Sbjct  233  GYRIRGNSGDQWSDLLGFAMSERSFKLPNPM  263



>ref|XP_010541004.1| PREDICTED: acid phosphatase 1 [Tarenaya hassleriana]
Length=252

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 140/226 (62%), Gaps = 7/226 (3%)
 Frame = -2

Query  792  IIELPAG--VGEDHWYCESWKLAVENNNAGPW--DQETCEDFAKSYMTDYRYLSDSMAVA  625
            +I+LP G     +  YCESW+LAVE  NAG W    + C+D+  +Y+T  +Y SD     
Sbjct  24   VIQLPGGESFSAESTYCESWRLAVETYNAGTWYGIPKKCQDYVVAYLTGEQYDSDYETAV  83

Query  624  SYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdl  451
             YA ++A +V ++   +DAWIFD+D+TLL+ + Y       S  + N ++ +   +    
Sbjct  84   DYAIDFAKTVKISGDGKDAWIFDVDETLLTNIDYYKAHGYGSEPY-NEESFNEWVETGAA  142

Query  450  pslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKS  271
            P+  ASL+LY  ++K+GF I +++ R + Q + T KNL   GY+ W +LILR   ++ KS
Sbjct  143  PAFDASLRLYSELKKIGFAIIILTGRDEEQRSITEKNLGDAGYSGWSRLILRGPENKGKS  202

Query  270  SLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + +FKS +R E++++GY + G+ GDQW+DLLG+  A RSFK PN M
Sbjct  203  ATIFKSGERSELIKKGYRIHGSIGDQWTDLLGFPVAERSFKVPNPM  248



>ref|XP_010447874.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=256

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 135/224 (60%), Gaps = 6/224 (3%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASY  619
             I+LP G  +   YC+SW+LA E NNAG WD     C D    Y+   ++LSD   +A Y
Sbjct  31   FIKLP-GSDDGSRYCDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADY  89

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            A  +A +V ++   +D WIFDID+TLL+ + Y    S  S  F +  + +        P+
Sbjct  90   AIAFAKTVEISGDGKDVWIFDIDETLLTNIDYYKAHSYGSEPF-DVNSFNEWVVQGTAPA  148

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
              ASL+LY  ++KLGF I L++ R + Q + T  NL   GY+ W++L+LR   D+  S+ 
Sbjct  149  FDASLRLYNALKKLGFTIILLTGRDEDQRSFTESNLRDAGYSGWERLLLRGPKDQGTSAT  208

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R ++VEEG+ ++GN GDQWSDL G+A A RSFK PN M
Sbjct  209  NYKSEQRSKLVEEGFKVRGNTGDQWSDLQGFAVADRSFKVPNPM  252



>ref|XP_010925515.1| PREDICTED: acid phosphatase 1-like isoform X2 [Elaeis guineensis]
Length=254

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 133/224 (59%), Gaps = 7/224 (3%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASY  619
            + E PA    +  YC+SW+L+VE NNAG W+     C  F   YM   RY SDS  VA+ 
Sbjct  30   VSENPASGDTEDLYCDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAE  89

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            +  +A +V V    +D WIFD+D+TLLS V Y D   V      N        +    P+
Sbjct  90   SLAFAQTVQVAGDGKDVWIFDVDETLLSNVPYYD---VHGWEEFNETAFDEWVNLAKAPA  146

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
            L ASL+LY+ +  LGF++ L++ R ++Q N T KNL  VGY++W + ILR+  D  K ++
Sbjct  147  LQASLRLYEELLGLGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAV  206

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R ++  +GY + GN GDQWSDLLG   A+RSFK PN M
Sbjct  207  TYKSERRAQLEAQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPM  250



>ref|XP_010438317.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=257

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 134/224 (60%), Gaps = 6/224 (3%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASY  619
             I+LP G  +   YC+SW+LA E NNAG WD     C D    Y+   ++LSD   +A Y
Sbjct  32   FIKLP-GSDDGSRYCDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADY  90

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            A  +A +V +    +D WIFDID+TLL+ + Y       S  F++    +        P+
Sbjct  91   AIAFAKTVEIPGDGKDVWIFDIDETLLTNIDYYKAHGYGSEPFES-NTFNEWVVQGTAPA  149

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
              ASL+LY  ++KLGF I L++ R + Q + T  NL   GY+ W++L+LR   D+  S+ 
Sbjct  150  FDASLRLYNALKKLGFTIILLTGRDEDQRSFTETNLRDAGYSGWERLLLRGPKDQGTSAT  209

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R +++EEG+ ++GN GDQWSDLLG+A A RSFK PN M
Sbjct  210  NYKSEQRSKLIEEGFKIRGNTGDQWSDLLGFAVADRSFKVPNPM  253



>gb|EYU30687.1| hypothetical protein MIMGU_mgv1a011950mg [Erythranthe guttata]
Length=255

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 128/212 (60%), Gaps = 17/212 (8%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYA---VSVNV  589
            YCE W+  VE N+AG W Q  E C DF K Y+    Y  +S AVA  A  +A   V V+ 
Sbjct  52   YCEGWRFTVETNDAGSWTQVPEKCVDFVKEYLAGDWYRLESEAVADSAVAFAKTAVGVSG  111

Query  588  THRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
              ++AW+FDID+TLLS V Y  +      GF               P+L ASL+L+  +Q
Sbjct  112  NGKNAWVFDIDETLLSNVPYYAD-----HGFGWVD-------LAVGPALSASLRLFNELQ  159

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LGF +FL++ R + Q N T  NL   G+NNW++LILR   D+ K + V+KSEKR E+ +
Sbjct  160  DLGFTVFLLTGRSEFQRNVTEINLRFAGFNNWERLILRGDGDQGKLASVYKSEKRKEIED  219

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGYI++GN GDQWSDL G+A A RSFK PN +
Sbjct  220  EGYIIRGNSGDQWSDLTGFAVAERSFKLPNPL  251



>ref|XP_007133483.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
 gb|ESW05477.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
Length=269

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 137/231 (59%), Gaps = 9/231 (4%)
 Frame = -2

Query  801  PEPIIELPAGVGED----HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSD  640
            P P+I   AGV E        C +W++A E NN G W    E C D+ K YMT   YL D
Sbjct  36   PRPLIVEYAGVAEMSEEVRLRCGAWRVAGEANNLGAWRTVPEECADYVKEYMTGKGYLVD  95

Query  639  SMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
               V+  A E+A SV ++   +DAWIFDID+TLLS + Y          F + K  +   
Sbjct  96   LEMVSKEAEEFAKSVKLSDDGKDAWIFDIDETLLSNLPYYAAHGYGLEIFDHEK-FNDWV  154

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            ++   PSL  SL+LY+ + KLGFK+ L++ R +   + TV NL   G+  WD LILR + 
Sbjct  155  EEGVAPSLQPSLKLYEDVLKLGFKVILLTGRSERHRSVTVDNLINAGFKEWDHLILRSSD  214

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+ K ++VFKSEKR E+ ++GY + GN GDQWSDL+G + +VRSFK PN M
Sbjct  215  DQGKRAVVFKSEKRSEMEKDGYRILGNSGDQWSDLIGSSLSVRSFKLPNPM  265



>ref|XP_002867419.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43678.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 135/224 (60%), Gaps = 7/224 (3%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASY  619
             I+LP   G    YC+SW+LA E NNAG WD     C D    Y+   ++ SD   +A Y
Sbjct  29   FIKLPTSDGSR--YCDSWRLAAETNNAGTWDVIPSICVDSVAEYLNGDQFRSDYDVIADY  86

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            A  +A SV ++   +D WIFDID+TLL+ + Y       S  + N  + S   +    P+
Sbjct  87   ALAFAKSVEISGDGKDVWIFDIDETLLTNIDYYKAHGYGSEPYDN-NSFSEWVEQGTAPA  145

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
              ASL+LY  ++K GF I L++ R + Q ++T  NL   GY+ W++L+LR   D+ KS+ 
Sbjct  146  FDASLRLYNALKKFGFTIILLTGRDEDQRSSTETNLRDAGYSGWERLLLRGPNDQGKSAT  205

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R ++++EG+ ++GN GDQWSDLLG+A A RSFK PN M
Sbjct  206  NYKSEQRSKLIQEGFKIRGNSGDQWSDLLGFAVADRSFKVPNPM  249



>ref|XP_009137842.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
 emb|CDY30222.1| BnaA03g49480D [Brassica napus]
Length=261

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 130/211 (62%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+LA E NNAG WD     C D    Y+   +Y SD   +A YA  +A +V V+  
Sbjct  48   YCESWRLAAETNNAGTWDVIPSVCVDSVAGYLNGDQYASDYGVIADYALAFAKTVQVSGD  107

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLL+ + Y       S  F++  + +    +   P+  ASL+LY  ++K
Sbjct  108  GKDVWIFDIDETLLTNLDYYKAHGYGSEPFES-NSFNEWVVEGTAPAFEASLRLYNALKK  166

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF I L++ R + Q + T  NL   GY+ W++L+LR   D+ KS+  +KSE+R +++ E
Sbjct  167  LGFTIVLLTGRDEHQRSVTETNLRDAGYSGWERLLLRGPEDQGKSATNYKSEQRSKLIGE  226

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            G+ ++GN GDQWSDLLG+A A RSFK PN M
Sbjct  227  GFKIRGNTGDQWSDLLGFAVADRSFKVPNPM  257



>ref|XP_006357920.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=251

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 144/255 (56%), Gaps = 15/255 (6%)
 Frame = -2

Query  888  MSAMAFMQCLVMCIFLISGGtttaaaTSRPEP-IIELPAGVGEDHWYCESWKLAVENNNA  712
            M    F+  L + I     G+    +   P P IIE P    E+   C SW+ AVE NN 
Sbjct  1    MRIFVFLMLLTVAI-----GSENLNSHVFPRPLIIEYP----ENQLKCTSWRFAVETNNL  51

Query  711  GPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLL  544
             PW    + C D+ + Y+    Y  D   V++ A EYA SV++    RD W+FD+D+TLL
Sbjct  52   SPWKTIPQECADYVREYIVGPGYKMDIDRVSNEAGEYAKSVDLGDDGRDVWVFDVDETLL  111

Query  543  SRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
            S + Y  +       F + +      +    P+L +SL+LY+ +  LGFK+FL++ R + 
Sbjct  112  SNLPYYSDHGYGLEVFDSVE-FDKWVEKGTAPALGSSLKLYQEVLSLGFKVFLLTGRSER  170

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
              + TV+NL   G+++W KLILR + D  K++  FKSE+R E+VEEG+ + GN GDQWSD
Sbjct  171  HRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTFKSERRNEIVEEGFRIVGNSGDQWSD  230

Query  183  LLGYATAVRSFKFPN  139
            LLG + + RSFK PN
Sbjct  231  LLGSSMSNRSFKLPN  245



>ref|XP_010433112.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 130/210 (62%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            CESW+LA E NNAG W      C +  K+Y+T  ++ +D   VA YA  YA  V +    
Sbjct  47   CESWRLASETNNAGSWKVVPSRCVNSVKNYITGGQFENDYNIVARYAIAYAKRVKLGGDG  106

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAW+FDID+TLLS + Y   L   S  + + K  +        P+  ASL+LYK +++L
Sbjct  107  KDAWVFDIDETLLSNLEYYKALGYGSEPYDDTK-FNEWAVQGKAPAFDASLKLYKALKRL  165

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GF I L++ R +SQ + T KNL   GY  W++L+LR   D+ K++  +KSE+R +VV+EG
Sbjct  166  GFTIILLTGRDESQRSVTAKNLRDAGYFGWNRLLLRGKNDQGKTATQYKSEQRSKVVKEG  225

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + G+ GDQWSDL G+A A RSFK PN M
Sbjct  226  YKIHGSTGDQWSDLQGFAVAARSFKVPNPM  255



>emb|CDY14217.1| BnaA08g13480D [Brassica napus]
Length=265

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 136/230 (59%), Gaps = 10/230 (4%)
 Frame = -2

Query  792  IIELPAGVGEDH----WYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMA  631
            II+LP   G        +CESW+LAVE NNAG WD    +C D    Y+   +Y SD   
Sbjct  32   IIKLPGRDGSRSAAADTFCESWRLAVETNNAGTWDVLPSSCVDSVARYLNGDQYGSDYDV  91

Query  630  VASYAREYAVSVNV--THRDAWIFDIDDTLLSRVSYCDE--LSVKSAGFKNCKNsslddd  463
            +  YA  +A +V +    +D WIFDID+TLL+ + Y       V  +   + K+ +    
Sbjct  92   IVDYALAFAKTVKIYGDGKDVWIFDIDETLLTNIGYYKNHGYGVSRSEPFDSKSFNEWVV  151

Query  462  dfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD  283
                P+  ASL++Y  ++KLGF I L++ R + Q N T  NL  VGY+ W++LILR   D
Sbjct  152  QGTAPAFAASLRMYNALKKLGFTIVLLTGRDEDQRNVTETNLRDVGYSGWERLILRGPDD  211

Query  282  EDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + KS+  +KSE+R +++++G+ + GN GDQWSDLLG+A A RSFK PN M
Sbjct  212  QGKSATNYKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPM  261



>ref|XP_006412859.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
 gb|ESQ54312.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
Length=263

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 134/228 (59%), Gaps = 9/228 (4%)
 Frame = -2

Query  792  IIELPAGVGEDH----WYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMA  631
            +I+LP   G        YCESW+LA E NNAG WD     C D    Y+   +Y SD   
Sbjct  33   VIKLPESDGSRSAAADTYCESWRLAAETNNAGTWDVIPSMCIDSVSEYVNGDQYGSDYGV  92

Query  630  VASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddf  457
            +A YA  +A +V ++    D WIFDID+TLL+ + Y       S  F++  + +      
Sbjct  93   IADYALAFAKTVQISGDGNDVWIFDIDETLLTNIDYYRAHGYGSEPFESS-SFNEWAVQG  151

Query  456  dlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDED  277
              P+  ASL+LY  ++KLGF I L++ R + Q + T  NL   GY+ W++L+LR   D+ 
Sbjct  152  TAPAFDASLRLYNALKKLGFTIILLTGRDEDQRSVTETNLRDAGYSGWERLLLRGPGDQG  211

Query  276  KSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            KS+  +KSE+R +++E+G+ + GN GDQWSDLLG+A A RSFK PN M
Sbjct  212  KSATNYKSEQRSKLIEKGFRIHGNTGDQWSDLLGFAVADRSFKVPNPM  259



>ref|NP_194655.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79684.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAK93622.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14114.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85608.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=255

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 133/224 (59%), Gaps = 7/224 (3%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASY  619
             I+LP   G    YC+SW+LA E NN G WD     C D    Y+   ++LSD   +  Y
Sbjct  31   FIKLPGSDGSR--YCDSWRLAAETNNVGTWDLIPSICVDSVAEYLNGDQFLSDYSVIVDY  88

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            A  +A SV ++   +D WIFDID+TLL+ + Y       S  + + K  S   +    P+
Sbjct  89   ALAFAKSVEISGDGKDVWIFDIDETLLTNIDYYKAHGYGSEPYDDNK-FSEWVEQGTAPA  147

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
              ASL+LY  ++KLGF I L++ R + Q  +T  NL   GY+ W++L+LR   D+ KS+ 
Sbjct  148  FDASLRLYNALKKLGFTIILLTGRDEHQRTSTETNLRDAGYSGWERLLLRGPNDQGKSAT  207

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R +++EEG+ ++GN GDQWSDL G+A A RSFK PN M
Sbjct  208  NYKSEQRSKLIEEGFKIRGNSGDQWSDLQGFAVADRSFKVPNPM  251



>emb|CDY47773.1| BnaC07g41870D [Brassica napus]
Length=261

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+LA E NNAG WD     C D    Y+   +Y SD   +A YA  +A +V V+  
Sbjct  48   YCESWRLAAETNNAGTWDVIPSVCVDSVAGYLNGDQYGSDYGVIADYALAFAKTVQVSGD  107

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLL+ + Y       S  F+   + +    +   P+  ASL+LY  ++K
Sbjct  108  GKDVWIFDIDETLLTNLDYYRAHGYGSEPFE-ANSFNEWVVEGTAPAFEASLRLYNALKK  166

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF I L++ R + Q + T  NL   GY+ W++L+LR   D+ KS+  +KSE+R +++ E
Sbjct  167  LGFTIVLLTGRDEHQRSVTETNLRDAGYSGWERLLLRGPEDQGKSATNYKSEQRSKLIGE  226

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            G+ ++GN GDQWSDLLG+A A RSFK PN M
Sbjct  227  GFKIRGNTGDQWSDLLGFAVADRSFKVPNPM  257



>gb|KFK29483.1| hypothetical protein AALP_AA7G140100 [Arabis alpina]
Length=257

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 134/227 (59%), Gaps = 9/227 (4%)
 Frame = -2

Query  789  IELPAGVGE----DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAV  628
            I+LP   G      + YCESW+LA E NN G WD     C D    Y+   +Y SD   +
Sbjct  28   IKLPGSDGSRSAATNTYCESWRLAAETNNVGTWDVIPSICVDSVSEYLNGDQYGSDYGVI  87

Query  627  ASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfd  454
            A YA  +A +V ++   +D WIFDID+TLL+ + Y       S  + +  + +       
Sbjct  88   ADYALAFAKTVQISGDGKDVWIFDIDETLLTNIDYYKAHGYGSIPY-DSNSYNEWVVQGT  146

Query  453  lpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDK  274
             P+  ASL+LY  ++KLGF I L++ R + Q + T KNL   GY +W++L+LR   D+ K
Sbjct  147  APAFDASLRLYNALKKLGFTIVLLTGRDEDQRSVTEKNLRDAGYLDWERLLLRGREDQGK  206

Query  273  SSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            S+  +KSE+R +++ EG+ + GN GDQWSDLLG+A AVRSFK PN M
Sbjct  207  SATNYKSEQRSKLIVEGFKIHGNTGDQWSDLLGFAVAVRSFKVPNPM  253



>gb|KCW90870.1| hypothetical protein EUGRSUZ_A02919 [Eucalyptus grandis]
Length=263

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 133/233 (57%), Gaps = 11/233 (5%)
 Frame = -2

Query  801  PEP-IIELPAGVGE-----DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P IIE P    E         C+SW+ AVE NN  PW    + C D+ + YM    Y 
Sbjct  28   PRPLIIEYPTTAKELDEEQVRLQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYG  87

Query  645  SDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssl  472
             D   V+  A  YA SV ++   +D WIFDID+TLLS + Y  E       F   +    
Sbjct  88   FDIDRVSKEAAVYAGSVELSGDGKDVWIFDIDETLLSNLPYYAEHGFGLEVFDPVE-FDK  146

Query  471  ddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRD  292
              D  +   +  SL+LY+ +  LGFK+FL++ R + Q + T++NL   G+ NWDKLI+R 
Sbjct  147  WVDKAEALGIQPSLKLYELVLGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRA  206

Query  291  TCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + D  K ++V+KSEKR E+V EGY + GN GDQWSDLLG + ++RSFK PN M
Sbjct  207  SEDHSKLAVVYKSEKRDEMVREGYRILGNSGDQWSDLLGSSMSIRSFKLPNPM  259



>emb|CDP05370.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 141/261 (54%), Gaps = 19/261 (7%)
 Frame = -2

Query  861  LVMCIFLI-----SGGtttaaaTSRPEP-IIELPAG--------VGEDHWYCESWKLAVE  724
            LVMC FL+     +       +   P P +IE P G        + E    C SW+ AVE
Sbjct  5    LVMCFFLMLFSSCTLANDNYNSHIFPRPLVIEYPEGNEFQLRESLEELRLQCTSWRFAVE  64

Query  723  NNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDID  556
             NN  PW      C  + + YMT   Y  D   V+  A  +A SV +    +D WIFD+D
Sbjct  65   ANNLSPWKTIPPECAAYVEDYMTGRAYSYDLQRVSRAAGAFAKSVELAEDGKDVWIFDVD  124

Query  555  DTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISE  376
            +TLLS + Y  +       F + K      ++   P++ +SL+LY+ +  LGFK+F ++ 
Sbjct  125  ETLLSNLPYYAQHGYGLEIFNHTK-FDKWVEEGLAPAIHSSLELYRDVTSLGFKVFFLTG  183

Query  375  RKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGD  196
            R +   N T  NL KVG+ +WDKLILR   D  K + ++KSEKR E+++EGY + GN GD
Sbjct  184  RSERHGNITADNLIKVGFQHWDKLILRSPEDHPKQATMYKSEKRDEMIKEGYRIVGNSGD  243

Query  195  QWSDLLGYATAVRSFKFPNLM  133
            QWSDLLG + A RSFK PN M
Sbjct  244  QWSDLLGSSPANRSFKLPNPM  264



>ref|XP_006358226.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=263

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 130/213 (61%), Gaps = 5/213 (2%)
 Frame = -2

Query  759  HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVT  586
            H  C SW+ AVE NN  PW    + C D+ + Y+T   Y  +   V+S A  +A S+ + 
Sbjct  48   HLECTSWRFAVEANNLSPWKIIPQECTDYVRQYITGGAYKMEIDRVSSEAGAFAESMKLG  107

Query  585  H--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTI  412
               +D WIFD+D+TLLS + Y  +    S  F + +      +    P++ +SL+LY+ +
Sbjct  108  EDGKDVWIFDVDETLLSNLPYYSQHGYGSEVFDSVE-FDKWVEKGVAPAIGSSLKLYQDV  166

Query  411  QKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVV  232
             +LGFK+FL++ R +     TV+NL   G+ +WDKLILR + D  KS+ ++KSEKR E+V
Sbjct  167  MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRNEMV  226

Query  231  EEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EEG  + GN GDQWSDLLG + ++RSFK PN M
Sbjct  227  EEGLRIAGNSGDQWSDLLGSSASIRSFKLPNPM  259



>ref|XP_009800382.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=257

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+ AVE NN  PW    + C D+ + Y+    Y  D   V+S A  YA S+ +    
Sbjct  45   CTSWRFAVEANNLSPWKTIPKECADYVRQYINGGAYKLDIDRVSSEAGAYAESMKLGADG  104

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D WIFD+D+TLLS + Y  +       F + K      +    P++ +SL+LY+ + +L
Sbjct  105  KDVWIFDVDETLLSNLPYYSQHGYGLEVFDSVK-FDEWVEKGVAPAIGSSLKLYQDVMRL  163

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK+FL++ R +     TV+NL   G+ +WDKLILR + D  KS+ ++KSEKR E+VEEG
Sbjct  164  GFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEMVEEG  223

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + + GN GDQWSDLLG +T++RSFK PN M
Sbjct  224  FRIVGNSGDQWSDLLGSSTSIRSFKLPNPM  253



>ref|XP_010915367.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=255

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 133/224 (59%), Gaps = 5/224 (2%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASY  619
            + E P+    D  YC+SW+L+ E NNAG W      C  F   YM   R+LSDS  VA+ 
Sbjct  29   VSEGPSSGDGDDLYCDSWRLSAETNNAGYWKTIPAGCLQFVAEYMNGDRFLSDSAVVAAE  88

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            +  +A +V V    +D WIFD+D+TLLS + Y       S  F N        +    P+
Sbjct  89   SLAFAQAVQVVGDGKDIWIFDVDETLLSNLPYYVVNGYGSEDF-NETAFDEWVNLAKAPA  147

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
            LPASL+LY+ +  LGF++  ++ R ++Q N TV+NL   GY++W++LILR+  D  K + 
Sbjct  148  LPASLRLYEELLGLGFQVVFLTGRVEAQRNATVENLSFAGYHSWNRLILREASDIGKKAA  207

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSE+R E+  +GY + GN GDQWSDLLG   A+RSFK PN M
Sbjct  208  AYKSERRAELEAQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPM  251



>gb|KHG01291.1| Acid phosphatase 1 [Gossypium arboreum]
Length=266

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 133/235 (57%), Gaps = 13/235 (6%)
 Frame = -2

Query  801  PEPIIELPAGV--------GEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYR  652
            P P+I  P  +         E + +C SW+ +VE NN  PW    E C  + K YMT   
Sbjct  29   PRPLIIQPEDIETLFEKFDDELNLHCTSWRFSVEANNLSPWKTIPEECLGYVKEYMTGRG  88

Query  651  YLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNs  478
            Y  D   V+S A  YA ++ ++   +D WIFDID+TLLS + Y  E       F   +  
Sbjct  89   YKLDLERVSSEAGVYAKNLELSGDGKDVWIFDIDETLLSNLPYYIEHGYGLEIFDPIE-F  147

Query  477  slddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLIL  298
                     P++  SL+LY+ I  LGFK+FL++ R +   + T++NL K G+  WDKLIL
Sbjct  148  DKWVQKGMAPAIEPSLKLYEKILDLGFKVFLLTGRNEKHRSITIENLTKAGFQRWDKLIL  207

Query  297  RDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            RD+    K ++VFKSEKR E+VEEGY + GN GDQWSDLLG   + RSFK PN M
Sbjct  208  RDSEQHGKLAVVFKSEKRSEMVEEGYRIVGNSGDQWSDLLGADPSRRSFKLPNPM  262



>ref|XP_010433681.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ A E NN  PW      C D+ K Y+    Y+ D   V+  A+ YA S   N  
Sbjct  54   HCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEAKIYASSFESNGD  113

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLLS + Y  E       F + K      +    P++  SL+LY+ +Q 
Sbjct  114  GKDVWIFDIDETLLSNLPYYLEHGCGLEVFNHSK-FDKWVEKGIAPAIAPSLKLYQMVQD  172

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +G+K+ L++ R+++    TV+NL   G++NWDKLILR   D+ K++ ++KSEKR E+V E
Sbjct  173  MGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIYKSEKRDEMVNE  232

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDLLG+A + RSFK PN M
Sbjct  233  GYRIRGNSGDQWSDLLGFAMSERSFKLPNPM  263



>ref|XP_010693738.1| PREDICTED: acid phosphatase 1 [Beta vulgaris subsp. vulgaris]
Length=263

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVT--H  583
            C SW+  VE NN  PW    + C D+ K+YM    Y  D   V+  +  +A SV++    
Sbjct  51   CTSWRFGVEANNLNPWKTIPQECGDYVKNYMMGKGYQLDLERVSYESSVFAKSVHLGDDS  110

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
             D W+FD+D+TLLS + Y  +       F + +      D    P++  SL+LY+ +  L
Sbjct  111  NDVWVFDVDETLLSNLPYYVQHGYGLEVFDSVE-FDKWVDKGMAPAIEPSLRLYEEVLSL  169

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFKIFL++ R + + + T +NL   G+ NWDKLILRDT D  K +++FKSEKRIE+V+EG
Sbjct  170  GFKIFLLTGRSEKRRDVTAQNLMNAGFKNWDKLILRDTEDHGKLAMIFKSEKRIEMVKEG  229

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + + GN GDQWSDLLG A + RSFK PN M
Sbjct  230  FRILGNSGDQWSDLLGSAMSTRSFKLPNPM  259



>ref|XP_009362705.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=266

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 134/236 (57%), Gaps = 14/236 (6%)
 Frame = -2

Query  801  PEPIIELPAGVGEDHW---------YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDY  655
            P P+I     + E H+         +C+SW+ +VE NN  PW    E C ++ K Y+T  
Sbjct  28   PRPLILEYPDIAESHFSDLENELRLHCDSWRFSVEANNVNPWKTIPEDCAEYVKDYLTGR  87

Query  654  RYLSDSMAVASYAREYA--VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
             Y  D   V+  A  YA  V +N   +D WIFDIDDTLLS + Y  +       F   + 
Sbjct  88   AYEFDLERVSKEAGVYAKRVELNGDGKDVWIFDIDDTLLSNLPYYADHGYGLEVFDTVE-  146

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
             +   +    P++ +SL+LY+ +  LGFK+FL++ R + +   TV+NL   G+  W KLI
Sbjct  147  FNKWVEKAMAPAIKSSLKLYEEVLSLGFKVFLLTGRTEGKRKVTVENLNNAGFREWHKLI  206

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LR   D +K ++++KSEKR E+  EGY L GN GDQWSDLLG + A+RSFK PN M
Sbjct  207  LRSADDHEKLAIIYKSEKRSEMEREGYRLLGNSGDQWSDLLGTSVALRSFKLPNPM  262



>ref|XP_004964489.1| PREDICTED: acid phosphatase 1-like isoform X2 [Setaria italica]
Length=367

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 137/233 (59%), Gaps = 18/233 (8%)
 Frame = -2

Query  801  PEPII------ELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P++      ++PA V      C SW+LA E NN  PW      C    + Y+    Y 
Sbjct  139  PRPLVFEPAVDDVPADV-----RCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYR  193

Query  645  SDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssl  472
            SD   +A  +  YA +  +    RDAW+FDID+TLLS + Y  E  ++     + +    
Sbjct  194  SDLDLIARESTTYARAAPLRGDGRDAWVFDIDETLLSNLPYYAEHGLE---LFDHQKFDR  250

Query  471  ddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRD  292
              +  +  ++P+SL+LY  +++LGFK FL++ R +  L+ T +NL K G+++WDKLILR+
Sbjct  251  WVERGEALAIPSSLKLYNEVRELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLILRE  310

Query  291  TCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             CD  K++ V+KSEKR  + EEGY + GN GDQWSDLLG++ + RSFK PN M
Sbjct  311  ACDRKKTATVYKSEKRKAMEEEGYRILGNSGDQWSDLLGWSMSARSFKLPNPM  363



>ref|XP_004964488.1| PREDICTED: acid phosphatase 1-like isoform X1 [Setaria italica]
Length=369

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 137/235 (58%), Gaps = 20/235 (9%)
 Frame = -2

Query  801  PEPII------ELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P++      ++PA V      C SW+LA E NN  PW      C    + Y+    Y 
Sbjct  139  PRPLVFEPAVDDVPADV-----RCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYR  193

Query  645  SDSMAVA----SYAREYAVSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNs  478
            SD   +A    +YAR  A  +    RDAW+FDID+TLLS + Y  E       F + K  
Sbjct  194  SDLDLIARESTTYAR--AAPLRGDGRDAWVFDIDETLLSNLPYYAEHGYGLELFDHQK-F  250

Query  477  slddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLIL  298
                +  +  ++P+SL+LY  +++LGFK FL++ R +  L+ T +NL K G+++WDKLIL
Sbjct  251  DRWVERGEALAIPSSLKLYNEVRELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLIL  310

Query  297  RDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            R+ CD  K++ V+KSEKR  + EEGY + GN GDQWSDLLG++ + RSFK PN M
Sbjct  311  REACDRKKTATVYKSEKRKAMEEEGYRILGNSGDQWSDLLGWSMSARSFKLPNPM  365



>ref|XP_010258799.1| PREDICTED: acid phosphatase 1 [Nelumbo nucifera]
Length=282

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 126/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+ A E NN  PW      C  + K Y+T   YL D   V+  A  YA SV +    
Sbjct  70   CTSWRFAAETNNLNPWKTIPSECAGYVKDYVTGRGYLVDLERVSKEAIAYARSVQLVGDG  129

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAWIFDID+TLLS + Y  +       F + +      +    P + +SL+LY+ + +L
Sbjct  130  KDAWIFDIDETLLSNLPYYADHGYGLEVF-DGREFDKWVEKAMAPVIESSLKLYEEVLEL  188

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK+FL++ R +   + T++NL   G+ NWDKLILR+  D  KS+ ++KSE+R E+V EG
Sbjct  189  GFKVFLLTGRSERHRSVTIENLRDAGFQNWDKLILRNLGDNGKSATLYKSERRSEMVNEG  248

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG +T+ RSFK PN M
Sbjct  249  YRILGNSGDQWSDLLGSSTSNRSFKLPNPM  278



>ref|XP_010062554.1| PREDICTED: acid phosphatase 1 [Eucalyptus grandis]
Length=365

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 133/233 (57%), Gaps = 11/233 (5%)
 Frame = -2

Query  801  PEP-IIELPAGVGE-----DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P IIE P    E         C+SW+ AVE NN  PW    + C D+ + YM    Y 
Sbjct  130  PRPLIIEYPTTAKELDEEQVRLQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYG  189

Query  645  SDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssl  472
             D   V+  A  YA SV ++   +D WIFDID+TLLS + Y  E       F   +    
Sbjct  190  FDIDRVSKEAAVYAGSVELSGDGKDVWIFDIDETLLSNLPYYAEHGFGLEVFDPVE-FDK  248

Query  471  ddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRD  292
              D  +   +  SL+LY+ +  LGFK+FL++ R + Q + T++NL   G+ NWDKLI+R 
Sbjct  249  WVDKAEALGIQPSLKLYELVLGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRA  308

Query  291  TCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + D  K ++V+KSEKR E+V EGY + GN GDQWSDLLG + ++RSFK PN M
Sbjct  309  SEDHSKLAVVYKSEKRDEMVREGYRILGNSGDQWSDLLGSSMSIRSFKLPNPM  361



>gb|KDP22459.1| hypothetical protein JCGZ_26290 [Jatropha curcas]
Length=268

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 134/238 (56%), Gaps = 16/238 (7%)
 Frame = -2

Query  801  PEPII-ELPAGVGEDHWY----------CESWKLAVENNNAGPWD--QETCEDFAKSYMT  661
            P P+I E P  + E + +          C SW+ AVE NN  PW    + C ++ ++YM 
Sbjct  28   PRPLILEYPENIIESNQFKELENELQLQCTSWRFAVEANNLNPWKTIPQDCAEYVRNYMM  87

Query  660  DYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNC  487
               Y  D   V++ A  YA SV +    +DAW+FD+D+TLLS + Y          F   
Sbjct  88   GRGYQVDLERVSNEAGVYAKSVQLNEDGKDAWVFDVDETLLSNLPYYTGHGYGLEIFDPL  147

Query  486  KNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDK  307
            +      +    P++  SL+LYK I  LGFK+FL++ R + Q + T +NL   G+ NWDK
Sbjct  148  E-FDKWVEKAMAPAIEPSLKLYKEILGLGFKVFLLTGRNEKQRSVTEENLINAGFQNWDK  206

Query  306  LILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LILR + D  K +  +KSEKR E+V EGY +QGN GDQWSDLLG + + RSFK PN M
Sbjct  207  LILRASDDHGKLATTYKSEKRNEMVNEGYRIQGNSGDQWSDLLGSSMSTRSFKLPNPM  264



>ref|XP_006412858.1| hypothetical protein EUTSA_v10025999mg [Eutrema salsugineum]
 gb|ESQ54311.1| hypothetical protein EUTSA_v10025999mg [Eutrema salsugineum]
Length=263

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/260 (38%), Positives = 146/260 (56%), Gaps = 12/260 (5%)
 Frame = -2

Query  879  MAFMQCLVMC--IFLISGGtttaaaTSRPEPIIELPAGVGEDHW-----YCESWKLAVEN  721
            MAF + + +   IF++       A +SR    I+LP  V E        YCESW+L+VE 
Sbjct  1    MAFSRSISVSFFIFILFAVLINPAISSRVSSFIKLPVTVHESRSSSVASYCESWRLSVET  60

Query  720  NNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDD  553
            NNAG W      C    ++Y    ++  D   VA+YA  +A ++ +    +DAW+FDID+
Sbjct  61   NNAGSWKVVPSKCVSSLETYYNRGQFDKDYNVVANYALAFAKTIKIGGDGKDAWVFDIDE  120

Query  552  TLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISER  373
            TLLS + Y       S  + N K  +        P   ASL+L+  ++KLGF I L++ R
Sbjct  121  TLLSNLEYYKANGYGSVPY-NSKTFNEWVVQGTAPGFDASLKLFNGLKKLGFTIILLTGR  179

Query  372  KQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQ  193
             ++Q + T KNL   GY+ W+ L+LR   D+ K++  +KSE+R  +V++G+ L GN GDQ
Sbjct  180  DEAQRSITEKNLLDAGYSGWEHLLLRGDEDQGKAAAQYKSEQRSRMVKKGFKLHGNTGDQ  239

Query  192  WSDLLGYATAVRSFKFPNLM  133
            WSDL G+A A RSFK PN M
Sbjct  240  WSDLQGFAVADRSFKVPNPM  259



>ref|XP_009138920.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=264

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 136/234 (58%), Gaps = 12/234 (5%)
 Frame = -2

Query  801  PEPII----ELPAGVGEDHWY--CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P+I    EL + V +D+    C SW+ A E NN  PW      C  + K Y+    Y+
Sbjct  28   PRPLIFETQELKSAVDDDNVNVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYV  87

Query  645  SDSMAVASYAREYAVSVNVTH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNss  475
             D   V+  A  YA S   +    +D WIFDID+TLLS + Y  E       F + K   
Sbjct  88   VDLERVSEEANVYASSFGFSGDDGKDTWIFDIDETLLSNLPYYLEHGCGLEVFDHTK-FD  146

Query  474  lddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILR  295
               +    P++  SL+LY+ ++ LG+K+ L++ R+++    T++NL   G+NNWD+LILR
Sbjct  147  KWVEKGAAPAIAPSLKLYEKVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILR  206

Query  294  DTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
               D+ K++ +FKSEKR E+V+EGY ++GN GDQWSDLLG A + RSFK PN M
Sbjct  207  SLDDDHKTATIFKSEKRDEMVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPM  260



>emb|CDY34346.1| BnaA01g14490D [Brassica napus]
Length=265

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 136/234 (58%), Gaps = 12/234 (5%)
 Frame = -2

Query  801  PEPII----ELPAGVGEDHWY--CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P+I    EL + V +D+    C SW+ A E NN  PW      C  + K Y+    Y+
Sbjct  29   PRPLIFDTHELKSAVDDDNVNVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYV  88

Query  645  SDSMAVASYAREYAVSVNVTH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNss  475
             D   V+  A  YA S   +    +D WIFDID+TLLS + Y  E       F + K   
Sbjct  89   VDLERVSEEANVYASSFGFSGDDGKDTWIFDIDETLLSNLPYYLEHGCGLEVFDHTK-FD  147

Query  474  lddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILR  295
               +    P++  SL+LY+ ++ LG+K+ L++ R+++    T++NL   G+NNWD+LILR
Sbjct  148  KWVEKGAAPAIAPSLKLYEKVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILR  207

Query  294  DTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
               D+ K++ +FKSEKR E+V+EGY ++GN GDQWSDLLG A + RSFK PN M
Sbjct  208  SLDDDHKTATIFKSEKRDEMVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPM  261



>ref|XP_004143740.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN50316.1| hypothetical protein Csa_5G167080 [Cucumis sativus]
Length=266

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/263 (37%), Positives = 145/263 (55%), Gaps = 15/263 (6%)
 Frame = -2

Query  879  MAFMQCL-VMCIFLISGGtttaaaTSRPEPII-ELPAGV--------GEDHWYCESWKLA  730
            M F++   ++C+  ++       +   P P+I E P GV        GE    C+SW+  
Sbjct  1    MGFLRSFSLLCLISVALAHEAFDSHLLPRPLILEFPEGVVNQVKELDGEIKLRCDSWRFN  60

Query  729  VENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFD  562
            VE NN  PW +  E+C ++ K Y+T   Y  +    ++ A+ +A +V +    +D W+FD
Sbjct  61   VEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLVGDGKDVWVFD  120

Query  561  IDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLI  382
            ID+TLLS + Y  +    S  FK         +    P L  SL+ YK +  LGFK+ L+
Sbjct  121  IDETLLSNLPYYTDHGYGSENFK-PDEFDNWVEKATAPPLQPSLEFYKELLDLGFKLVLL  179

Query  381  SERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNC  202
            + R + Q   T +NL   G+ +WD+LILR   D+ KS++++KSEKR E+  EG  + GN 
Sbjct  180  TGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEMENEGLRIIGNS  239

Query  201  GDQWSDLLGYATAVRSFKFPNLM  133
            GDQWSDLLG + +VRSFK PN M
Sbjct  240  GDQWSDLLGTSVSVRSFKLPNPM  262



>ref|XP_009588519.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=258

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+ AVE NN  PW    E C D+ + Y+    Y  D   V+S A  YA S+ +    
Sbjct  46   CTSWRFAVETNNLSPWKTIPEECADYVRQYINGGAYKLDIDRVSSEAGTYAESMKLGGDG  105

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FD+D+TLLS + Y  +       F + K      +    P++ +SL+LY+ + +L
Sbjct  106  KDVWVFDVDETLLSNLPYYSQHGYGLEVFDSVK-FDEWVEKGVAPAIGSSLKLYQDVMRL  164

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK+FL++ R +     TV+NL   G+ +WDKLILR + D  KS+ ++KSEKR E+V+EG
Sbjct  165  GFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATMYKSEKRDEMVKEG  224

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + + GN GDQWSDLLG + ++RSFK PN M
Sbjct  225  FRIVGNSGDQWSDLLGSSASIRSFKLPNPM  254



>emb|CDY03376.1| BnaC01g17060D [Brassica napus]
Length=264

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 136/234 (58%), Gaps = 12/234 (5%)
 Frame = -2

Query  801  PEPII----ELPAGVGEDHWY--CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYL  646
            P P+I    EL + + +D+    C SW+ A E NN  PW      C  + K Y+    Y+
Sbjct  28   PRPLIFETHELKSAIDDDNVNVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYV  87

Query  645  SDSMAVASYAREYAVSVNVTH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNss  475
             D   V+  A  YA S   +    +D WIFDID+TLLS + Y  E       F + K   
Sbjct  88   VDLERVSEEANVYASSFGFSGDDGKDTWIFDIDETLLSNLPYYLEHGCGLEVFDHTK-FD  146

Query  474  lddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILR  295
               +    P++  SL+LY+ ++ LG+K+ L++ R+++    T++NL   G+NNWD+LILR
Sbjct  147  KWVEKGAAPAIAPSLKLYEKVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILR  206

Query  294  DTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
               D+ K++ +FKSEKR E+V+EGY ++GN GDQWSDLLG A + RSFK PN M
Sbjct  207  SLDDDHKTATIFKSEKRDEMVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPM  260



>ref|XP_006284361.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
 gb|EOA17259.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
Length=260

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 137/230 (60%), Gaps = 8/230 (3%)
 Frame = -2

Query  801  PEPII---ELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDS  637
            P P+I   +L     + + +C SW+ A E NN  PW      C D+ K Y+    Y+ D 
Sbjct  28   PRPLIFKTQLKTIDDDVNLHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGKGYVFDV  87

Query  636  MAVASYAREYAVSV--NVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddd  463
              V+  A+ YA +   N   +D WIFDID+TLLS + Y  E       F + K      +
Sbjct  88   ERVSEEAKVYASTFESNGDGKDVWIFDIDETLLSNLPYYLEHGCGLEVFDHSK-FDKWVE  146

Query  462  dfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD  283
                P++  SL+LY+ ++++G+K+ L++ R+++    TV+NL   G++NWDKLILR + D
Sbjct  147  RGIAPAIAPSLKLYQMVKEMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSSDD  206

Query  282  EDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + K++  +KSEKR E+V+EGY ++GN GDQWSDLLG A + RSFK PN M
Sbjct  207  DHKTATTYKSEKRDEMVKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPM  256



>ref|XP_010536549.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=258

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 149/254 (59%), Gaps = 14/254 (6%)
 Frame = -2

Query  858  VMCIFLISGGtttaaaTSRPEPIIELPAGV--------GEDHWYCESWKLAVENNNAGPW  703
            ++ IFL+S    + A + +P   + LPA +         E + +C SW+ A E NN  PW
Sbjct  3    ILGIFLLSP-LFSLAFSEQPFNSLLLPAIIETRINELDDETNLHCTSWRFAAETNNLAPW  61

Query  702  D--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRV  535
                  C D+ K YM +  Y+ D   V+  A  YA SV ++   +D W+FDID+TLLS +
Sbjct  62   KAVPAECADYVKDYMVERAYVIDLEKVSDEAEVYASSVELSGDGKDIWVFDIDETLLSNL  121

Query  534  SYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLN  355
             Y  E    +  F + +      +    P++ ASL+LY+ ++ LG+K+FL++ R +S   
Sbjct  122  PYYIEHGYGAEVFDHLE-FDKWVEKGRAPAIEASLKLYQKVRDLGYKVFLLTGRSESHRL  180

Query  354  NTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLG  175
             TV+NL   G+ NWDKLILR + D+ K++  +KSEKR  +V++GY ++GN GDQWSDLLG
Sbjct  181  VTVENLINAGFQNWDKLILRSSEDKWKTATEYKSEKREGMVDDGYKIRGNSGDQWSDLLG  240

Query  174  YATAVRSFKFPNLM  133
             + + RSFK PN M
Sbjct  241  SSMSERSFKLPNPM  254



>ref|XP_008376378.1| PREDICTED: acid phosphatase 1 [Malus domestica]
Length=266

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/266 (38%), Positives = 147/266 (55%), Gaps = 21/266 (8%)
 Frame = -2

Query  879  MAFMQ-CLVMCIFLISGGtttaaaTSRPEPII------------ELPAGVGEDHWYCESW  739
            M F++ CL+  +  ++    T  +   P P+I            EL   +G    +C SW
Sbjct  1    MKFLKICLLFSLLSVAFSHGTFDSHLLPRPLILEYQENTETQFKELEDELG---LHCASW  57

Query  738  KLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVTHRDAW  571
            + +VE NN  PW+   E C ++ K Y+T   Y  D   V+  A  YA SV  N   +D W
Sbjct  58   RFSVEANNVNPWETIPEECAEYVKDYLTGRAYGFDLERVSKEAGVYAKSVELNGDGKDVW  117

Query  570  IFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKI  391
            IFDIDDTLLS + Y  +       F N +      +    P++ +SL+LY+ +  LGFK+
Sbjct  118  IFDIDDTLLSNLPYYTDHGYGLEVFDNVE-FDKWVEKAMAPAIKSSLKLYEEVLSLGFKV  176

Query  390  FLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQ  211
            FL++ R + +   TV+NL   G+ +W KLILR   D +K + ++KSEKR E+ +EGY + 
Sbjct  177  FLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRSEMEKEGYRIL  236

Query  210  GNCGDQWSDLLGYATAVRSFKFPNLM  133
            GN GDQWSDLLG + ++RSFK PN M
Sbjct  237  GNSGDQWSDLLGTSVSLRSFKLPNPM  262



>ref|XP_006285610.1| hypothetical protein CARUB_v10007060mg [Capsella rubella]
 gb|EOA18508.1| hypothetical protein CARUB_v10007060mg [Capsella rubella]
Length=215

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 132/211 (63%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            + E W+LAVE +NAG W+     C  + K+Y+   ++  D   +ASYA  YA ++++   
Sbjct  2    WGEGWRLAVETDNAGKWEVVPRQCVRYIKNYIDGGQFDKDYDVLASYAIAYAKTIDLAGY  61

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS ++Y       S  + N    +       +P   ASL+LYK +++
Sbjct  62   GKDAWVFDIDETLLSNLAYYKAHGYGSEPYDNTL-FNEWVVTGKVPGFDASLRLYKALKE  120

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF I L++ R +SQ + T +NL   GY+ W++L+LR   D+ K++  +KSE+R +V++E
Sbjct  121  LGFTIILLTGRDESQRSITEQNLIHAGYSGWNRLLLRGHEDQGKAAAQYKSEQRSKVIKE  180

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDL G+A A RSFK PN M
Sbjct  181  GYTIHGNTGDQWSDLQGFAVATRSFKVPNPM  211



>ref|NP_194245.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB36757.1| acid phosphatase-like protein [Arabidopsis thaliana]
 emb|CAB79424.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAL67073.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14241.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85017.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=260

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ A E NN  PW      C D+ K Y+    Y+ D   V+  A+ YA S   N  
Sbjct  47   HCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGEGYVVDVERVSEEAKVYASSFESNGD  106

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLLS + Y  E       F + K   +  +    P++  SL+LY+ +  
Sbjct  107  GKDIWIFDIDETLLSNLPYYMEHGCGLEVFDHSK-FDMWVEKGIAPAIAPSLKLYQKVIH  165

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG+K+ L++ R+++    TV+NL   G++NWDKLILR   D +K++ ++KSEKR E+V+E
Sbjct  166  LGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEMVKE  225

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDLLG A + RSFK PN M
Sbjct  226  GYRIRGNSGDQWSDLLGSAMSERSFKLPNPM  256



>ref|XP_010532228.1| PREDICTED: acid phosphatase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532229.1| PREDICTED: acid phosphatase 1-like isoform X2 [Tarenaya hassleriana]
Length=266

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 147/260 (57%), Gaps = 14/260 (5%)
 Frame = -2

Query  873  FMQCLVMCIFLISGGtttaaaTSRPEPII-ELPAGV--------GEDHWYCESWKLAVEN  721
            F   L+  +F ++    + ++   P P+I E PA +         E +  C SW+ A E 
Sbjct  4    FGISLLFPLFSLAFSDDSFSSYLLPRPLILEYPANIETRIKELDDETNLRCTSWRFAAET  63

Query  720  NNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDD  553
            NN  PW      C D+ K Y+    Y+ D   V+  A  YA SV+++   +D W+FDID+
Sbjct  64   NNLAPWKTVPAECADYVKDYVMGRAYVIDLERVSDEAGFYASSVDLSGDGKDIWVFDIDE  123

Query  552  TLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISER  373
            TLLS + Y  E       F + +      +    P++  SL+LY+ +  LG+K+FL++ R
Sbjct  124  TLLSNLPYYIEHGYGMEVFDHLE-FDKWVEKGVAPAIAPSLKLYQKVIDLGYKVFLLTGR  182

Query  372  KQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQ  193
             +S    TV+NL   G+ NWDKLILR + ++ K++  +KSEKR E+V+EGY ++GN GDQ
Sbjct  183  SESHRLVTVENLINAGFQNWDKLILRSSEEKGKTATEYKSEKREEMVKEGYRIRGNSGDQ  242

Query  192  WSDLLGYATAVRSFKFPNLM  133
            WSDLLG + + RSFK PN M
Sbjct  243  WSDLLGSSMSQRSFKLPNPM  262



>gb|KFK26738.1| acid phosphatase [Arabis alpina]
Length=264

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 133/229 (58%), Gaps = 7/229 (3%)
 Frame = -2

Query  801  PEPIIELPAGVGED--HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSM  634
            P  I+  P    ED  + +C SW+ A E NN  PW    E C D+ K Y+    Y++D  
Sbjct  33   PSEIVTRPKKSDEDVINLHCTSWRFAAETNNLSPWKTIPEECADYVKDYVLGKGYVTDLE  92

Query  633  AVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldddd  460
             V+  A  +A SV      +D WIFDID+TLLS + Y  +       F + +      + 
Sbjct  93   RVSEEASMFASSVEFAGDGKDIWIFDIDETLLSNLPYYIDHGFGLEVFHHSE-FDKWVER  151

Query  459  fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDE  280
               P++  SL+LY+ +  LG+K+FL++ RK+S    TV+NL   G+ NWDKLILR   ++
Sbjct  152  GVAPAIAPSLKLYQRVVDLGYKVFLLTGRKESHRLITVENLINAGFQNWDKLILRSPDEQ  211

Query  279  DKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             K + ++KSEKR E+V+EGY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  212  HKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPM  260



>ref|XP_004158153.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
Length=264

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 140/263 (53%), Gaps = 17/263 (6%)
 Frame = -2

Query  879  MAFMQCL-VMCIFLISGGtttaaaTSRPEPII-ELPAGV--------GEDHWYCESWKLA  730
            M F++   ++C+  ++       +   P P+I E P GV        GE    C+SW+  
Sbjct  1    MGFLRSFSLLCLISVALAHEAFDSHLLPRPLILEFPEGVVNQVKELDGEIKLRCDSWRFN  60

Query  729  VENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFD  562
            VE NN  PW +  E+C ++ K Y+T   Y  +    ++ A+ +A +V +    +D W+FD
Sbjct  61   VEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLVGDGKDVWVFD  120

Query  561  IDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLI  382
            ID+TLLS + Y  +      G     N         L       + YK +  LGFK+ L+
Sbjct  121  IDETLLSNLPYYTDHGYGGLGPDEFDNWVEKATAPPLQPSL---EFYKELLDLGFKLVLL  177

Query  381  SERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNC  202
            + R + Q   T +NL   G+ +WD+LILR   D+ KS++++KSEKR E+  EG  + GN 
Sbjct  178  TGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEMENEGLRIIGNS  237

Query  201  GDQWSDLLGYATAVRSFKFPNLM  133
            GDQWSDLLG + +VRSFK PN M
Sbjct  238  GDQWSDLLGTSVSVRSFKLPNPM  260



>ref|XP_009602496.1| PREDICTED: acid phosphatase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=255

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 149/256 (58%), Gaps = 16/256 (6%)
 Frame = -2

Query  879  MAFMQCLVMCIFL----ISGGtttaaaTSRPEPI----IELPAGVGEDH---WYCESWKL  733
            MA+ Q L++ +F+    +S   + +     PE +    I     + +D+    YCESW+ 
Sbjct  1    MAYAQNLMLALFISFTFVSTSFSQSILGITPEILQLLTINRHRKIPKDNNNALYCESWRF  60

Query  732  AVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIF  565
             VE N+AG W    E C  F + YM   RY SD  AVA  +  +A +V V++  +DAW+F
Sbjct  61   TVETNDAGFWALIPERCASFVQDYMNGDRYSSDCGAVADLSLAFANTVKVSNDGKDAWVF  120

Query  564  DIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFL  385
            DID+TLLS + Y       S  F          ++ + P++PASL+LYK +Q+ GFKIFL
Sbjct  121  DIDETLLSNLPYYVTHGFGSEIFDEIA-FDKWVNEAEAPAIPASLKLYKELQQRGFKIFL  179

Query  384  ISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGN  205
            ++ R + Q N T KNL   GY+NW+KLILR   D+ K +  +KSEKR E+ +EGY + G+
Sbjct  180  LTGRSEFQRNYTEKNLVYAGYSNWEKLILRGPSDKSKLATQYKSEKRKELEDEGYRIHGS  239

Query  204  CGDQWSDLLGYATAVR  157
             GDQWSDL G+A A R
Sbjct  240  SGDQWSDLNGFAVAKR  255



>ref|XP_008367296.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=266

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 132/236 (56%), Gaps = 14/236 (6%)
 Frame = -2

Query  801  PEPIIELPAGVGEDHW---------YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDY  655
            P P+I     + E H+         +C+SW+ +VE NN   W    E C  + K Y+T  
Sbjct  28   PRPLILEYPDIAETHFNDLENELRLHCDSWRFSVEANNVNXWKTIPEECAGYVKDYLTGR  87

Query  654  RYLSDSMAVASYAREYAVSV--NVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
             Y  D   V+  A  YA SV  N   +D WIFDIDDTLLS + Y  +       F   + 
Sbjct  88   AYAXDLERVSKEAGVYAKSVELNGDGKDVWIFDIDDTLLSNLPYYADHGYGLEVFDTVE-  146

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
                 +    P++ +SL+LY+ +  LGFK+FL++ R + +   TV+NL   G+  W KLI
Sbjct  147  FDKWVEKAMAPAIKSSLKLYEEVLSLGFKVFLLTGRTEGKRKVTVENLNNAGFXEWHKLI  206

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LR   D +K ++++KSEKR E+ +EGY L GN GDQWSDLLG + A+RSFK PN M
Sbjct  207  LRSADDHEKLAIIYKSEKRSEMEKEGYRLLGNSGDQWSDLLGTSLALRSFKLPNPM  262



>ref|XP_004235180.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=263

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 130/213 (61%), Gaps = 5/213 (2%)
 Frame = -2

Query  759  HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVT  586
            H  C SW+ AVE NN  PW    + C D+ + Y+T   Y  +   V++ A  +A S+ + 
Sbjct  48   HLECTSWRFAVEANNLSPWKIIPQECADYVRQYITGGAYKMEIDRVSTEAGAFAESMKLG  107

Query  585  H--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTI  412
               +D WIFD+D+TLLS + Y  +       F + +      +  + P++ +SL+LY+ +
Sbjct  108  EDGKDVWIFDVDETLLSNLPYYSQHGYGLEVFDSVE-FDKWVEKGEAPAIGSSLKLYQDV  166

Query  411  QKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVV  232
             +LGFK+FL++ R +     TV+NL   G+ +WDKLILR + D  KS+ ++KSEKR E+V
Sbjct  167  MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRNEMV  226

Query  231  EEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            E+G  + GN GDQWSDLLG + ++RSFK PN M
Sbjct  227  EDGLRIAGNSGDQWSDLLGSSASIRSFKLPNPM  259



>ref|XP_010438316.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            CESW+LA E NNAG W      C +  K+Y+T  ++ +D   VA Y   YA  V +    
Sbjct  47   CESWRLASETNNAGSWKVVPSRCVNSVKNYITGGQFDNDYNIVARYVIAYAKRVKLGGDG  106

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAW+FDID+TLLS + Y       S  + + K  +        P+  ASL+LYK +++L
Sbjct  107  KDAWVFDIDETLLSNLEYYKAHGYGSEPYDDTK-FNEWAVQGKAPAFDASLKLYKALKRL  165

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GF I L++ R +SQ + T KNL   GY  W++ +LR   D+ K++  +KSE+R +VV+EG
Sbjct  166  GFTIILLTGRDESQRSITAKNLRDAGYFGWNRFLLRGKNDQGKTATQYKSEQRSKVVKEG  225

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + G+ GDQWSDL G+A A RSFK PN M
Sbjct  226  YKIHGSTGDQWSDLQGFAVAARSFKVPNPM  255



>ref|XP_002510996.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF51598.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=272

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+ AVE NN  PW    + C  + + Y+    Y  D   V++ A  YA SV ++   
Sbjct  60   CTSWRFAVEANNLNPWKTIPQECAGYVRDYVMGRGYQVDLERVSNEAGVYAKSVQLSEDG  119

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAW+FD+D+TLLS + Y  +       F   K      ++   P++ +SL+LYK ++ L
Sbjct  120  KDAWVFDVDETLLSNLPYYADHGYGLEVFDPMK-FDKWVEEATAPAIESSLKLYKEVRGL  178

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK+FL++ R + Q   T +NL K G+ +WDKLILR + D  K + ++KSEKR E+V EG
Sbjct  179  GFKVFLLTGRSEYQRGVTEENLIKAGFQSWDKLILRASGDHGKLASIYKSEKRSEMVSEG  238

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG + + RSFK PN M
Sbjct  239  YRILGNSGDQWSDLLGISMSTRSFKLPNPM  268



>ref|XP_009602493.1| PREDICTED: acid phosphatase 1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602494.1| PREDICTED: acid phosphatase 1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602495.1| PREDICTED: acid phosphatase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=275

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 150/257 (58%), Gaps = 16/257 (6%)
 Frame = -2

Query  879  MAFMQCLVMCIFL----ISGGtttaaaTSRPEPI----IELPAGVGEDH---WYCESWKL  733
            MA+ Q L++ +F+    +S   + +     PE +    I     + +D+    YCESW+ 
Sbjct  1    MAYAQNLMLALFISFTFVSTSFSQSILGITPEILQLLTINRHRKIPKDNNNALYCESWRF  60

Query  732  AVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIF  565
             VE N+AG W    E C  F + YM   RY SD  AVA  +  +A +V V++  +DAW+F
Sbjct  61   TVETNDAGFWALIPERCASFVQDYMNGDRYSSDCGAVADLSLAFANTVKVSNDGKDAWVF  120

Query  564  DIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFL  385
            DID+TLLS + Y       S  F          ++ + P++PASL+LYK +Q+ GFKIFL
Sbjct  121  DIDETLLSNLPYYVTHGFGSEIFDEIA-FDKWVNEAEAPAIPASLKLYKELQQRGFKIFL  179

Query  384  ISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGN  205
            ++ R + Q N T KNL   GY+NW+KLILR   D+ K +  +KSEKR E+ +EGY + G+
Sbjct  180  LTGRSEFQRNYTEKNLVYAGYSNWEKLILRGPSDKSKLATQYKSEKRKELEDEGYRIHGS  239

Query  204  CGDQWSDLLGYATAVRS  154
             GDQWSDL G+A A R+
Sbjct  240  SGDQWSDLNGFAVAKRN  256



>gb|KFK39517.1| hypothetical protein AALP_AA3G254300 [Arabis alpina]
Length=267

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 134/237 (57%), Gaps = 13/237 (5%)
 Frame = -2

Query  807  SRPEPIIELPAGVGEDHW--------YCESWKLAVENNNAGPWD--QETCEDFAKSYMTD  658
            SR  P IELP+ + +           YCESW+LAVE NNAG W      C      Y   
Sbjct  28   SRVTPFIELPSSIADLESQSDLSVGSYCESWRLAVETNNAGSWKVVPTKCVSSVAIYYDK  87

Query  657  YRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCK  484
             ++  D   VA+YA  +A ++ +    +DAW+FDID+TLLS ++Y       S  + N  
Sbjct  88   GQFARDYNVVANYALAFARTIKLGGDGKDAWVFDIDETLLSNLAYYSAHGYGSEPY-NSI  146

Query  483  NsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKL  304
              +    +       AS++L+  ++KLGFKI L++ R + Q + T  NL   GY+ W++L
Sbjct  147  AFNEWVVEGTALGFRASVRLFNALKKLGFKIILLTGRDEGQRSITESNLRDAGYSGWERL  206

Query  303  ILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +LR   D+ K+++ +KSE+R  +V+ G+ L GN GDQWSDL G+A A RSFK PN +
Sbjct  207  LLRGHKDQGKAAVQYKSEQRESMVKLGFKLHGNTGDQWSDLEGFAVATRSFKVPNPL  263



>gb|EYU20188.1| hypothetical protein MIMGU_mgv1a011800mg [Erythranthe guttata]
Length=270

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 130/215 (60%), Gaps = 5/215 (2%)
 Frame = -2

Query  765  EDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVN  592
            ED   C SW++A E NN  PW    E C D+ K Y+    Y  D + V+  A  +A +VN
Sbjct  53   EDELQCTSWRVAGEANNLNPWRTIPEECIDYVKEYIKGKGYEFDLVRVSKIAGAFATTVN  112

Query  591  VTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYK  418
            +++  RDAWIFDID+TLLS + Y          F + K      +  + P++ +SL LY+
Sbjct  113  LSNDGRDAWIFDIDETLLSNLPYYAAHGYGLEIFDSAK-FDKWVETGNAPAIESSLNLYR  171

Query  417  TIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIE  238
             + +LGFK  L++ R +   + TV+NL K G+ +W+KLILR T D  K++  +KSEKR E
Sbjct  172  EVLRLGFKAILLTGRSERHRSITVENLSKAGFCDWEKLILRSTEDHGKTAKEYKSEKRNE  231

Query  237  VVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +VEEGY + GN GDQWSDLLG + + RSFK  N M
Sbjct  232  LVEEGYRILGNSGDQWSDLLGSSVSERSFKLSNPM  266



>ref|XP_009372837.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ +VE NN  PW    E C ++ K Y+T   Y  D   V+  A  YA SV  N  
Sbjct  53   HCASWRFSVEANNVNPWKTIPEECAEYVKDYLTGRAYGFDLERVSKEAGLYAKSVELNGD  112

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDIDDTLLS + Y  +       F N +      +    P++ +SL+LY+ +  
Sbjct  113  GKDVWIFDIDDTLLSNLPYYADHGYGLEVFDNVE-FDKWVEKAMAPAVKSSLKLYEEVLS  171

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGFK+FL++ R + +   TV+NL   G+ +W KLILR   D +K + ++KSEKR E+ +E
Sbjct  172  LGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRGEMEKE  231

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG + ++RSFK PN M
Sbjct  232  GYRILGNSGDQWSDLLGTSVSLRSFKLPNPM  262



>ref|XP_008798586.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=255

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 132/220 (60%), Gaps = 6/220 (3%)
 Frame = -2

Query  780  PAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREY  607
            P G G+D  YC+SW+L+ E NNAG W      C  F   YM   R+ SDS  VA+ +  +
Sbjct  34   PCGDGDD-LYCDSWRLSEETNNAGYWKTIPARCLQFVAEYMNGDRFASDSAVVAAESLAF  92

Query  606  AVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpas  433
            A +V V    +D WIFD+D+TLLS + Y       S  F N        +    P+LPAS
Sbjct  93   AQTVQVVGDGKDVWIFDVDETLLSNLPYYAVNGYGSEDF-NETTFDEWVNLAKAPALPAS  151

Query  432  LQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKS  253
            L+LY+ +  LGF++ L++ R ++Q N T +NL   GY++W++LILR+  D  K ++ +KS
Sbjct  152  LRLYEELLGLGFQVVLLTGRVEAQRNVTAENLSFAGYHSWNRLILREDSDIGKKAVRYKS  211

Query  252  EKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +R E+  +GY + GN GDQWSDLLG   A+RSFK PN M
Sbjct  212  GRRAELEAQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPM  251



>ref|XP_004307784.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=267

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 134/237 (57%), Gaps = 15/237 (6%)
 Frame = -2

Query  801  PEP-IIELPAGVGEDHW---------YCESWKLAVENNNAGPWD--QETCEDFAKSYMTD  658
            P P IIE P    E ++          C SW+ AVE NN  PW    E C ++ K Y+T 
Sbjct  28   PRPLIIEYPDHHAEPNFKELDEEVKLRCTSWRFAVEANNVNPWKTIPEECVEYVKDYVTG  87

Query  657  YRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCK  484
              Y  D   V++ A  Y  SV +    +D WIFD+DDTLLS V Y  +    S  F   +
Sbjct  88   RGYSVDLERVSNEAGIYVKSVVLGGDGKDVWIFDVDDTLLSNVPYYADHGYGSEVFDQVE  147

Query  483  NsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKL  304
                  D    P++ +SL+LY+ +  LGFK+FL++ R + +   T +NL  VG+ +W KL
Sbjct  148  -FDKWVDKGMSPAIKSSLKLYEEVLGLGFKVFLLTGRSEGKRGVTAENLKNVGFQDWHKL  206

Query  303  ILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            ILR   D  KS+ ++KSEKR E+ +EGY + GN GDQWSDLLG + ++RSFK PN M
Sbjct  207  ILRAADDHGKSATIYKSEKRSEMEKEGYRILGNSGDQWSDLLGSSMSIRSFKLPNPM  263



>ref|XP_002867623.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43882.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ A E NN  PW      C D+   Y+    Y+ D   V+  A+ YA S   N  
Sbjct  47   HCTSWRFAAETNNLAPWKTIPAECADYVYHYLMGEGYVVDVERVSEEAKLYASSFQSNAD  106

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDID+TLLS + Y  E       F + K      +    P++  S +LY+ +  
Sbjct  107  GKDIWIFDIDETLLSNLPYYMEHGCGLEVFDHSK-FDKWVEKGIAPAIAPSFKLYQKVVD  165

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG+K+ L++ R+++    TV+NL   G++NWDKLILR   D +K++ ++KSEKR E+V+E
Sbjct  166  LGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEMVKE  225

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDLLG A + RSFK PN M
Sbjct  226  GYRIRGNSGDQWSDLLGSAMSERSFKLPNPM  256



>ref|XP_003557220.2| PREDICTED: acid phosphatase 1-like [Brachypodium distachyon]
Length=270

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 147/263 (56%), Gaps = 17/263 (6%)
 Frame = -2

Query  876  AFMQCLVMCIFL-ISGGtttaaaTSRPEPIIELPAGVGED--------HWYCESWKLAVE  724
            + +  ++M + L ++G    AA   RP  +I+LP+   E            C SW++AVE
Sbjct  6    SLLALVLMGVMLAVAGAEEHAAELPRPL-VIQLPSSTTEKTAADEAEAEARCASWRVAVE  64

Query  723  NNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVA----SYAREYAVSVNVTHRDAWIFD  562
             NN  PW      C    + Y+T   Y SD   VA    +YAR  A S +    DAW+FD
Sbjct  65   ANNVLPWSAVPAECAAHVRRYVTGPAYRSDLELVAREASAYARSLAASASDRAADAWVFD  124

Query  561  IDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLI  382
            +D+TLLS + Y  +       F + +      +  + P++P+SL+LYK ++ LGFK FL+
Sbjct  125  VDETLLSNLPYYADHGYGLELFDH-REFDRWVEKGEAPAIPSSLKLYKEVRDLGFKTFLL  183

Query  381  SERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNC  202
            + R +     TV NL K G+++WD+LILR   D  K++  +KSEKR E+  EGY + GN 
Sbjct  184  TGRSEGHQGVTVDNLKKQGFHDWDRLILRAAADRTKTATAYKSEKRKEMEAEGYKILGNS  243

Query  201  GDQWSDLLGYATAVRSFKFPNLM  133
            GDQWSDLLGY+ + RSFK PN M
Sbjct  244  GDQWSDLLGYSMSARSFKLPNPM  266



>ref|XP_008437018.1| PREDICTED: acid phosphatase 1 [Cucumis melo]
Length=266

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/263 (37%), Positives = 142/263 (54%), Gaps = 15/263 (6%)
 Frame = -2

Query  879  MAFMQCL-VMCIFLISGGtttaaaTSRPEPII-ELPAGV--------GEDHWYCESWKLA  730
            M F++   + C+  ++       +   P P+I E P GV         E    C+SW+  
Sbjct  1    MGFLRSFSLFCLISVAFAHEAFDSHLLPRPLILEFPEGVVNQVKELDEEIKLRCDSWRFN  60

Query  729  VENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFD  562
            VE NN  PW    + C ++ K Y+T   Y  +    ++ A  +A +V +    +D WIFD
Sbjct  61   VEANNLNPWKTIPKNCSEYVKQYVTGRAYQLELEIASNEAEIFAKTVKLVGDGKDVWIFD  120

Query  561  IDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLI  382
            ID+TLLS + Y  +    S  FK         +    P L  SL+LYK +  LGFK+ L+
Sbjct  121  IDETLLSNLPYYTDHGYGSESFK-PDEFDNWVEKATAPPLQPSLELYKELLDLGFKLVLL  179

Query  381  SERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNC  202
            + R + Q  +T +NL   G+ +WD+L+LR   D+ KS++++KSEKR E+  EG  + GN 
Sbjct  180  TGRSEKQRESTTRNLINAGFYDWDRLVLRRDDDQGKSAILYKSEKRSEMENEGLRIIGNS  239

Query  201  GDQWSDLLGYATAVRSFKFPNLM  133
            GDQWSDLLG + +VRSFK PN M
Sbjct  240  GDQWSDLLGTSVSVRSFKLPNPM  262



>ref|XP_009797620.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=263

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 138/255 (54%), Gaps = 19/255 (7%)
 Frame = -2

Query  855  MCIFLISGGtttaaaTSRPEP-IIELPAGVGEDHWY---------CESWKLAVENNNAGP  706
            + +F +  G     +   P P IIE P    E H +         C SW+ AVE NN GP
Sbjct  10   LVLFTLVTGHENLNSHMFPRPLIIEYP----EPHHHQLKDEVQLQCTSWRFAVETNNLGP  65

Query  705  WD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVS--VNVTHRDAWIFDIDDTLLSR  538
            W    E C ++ + Y+    Y  D   V+  A  YA S  +    +D W+FD+D+TLLS 
Sbjct  66   WKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLGADGKDVWVFDVDETLLSN  125

Query  537  VSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQL  358
            + Y  +       F + +      +    P++ +SL+LY+ +  LGFK+FL++ R +   
Sbjct  126  LPYYSDHGHGLEVFDSVE-FEKWVEKGMAPAIGSSLKLYQDVLSLGFKVFLLTGRGERHR  184

Query  357  NNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLL  178
              TV+NL   G+ +W KLILR + D  K++  FKSE+R E+VEEG+ + GN GDQWSDLL
Sbjct  185  GITVENLMNAGFRDWHKLILRGSDDHGKTATTFKSERRNEMVEEGFRILGNSGDQWSDLL  244

Query  177  GYATAVRSFKFPNLM  133
            G + + RSFK PN M
Sbjct  245  GSSASNRSFKLPNPM  259



>ref|NP_001240054.1| uncharacterized protein LOC100802126 precursor [Glycine max]
 gb|ACU19722.1| unknown [Glycine max]
Length=271

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 135/231 (58%), Gaps = 14/231 (6%)
 Frame = -2

Query  801  PEPII----ELPAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSD  640
            P P+I    E  AG+      C +W++A E NN G W    E C ++ K YMT   Y  D
Sbjct  43   PRPLIVEYPEFEAGL-----RCGAWRVAGEANNLGAWRTIPEECTEYVKEYMTGKGYAVD  97

Query  639  SMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
               V+  A E+A SV +    +DAWIFDID+TLLS + Y          F + K  +   
Sbjct  98   LEMVSKEAEEFARSVPLGSDGKDAWIFDIDETLLSNLPYYAAHGYGLEVFDHEK-FNNWV  156

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            +    P++  SL+LY+ +  LGFK+ L++ R +   + TV NL   G+  WD+LILR++ 
Sbjct  157  EKGVAPAIEPSLKLYEDVLNLGFKVILLTGRSERHRSVTVDNLINAGFKEWDQLILRNSD  216

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D+ K ++++KSEKR E+ ++GY + GN GDQWSDLLG + +VRSFK PN M
Sbjct  217  DQGKRAVLYKSEKRSEMEKDGYRILGNSGDQWSDLLGSSVSVRSFKLPNPM  267



>ref|XP_009128910.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=261

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 144/251 (57%), Gaps = 13/251 (5%)
 Frame = -2

Query  864  CLVMCIFLISGGtttaaaTSRPEPIIELPA---GVGEDHWYCESWKLAVENNNAGPWD--  700
             LV+   LIS        +SR   +++LP     +     YC+SW+LAVE NNA  W   
Sbjct  13   ILVLFTVLIS-----PVISSRVSSLMKLPVIVESLSSVDSYCDSWRLAVETNNAVKWKVV  67

Query  699  QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYC  526
               C  + ++Y +  ++  D   VASYA  +A +V +    +DAW+FD+D+TLLS + Y 
Sbjct  68   PSKCVSYLETYYSKGQFDKDYSLVASYALAFAKTVKMGGDGKDAWVFDVDETLLSNLEYY  127

Query  525  DELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTV  346
                  +  F N K  S        P   ASL+LY+ ++KLGF I L++ R ++Q + T 
Sbjct  128  KTHIYGAEPF-NSKEFSEWVVQGTTPGYDASLKLYEDLKKLGFTIILLTGRDEAQRSVTE  186

Query  345  KNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYAT  166
            KNL   GY+ WD+L+LR   D+ K++  +KSE+R  +V++G+ L GN GDQWSDL G+A 
Sbjct  187  KNLKDAGYSGWDQLLLRGQEDQGKAATEYKSEQRSRMVKKGFKLHGNTGDQWSDLQGFAV  246

Query  165  AVRSFKFPNLM  133
            A RSFK PN +
Sbjct  247  ADRSFKVPNPL  257



>ref|XP_002436441.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
 gb|EER87808.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
Length=303

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 127/212 (60%), Gaps = 8/212 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVA----SYAREYAVSVNV  589
            C SW LA E NN  PW      C    + Y+T   Y SD   VA    +YAR  A+ +  
Sbjct  90   CASWWLAAEANNLAPWKAVPPECVPHVRDYVTGAAYRSDLELVARESAAYARA-ALPLGD  148

Query  588  THRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
              RDAW+FD+D+TLLS + Y  +    +  F + +      +  +  ++P+SL+LY  ++
Sbjct  149  DGRDAWVFDVDETLLSNLPYYADHGYGAELFDHHR-FDEWVERGEAAAIPSSLKLYNEVR  207

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
            +LGFK FL++ R +     TV+NL K G+++W+KLILR   D  K++ V+KSEKR E+ E
Sbjct  208  ELGFKTFLLTGRSEGHRGVTVENLNKQGFHDWEKLILRAAGDRKKTATVYKSEKRKEMEE  267

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGY + GN GDQWSDLLG + + RSFK PN M
Sbjct  268  EGYRILGNSGDQWSDLLGSSMSARSFKLPNPM  299



>gb|KDO45271.1| hypothetical protein CISIN_1g023192mg [Citrus sinensis]
Length=286

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 122/210 (58%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C +W+ AVE NN  PW      C ++ + YM    Y  D   V++ A  YA SV +    
Sbjct  74   CTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELRGDG  133

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAWIFDID+TLLS + Y  E       F N        +    P++ ASL+LY+ +  L
Sbjct  134  KDAWIFDIDETLLSNLPYYQEHGYGLEIF-NPVEFDKWVEKAMSPAIEASLKLYEEVLGL  192

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFKIFL++ R + Q + TV NL   G   WDKLILR + D  K ++++KSEKR E+V+EG
Sbjct  193  GFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMVQEG  252

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     RSFK PN M
Sbjct  253  YRILGNSGDQWSDLLGSPMPSRSFKLPNPM  282



>ref|XP_006413336.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
 gb|ESQ54789.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
Length=258

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 94/255 (37%), Positives = 147/255 (58%), Gaps = 10/255 (4%)
 Frame = -2

Query  870  MQCLV--MCIFLISGGtttaaaTSR--PEPII-ELPAGVGEDHWYCESWKLAVENNNAGP  706
            M+ LV  + +FLI    +   ++S   P P+I E      +D+ +C SW+ A E NN  P
Sbjct  1    MRILVSFLLLFLIHLAFSEENSSSHILPRPLIFETQLKSVDDNVHCTSWRFAAETNNLAP  60

Query  705  WD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSR  538
            W      C D+ K Y+    Y++D   V+  A  YA +       +D W+FDID+TLLS 
Sbjct  61   WKTIPPECADYVKDYLMGKGYVADLERVSEEAWVYASTFEFPGDGKDTWVFDIDETLLSN  120

Query  537  VSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQL  358
            + Y  E       F + +      +    P++  SL+LY+ ++ LG+K+ L++ R++   
Sbjct  121  LPYYLEHGCGLEVFNHVE-FDKWVEKGVAPAIAPSLKLYQKVKDLGYKVILLTGRREKHK  179

Query  357  NNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLL  178
              TV+NL   G+++WD+LILR    ++K++ ++KSE+R E+V+EGY ++GN GDQWSDLL
Sbjct  180  VVTVENLLNAGFHSWDELILRSLDGQNKTATIYKSEQRDEMVKEGYRIRGNSGDQWSDLL  239

Query  177  GYATAVRSFKFPNLM  133
            G A + RSFK PN M
Sbjct  240  GSAMSERSFKLPNPM  254



>ref|XP_008794092.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=258

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 129/224 (58%), Gaps = 5/224 (2%)
 Frame = -2

Query  792  IIELPAGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASY  619
            I E  A    D  YC+SW+L+ E NNAG W      C  F   YM   RY  DS  VA+ 
Sbjct  32   ISENQASGDSDGLYCDSWRLSEETNNAGYWGTIPARCLQFVAEYMNGDRYALDSDVVAAE  91

Query  618  AREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlps  445
            +  +A +V V     D WIFD+D+TLLS + Y       S  F N        +    P+
Sbjct  92   SLAFAQTVQVAGDGNDVWIFDVDETLLSNLPYYAVNGYGSEEF-NETTFDEWLNLAKAPA  150

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
            LPASL+LY+ +  LGF+I L++ R +++ N T KNL   GY++W +LILR+  D  K+++
Sbjct  151  LPASLRLYEELLGLGFQIILLTGRVEAERNATEKNLSFAGYHSWTRLILREASDIGKTAV  210

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KSEKR ++  +G+ + GN GDQWSDLLG   A RSFK PN M
Sbjct  211  AYKSEKRAQLEAQGHRIHGNSGDQWSDLLGSPMATRSFKLPNPM  254



>emb|CDY48606.1| BnaA01g07590D [Brassica napus]
Length=263

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 144/253 (57%), Gaps = 15/253 (6%)
 Frame = -2

Query  864  CLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHW---YCESWKLAVENNNAGPWD--  700
             LV+   LIS        +SR   +++LP  V        YC+SW+LAVE NNA  W   
Sbjct  13   ILVLFTVLIS-----PVISSRVSSLMKLPVIVESRSSVDSYCDSWRLAVETNNAVKWKVA  67

Query  699  --QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVS  532
                 C  + ++Y +  ++  D   VASYA  +A +V +    +DAW+FD+D+TLLS + 
Sbjct  68   VVPSNCVSYLETYYSKGQFDKDYSLVASYALAFAKTVKMGGDGKDAWVFDVDETLLSNLE  127

Query  531  YCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNN  352
            Y       +  F N K  S        P   ASL+LY+ ++KLGF I L++ R ++Q + 
Sbjct  128  YYKTHIYGAEPF-NSKEFSEWVVQGTTPGYDASLKLYEDLKKLGFTIILLTGRDEAQRSV  186

Query  351  TVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGY  172
            T KNL   GY+ WD+L+LR   D+ K++  +KSE+R  +V++G+ L GN GDQWSDL G+
Sbjct  187  TEKNLKDAGYSGWDQLLLRGQEDQGKAATEYKSEQRSRMVKKGFKLHGNTGDQWSDLQGF  246

Query  171  ATAVRSFKFPNLM  133
            A A RSFK PN +
Sbjct  247  AVADRSFKVPNPL  259



>ref|NP_001150931.1| acid phosphatase 1 precursor [Zea mays]
 gb|ACG40987.1| acid phosphatase 1 precursor [Zea mays]
Length=299

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 133/240 (55%), Gaps = 18/240 (8%)
 Frame = -2

Query  801  PEP-IIELPAGVGEDH-----------WYCESWKLAVENNNAGPWD--QETCEDFAKSYM  664
            P P +IELP+   ED              C SW+LA E NN  PW      C    + Y+
Sbjct  57   PRPLVIELPSSRAEDEDEPGADAVPPDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYV  116

Query  663  TDYRYLSDSMAVASYAREYAV---SVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK  493
            T   Y SD   VA  +  YA     +    RDAW+FD+D+TLLS + Y  E    +  F 
Sbjct  117  TGVAYRSDLDLVARESAAYARAAAPLGADGRDAWVFDVDETLLSNLPYYAEHGYGAELFD  176

Query  492  NCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNW  313
            + K      +  +  ++P+SL+LY  +++LGFK FL++ R +     TV NL K G+++W
Sbjct  177  HHK-FDEWVERGEAAAIPSSLKLYNEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDW  235

Query  312  DKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +KL+LR   D  K++ V+KSEKR E+ +EGY + GN GDQWSDLLG +   RSFK PN M
Sbjct  236  EKLVLRAAGDRKKTATVYKSEKRKEMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPM  295



>ref|XP_009388590.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=256

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 130/216 (60%), Gaps = 9/216 (4%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV  589
            DH YC+SW+L+VE NNA  W      C +F + YM+  RY SD+  V   +  +A SV +
Sbjct  40   DHLYCDSWRLSVETNNARFWRTVPFRCSEFVQEYMSGARYASDTDIVVDESLAFARSVQI  99

Query  588  TH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFK--NCKNsslddddfdlpslpasLQLY  421
             +   DAWIFD+D+TLLS V Y    ++   G K  N  + +   D    P+L ASL+LY
Sbjct  100  ANDGNDAWIFDVDETLLSNVPY---YAINGFGTKVFNETSFNEWVDKARAPALAASLRLY  156

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
            + +   GF+I L++ R ++Q   TV+NL   GY++W  LI R+  D  K ++VFKS +R 
Sbjct  157  EELLVSGFQIILLTGRNEAQRKVTVENLLHAGYHSWRSLIFREDSDMGKPAVVFKSGRRA  216

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            E+  +G+ +  + GDQWSDLLG+  A RSFK PN M
Sbjct  217  ELEGQGFRILASSGDQWSDLLGFPMAQRSFKHPNPM  252



>gb|AFW75455.1| hypothetical protein ZEAMMB73_076415 [Zea mays]
Length=299

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 133/240 (55%), Gaps = 18/240 (8%)
 Frame = -2

Query  801  PEP-IIELPAGVGEDH-----------WYCESWKLAVENNNAGPWD--QETCEDFAKSYM  664
            P P +IELP+   ED              C SW+LA E NN  PW      C    + Y+
Sbjct  57   PRPLVIELPSSRAEDEDEPGADAVPPDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYV  116

Query  663  TDYRYLSDSMAVASYAREYAV---SVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK  493
            T   Y SD   VA  +  YA     +    RDAW+FD+D+TLLS + Y  E    +  F 
Sbjct  117  TGVAYRSDLDLVARESAAYARAAAPLGADGRDAWVFDVDETLLSNLPYYAEHGYGAELFD  176

Query  492  NCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNW  313
            + K      +  +  ++P+SL+LY  +++LGFK FL++ R +     TV NL K G+++W
Sbjct  177  HHK-FDEWVERGEAAAIPSSLKLYNEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDW  235

Query  312  DKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +KL+LR   D  K++ V+KSEKR E+ +EGY + GN GDQWSDLLG +   RSFK PN M
Sbjct  236  EKLVLRAAGDRKKTATVYKSEKRKEMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPM  295



>ref|XP_006490172.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=286

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 122/210 (58%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C +W+ AVE NN  PW      C ++ + YM    Y  D   V++ A  YA SV +    
Sbjct  74   CTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELRGDG  133

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAWIFDID+TLLS + Y  E       F   +      +    P++ ASL+LY+ +  L
Sbjct  134  KDAWIFDIDETLLSNLPYYQEHGYGLEIFDPVE-FDKWVEKAMSPAIEASLKLYEEVLGL  192

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFKIFL++ R + Q + TV NL   G   WDKLILR + D  K ++++KSEKR E+V+EG
Sbjct  193  GFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMVQEG  252

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     RSFK PN M
Sbjct  253  YRILGNSGDQWSDLLGSPMPSRSFKLPNPM  282



>ref|XP_010433111.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/259 (36%), Positives = 143/259 (55%), Gaps = 17/259 (7%)
 Frame = -2

Query  870  MQCLVMCIFLISGGtttaaaTSRPEPIIELPAG---------VGEDHWYCESWKLAVENN  718
            + C ++ +F +       A +SR    I LP+            +   +C +W+LAVE +
Sbjct  9    VSCFILALFAV---LINPAISSRASSFIRLPSSDESPDESPDESQVIAHCAAWRLAVETD  65

Query  717  NAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDT  550
            NAG W      C  + K+Y +  ++ +D   +  Y   YA ++ +    +DAW+FDID+T
Sbjct  66   NAGKWKVVPRGCVSYVKNYYSSGQFDADYDVLVVYITNYAKTIKLAGNGKDAWVFDIDET  125

Query  549  LLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERK  370
            LLS  +Y       S  + N +           P+  ASL+LY  ++KLGF I L++ R 
Sbjct  126  LLSNFAYYKAHGYGSEPYDNTQ-FYRWVVTGKAPAFDASLRLYNALKKLGFTIILLTGRD  184

Query  369  QSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQW  190
            +SQ + T KNL   GY+ W++L+LR   D+ K++  +KSE+R +VV+EGY + G+ GDQW
Sbjct  185  ESQRSITEKNLLYAGYSGWNRLLLRGPEDQGKAATQYKSEQREKVVKEGYTIHGSTGDQW  244

Query  189  SDLLGYATAVRSFKFPNLM  133
            SDL G+A A RSFK PN +
Sbjct  245  SDLQGFALAARSFKVPNPL  263



>ref|XP_008801792.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=270

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 133/241 (55%), Gaps = 19/241 (8%)
 Frame = -2

Query  801  PEPII-ELPAG-----------VGED--HWYCESWKLAVENNNAGPWD--QETCEDFAKS  670
            P P+I E P G           VG++     C SW+ A E NN  PW      C  + K 
Sbjct  27   PRPLILEYPPGDDQIFQTSTSDVGKEEVQLRCASWRFAGEANNLAPWKTVPADCGAYVKD  86

Query  669  YMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGF  496
            YMT   Y  D   VA  A  YA SV++     DAW+FD+D+TLLS + Y  +       F
Sbjct  87   YMTGKAYRFDLEMVADEAAAYARSVSLAGDCMDAWVFDVDETLLSNLPYYADHGYGLEVF  146

Query  495  KNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNN  316
             +        D    P++ +SL+LY+ I +LGFKIFL++ R + Q   T++NL KVG+ +
Sbjct  147  -SSHEFDKWVDKAMAPAIQSSLKLYEEILRLGFKIFLLTGRTEGQKIVTMENLKKVGFRD  205

Query  315  WDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNL  136
            W +LILR   D  +++ ++KSEKR E+V  GY + GN GDQWSDLLG +   RSFK PN 
Sbjct  206  WKQLILRGVNDHGRTATMYKSEKRSEIVANGYRILGNSGDQWSDLLGSSMGNRSFKLPNP  265

Query  135  M  133
            M
Sbjct  266  M  266



>ref|XP_009370433.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--NVT  586
            +C SW+ +VE NN  PW    E C ++ K Y+    Y  D   V+  A  YA SV  N  
Sbjct  53   HCASWRFSVEANNVNPWKTIPEECAEYVKDYLKGRAYGFDLERVSKEAGVYAKSVELNGD  112

Query  585  HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D WIFDIDDTLLS + Y  +       F N +      +    P++ +SL+LY+ +  
Sbjct  113  GKDVWIFDIDDTLLSNLPYYADHGYGLEVFDNVE-FDKWVEKAMAPAIKSSLKLYEEVLS  171

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGFK+FL++ R + +   TV+NL   G+ +W KLILR   D +K + ++KSEKR E+ +E
Sbjct  172  LGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDLEKMATIYKSEKRSEMEKE  231

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG + + RSFK PN M
Sbjct  232  GYRILGNSGDQWSDLLGTSVSPRSFKLPNPM  262



>gb|EYU31308.1| hypothetical protein MIMGU_mgv1a011623mg [Erythranthe guttata]
Length=276

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 150/266 (56%), Gaps = 17/266 (6%)
 Frame = -2

Query  888  MSAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIEL---------PAGVGEDHWYCESWK  736
            +SA+ F+  ++   F     ++T     RP  I+E+         PA   E    C SW+
Sbjct  10   ISALIFLLTVLPLAFPKETSSSTDHQFPRPL-ILEINESHHLKKSPAA-EESELQCTSWR  67

Query  735  LAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD---AW  571
            +A E NN  PW +  + C D+ K YM    Y  D   V++ +  YA ++N++  D   +W
Sbjct  68   VAAEANNLSPWKKIPDECADYVKEYMEYKGYEIDLQRVSNESVLYARTLNLSGSDGKFSW  127

Query  570  IFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKI  391
            +FD+D+TLLS + Y  +       F   K      +  + P+L +SL++Y+ +  LGFK+
Sbjct  128  VFDVDETLLSNLPYYVDHGYGLEIFDGEK-FDEWVEKGEAPALKSSLKVYEEVLALGFKV  186

Query  390  FLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQ  211
            FL++ R +   N T +NL + G+ NWDKLILR T D  K+++ +KS KR E+V+EGY + 
Sbjct  187  FLLTGRSERFRNITARNLVRAGFRNWDKLILRSTEDNGKTAIKYKSGKRNELVQEGYKIL  246

Query  210  GNCGDQWSDLLGYATAVRSFKFPNLM  133
            GN GDQWSDLLG + + RSFK PN M
Sbjct  247  GNSGDQWSDLLGTSISERSFKLPNPM  272



>ref|XP_009127318.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=261

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 137/236 (58%), Gaps = 12/236 (5%)
 Frame = -2

Query  807  SRPEPIIELPA------GVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYR  652
            S P  I++ P+         E + +C SW+ A E NN  PW      C D+ K Y+    
Sbjct  23   SDPSSILKYPSEETKRVDGDEVNLHCTSWRFAAETNNLAPWSTIPAECADYVKDYVLGKG  82

Query  651  YLSDSMAVASYAREYAVSVNVTH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
            Y++D   V+  A  +A +V+ +    +DAW+FDID+TLLS + Y  +       F + + 
Sbjct  83   YVADLERVSEEASVFASTVDFSAGDGKDAWVFDIDETLLSNLPYYIDHGFGLEVFDHSE-  141

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
                 +    P++  SL+LY+ +  LG+++FL++ RK+S    TV+NL   G+ NWDKLI
Sbjct  142  FDKWVERGVAPAIAPSLKLYQRVIDLGYRVFLLTGRKESHRLVTVENLINAGFQNWDKLI  201

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LR   ++ K + ++KSEKR E+V+EGY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  202  LRSPDEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPM  257



>ref|NP_199939.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 dbj|BAA97389.1| acid phosphatase [Arabidopsis thaliana]
 dbj|BAD95053.1| acid phosphatase [Arabidopsis thaliana]
 gb|ABD19661.1| At5g51260 [Arabidopsis thaliana]
 gb|AED96059.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=257

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (56%), Gaps = 14/254 (6%)
 Frame = -2

Query  855  MCIFLISGGtttaaaTSRPEPIIELPAGVGEDH---------WYCESWKLAVENNNAGPW  703
            M I+LI     +   ++  + I+E P+ +   H          +C +W+ A E NN  PW
Sbjct  1    MRIYLIFLVVVSLFTSAFSDSILEYPSEIESRHKKAAEEDVNLHCTTWRFAAEMNNLAPW  60

Query  702  DQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRV  535
                  C D+ K Y+    YL+D   V+  A  +A S+  +   +D WIFDID+TLLS +
Sbjct  61   KTIPVECADYVKDYVMGKGYLTDLERVSEEALIFARSIEFSGDGKDIWIFDIDETLLSNL  120

Query  534  SYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLN  355
             Y  +       F + +      +    P++  SL+LY+ +  LG+K+FL++ RK+S   
Sbjct  121  PYYIDHGFGLELFDHSE-FDKWVERGVAPAIAPSLKLYQRVLDLGYKVFLLTGRKESHRL  179

Query  354  NTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLG  175
             TV+NL   G+ NWDKLILR   ++ K + ++KSEKR E+V+EGY ++GN GDQWSDLLG
Sbjct  180  VTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLG  239

Query  174  YATAVRSFKFPNLM  133
             + + RSFK  N M
Sbjct  240  TSMSQRSFKLANPM  253



>ref|XP_006401998.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
 gb|ESQ43451.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
Length=258

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/236 (40%), Positives = 136/236 (58%), Gaps = 15/236 (6%)
 Frame = -2

Query  798  EP-IIELPA--------GVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYR  652
            EP I+E P+        G  E   +C SW+ A E NN  PW      C D+ K Y+    
Sbjct  20   EPSILEYPSTRHKNPDDGGDEVDLHCTSWRFAAETNNLAPWQTIPVECADYIKDYVLGKG  79

Query  651  YLSDSMAVASYAREYAVSVNVTH---RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
            Y++D   V+  A  +A SV  +    +D WIFDID+TLLS + Y  +       F + + 
Sbjct  80   YVTDLERVSEEASNFASSVVESSGDGKDIWIFDIDETLLSNLPYYIDHGFGLELFDHSE-  138

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
                 +    P++  SL+LY+ +  LG+K+FL++ RK+S    TV+NL   G+ NWDKLI
Sbjct  139  FDKWVERGVAPAIAPSLKLYQRVLDLGYKVFLLTGRKESHRLVTVENLISAGFQNWDKLI  198

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LR   ++ K++ ++KSEKR E+V+EGY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  199  LRSPDEQHKTATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPM  254



>ref|XP_009109045.1| PREDICTED: acid phosphatase 1-like [Brassica rapa]
Length=263

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 141/260 (54%), Gaps = 16/260 (6%)
 Frame = -2

Query  885  SAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGED-----HWYCESWKLAVEN  721
            S+++F   L+  + + +        +SR    I+LP  V E        YC SW+LAVE 
Sbjct  7    SSISFFTFLLFSVLINTA------ISSRVSSFIKLPTSVDESVSSSLESYCASWRLAVET  60

Query  720  NNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDD  553
            +NAG W      C    ++Y    ++  D   VA YA  YA ++ +    +DAW+FDID+
Sbjct  61   DNAGKWKVVPSQCVSSLETYYDKGQFDKDYSVVAGYAYAYAKTITLKGDGKDAWVFDIDE  120

Query  552  TLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISER  373
            TLLS + Y       S  + N    +        P   ASL+L+  ++KLGF + L++ R
Sbjct  121  TLLSNLEYYKAHGYGSEPY-NSLAFNEWVLQGTAPGFAASLKLFNRLKKLGFALILLTGR  179

Query  372  KQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQ  193
             + Q + T +NL   GY+ W+ L+LR   D+ K++  +KSE+R  +V+EGY L GN GDQ
Sbjct  180  DEVQRSVTEQNLLDAGYSGWEYLLLRGHQDQGKAAAQYKSEQRSRMVKEGYRLHGNTGDQ  239

Query  192  WSDLLGYATAVRSFKFPNLM  133
            WSDL G++ A RSFK PN M
Sbjct  240  WSDLQGFSVADRSFKVPNPM  259



>ref|XP_011028463.1| PREDICTED: acid phosphatase 1 [Populus euphratica]
Length=261

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 130/231 (56%), Gaps = 9/231 (4%)
 Frame = -2

Query  801  PEPII----ELPAGVGEDHWYCESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSD  640
            P P+I    +L     E    C SW+  VE NN  PW      C ++ K YM    Y  D
Sbjct  28   PRPLILETTQLREADNEVKLQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLD  87

Query  639  SMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssldd  466
               V++ A  YA S+ ++   +D W+FD+D+TLLS + Y  +       F   +  +   
Sbjct  88   LERVSNEAGVYAKSLKLSGDGKDIWVFDVDETLLSHLPYYADHGYGLERFDPAE-FNKWV  146

Query  465  ddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC  286
            D    P+L  SL+LYK +  LGFK+FL++ R + Q + T +NL   G+ NWDKLILR + 
Sbjct  147  DKAIAPALEPSLKLYKEVMGLGFKVFLLTGRSEMQRSVTEENLINAGFQNWDKLILRGSE  206

Query  285  DEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            D  K + +FKS+KR E+V+EGY + GN GDQWSDLLG   + RSFK PN M
Sbjct  207  DHGKLATIFKSDKRSEMVKEGYRILGNSGDQWSDLLGSFMSNRSFKLPNPM  257



>ref|XP_006421584.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
 gb|ESR34824.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
Length=286

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 122/210 (58%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C +W+ AVE NN  PW      C ++ + YM    Y  D   V++ A  +A SV +    
Sbjct  74   CTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVFAKSVELRGDG  133

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAWIFDID+TLLS + Y  E       F   +      +    P++ ASL+LY+ +  L
Sbjct  134  KDAWIFDIDETLLSNLPYYQEHGYGLEIFDPVE-FDKWVEKAMSPAIEASLKLYEEVLGL  192

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFKIFL++ R + Q + TV NL   G   WDKLILR + D  K ++++KSEKR E+V+EG
Sbjct  193  GFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMVQEG  252

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     RSFK PN M
Sbjct  253  YRILGNSGDQWSDLLGSPMPSRSFKLPNPM  282



>emb|CDY62035.1| BnaC03g77680D [Brassica napus]
Length=263

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 141/260 (54%), Gaps = 12/260 (5%)
 Frame = -2

Query  879  MAFMQC--LVMCIFLISGGtttaaaTSRPEPIIELPAGVGED-----HWYCESWKLAVEN  721
            MAF +   +    FL+       A +SR    I+LP  V E        YC SW+LAVE 
Sbjct  1    MAFPRSNSIFFFTFLLFAVLINTAISSRVSSFIKLPTSVDESVSSSLESYCASWRLAVET  60

Query  720  NNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDD  553
            +NAG W      C    ++Y    ++  D   VA YA  YA ++ +    +DAW+FDID+
Sbjct  61   DNAGKWTVVPSQCVSSLETYYDKGQFDKDYSVVAGYAYAYAKTITLKGDGKDAWVFDIDE  120

Query  552  TLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISER  373
            TLLS + Y       S  + N    +        P   ASL+L+  ++KLGF + L++ R
Sbjct  121  TLLSNLEYYKAHGYGSEPY-NSLAFNEWVLQGTAPGFAASLKLFNRLKKLGFALILLTGR  179

Query  372  KQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQ  193
             + Q + T +NL   GY+ W+ L+LR   D+ K+++ +KSE+R  +V++GY L GN GDQ
Sbjct  180  DEVQRSVTEQNLLDAGYSGWEYLLLRGREDQGKAAVQYKSEQRSRMVKKGYRLHGNTGDQ  239

Query  192  WSDLLGYATAVRSFKFPNLM  133
            WSDL G++ A RSFK PN M
Sbjct  240  WSDLQGFSVADRSFKVPNPM  259



>emb|CDY14216.1| BnaA08g13470D [Brassica napus]
Length=263

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 141/260 (54%), Gaps = 16/260 (6%)
 Frame = -2

Query  885  SAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGED-----HWYCESWKLAVEN  721
            S+++F   L+  + + +        +SR    I+LP  V E        YC SW+LAVE 
Sbjct  7    SSISFFTFLLFSVLINTA------ISSRVSSFIKLPTSVDESVSSSLESYCASWRLAVET  60

Query  720  NNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDD  553
            +NAG W      C    ++Y    ++  D   VA YA  YA ++ +    +DAW+FDID+
Sbjct  61   DNAGKWKVVPSQCVSSLETYYDKGQFDKDYSVVAGYAYAYAKTITLKGDGKDAWVFDIDE  120

Query  552  TLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISER  373
            TLLS + Y       S  + N    +        P   ASL+L+  ++KLGF + L++ R
Sbjct  121  TLLSNLEYYKAHGYGSEPY-NSLAFNEWVLQGTAPGFAASLKLFNRLKKLGFALILLTGR  179

Query  372  KQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQ  193
             + Q + T +NL   GY+ W+ L+LR   D+ K++  +KSE+R  +V++GY L GN GDQ
Sbjct  180  DEVQRSVTEQNLLDAGYSGWEYLLLRGHQDQGKAAAQYKSEQRSRMVKKGYRLHGNTGDQ  239

Query  192  WSDLLGYATAVRSFKFPNLM  133
            WSDL G++ A RSFK PN M
Sbjct  240  WSDLQGFSVADRSFKVPNPM  259



>ref|XP_003531798.1| PREDICTED: acid phosphatase 1-like [Glycine max]
 gb|KHN38151.1| Acid phosphatase 1 [Glycine soja]
Length=261

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 126/208 (61%), Gaps = 5/208 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C +W++A E NN G W    E C ++ K YM+   Y  D   V+  A EYA +V + +  
Sbjct  49   CGAWRVAGEANNLGAWAIIPEECAEYVKDYMSGKGYALDLEMVSKEAEEYARTVPLGYDG  108

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +DAW+FDID+TLLS + Y          F + K  +   +     ++  SL+LY+ +  L
Sbjct  109  KDAWVFDIDETLLSNLPYYAAHGYGLEVFDHEK-FNDWVEKGVATAIEPSLKLYEDVLNL  167

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK+ L++ R +   + TV NL   G+ +WD+LILR + D+ K ++++KSEKR E+ ++G
Sbjct  168  GFKVILLTGRNERHRSVTVDNLINAGFKDWDQLILRTSDDQGKPAVLYKSEKRGEMEKDG  227

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPN  139
            Y + GN GDQWSDLLG + +VRSFK PN
Sbjct  228  YRILGNSGDQWSDLLGSSISVRSFKLPN  255



>gb|AFW85941.1| acid phosphatase 1 [Zea mays]
Length=312

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 126/212 (59%), Gaps = 7/212 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LA E NN  PW      C    + Y+T   Y SD   VA  +  YA +       
Sbjct  98   CASWRLAAEANNLAPWAAVPPECAPHVRDYVTGSAYRSDLDLVARESAAYARAAAPAGAA  157

Query  582  --RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
              RDAW+FD+D+TLLS + Y  E    +  F + K      +  +  ++P+SL+LY  ++
Sbjct  158  DGRDAWVFDVDETLLSNLPYYAEHGYGAELFDHHK-FDEWVERGEAAAIPSSLKLYNEVR  216

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LGFK FL++ R ++    TV+NL K G+++W+KLILR   D +K++ V+KSEKR E+ +
Sbjct  217  GLGFKTFLLTGRSEAHRGVTVENLNKQGFHDWEKLILRAAGDREKTATVYKSEKRDEMEQ  276

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGY + GN GDQWSDLLG + + RSFK PN M
Sbjct  277  EGYRILGNSGDQWSDLLGSSMSARSFKLPNPM  308



>gb|ABL85037.1| acid phosphatase [Brachypodium sylvaticum]
Length=248

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 139/246 (57%), Gaps = 9/246 (4%)
 Frame = -2

Query  849  IFLISGGtttaaaTSRPEPIIELPAGV-GEDHWYCESWKLAVENNNAGPWD--QETCEDF  679
            +  ++G    AA   RP  +I+LP+    E    C SW++A E NN  PW      C   
Sbjct  1    MLAVAGAEEYAAELPRPL-VIQLPSLTEAEAEARCASWRVAGEANNLAPWSAVPAECAAH  59

Query  678  AKSYMTDYRYLSDSMAVASYAREYAVSVNVT----HRDAWIFDIDDTLLSRVSYCDELSV  511
             + Y+T   Y SD   VA  A  YA ++  +      DAW+FD+D+TLLS + Y  +   
Sbjct  60   VRRYVTGPAYRSDLELVAREASAYARALAASGADRAADAWVFDVDETLLSNLPYYADHGY  119

Query  510  KSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCK  331
                F + +      +  + P++P+SL+LYK ++ LGFK FL++ R +     TV NL K
Sbjct  120  GLELFDH-REFDRWVEKGEAPAIPSSLRLYKEVRDLGFKTFLLTGRSEGHQGVTVDNLKK  178

Query  330  VGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSF  151
             G+++WD+LILR   D  K++  +KSEKR E+  EGY + GN GDQWSDLLGY+ + RSF
Sbjct  179  QGFHDWDRLILRAAADRTKTATAYKSEKRKEMEAEGYKILGNSGDQWSDLLGYSMSARSF  238

Query  150  KFPNLM  133
            K PN M
Sbjct  239  KLPNPM  244



>ref|NP_001151681.1| acid phosphatase 1 precursor [Zea mays]
 ref|XP_008658711.1| PREDICTED: acid phosphatase 1 isoform X1 [Zea mays]
 gb|ACG43863.1| acid phosphatase 1 precursor [Zea mays]
Length=295

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 126/212 (59%), Gaps = 7/212 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LA E NN  PW      C    + Y+T   Y SD   VA  +  YA +       
Sbjct  81   CASWRLAAEANNLAPWAAVPPECAPHVRDYVTGSAYRSDLDLVARESAAYARAAAPAGAA  140

Query  582  --RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
              RDAW+FD+D+TLLS + Y  E    +  F + K      +  +  ++P+SL+LY  ++
Sbjct  141  DGRDAWVFDVDETLLSNLPYYAEHGYGAELFDHHK-FDEWVERGEAAAIPSSLKLYNEVR  199

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LGFK FL++ R ++    TV+NL K G+++W+KLILR   D +K++ V+KSEKR E+ +
Sbjct  200  GLGFKTFLLTGRSEAHRGVTVENLNKQGFHDWEKLILRAAGDREKTATVYKSEKRDEMEQ  259

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            EGY + GN GDQWSDLLG + + RSFK PN M
Sbjct  260  EGYRILGNSGDQWSDLLGSSMSARSFKLPNPM  291



>ref|XP_004511128.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=264

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 122/210 (58%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHR-  580
            C SW+ A E NN  PW    + C ++ K YMT   Y+ D   V+  A EYA SV +    
Sbjct  52   CSSWRFAGEANNLSPWKTVPKECAEYVKEYMTGKGYVYDLEIVSKEAEEYAKSVQLNEDG  111

Query  579  -DAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
             DAWIFDID+TLLS + Y          F + K           P++  SL+LY+ +  L
Sbjct  112  LDAWIFDIDETLLSNLPYYAAHGFGLQVFDHAK-FDDWVVKGVAPAIEPSLKLYEDVLNL  170

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G+K+ L++ R +     TV NL   G+ +W +LILR + D+ K ++++KSEKR E+ ++G
Sbjct  171  GYKVILLTGRSEQHRAVTVDNLINAGFRDWHQLILRGSDDKGKRAVIYKSEKRSEMEKDG  230

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDL+G + +V+SFK PN M
Sbjct  231  YRILGNSGDQWSDLIGSSLSVKSFKLPNPM  260



>ref|XP_009415369.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=264

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 129/214 (60%), Gaps = 5/214 (2%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV  589
            D  +C+SW+L+VE N+AG W    + C  F + Y+   RY SD   ++S +  +A +V +
Sbjct  48   DRLFCDSWRLSVETNDAGYWRTIPQKCLKFVEDYVNGDRYASDFDVISSESLSFAETVPI  107

Query  588  TH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKT  415
                +D WIFDID+TLLS V Y       S  F N  +     D    P+LPASL+LY+ 
Sbjct  108  AGDGKDVWIFDIDETLLSNVPYYAINGYGSEVF-NETSFDEWVDLARAPALPASLRLYEE  166

Query  414  IQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEV  235
            +  LGF++ L++ R ++Q N+T  NL   GY++W  LILR T D  K +LV+KSE+R  +
Sbjct  167  LIGLGFQMVLLTGRSENQRNSTENNLLYAGYHSWITLILRQTSDLGKPALVYKSERRAAL  226

Query  234  VEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              +G+ + G+ GDQWSDLLG   A RSFK PN M
Sbjct  227  EAQGFRIHGSSGDQWSDLLGLPLAKRSFKLPNPM  260



>ref|XP_002865848.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42107.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
Length=257

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 133/233 (57%), Gaps = 14/233 (6%)
 Frame = -2

Query  792  IIELPAGVGEDH---------WYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYL  646
            I+E P+ +   H          +C +W+ A E NN  PW      C D+ K Y+    Y+
Sbjct  22   ILEYPSEIESRHKKATDEDVNLHCTTWRFAAEMNNLAPWKTIPVECADYVKDYVMGKGYV  81

Query  645  SDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssl  472
            +D   V+  A  +A SV  +   +D WIFDID+TLLS + Y  +       F + +    
Sbjct  82   TDLERVSEEALIFASSVEFSGDGKDIWIFDIDETLLSNLPYYIDHGFGLELFDHSE-FDK  140

Query  471  ddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRD  292
              +    P++  SL+LY+ +  LG+K+FL++ RK+S    TV+NL   G+ NWDKLILR 
Sbjct  141  WVEKGVAPAIAPSLKLYQRVIDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRS  200

Query  291  TCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              ++ K + ++KSEKR E+V++GY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  201  PEEQHKMATLYKSEKRDEMVKDGYRIRGNSGDQWSDLLGTSMSQRSFKLANPM  253



>ref|XP_010442941.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 133/233 (57%), Gaps = 14/233 (6%)
 Frame = -2

Query  792  IIELPAGVGEDH---------WYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYL  646
            I+E P+ +   H          +C +W+ A E NN  PW      C D+ K+Y+    Y 
Sbjct  25   ILEYPSEIESMHKKAAEEDVDLHCTTWRFAAEMNNLAPWKSIPAECADYVKNYVMGKGYA  84

Query  645  SDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssl  472
            +D   V+  A  +A SV  +   +D W+FDID+TLLS + Y  +       F + +    
Sbjct  85   TDLERVSEEALIFANSVEFSGDGKDIWVFDIDETLLSNLPYYIDHGFGLELFDHSE-FDK  143

Query  471  ddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRD  292
              +    P++  SL+LY+ +  LG+K+FL++ RK+S    TV+NL   G+ NWDKLILR 
Sbjct  144  WVERGVAPAIAPSLKLYQRVVDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRS  203

Query  291  TCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              ++ K + ++KSEKR E+V+EGY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  204  PEEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPM  256



>ref|XP_010438315.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            +C +W+LAVE +NAG W      C  + K+Y +  ++ +D   +  Y   YA ++ +   
Sbjct  54   HCAAWRLAVETDNAGKWKVVPRGCVVYVKNYYSSGQFDADYDVLVVYITNYAKTIKLAGN  113

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS   Y       S  + N +  +         +  ASL+LY  +++
Sbjct  114  GKDAWVFDIDETLLSNFPYYKAHGYGSEPYDNTQ-FNRWVVTGKAQAFDASLRLYNVLKE  172

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF I L++ R +SQ + T KNL   GY+ W++L+LR   D+ K++  +KSE+R +V++E
Sbjct  173  LGFTIILLTGRDESQRSITEKNLLYAGYSGWNRLLLRGHEDQGKAATQYKSEQRAKVLKE  232

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + G+ GDQWSDL G+A A RSFK PN +
Sbjct  233  GYTIHGSTGDQWSDLQGFALAARSFKVPNPL  263



>ref|XP_006385121.1| acid phosphatase family protein [Populus trichocarpa]
 gb|ERP62918.1| acid phosphatase family protein [Populus trichocarpa]
Length=261

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 124/210 (59%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+  VE NN  PW      C ++ K YM    Y  D   V++ +  YA S+ ++   
Sbjct  49   CTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNESGVYAKSLKLSGDG  108

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FD+D+TLLS + Y  +       F   +  +   D    P+L  SL+LYK +  L
Sbjct  109  KDIWVFDVDETLLSHLPYYADHGYGLEIFDPAE-FNKWVDKAIAPALEPSLKLYKEVMDL  167

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK+FL++ R ++Q + T +NL   G+ NWDKLILR + D  K + +FKS+KR E+V+EG
Sbjct  168  GFKVFLLTGRSETQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEMVKEG  227

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + + GN GDQWSDLLG   + RSFK PN M
Sbjct  228  FRILGNSGDQWSDLLGSFMSNRSFKLPNPM  257



>ref|XP_010482458.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 133/233 (57%), Gaps = 14/233 (6%)
 Frame = -2

Query  792  IIELPAGVGEDH---------WYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYL  646
            I+E P+ +   H          +C +W+ A E NN  PW      C D+ K+Y+    Y 
Sbjct  25   ILEYPSEIESMHKKAAEEDVDLHCTTWRFAAEMNNLAPWKTIPVECADYVKNYVMGKGYA  84

Query  645  SDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssl  472
            +D   V+  A  +A SV  +   +D W+FDID+TLLS + Y  +       F + +    
Sbjct  85   TDLERVSEEAFIFANSVEFSGDGKDIWVFDIDETLLSNLPYYIDHGFGLELFDHSE-FDK  143

Query  471  ddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRD  292
              +    P++  SL+LY+ +  LG+K+FL++ RK+S    TV+NL   G+ NWDKLILR 
Sbjct  144  WVERGVAPAIAPSLKLYQRVVDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRS  203

Query  291  TCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              ++ K + ++KSEKR E+V+EGY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  204  PEEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPM  256



>ref|XP_008234437.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=266

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 145/263 (55%), Gaps = 15/263 (6%)
 Frame = -2

Query  879  MAFMQCLVMCIFL-ISGGtttaaaTSRPEP-IIELPAGVG--------EDHWYCESWKLA  730
            M F++  ++   L ++    T  +   P P IIE P            E   +C SW+ +
Sbjct  1    MTFLKIFLLFPLLSLAFSQETFTSHLLPRPLIIEYPENTETNFRELEEEFKLHCISWRFS  60

Query  729  VENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFD  562
            VE NN  PW    + C ++ K Y+T   Y  D   V+  A  YA ++ ++   +DAWIFD
Sbjct  61   VEANNINPWKTIPQECAEYVKDYVTGRAYGFDLERVSKEAGVYAKAIELSGDGKDAWIFD  120

Query  561  IDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLI  382
            IDDTLLS + Y  +       F + +      +    P++ +SL+LY+ +  LG K+FL+
Sbjct  121  IDDTLLSNLPYYADHGYGLEVFDHLE-FERWVEKAMAPAIKSSLKLYEEVLGLGIKVFLL  179

Query  381  SERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNC  202
            + R + +   T++NL   G+ +W KLILR   ++ K + V+KSEKR E+ +EGY + GN 
Sbjct  180  TGRGEGKRKATIENLVNAGFRDWHKLILRAPDEQGKLATVYKSEKRNEMEKEGYRILGNS  239

Query  201  GDQWSDLLGYATAVRSFKFPNLM  133
            GDQWSD+LG + ++RSFK PN M
Sbjct  240  GDQWSDILGTSMSIRSFKLPNPM  262



>ref|XP_006280976.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
 gb|EOA13874.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
Length=258

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            +C +W+ A E NN  PW      C D+ K+Y+    Y +D   V+  A  +A SV  +  
Sbjct  45   HCTTWRFAAEMNNLAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFASSVEFSGD  104

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D W+FDID+TLLS + Y  +       F + +      +    P++  SL+LY+ +  
Sbjct  105  GKDIWVFDIDETLLSNLPYYIDHGFGLELFDHSE-FDKWVERGVAPAIAPSLKLYQRVID  163

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG+K+FL++ RK+S    TV+NL   G+ NWDKLILR   ++ K + ++KSEKR E+V+E
Sbjct  164  LGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMVKE  223

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY ++GN GDQWSDLLG + + RSFK  N M
Sbjct  224  GYRIRGNSGDQWSDLLGTSMSQRSFKLANPM  254



>ref|XP_010227605.1| PREDICTED: acid phosphatase 1-like isoform X2 [Brachypodium distachyon]
Length=260

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 129/239 (54%), Gaps = 20/239 (8%)
 Frame = -2

Query  798  EPIIEL---------PAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYR  652
            EPI+ L           G   D  +C+SW+L+VE  N GPW      C  F + YM   R
Sbjct  21   EPILRLVTDIPTSVSAGGADADALFCDSWRLSVETGNTGPWRAVPARCGPFMREYMEGER  80

Query  651  YLSDSMAVASYAR----EYAVSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK--N  490
            Y SDS   A+ +     +   S     R AW+FD+D+TLLS   Y    +V   G +  N
Sbjct  81   YASDSAVAAAESLAFAAQAFASGEGGARPAWVFDVDETLLSNAPY---YAVSGWGLQEFN  137

Query  489  CKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWD  310
              +     D    P+LP+SL+LY  ++ LGF I L++ R + Q N T  NL   GY++W+
Sbjct  138  ETSFDEWVDVAKAPALPSSLKLYNELKGLGFHIILLTGRSELQRNATEDNLLFAGYHSWE  197

Query  309  KLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            KLILR   D  K+++ +KSE+R  +  EG+ + GN GDQWSDL+G   A RSFK PN M
Sbjct  198  KLILRQPSDIGKTAVQYKSERRAVMEAEGFKILGNSGDQWSDLIGLPMATRSFKLPNPM  256



>ref|XP_010447870.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=268

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 124/211 (59%), Gaps = 4/211 (2%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            +C +W+LAVE +NAG W      C  + K+Y +  ++ +D   +  Y   YA ++ +   
Sbjct  54   HCAAWRLAVETDNAGEWKVVPRGCVPYVKNYYSSGQFDADYDVLVVYITNYAKTIKLAGN  113

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS   Y        +   +    +        P+  A L+LY  +++
Sbjct  114  GKDAWVFDIDETLLSNFPYYKAHHGYGSEPYDNTQFNRWVVTGKAPAFDAGLRLYNALKE  173

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LGF I L++ R +SQ + T KNL   GY+ W++L+LR   D+ KS+  +KSE+R +VV+E
Sbjct  174  LGFTIILLTGRDESQRSITEKNLLYAGYSGWNRLLLRGHEDQGKSATQYKSEQRSKVVKE  233

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + G+ GDQWSDL G+A A RSFK PN +
Sbjct  234  GYTIHGSTGDQWSDLQGFALATRSFKVPNPL  264



>emb|CBI27978.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 113/180 (63%), Gaps = 3/180 (2%)
 Frame = -2

Query  666  MTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFK  493
            MT  RY SDS   A  +  +A +V +    +D W+FDID+TLLS + Y       S  F 
Sbjct  1    MTGDRYRSDSEFAADDSLSFAKTVQIAGDGKDVWVFDIDETLLSNLPYYAAHGFGSEAFD  60

Query  492  NCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNW  313
            +        +  + P+L ASL+LY+ +++LGFKI LI+ R + Q N T KNL   GY+NW
Sbjct  61   DS-TFDEWVNLAEAPALQASLRLYREVEQLGFKIVLITGRIEPQRNVTEKNLVYAGYSNW  119

Query  312  DKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            ++L LR   D  K++LV+KSEKR E+ +EGY + G+ GDQWSDLLG+A A RSFK PN M
Sbjct  120  ERLFLRGRADSGKTALVYKSEKRRELEDEGYRIHGSSGDQWSDLLGFAIARRSFKLPNPM  179



>ref|XP_007218818.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
 gb|EMJ20017.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
Length=266

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 131/236 (56%), Gaps = 14/236 (6%)
 Frame = -2

Query  801  PEP-IIELPAGVG--------EDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDY  655
            P P IIE P            E   +C SW+ +VE NN  PW    + C  + K Y+T  
Sbjct  28   PRPLIIEYPENTETNFRELEEEFKLHCTSWRFSVEANNINPWKTIPQECAKYVKDYVTGR  87

Query  654  RYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKN  481
             Y  D   V+  A  YA +V ++   +D WIFDIDDTLLS + Y  +       F + + 
Sbjct  88   AYGFDLERVSKEAGVYAKAVELSGDGKDVWIFDIDDTLLSNLPYYADHGYGLEVFDHLE-  146

Query  480  sslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLI  301
                 D    P++ +SL+LY+ +  LG K+FL++ R   +   T++NL   G+ +W KLI
Sbjct  147  FDRWVDKAMAPAIKSSLKLYEEVLGLGIKVFLLTGRSDGKRKATIENLINAGFRDWHKLI  206

Query  300  LRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            LR   ++ K + V+KSEKR E+ +EGY + GN GDQWSD+LG + ++RSFK PN M
Sbjct  207  LRAPDEQGKLATVYKSEKRNEMEKEGYRILGNSGDQWSDILGTSMSIRSFKLPNPM  262



>gb|ADE77538.1| unknown [Picea sitchensis]
Length=268

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 128/212 (60%), Gaps = 6/212 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYM--TDYRYLSDSMAVASYAREYAVSVNVTH  583
            CE+W+  VE N    W+     C ++ K+YM  +  +Y+ DS  VA+ +  Y  S+ ++ 
Sbjct  53   CEAWRFGVETNTLRSWNVVPPECVEYVKNYMIGSGSQYVRDSNMVANESIAYVNSLQLSG  112

Query  582  --RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
              +DAW+FD+D+TL+S + Y                +    D    P+LPAS +LY  + 
Sbjct  113  DGKDAWVFDVDETLISTLPYFAAHQFGGEVIAEDDFNVKWLDRAVAPALPASHKLYARLL  172

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
            +LGFKIFL++ R+  Q N T +NL + GY++W+ L LR+  D  KS++V+KSE+R+++ +
Sbjct  173  ELGFKIFLLTGRRHCQRNVTERNLVRAGYHSWEALFLREPEDRAKSAVVYKSERRLKIEQ  232

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             G+ ++GN GDQWSDL GY+   R+FK PN M
Sbjct  233  NGFRIRGNSGDQWSDLTGYSVGDRTFKLPNPM  264



>ref|NP_001130101.1| acid phosphatase 1 precursor [Zea mays]
 gb|ACF78228.1| unknown [Zea mays]
 gb|ACG37772.1| acid phosphatase 1 precursor [Zea mays]
 gb|AFW76506.1| acid phosphatase 1 [Zea mays]
Length=275

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 121/218 (56%), Gaps = 13/218 (6%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV-----  595
            +C+SW+L+VE  NAGPW      C  F + YM   RY SDS AVA        S      
Sbjct  56   FCDSWRLSVETANAGPWSAVPSRCGAFVRDYMEGPRYASDS-AVADADALAFASEALAAA  114

Query  594  ----NVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQ  427
                + + R AW+FD+D+TLLS   Y       S  F N  +     D    P+LP+SL 
Sbjct  115  EWGGSASARPAWVFDVDETLLSNAPYYAVNGWGSQEF-NETSFDEWVDAAKAPTLPSSLN  173

Query  426  LYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEK  247
            LY  +Q LGF + L++ R + Q N T  NL   GYN+W+KLILR   D  K+++ +KSE+
Sbjct  174  LYNQLQGLGFHVILLTGRSEFQRNATELNLLFAGYNSWEKLILRQPYDIGKNAVQYKSER  233

Query  246  RIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            R  +  EG+ + GN GDQWSDL+G   A RSFK PN M
Sbjct  234  RAAMEAEGFKILGNSGDQWSDLIGSPMATRSFKLPNPM  271



>gb|ACJ84626.1| unknown [Medicago truncatula]
Length=259

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 121/210 (58%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHR-  580
            C SW+ A E NN  PW    + C +  K YM    Y+ D       A E+A SV +    
Sbjct  47   CRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLKEDG  106

Query  579  -DAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
             DAW+FDID+TLLS + Y          F + K      +    P++ ASL+LY+ I  L
Sbjct  107  LDAWVFDIDETLLSNLPYYAAHGYGFEVFDHAK-FDDWVEKGVTPAIEASLKLYEDILNL  165

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G+K+ L++ R +S    TV NL   G+ +W +LILR + D+ K ++++KSEKR E+ +EG
Sbjct  166  GYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEMEKEG  225

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + + GN GDQWSDLLG + +VRSFK PN M
Sbjct  226  FRILGNSGDQWSDLLGSSVSVRSFKLPNPM  255



>gb|AFK42878.1| unknown [Medicago truncatula]
 gb|AET02725.2| plant acid phosphatase [Medicago truncatula]
Length=259

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 121/210 (58%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHR-  580
            C SW+ A E NN  PW    + C +  K YM    Y+ D       A E+A SV +    
Sbjct  47   CRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLKEDG  106

Query  579  -DAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
             DAW+FDID+TLLS + Y          F + K      +    P++ ASL+LY+ I  L
Sbjct  107  LDAWVFDIDETLLSNLPYYAAHGYGFEVFDHAK-FDDWVEKGVAPAIEASLKLYEDILNL  165

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G+K+ L++ R +S    TV NL   G+ +W +LILR + D+ K ++++KSEKR E+ +EG
Sbjct  166  GYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEMEKEG  225

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + + GN GDQWSDLLG + +VRSFK PN M
Sbjct  226  FRILGNSGDQWSDLLGSSVSVRSFKLPNPM  255



>ref|XP_002438575.1| hypothetical protein SORBIDRAFT_10g022110 [Sorghum bicolor]
 gb|EER89942.1| hypothetical protein SORBIDRAFT_10g022110 [Sorghum bicolor]
Length=268

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 127/223 (57%), Gaps = 16/223 (7%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPW--DQETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSV--  595
            D  +C+SW+L+VE  NAGPW      C DF + YM   RY SDS   A+ A  +A     
Sbjct  45   DALFCDSWRLSVETANAGPWLAVPARCGDFVRDYMEGPRYASDSAIAAADALAFASDALA  104

Query  594  -------NVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK--NCKNsslddddfdlpsl  442
                   + + R AW+FD+D+TLLS   Y    +V   G +  N  +     D    P+L
Sbjct  105  AAAEWGGSASARPAWVFDVDETLLSNAPY---YAVNGWGLQEFNETSFDEWVDAAKAPAL  161

Query  441  pasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV  262
            P+SL LY  +Q LGF + L++ R + Q N T  NL   GYN+W+KLILR + D  K+++ 
Sbjct  162  PSSLNLYNQLQGLGFHVILLTGRSEFQRNATESNLLFSGYNSWEKLILRQSSDIGKTAVQ  221

Query  261  FKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +KSE+R  +  EG+ + GN GDQWSDL+G   A RSFK PN M
Sbjct  222  YKSERRAAMEAEGFKILGNSGDQWSDLIGSPMATRSFKLPNPM  264



>dbj|BAJ34931.1| hypothetical protein [Vitis hybrid cultivar]
Length=237

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 123/210 (59%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W+   + CE +   YM  ++Y  DS  V   A  YA S+ +    
Sbjct  26   CPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYRQDSRVVVYEAIAYAESLKLGGDG  85

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FDID+T LS + Y  E    +  F N  + +      + P+LP SL+LY  +  L
Sbjct  86   KDVWVFDIDETTLSNLPYYAENGFGAEVF-NETSFNEWVMKGEAPALPESLKLYNKLVSL  144

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K+  ++ + + + N TV NL KVGY+ W+KLILR + D   ++LV+KS +R +V E G
Sbjct  145  GIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILRKSSD-GSTALVYKSNQRKKVEESG  203

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSD+LG  T  R+FK P+ M
Sbjct  204  YKIVGNMGDQWSDILGTNTGNRTFKLPDPM  233



>dbj|BAD53728.1| putative Acid phosphatase precursor 1 [Oryza sativa Japonica 
Group]
 dbj|BAD54156.1| putative Acid phosphatase precursor 1 [Oryza sativa Japonica 
Group]
 dbj|BAG91399.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87322.1| unnamed protein product [Oryza sativa Japonica Group]
Length=264

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 124/216 (57%), Gaps = 7/216 (3%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA----V  601
            D  YC+ W+L+VE  NAGPW      C +F ++YM   RY SDS   A+ +  +A     
Sbjct  46   DELYCDGWRLSVETGNAGPWTAIPPRCLEFVRAYMEGERYASDSAVAAADSLAFAARALA  105

Query  600  SVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLY  421
            S     R AW+FD+D+TLL+   Y       S  F N  +     D    P+LPASL+LY
Sbjct  106  SGGGGARPAWVFDVDETLLTNAPYYAVNGWGSLEF-NETSFDEWVDVAKAPALPASLKLY  164

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
              +Q LG  I L++ R + Q N T  NL   GY++W+KLILR + D  K+++ +KSE+R 
Sbjct  165  NELQGLGIHIILLTGRSEFQRNATQVNLLFAGYHSWEKLILRQSPDIGKTAVQYKSERRA  224

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +  EG+ + GN GDQWSDLLG   A RSFK PN M
Sbjct  225  ALEAEGFKILGNSGDQWSDLLGLPMATRSFKLPNPM  260



>ref|XP_003632911.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 123/210 (59%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W+   + CE +   YM  ++Y  DS  V   A  YA S+ +    
Sbjct  44   CPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYRQDSRVVVYEAIAYAESLKLGGDG  103

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FDID+T LS + Y  E    +  F N  + +      + P+LP SL+LY  +  L
Sbjct  104  KDVWVFDIDETTLSNLPYYAENGFGAEVF-NETSFNEWVMKGEAPALPESLKLYNKLVSL  162

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K+  ++ + + + N TV NL KVGY+ W+KLILR + D   ++LV+KS +R +V E G
Sbjct  163  GIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILRKSSD-GSTALVYKSNQRKKVEESG  221

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSD+LG  T  R+FK P+ M
Sbjct  222  YKIVGNMGDQWSDILGTNTGNRTFKLPDPM  251



>gb|EAZ01337.1| hypothetical protein OsI_23372 [Oryza sativa Indica Group]
Length=265

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 124/216 (57%), Gaps = 7/216 (3%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA----V  601
            D  YC+ W+L+VE  NAGPW      C +F ++YM   RY SDS   A+ +  +A     
Sbjct  47   DELYCDGWRLSVETGNAGPWTAIPPRCLEFVRAYMEGERYASDSAVAAADSLAFAARALA  106

Query  600  SVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLY  421
            S     R AW+FD+D+TLL+   Y       S  F N  +     D    P+LPASL+LY
Sbjct  107  SGGGGARPAWVFDVDETLLTNAPYYAVNGWGSLEF-NETSFDEWVDVAKAPALPASLKLY  165

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
              +Q LG  I L++ R + Q N T  NL   GY++W+KLILR + D  K+++ +KSE+R 
Sbjct  166  NELQGLGIHIILLTGRSEFQRNATQVNLLFAGYHSWEKLILRQSPDIGKTAVQYKSERRA  225

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +  EG+ + GN GDQWSDLLG   A RSFK PN M
Sbjct  226  ALEAEGFKILGNSGDQWSDLLGLPMATRSFKLPNPM  261



>gb|ABK23358.1| unknown [Picea sitchensis]
Length=275

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            CESW+  VE N    W    + C ++ K YM   +YL DS  VA+ +  YA S+N++   
Sbjct  63   CESWRFGVETNTVRFWSVVPQECVEYVKDYMDGSQYLLDSNVVANVSIAYANSLNLSGDG  122

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FD+D+TLLS +      +   A   +        D  + P+LPAS +LY  + +L
Sbjct  123  KDVWVFDVDETLLSNLPLYAAYNYGGADMDDGA-FIKWADLAEAPALPASQRLYAHLLQL  181

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFKIFL++ R   + N T KNL + GY++W+ L+LR   D + +++V+KS +R+++ ++G
Sbjct  182  GFKIFLLTGRYDYERNATEKNLVQAGYHSWEALLLRGPDDYETTAVVYKSGRRLKIEKDG  241

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + ++GN GDQWSDL GY+   R+FK PN M
Sbjct  242  FRIRGNSGDQWSDLSGYSCGDRTFKLPNPM  271



>gb|ADE76411.1| unknown [Picea sitchensis]
Length=254

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 117/211 (55%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYM-TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            CE W+L+VE+ N   WD     C  + + YM T  +Y  DS        EY  ++ +   
Sbjct  41   CEGWRLSVESGNLRDWDVVPSKCVGYVQKYMMTAGQYWEDSKVAVFTILEYVKTLKLVGD  100

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FDID+TLLS + Y  +       F + K       +   P+LP+SL LY  +  
Sbjct  101  GKDAWVFDIDETLLSNIPYYQQHEYGGKAF-DSKTFEAWVLEMKSPALPSSLLLYNRLLA  159

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GFKIFL++ R +SQ N TV NL + GY  W  LILR   ++   +  +K EKR E+V++
Sbjct  160  RGFKIFLLTGRDESQRNGTVHNLFQAGYKGWAGLILRGVNEQGSQASAYKPEKRAELVKK  219

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY L G+ GDQWSDL G   A RSFK PN M
Sbjct  220  GYRLWGSVGDQWSDLSGPYEASRSFKLPNPM  250



>dbj|BAJ97988.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 123/210 (59%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVA--SYAREYAVSVNVTH  583
            C SW+ A E NN  PW      C    ++Y+T   Y SD   VA  + A   + + +   
Sbjct  67   CASWRTAGEANNLSPWAAVPPDCVPHVRAYLTGPAYRSDLDLVAREASAYARSAAASTGD  126

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
              AW+FD+D+TLLS + Y  +       F + +      +  + P++P+SL+LY+ ++ L
Sbjct  127  AAAWVFDVDETLLSNLPYYAQHGYGLELFDH-REFDRWVETGEAPAIPSSLRLYREVRDL  185

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFK FL++ R ++    TV NL K G+++WDKLILR   D  K++  +KSEKR E+  EG
Sbjct  186  GFKTFLLTGRSEAHQGVTVDNLRKQGFHDWDKLILRAAADRTKTATDYKSEKRKEMEAEG  245

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLGY+ + RSFK PN M
Sbjct  246  YKILGNSGDQWSDLLGYSMSARSFKLPNPM  275



>ref|XP_010088387.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB34861.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=259

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 120/210 (57%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+  VE NN   W    E CE +  +YM   +Y  DS  V   A  YA S+N++   
Sbjct  47   CLSWRFGVETNNIIDWSTIPEKCELYVGNYMLGEQYRKDSEVVIKEAYLYATSLNLSKDG  106

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D WIFDID+T LS + Y          F N  + +      D P+LP +L+LYK++  L
Sbjct  107  KDVWIFDIDETSLSNLPYYARHGFGVEPF-NLTSFTEWILTEDAPALPETLKLYKSLISL  165

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            GFKI  +S R +   + T +NL  VGY  W+K++LR   D+  SSL +KS +R ++V++G
Sbjct  166  GFKIVFLSGRYEKTRSATERNLIYVGYKAWEKVLLRKDSDKSASSLEYKSAQRKQLVKDG  225

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  226  YSIVGNIGDQWSDLLGTDPGNRTFKLPDPM  255



>ref|XP_004302846.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 119/210 (57%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            C SW+L VE  N   W      CE +   YM  ++Y  DS AV   A  YA S+N+T  D
Sbjct  53   CLSWRLGVETRNIIDWTTVPAACEGYVGHYMLGHQYRKDSKAVTYEAYLYAKSLNLTEDD  112

Query  576  A--WIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
               WIFDID+T LS + Y          + N         +   P+LP SL+LYK +  L
Sbjct  113  KNLWIFDIDETSLSNLPYYVHHGFGVEVY-NSTTFDAWVLEGTAPALPESLKLYKKLSTL  171

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K+  I+ R +SQ + T  NL KVGY+ W+KL+L+D+    K+++V+KS +R ++ E+G
Sbjct  172  GVKVAFITGRGESQRSVTETNLKKVGYHTWEKLVLKDSSYSGKTAVVYKSTERKKLEEKG  231

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  232  YRIIGNIGDQWSDLLGTNVGNRTFKMPDPM  261



>ref|XP_002515949.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
 gb|EEF46369.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
Length=258

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = -2

Query  879  MAFMQCLVMCIFLISG-----GtttaaaTSRPEPIIELPAGVGEDHW---YCESWKLAVE  724
            MA  Q L + I L +      G        RP+      +G    H     C SW+L VE
Sbjct  1    MALFQLLFLAIILATSHGSEMGVPHQIHLLRPQ------SGTAGHHVPGVSCLSWRLGVE  54

Query  723  NNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDID  556
             NN   W      CE +   YM  ++Y  DS  +A  A  YA S+ ++   +D W+FDID
Sbjct  55   TNNIIGWTTVPAECEGYVGHYMLGHQYRKDSKIIADEAFLYAKSLELSGDGKDIWVFDID  114

Query  555  DTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISE  376
            +T LS + Y  E    +  + N    +        P+LP SL LYK +  LG KI  I+ 
Sbjct  115  ETTLSNLPYYAEHGFGAEPY-NSTLFNKWVVTSKAPALPESLSLYKRLLSLGIKIVFITG  173

Query  375  RKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGD  196
            R + Q   T  NL K GY+ W KL+L+ +    K+++ +KS +R ++V+ GY + GN GD
Sbjct  174  RTEDQRTVTTNNLKKAGYHTWMKLVLKTSSYSGKTAVFYKSSERGKLVKSGYRITGNIGD  233

Query  195  QWSDLLGYATAVRSFKFPNLM  133
            QWSDLLG  T  R+FK P+ M
Sbjct  234  QWSDLLGTYTGNRTFKLPDPM  254



>gb|ABK22580.1| unknown [Picea sitchensis]
Length=297

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 125/211 (59%), Gaps = 7/211 (3%)
 Frame = -2

Query  747  ESWKLAVENNNAGPWD--QETCEDFAKSYM--TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            ++W+L VE N    W      C ++ KSYM  +  +Y+ DS  VA  +  Y  SV ++  
Sbjct  84   QAWRLGVETNTLRSWTVVPPECVEYVKSYMVGSGSQYVRDSYMVAKESMAYINSVKLSGD  143

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + +         G  +        D  + P LPAS   Y  + +
Sbjct  144  GKDAWVFDVDETLLSSLPFFAGHQYGGEGMDD-DAFIKWADLAEAPPLPASRSFYAHLLE  202

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG KIFL++ R   + N T KNL + GY++W+ L+LRD  D +KS++++KSE+R+++ ++
Sbjct  203  LGIKIFLLTGRYDYERNATEKNLGRAGYHSWEALLLRDPEDYEKSAMIYKSERRLKIEQD  262

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            G+ + GN GDQWSDL GYA   R+FK PN +
Sbjct  263  GFRIVGNSGDQWSDLTGYAVGDRTFKLPNPL  293



>ref|XP_004965618.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=264

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 125/217 (58%), Gaps = 8/217 (4%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMA-----VASYAREYA  604
            D  +C+SW+L+VE  NAGPW      C  F ++YM   RY SDS       +A  +   A
Sbjct  45   DTLFCDSWRLSVETANAGPWGAIPVRCVAFVQAYMEGPRYASDSAVAAADSLAFASGALA  104

Query  603  VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQL  424
             +     + AW+FD+D+TLL+   Y       S  F N  +     D    P+LP+SL+L
Sbjct  105  AAEAGAAKPAWVFDVDETLLTNAPYYAVNGWGSQEF-NETSFDEWVDAAKAPALPSSLKL  163

Query  423  YKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKR  244
            YK +Q LGF I L++ R + Q N+T  NL   GY +W+KLILR   D  K+++++KSE+R
Sbjct  164  YKELQGLGFHIILLTGRTEFQRNSTEANLLFAGYQSWEKLILRQPSDIGKTAVLYKSERR  223

Query  243  IEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              +  EG+ + GN GDQWSDL+G   A RSFK PN M
Sbjct  224  AAMEAEGFKILGNSGDQWSDLIGPPMATRSFKLPNPM  260



>ref|XP_003563756.1| PREDICTED: acid phosphatase 1-like isoform X1 [Brachypodium distachyon]
Length=298

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 128/274 (47%), Gaps = 52/274 (19%)
 Frame = -2

Query  798  EPIIEL---------PAGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYR  652
            EPI+ L           G   D  +C+SW+L+VE  N GPW      C  F + YM   R
Sbjct  21   EPILRLVTDIPTSVSAGGADADALFCDSWRLSVETGNTGPWRAVPARCGPFMREYMEGER  80

Query  651  YLSDSMAVASYAR----EYAVSVNVTHRDAWIFDIDDTLLSRVSY-------CDELSVK-  508
            Y SDS   A+ +     +   S     R AW+FD+D+TLLS   Y         + SVK 
Sbjct  81   YASDSAVAAAESLAFAAQAFASGEGGARPAWVFDVDETLLSNAPYYAVSGWGATQASVKP  140

Query  507  -----SAGFKNCKNsslddddfdlpslpasLQ------------------------LYKT  415
                 ++ + N  +++          L   LQ                        LY  
Sbjct  141  VFSPRNSQYSNPSSATPSHSAEVSSFLAYGLQEFNETSFDEWVDVAKAPALPSSLKLYNE  200

Query  414  IQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEV  235
            ++ LGF I L++ R + Q N T  NL   GY++W+KLILR   D  K+++ +KSE+R  +
Sbjct  201  LKGLGFHIILLTGRSELQRNATEDNLLFAGYHSWEKLILRQPSDIGKTAVQYKSERRAVM  260

Query  234  VEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              EG+ + GN GDQWSDL+G   A RSFK PN M
Sbjct  261  EAEGFKILGNSGDQWSDLIGLPMATRSFKLPNPM  294



>ref|XP_008228404.1| PREDICTED: acid phosphatase 1-like [Prunus mume]
Length=265

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 121/212 (57%), Gaps = 9/212 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W      CE +   YM  ++Y  DS  V + A  YA S+N+T   
Sbjct  53   CLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLNLTKDG  112

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAG--FKNCKNsslddddfdlpslpasLQLYKTIQ  409
            ++ W+FDID+T LS + Y    +V   G    N  + +        P+LP SL+LY+ + 
Sbjct  113  KNVWVFDIDETTLSNLPYY---AVNGFGTELYNSTSFNEWVLKGIAPALPESLKLYQKLL  169

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LG K+  ++ R + Q N T  NL  VGY+ W+KLIL+ +    K+S V+KS +R ++V+
Sbjct  170  TLGVKVVFLTGRGEDQRNVTTTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERTKLVK  229

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             G+ + GN GDQWSD+LG     R+FK P+ M
Sbjct  230  SGFRIIGNAGDQWSDILGTNVGNRTFKVPDPM  261



>gb|ABK27105.1| unknown [Picea sitchensis]
Length=262

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 124/211 (59%), Gaps = 7/211 (3%)
 Frame = -2

Query  747  ESWKLAVENNNAGPWD--QETCEDFAKSYM--TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            ++W+L VE N    W      C ++ KSYM  T  +Y  DS  VA  +  Y  SV ++  
Sbjct  49   QAWRLGVETNTLRSWTVVPPECVEYVKSYMVGTGSQYGRDSYMVAKESMAYINSVKLSGD  108

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + +         G  +        D  + P LPAS   Y  + +
Sbjct  109  GKDAWVFDVDETLLSSLPFFAGHQYGGEGMDD-DAFIKWADLAEAPPLPASRSFYGHLLE  167

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG KIFL++ R   + + T KNL + GY++W+ L++RD  D +KS++++KSE+R+++ ++
Sbjct  168  LGLKIFLLTGRYDYERSATEKNLGRAGYHSWEALLMRDPEDYEKSAMLYKSERRLKIEQD  227

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            G+ + GN GDQWSDL GYA   R+FK PN +
Sbjct  228  GFRIVGNSGDQWSDLTGYAVGDRTFKLPNPL  258



>ref|XP_007215831.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17030.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=261

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 120/212 (57%), Gaps = 9/212 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W      CE +   YM  ++Y  DS  V + A  YA S+N+T   
Sbjct  49   CLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLNLTKDG  108

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAG--FKNCKNsslddddfdlpslpasLQLYKTIQ  409
            ++ W+FDID+T LS + Y    +V   G    N  +          P+LP SL+LY+ + 
Sbjct  109  KNVWVFDIDETTLSNLPYY---AVNGFGTELYNATSFDEWVLKGTAPALPESLKLYQKLL  165

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LG K+  ++ R + + N T  NL  VGY+ W+KLIL+ +    K+S V+KS +R ++V+
Sbjct  166  TLGVKVVFLTGRGEDKRNVTTTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERTKLVK  225

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             G+ + GN GDQWSD+LG     R+FK P+ M
Sbjct  226  SGFRIIGNAGDQWSDILGTNVGNRTFKLPDPM  257



>gb|ACN40193.1| unknown [Picea sitchensis]
Length=297

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 124/211 (59%), Gaps = 7/211 (3%)
 Frame = -2

Query  747  ESWKLAVENNNAGPWD--QETCEDFAKSYM--TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            ++W+L VE N    W      C ++ KSYM  T  +Y  DS  VA  +  Y  SV ++  
Sbjct  84   QAWRLGVETNTLRSWTVVPPECVEYVKSYMVGTGSQYGRDSYMVAKESMAYINSVKLSGD  143

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + +         G  +        D  + P LPAS   Y  + +
Sbjct  144  GKDAWVFDVDETLLSSLPFFAGHQYGGEGMDD-DAFIKWADLAEAPPLPASRSFYAHLLE  202

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG KIFL++ R   + + T KNL + GY++W+ L++RD  D +KS++++KSE+R+++ ++
Sbjct  203  LGLKIFLLTGRYDYERSATEKNLGRAGYHSWEALLMRDPEDYEKSAMLYKSERRLKIEQD  262

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            G+ + GN GDQWSDL GYA   R+FK PN +
Sbjct  263  GFRIVGNSGDQWSDLTGYAVGDRTFKLPNPL  293



>ref|XP_007024338.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY26960.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=259

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 118/210 (56%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+L VE NN   W    E CE++   YM  ++Y  DS  VA+ A  YA S+++    
Sbjct  47   CLSWRLGVETNNVVGWITVPEECEEYVGHYMLGHQYRKDSRVVANQALLYAQSLSLARDC  106

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FDID+T LS + Y  +       + N    +    +   P+LP +L LYK +  L
Sbjct  107  KDVWVFDIDETALSNLPYYAQHGFGVEQY-NPTLFNKWVMEGKAPALPETLNLYKKLLSL  165

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K+  ++ R + Q + T  NL K GY  W+KLIL+ +    KS++V+KS +R ++   G
Sbjct  166  GTKVVFLTGRPEYQRSVTANNLRKAGYQTWEKLILKGSSYSGKSAVVYKSSERKKLAMSG  225

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  226  YKIIGNMGDQWSDLLGTDVGNRTFKMPDPM  255



>ref|XP_010033825.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53660.1| hypothetical protein EUGRSUZ_J02927 [Eucalyptus grandis]
Length=262

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 137/257 (53%), Gaps = 14/257 (5%)
 Frame = -2

Query  879  MAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHW---YCESWKLAVENNNAG  709
            + F+   V     ++G         RP+       G G  H     C+SW+LAVE +N  
Sbjct  8    LLFLAIAVPASLTLAGDMPNKIHPLRPQ------VGSGGHHIPGVSCQSWRLAVETDNIK  61

Query  708  PWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLS  541
             WD     CE++  +YM  ++Y  D  A    A +YA  + +    +D WIFDID+T LS
Sbjct  62   DWDVVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALS  121

Query  540  RVSY-CDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
             + Y     +   A   N       + +   P++PA L LYK + KLGFKI  IS + +S
Sbjct  122  NLPYYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILYLYKRLLKLGFKIVFISGKSES  181

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
              + TV N+ KVGY+ W+KLIL+ T +   +++V+KS+KR E+ E GY + GN GDQWSD
Sbjct  182  LRSITVYNMKKVGYHTWEKLILKQTSESGTTAMVYKSKKRKELEEAGYRILGNMGDQWSD  241

Query  183  LLGYATAVRSFKFPNLM  133
            L+G     R+FK PN M
Sbjct  242  LMGSHVGNRTFKVPNPM  258



>ref|XP_010033711.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53446.1| hypothetical protein EUGRSUZ_J02693 [Eucalyptus grandis]
Length=262

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 137/257 (53%), Gaps = 14/257 (5%)
 Frame = -2

Query  879  MAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHW---YCESWKLAVENNNAG  709
            + F+   V     ++G         RP+       G G  H     C+SW+LAVE +N  
Sbjct  8    LLFLAIAVSASLTLAGDVPDKIHPLRPQ------VGSGGHHIPGVSCQSWRLAVETDNIK  61

Query  708  PWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLS  541
             WD     CE++  +YM  ++Y  D  A    A +YA  + +    +D WIFDID+T LS
Sbjct  62   DWDVVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALS  121

Query  540  RVSY-CDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
             + Y     +   A   N       + +   P++PA L LYK + KLGFKI  IS + +S
Sbjct  122  NLPYYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILYLYKRLLKLGFKIVFISGKSES  181

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
              + TV N+ KVGY+ W+KLIL+ T +   +++V+KS+KR E+ E GY + GN GDQWSD
Sbjct  182  LRSITVYNMKKVGYHTWEKLILKQTSESGTTAMVYKSKKRKELEEAGYRILGNMGDQWSD  241

Query  183  LLGYATAVRSFKFPNLM  133
            L+G     R+FK PN M
Sbjct  242  LMGSHVGNRTFKVPNPM  258



>gb|ABK21277.1| unknown [Picea sitchensis]
 gb|ABR17651.1| unknown [Picea sitchensis]
Length=254

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYM-TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            C +W+L+VE +N   W      C  + + YM T  +Y  DS         YA +V +   
Sbjct  41   CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAWIFDID+TLLS + Y  +       + N         +     LP+SL LY  +  
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHEYGGEAY-NSTTFEAWVSETKALVLPSSLLLYNVLLA  159

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GFKIFL++ R + Q N T  NL + GY  WD LILR   ++  ++ V+K EKR E+V++
Sbjct  160  RGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVKK  219

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY L G+ GDQWSDL G   A RSFK PN M
Sbjct  220  GYRLWGSVGDQWSDLSGPYEASRSFKLPNPM  250



>gb|ABK21327.1| unknown [Picea sitchensis]
 gb|ABR18337.1| unknown [Picea sitchensis]
Length=254

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 113/211 (54%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYM-TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            C +W+L+VE  N   W      C  + + YM T  +Y  DS         YA +V +   
Sbjct  41   CLAWRLSVETGNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAWIFDID+TLLS + Y  +       + N         +     LP+SL LY  +  
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHEYGGEAY-NSTTFEAWVSETKALVLPSSLLLYNVLLA  159

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GFKIFL++ R + Q N T  NL + GY  WD LILR   ++  ++ V+K EKR E+V++
Sbjct  160  RGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVKK  219

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY L G+ GDQWSDL G   A RSFK PN M
Sbjct  220  GYRLWGSVGDQWSDLSGPYEASRSFKLPNPM  250



>gb|ACN40876.1| unknown [Picea sitchensis]
Length=254

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYM-TDYRYLSDSMAVASYAREYAVSVNVTH-  583
            C +W+L+VE +N   W      C  + + YM T  +Y  DS         YA +V +   
Sbjct  41   CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTNLGYAKTVKLVGD  100

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAWIFDID+TLLS + Y  +       + N         +     LP+SL LY  +  
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHEYGGEAY-NSTTFEAWVSETKALVLPSSLLLYNVLLA  159

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
             GFKIFL++ R + Q N T  NL + GY  WD LILR   ++  ++ V+K EKR E+V++
Sbjct  160  RGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVKK  219

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY L G+ GDQWSDL G   A RSFK PN M
Sbjct  220  GYRLWGSVGDQWSDLSGPYEASRSFKLPNPM  250



>gb|KDP40846.1| hypothetical protein JCGZ_24845 [Jatropha curcas]
Length=262

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 114/210 (54%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+L VE NN   W    E CE +   YM  ++Y  DS AV   A  YA S  +    
Sbjct  50   CLSWRLGVETNNIVGWKTVPEECEGYVGHYMLGHQYRLDSKAVTDEAFVYAKSHVLAGDG  109

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FDID+T LS + Y       +  + N    +        P+LP SLQLYK +  L
Sbjct  110  KDLWVFDIDETTLSNLPYYASHGFGAEPY-NFTLFNKWVLTSKAPALPESLQLYKRLIAL  168

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G KI  I+ R + Q   T  NL K GY  W KL+L+ +    K+++ +KS +R ++V+ G
Sbjct  169  GLKIVFITGRPEDQRAATTDNLKKAGYGAWLKLVLKASSYSGKTAVFYKSSERAKLVKSG  228

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG  T  R+FK P+ M
Sbjct  229  YRIIGNIGDQWSDLLGTNTGNRTFKLPDPM  258



>ref|XP_008798588.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=262

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 116/210 (55%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            CESW++AVE NN   W     TCE +   YM    Y  DS  VA  A +YA S+++    
Sbjct  51   CESWRVAVEANNMRGWKTIPRTCEGYVGHYMLGGLYRRDSAVVAGEAAKYAESLDLRADG  110

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FD+D+T LS + Y            N  + +        P+LP SL+LYK +  L
Sbjct  111  KDVWVFDVDETTLSNLPYYARHGF-GVELYNATSFNAWVMKGKAPALPESLELYKKLLSL  169

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G KI  ++ R + Q + T  NL  VGY+ W+KL+L+   +   SS+ +KS  R ++ EEG
Sbjct  170  GIKIVFLTGRTEDQRDITAHNLKMVGYHTWEKLLLKG-LNVSGSSVAYKSGMRQKLEEEG  228

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSD+LG     R+FK P+ M
Sbjct  229  YSVVGNIGDQWSDILGQPEGGRTFKVPDPM  258



>ref|XP_007201377.1| hypothetical protein PRUPE_ppa010275mg [Prunus persica]
 gb|EMJ02576.1| hypothetical protein PRUPE_ppa010275mg [Prunus persica]
Length=256

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 122/224 (54%), Gaps = 15/224 (7%)
 Frame = -2

Query  774  GVGED-HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA  604
            GVG+    YCESW++ VE NN   +D   + C  + + YMT  +Y +DS         Y 
Sbjct  35   GVGDGLKKYCESWRINVEVNNIRGFDVVPQECVQYIQKYMTSSQYKADSEKALEEVTFYL  94

Query  603  VS---VNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlps  445
             S   +    +DAWIFD+DDTLLS + Y      K+ GF     N  +      +   P+
Sbjct  95   SSCCTLEGDGKDAWIFDVDDTLLSTIPY-----FKTHGFGGEKINATSMEARMRESKAPA  149

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
            L  +L+L+  I+  G KIFLIS R+++  +++V NL KVGY+ W  LILR   DE     
Sbjct  150  LGHTLKLFHEIKNRGLKIFLISSRRENLRSSSVDNLIKVGYHGWTGLILRGLEDEFMEVQ  209

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KS+ R  +V+EGY++ G  GDQWS   G   A R+FK PN M
Sbjct  210  KYKSKARHRLVDEGYLIWGIIGDQWSSFEGLPIAKRTFKLPNSM  253



>dbj|BAJ85799.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 125/251 (50%), Gaps = 41/251 (16%)
 Frame = -2

Query  762  DHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV  589
            D  +C+SW+L+VE  NAGPW      C    ++YM   RY SDS   A+ +  +A     
Sbjct  41   DALFCDSWRLSVETANAGPWRTVPARCGASVRAYMEGERYASDSAVAAAESLAFAAQAFA  100

Query  588  THR----DAWIFDIDDTLLSRVSYC-----DELSVKSAGFKNCKNssldddd--------  460
            +       AW+FD+D+TLLS   Y            +A + + +NS              
Sbjct  101  SGEGGAMPAWVFDVDETLLSNAPYYAVSGWGATQTSAASYLSAQNSQYPSPAIRSHGEAI  160

Query  459  ----------------------fdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTV  346
                                     P+LP+SL+LY  +Q LGF I L++ R + Q N T 
Sbjct  161  SSFLATGLQEFNETSFDAWVDVAKAPALPSSLKLYSELQGLGFHIILLTGRSELQRNTTE  220

Query  345  KNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYAT  166
            +NL   GY++W+KLILR   D  K+++ +KSE+R  +  +G+ + GN GDQWSDL+G   
Sbjct  221  ENLLFAGYHSWEKLILRQISDIGKTAVQYKSERRAAMEAQGFKILGNSGDQWSDLIGLPM  280

Query  165  AVRSFKFPNLM  133
            A RSFK PN M
Sbjct  281  ATRSFKLPNPM  291



>gb|KHN40364.1| Acid phosphatase 1 [Glycine soja]
Length=186

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 98/158 (62%), Gaps = 1/158 (1%)
 Frame = -2

Query  606  AVSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQ  427
            +V +    RDAW+FD+D+TLLS V Y   +   S  F N  +     D    P+LPA L 
Sbjct  26   SVGLAGDGRDAWVFDVDETLLSNVPYYQGVGFGSEIF-NETSFDNWVDLAAAPALPAILS  84

Query  426  LYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEK  247
            LY  +++LGFKIF ++ R + Q N T  NL   GY +W++LILR + D+ K +  +KSEK
Sbjct  85   LYNELKELGFKIFFLTGRSEFQRNATETNLLLSGYRDWERLILRGSSDQGKPATTYKSEK  144

Query  246  RIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            R E+  EGY + GN GDQWSDL GYA + RSFK PN M
Sbjct  145  RAELENEGYRIHGNSGDQWSDLWGYAVSARSFKLPNPM  182



>emb|CDY06827.1| BnaC01g09260D [Brassica napus]
Length=261

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 135/232 (58%), Gaps = 8/232 (3%)
 Frame = -2

Query  807  SRPEPIIELPAGVGEDHW---YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLS  643
            SR   +++LP  V        YCESW+LAVE NNA         C  + ++Y    ++ +
Sbjct  27   SRVSSLMKLPVIVESRSSVDSYCESWRLAVETNNAVKCKVVPSKCVSYLETYYGKGQFDT  86

Query  642  DSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNssld  469
            D   VASYA  +A +V +    +DAW+FD+D+TLLS + Y    S  +  F N K  S  
Sbjct  87   DYNVVASYALAFAKTVKMGGDCKDAWVFDVDETLLSNLEYYKAHSYGAEPF-NSKEFSEW  145

Query  468  dddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDT  289
                  P   ASL+LYK ++KLGF I L++ R ++Q + T K L   GY+ W +L+LR  
Sbjct  146  VVQGTTPGYDASLKLYKDLKKLGFAIILLTGRDEAQRSITEKILKDAGYSGWVQLLLRGQ  205

Query  288  CDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             D+ K++  +KSE+R  +V++G+ L GN GDQWSDL G+A A RSFK PN +
Sbjct  206  EDQGKAATQYKSEQRSRMVKKGFKLHGNTGDQWSDLQGFAVADRSFKVPNPL  257



>ref|XP_002439412.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
 gb|EES17842.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
Length=268

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 121/210 (58%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C+SW+ AVE +    W+     CE +  +YM   +Y SDS AV   A  YA  + ++   
Sbjct  57   CDSWRFAVETDTLRDWETVPARCEKYVGNYMLGGQYRSDSQAVVDEAVAYAEGLKLSGDG  116

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            ++ W+FD+D+T LS + Y  E    S  + N           + P+LP + +LYK +Q+L
Sbjct  117  KEVWVFDVDETTLSNLPYYAEHGFGSEPY-NSTAFGAYTKLANAPALPETQRLYKRLQEL  175

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K  +++ R++ +  +T KNL  VGY  ++KL+L+   D   +++ FKS +R ++V+ G
Sbjct  176  GIKPVILTGRREDKRESTAKNLADVGYTGYEKLLLKPQ-DARVTAVEFKSGERKKLVDAG  234

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y++ GN GDQW+DLLG     R+FK P+ M
Sbjct  235  YVIVGNIGDQWTDLLGEPEGDRTFKLPDPM  264



>gb|EPS70753.1| hypothetical protein M569_04009, partial [Genlisea aurea]
Length=215

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 122/212 (58%), Gaps = 7/212 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVT--H  583
            C SW++A E NN   W    E C ++ K YM+   Y  D   V+  A  +A S+++    
Sbjct  2    CRSWRVAGEANNLASWKTIPEACGEYVKDYMSGEGYELDLETVSREAEWFARSLDLGGDR  61

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            + AWIFD+D+TLLS + Y  +       F   +      +    P++  SL+LY+ +  L
Sbjct  62   KLAWIFDVDETLLSNLPYYQQHGYGLEVFDEAE-FDKWVEMGVAPAIEHSLKLYEVVDAL  120

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYN-NWDKLILRDTCDEDKSSLVFKSEKRIEVVE-  229
            GF+I L++ R +   + TV NL + G+  +WDKLI+R + D  KS+  +KSEKR +++E 
Sbjct  121  GFRILLLTGRSERHRDITVNNLFQAGFRPSWDKLIMRGSEDHGKSATRYKSEKRRDLMEG  180

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +GY L GN GDQWSDLL    ++RSFK PN M
Sbjct  181  DGYELAGNSGDQWSDLLDSYMSLRSFKLPNPM  212



>ref|XP_004959893.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=259

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 117/220 (53%), Gaps = 9/220 (4%)
 Frame = -2

Query  777  AGVGEDHWYCESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYA  604
             G GED  YC SW++ VE NNA  W +    C  + + YM   +Y  D  +VA     YA
Sbjct  40   GGGGEDP-YCLSWRVMVEANNAKGWRRVPAPCIGYVRGYMAWGQYYRDVGSVADQVAAYA  98

Query  603  VSVNVT--HRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasL  430
              +  T    DAW+FD+DDT LS   Y      K  G  +     +       P +PA  
Sbjct  99   AQIVPTADGLDAWVFDVDDTCLSNQPY---YQAKQFGAYDPVAFKMWASRGVCPGIPAMQ  155

Query  429  QLYKTIQKLGFKIFLISERKQSQL-NNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKS  253
             L++T++  GF++FL++ R +  L ++TV NL   G+  +D+LI+R      +SS+ FKS
Sbjct  156  WLFQTLRGRGFRVFLVTGRDEETLASSTVANLAAAGFFGYDRLIMRSASYRGQSSVAFKS  215

Query  252  EKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
              R ++V EGY L+GN GDQWSDL G     R FK PN M
Sbjct  216  AVRRQLVAEGYRLRGNMGDQWSDLQGECVGDRVFKVPNPM  255



>ref|XP_008235609.1| PREDICTED: acid phosphatase 1-like isoform X2 [Prunus mume]
Length=256

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 122/224 (54%), Gaps = 15/224 (7%)
 Frame = -2

Query  774  GVGED-HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA  604
            GVG+    YCESW++ VE NN   +D   + C  + + YMT  +Y +DS         Y 
Sbjct  35   GVGDGLKKYCESWRINVEVNNIRGFDVVPQECVQYIQKYMTSSQYKADSEKALEEVTFYL  94

Query  603  VS---VNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlps  445
             S   +    +DAWIFD+DDTLLS + Y      K+ GF     N  +      +   P+
Sbjct  95   SSCCTLEGDGKDAWIFDVDDTLLSTIPY-----FKTHGFGGEKINATSLEAWMRESKAPA  149

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSL  265
            L  +L+L+  I+  G KIFLIS R+++  +++V NL KVGY+ W  LILR   DE     
Sbjct  150  LEHTLKLFHEIKNRGLKIFLISSRRENLRSSSVDNLIKVGYHGWTGLILRGLEDEFMEVQ  209

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +KS+ R  +V+EGY++ G  GDQWS   G   A R+FK PN M
Sbjct  210  KYKSKARHRLVDEGYLIWGIIGDQWSSFEGLPIAKRTFKLPNSM  253



>ref|XP_010936027.1| PREDICTED: acid phosphatase 1 isoform X2 [Elaeis guineensis]
Length=259

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 133/259 (51%), Gaps = 11/259 (4%)
 Frame = -2

Query  888  MSAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHWYCESWKLAVENNNAG  709
            M A A +      I +++G     + T++     +  AG+   + YCESW++ VE NN  
Sbjct  1    MRAEALLLFFSFSIGIVTGDWNILSYTTKKRDHHQHHAGISLKN-YCESWRINVELNNIR  59

Query  708  PWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVS---VNVTHRDAWIFDIDDTLL  544
             +D     C  +   YMT  +Y  D    A     +  +   +    +DAWIFDIDDTLL
Sbjct  60   GFDVVPGECVGYIGKYMTSTQYKVDVQRAAEQTTLFLTNNFRLGADGKDAWIFDIDDTLL  119

Query  543  SRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
            S V Y  +     A   N  +     ++   P++   L LY  I+  G KIFLIS R++ 
Sbjct  120  STVPYFKKHQHGGAT-TNSTSMEQWMEERSAPAVEHMLDLYHEIRARGLKIFLISSRREH  178

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV--FKSEKRIEVVEEGYILQGNCGDQW  190
              + T+ NL KVGY  W  LILR  C ED    V  +K+EKR +++E+GY L G  GDQW
Sbjct  179  LRDATIDNLVKVGYLGWTDLILR--CAEDCYHAVANYKTEKRRKLIEQGYHLWGIMGDQW  236

Query  189  SDLLGYATAVRSFKFPNLM  133
              L+G+ +A R+FK PN M
Sbjct  237  CSLVGHPSANRTFKLPNPM  255



>ref|XP_011080101.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=266

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 115/215 (53%), Gaps = 15/215 (7%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVS----VN  592
            YCESW+  VE NN   ++   + C D+   YMT  +Y SD        + Y  +    + 
Sbjct  51   YCESWRFNVELNNVRGFEVVPQECTDYIAKYMTSTQYKSDCQRAVEECQLYLTTCCCALK  110

Query  591  VTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlpslpasLQL  424
               +DAWIFD+DDTL+S + Y      K  GF     N  +     +    P+L  +L+L
Sbjct  111  GDGKDAWIFDVDDTLISTLPY-----FKKHGFGGNKLNLTSLEGWMEKSKAPALEHTLRL  165

Query  423  YKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKR  244
            +  I+K GFK+F IS R++S  + TV NL K GY+ W  L+LRD  DE+K    +K+E R
Sbjct  166  FHEIKKKGFKVFFISTRRESLRDATVDNLIKEGYHGWSGLVLRDLEDENKHVKNYKAEAR  225

Query  243  IEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPN  139
              +V EGY + G  GDQWS   G   A R+FK PN
Sbjct  226  KRLVNEGYRIWGIVGDQWSSFDGTPGAKRTFKLPN  260



>ref|XP_010915365.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=262

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 114/210 (54%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW++ VE NN   W     TCE +   YM    Y  DS  V + A  YA  +N+    
Sbjct  51   CVSWRVGVEANNVRDWKTIPSTCEGYVGHYMLGDLYRQDSALVTAEAANYAEGLNLQGDG  110

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FDID+T LS + Y            N  + +      + P+LP SL LYK +  L
Sbjct  111  KDVWVFDIDETTLSNLPYYAHHGF-GVELYNATSFNAWVMKGEAPALPESLGLYKKLLSL  169

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G KI  ++ R + Q N T  NL  VGY+ W+KL+L+   +   SS+ +KS  R ++++EG
Sbjct  170  GIKIVFLTGRTEDQRNITAHNLRMVGYHTWEKLLLK-ALNVRGSSVAYKSGMRQKLIDEG  228

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSD+LG     R+FKFP+ M
Sbjct  229  YRIVGNMGDQWSDILGQPKGDRTFKFPDPM  258



>ref|XP_010033712.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53448.1| hypothetical protein EUGRSUZ_J02694 [Eucalyptus grandis]
Length=258

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 115/210 (55%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+L VE NN   W      CE +   YM  ++Y  DS  VA  A  YA S+ +    
Sbjct  46   CLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYREDSKVVAREAVLYAKSLKLAGDG  105

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FD+D+TLLS + Y  +    +  + N    +        P+LP +L+LY+ + KL
Sbjct  106  KDVWVFDVDETLLSNLPYYAKHGFGAEPY-NSTLFNQWVLTGKAPALPETLELYRELLKL  164

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K   ++ R + Q   T  NL   G++NW+ LIL+ +     +++V+KS +R +V E G
Sbjct  165  GIKPIFLTGRTEDQRKITSSNLRNAGFSNWEMLILKGSTYSGTTAVVYKSSERRKVEESG  224

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  225  YRIVGNIGDQWSDLLGIHAGNRTFKLPDPM  254



>ref|XP_010033826.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53661.1| hypothetical protein EUGRSUZ_J02928 [Eucalyptus grandis]
Length=258

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 114/210 (54%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+L VE NN   W      CE +   YM  ++Y  DS  VA  A  YA S+ +    
Sbjct  46   CLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYREDSKVVAREAVLYAKSLKLAGDG  105

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D W+FD+D+TLLS + Y  +    +  + N    +        P+LP +L+LY+ + KL
Sbjct  106  KDVWVFDVDETLLSNLPYYAKHGFGAEPY-NSTLFNQWVLTGKAPALPETLELYRELLKL  164

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K   ++ R + Q   T  NL   G+ NW+ LIL+ +     +++V+KS +R +V E G
Sbjct  165  GIKPIFLTGRTEDQRKITSSNLRNAGFRNWEMLILKGSAYSGTTAVVYKSSERRKVEESG  224

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  225  YRIVGNIGDQWSDLLGIHAGNRTFKLPDPM  254



>ref|XP_009776612.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=266

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 118/212 (56%), Gaps = 8/212 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W     +CE++   YM   +Y  D  AVA+ A EYA S+ ++   
Sbjct  53   CLSWRLAVETNNLQNWKLVPISCENYIGHYMLGKQYRHDCEAVANAAIEYAKSLKLSGDG  112

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFK-NCKNsslddddfdlpslpasLQLYKTIQK  406
            +D W+FDID+T LS + Y     V       N    +    +   P++P+ L +YKT+  
Sbjct  113  KDVWVFDIDETTLSNLPYYARSDVAFGAIPFNSTKFNAWVAEGKAPAIPSILGVYKTVLS  172

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV-FKSEKRIEVVE  229
            LG K   I+  ++S     + NL K GY+NW KL+L+   D D  + V FKS KR E+V+
Sbjct  173  LGIKPVFITGTRESFKQVRITNLKKAGYSNWAKLVLKG--DNDSGTAVEFKSSKRTELVK  230

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             GY + GN GDQWSD+LG     R+FK P+ M
Sbjct  231  AGYRIVGNIGDQWSDILGDNVGSRTFKVPDPM  262



>ref|XP_006857494.1| hypothetical protein AMTR_s00067p00205850 [Amborella trichopoda]
 gb|ERN18961.1| hypothetical protein AMTR_s00067p00205850 [Amborella trichopoda]
Length=256

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 118/214 (55%), Gaps = 10/214 (5%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVAS-----YAREYAVSV  595
            YCESW++ VE +N   ++     C ++   YMT  +Y  DS           ++E+ ++ 
Sbjct  43   YCESWRVNVEVHNLRDFEVVPHECVEYIGKYMTSTQYKVDSERALEQCTLYLSQEFGLTG  102

Query  594  NVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKT  415
            +   +DAWIFD+DDTLLS + Y  +         N  +          P+L +SL LY  
Sbjct  103  D--GKDAWIFDVDDTLLSNIPYYKKHQYGGEKL-NLTSLEGWMRGRKAPALASSLSLYNE  159

Query  414  IQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEV  235
            I+  G KIFLIS R +   + TV NL +VGY  W  LILR   D  KS+  +K+EKR ++
Sbjct  160  IKGKGIKIFLISNRGEHLRDATVDNLFEVGYTGWTGLILRGDEDCGKSAQKYKAEKRQKL  219

Query  234  VEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            VEEGY + G  GDQWS LLG+  A R+FK PN M
Sbjct  220  VEEGYRIWGIVGDQWSSLLGHPHATRTFKLPNSM  253



>gb|EMS54945.1| Acid phosphatase 1 [Triticum urartu]
Length=213

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 115/191 (60%), Gaps = 4/191 (2%)
 Frame = -2

Query  696  ETCEDFAKSYMTDYRYLSDSMAVA---SYAREYAVSVNVTHRDAWIFDIDDTLLSRVSYC  526
            E C    ++Y+T   Y SD   VA   S     A + + T+  AW+FDID+TLLS + Y 
Sbjct  20   EGCVPHVRAYLTGPAYRSDLDLVAREASAYARSARAADSTNDAAWVFDIDETLLSNLPYY  79

Query  525  DELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNTV  346
             +       F + +      +  + P++P+SL+LY+  + LGFK FL++ R ++    TV
Sbjct  80   AQHGYGLELFDH-REFDRWVETGEAPAIPSSLRLYREGRDLGFKTFLLTGRTEAHQAVTV  138

Query  345  KNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYAT  166
             NL + G+++WDKLILR   D +K++  +KSEKR E+  EGY + GN GDQWSDLLGY+ 
Sbjct  139  DNLRRQGFHDWDKLILRAAADREKTATAYKSEKRKEMEAEGYKILGNSGDQWSDLLGYSM  198

Query  165  AVRSFKFPNLM  133
            + RSFK PN M
Sbjct  199  SARSFKLPNPM  209



>ref|XP_007135620.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
 gb|ESW07614.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
Length=270

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 132/259 (51%), Gaps = 18/259 (7%)
 Frame = -2

Query  879  MAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHWY---CESWKLAVENNNAG  709
            M F   L++ +FL++     +     P   +++  G  E +     C SW+L VE NN  
Sbjct  17   MKFFSVLIVAVFLVALPCHGSEYQVFP---LQMKTGSNEQYSTQVSCTSWRLGVEANNLI  73

Query  708  PWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRDAWIFDIDDTLLSRV  535
             W      C+++   Y+   +Y SDS  V   A  YA  +N+T +D ++FDIDDT LS +
Sbjct  74   KWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAKRLNITAKDVFVFDIDDTTLSNL  133

Query  534  SYCDELSVKSAGF----KNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQ  367
             Y       + GF     N     +     +  +LP +L LY  +  LG K+  I+ER  
Sbjct  134  QY-----FANHGFGVEAHNATAFKIWVSFGEAFALPETLVLYNKLVSLGIKVVFITERPV  188

Query  366  SQLNNTVKNLCKVGYNNWDKLILRDTCD-EDKSSLVFKSEKRIEVVEEGYILQGNCGDQW  190
               + T+ NL +VG++ W+KLI RD      K S  FK+ +R ++V EGY + GN GDQW
Sbjct  189  DLKDVTISNLKEVGFHTWEKLIARDPAIYSGKLSNAFKTSERKKLVAEGYRIVGNIGDQW  248

Query  189  SDLLGYATAVRSFKFPNLM  133
            SD++G     R+FK PN +
Sbjct  249  SDIVGEKKGFRTFKLPNPL  267



>emb|CDO97963.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 115/211 (55%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE  N   W    E+CE++   YM   +Y  D  AVA  A  YA ++ +    
Sbjct  65   CLSWRLAVETYNLRNWKLVPESCENYVGHYMLGKQYREDCDAVADIAIAYAKNLTLAGDG  124

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFK-NCKNsslddddfdlpslpasLQLYKTIQK  406
            ++ W+FDID+T LS   Y     V+      N    +    +   P++P  L+LYKT+  
Sbjct  125  KEIWVFDIDETSLSNAPYYARSDVQFGAIPYNDTKFNAWVAEGAAPAVPGVLRLYKTLLS  184

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG K   IS  K+      + NL  VGY NW+KLIL+   D   S++V+KS KR E+VE 
Sbjct  185  LGIKPVFISGTKEVYREVRISNLKNVGYRNWEKLILKGENDTG-SAVVYKSNKRTELVEA  243

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG     R+FK P+ M
Sbjct  244  GYRIVGNIGDQWSDLLGTNVGDRTFKVPDPM  274



>ref|XP_004241952.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 117/220 (53%), Gaps = 6/220 (3%)
 Frame = -2

Query  777  AGVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA  604
            AG       C SW+LAVE NN   W      C ++   YM   +Y  D  AVA  A EYA
Sbjct  44   AGYAVPQLDCLSWRLAVETNNVRDWKLVPNECSNYVGHYMLGKQYRRDCEAVADAAIEYA  103

Query  603  VSVNVTH--RDAWIFDIDDTLLSRVSYCDELSVK-SAGFKNCKNsslddddfdlpslpas  433
              + ++   +D W+FD+D+T LS + Y     V   A   N    +    +   P++PA+
Sbjct  104  KGLKLSGDGKDVWVFDVDETTLSNLPYYARSDVAFGAKAFNSTRFNAWVMEGTAPAIPAT  163

Query  432  LQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKS  253
            L+LYKT+  LG K  +++   +      V NL K GY +W KLIL+   D  KS +V+KS
Sbjct  164  LRLYKTVLSLGIKPVILTGTPEFTREGRVTNLKKAGYTSWLKLILKGENDSPKS-VVYKS  222

Query  252  EKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             KR E+V  GY + GN GDQWSDL+G     R+FK P+ M
Sbjct  223  NKRTELVIAGYRIVGNTGDQWSDLIGKNAGARTFKVPDPM  262



>ref|XP_007135625.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
 gb|ESW07619.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
Length=260

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 121/209 (58%), Gaps = 4/209 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            C+SW++ VE +N   W      CE +  +YM   +Y SDS  V   A  YA ++N+T RD
Sbjct  49   CQSWRVGVEAHNVVEWKTVPADCEGYVGNYMLGKQYRSDSKTVCHEAFSYAKTLNITSRD  108

Query  576  AWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGF  397
             W+FD+D+T LS + Y          + N   S    +  + P+LP SL+LYK +  LG 
Sbjct  109  IWVFDVDETTLSNLPYYAHHGFGVEPY-NATTSDEWVEVGEAPALPESLKLYKKLLSLGI  167

Query  396  KIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD-EDKSSLVFKSEKRIEVVEEGY  220
            KI  ++ R  +Q   TV NL   GY+ W+KLIL+DT     K+++ +KS +R +V +EGY
Sbjct  168  KIVFLTGRPLNQKAVTVTNLKIAGYHKWEKLILKDTSIYHGKTAVTYKSSERKKVEKEGY  227

Query  219  ILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             + GN GDQWSD+LG  T  R+FK P+ M
Sbjct  228  KIIGNIGDQWSDILGTNTGQRTFKLPDPM  256



>gb|AGV54493.1| acid phosphatase [Phaseolus vulgaris]
Length=256

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 131/259 (51%), Gaps = 18/259 (7%)
 Frame = -2

Query  879  MAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHWY---CESWKLAVENNNAG  709
            M F   L++  FL++     +     P   +++  G  E +     C SW+L VE NN  
Sbjct  3    MKFFSVLIVAAFLVALPCHGSEYQVFP---LQMKTGSNEQYSTQVSCTSWRLGVEANNLI  59

Query  708  PWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRDAWIFDIDDTLLSRV  535
             W      C+++   Y+   +Y SDS  V   A  YA ++N+T RD ++FDIDDT LS +
Sbjct  60   KWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAKTLNITARDVFVFDIDDTTLSNL  119

Query  534  SYCDELSVKSAGF----KNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQ  367
             Y       + GF     N     +     +  +LP +L LY  +  LG K+  I+ER  
Sbjct  120  QY-----FANHGFGVEAHNATAFKIWVSFGEAFALPETLVLYNKLVGLGIKVVFITERPV  174

Query  366  SQLNNTVKNLCKVGYNNWDKLILRDTCD-EDKSSLVFKSEKRIEVVEEGYILQGNCGDQW  190
               + T+ NL +VG++ W+K I RD      K S  FK+ +R ++V EGY + GN GDQW
Sbjct  175  DLKDVTISNLKEVGFHTWEKFIARDPAIYSGKLSNAFKTSERKKLVAEGYRIVGNIGDQW  234

Query  189  SDLLGYATAVRSFKFPNLM  133
            SD++G     R+FK PN +
Sbjct  235  SDIVGEKKGFRTFKLPNPL  253



>ref|NP_001242215.1| uncharacterized protein LOC100795218 precursor [Glycine max]
 gb|ACU20782.1| unknown [Glycine max]
 gb|ACU22719.1| unknown [Glycine max]
 gb|KHN05324.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=255

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 116/212 (55%), Gaps = 14/212 (7%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            C SW+L VE NN   W      C ++   Y+   +Y SDS  V   A  YA S+ +T++D
Sbjct  45   CASWRLGVEANNVVKWQTVPAACGEYIADYVLGDQYRSDSKTVNQQAYFYAKSLKLTNKD  104

Query  576  AWIFDIDDTLLSRVSYCDELSV-----KSAGFKNCKNsslddddfdlpslpasLQLYKTI  412
             ++ D+DDT LS + Y            +  FKN         D +  +LP +L++Y  +
Sbjct  105  VFVLDVDDTTLSNLQYFANHGFGVEPHNTTAFKNW------VLDGEAFALPETLKMYNKL  158

Query  411  QKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD-EDKSSLVFKSEKRIEV  235
              LG KI  +SER  S  + T KNL +VG+N W+KLILRD  +   K S  +KS +R ++
Sbjct  159  LALGIKIVFLSERPLSLGDVTAKNLKEVGFNTWEKLILRDPSEYSGKLSFEYKSAEREKL  218

Query  234  VEEGYILQGNCGDQWSDLLGYATAVRSFKFPN  139
             +EGY + GN GDQWSDLLG     R+FK PN
Sbjct  219  EKEGYRIIGNVGDQWSDLLGSNKGTRTFKLPN  250



>ref|XP_010936026.1| PREDICTED: acid phosphatase 1 isoform X1 [Elaeis guineensis]
Length=265

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 135/265 (51%), Gaps = 17/265 (6%)
 Frame = -2

Query  888  MSAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGEDHWYCESWKLAVENNNAG  709
            M A A +      I +++G     + T++     +  AG+   + YCESW++ VE NN  
Sbjct  1    MRAEALLLFFSFSIGIVTGDWNILSYTTKKRDHHQHHAGISLKN-YCESWRINVELNNIR  59

Query  708  PWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVS---VNVTHRDAWIFDIDDTLL  544
             +D     C  +   YMT  +Y  D    A     +  +   +    +DAWIFDIDDTLL
Sbjct  60   GFDVVPGECVGYIGKYMTSTQYKVDVQRAAEQTTLFLTNNFRLGADGKDAWIFDIDDTLL  119

Query  543  SRVSYCDE------LSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLI  382
            S V Y  +      L  + A   N  +     ++   P++   L LY  I+  G KIFLI
Sbjct  120  STVPYFKKHQHGAVLGCRGAT-TNSTSMEQWMEERSAPAVEHMLDLYHEIRARGLKIFLI  178

Query  381  SERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV--FKSEKRIEVVEEGYILQG  208
            S R++   + T+ NL KVGY  W  LILR  C ED    V  +K+EKR +++E+GY L G
Sbjct  179  SSRREHLRDATIDNLVKVGYLGWTDLILR--CAEDCYHAVANYKTEKRRKLIEQGYHLWG  236

Query  207  NCGDQWSDLLGYATAVRSFKFPNLM  133
              GDQW  L+G+ +A R+FK PN M
Sbjct  237  IMGDQWCSLVGHPSANRTFKLPNPM  261



>ref|XP_010258709.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=260

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 114/210 (54%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+  VE NN   W      CED+   YM    Y  D   V   A  YA ++ +T   
Sbjct  48   CLSWRFGVETNNIRGWKTIPSKCEDYVGHYMLGSLYRKDCKVVVDEAILYAENLKLTGDG  107

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            +D WIFDID+T+LS + Y          F N    +   +  + P LP SL+LY+ +  L
Sbjct  108  KDVWIFDIDETILSNLPYYARHGFGVEPF-NSTLFNEWVNTGEAPPLPESLRLYRKLLSL  166

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G KI  ++ R + Q   T  NL K G++ W+KLIL+ + ++  +++V+KS +R  + E G
Sbjct  167  GLKIVFLTGRSEDQRKATSTNLKKAGFHTWEKLILKKSSNQGTTAVVYKSGERKTLEESG  226

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSD+LG  T  R+FK P+ M
Sbjct  227  YRIVGNIGDQWSDILGNNTGNRTFKLPDPM  256



>ref|XP_004960899.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X1 [Setaria 
italica]
Length=274

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHR-  580
            C+SW+ AVE NN   W      CE +  +YM    Y SDS AV + A  YA  + ++ + 
Sbjct  63   CDSWRFAVETNNKRGWKTIPARCERYVGNYMMGGHYRSDSRAVVNEAIAYAEGLELSGKG  122

Query  579  -DAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
             + W+FDID+T LS + Y  +    +  + N           + P+LP +L+LYK +Q L
Sbjct  123  NEVWVFDIDETALSNLPYYAKHGFGAEPY-NWTAFGAYAKQANAPALPETLRLYKRLQAL  181

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K  +++ R++ +   TV+NL   GY  + KL+L+   +    SL FKS +R ++V+ G
Sbjct  182  GIKPVILTGRREDKREATVRNLASAGYTGYLKLLLKPQ-NVRMHSLEFKSGERKKLVDAG  240

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y++ GN GDQWSDLLG     R+FK P+ M
Sbjct  241  YVIVGNIGDQWSDLLGAPEGDRTFKLPDPM  270



>ref|XP_003530059.1| PREDICTED: stem 28 kDa glycoprotein-like [Glycine max]
Length=264

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 118/209 (56%), Gaps = 4/209 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            C+SW+L VE +N   W    + CE +  +YM  ++Y SDS  V   A  YA ++N+T + 
Sbjct  53   CKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDSKTVCREAYFYAKTINITAKT  112

Query  576  AWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGF  397
             W+FD+D+T LS + Y  +         N    +   D  + P+LP SL+LY  +  LG 
Sbjct  113  TWVFDVDETTLSNLPYFADHGF-GVELYNATAFNEWVDLGEAPALPESLKLYNKLLSLGI  171

Query  396  KIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDED-KSSLVFKSEKRIEVVEEGY  220
            KI  I+ R   Q   T  NL   GY  W+KLI +DT   + K+++ +KS +R ++ E GY
Sbjct  172  KIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTDKYNGKTAVTYKSTERQKLEENGY  231

Query  219  ILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             + GN GDQWSD+LG  T +R+FK P+ M
Sbjct  232  NIIGNIGDQWSDILGTNTGLRTFKLPDPM  260



>ref|XP_007045549.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY01381.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=260

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 139/257 (54%), Gaps = 9/257 (4%)
 Frame = -2

Query  879  MAFMQCLVMC-IFLISGGtttaaaTSRPEPIIELPAGVGED---HWYCESWKLAVENNNA  712
            MA +  L +  I  +S G++  A   R   ++   +G G D      C SW+L VE NN 
Sbjct  1    MALLLVLFLANILTLSQGSSQPAHVHRQIHLLRPQSGAGGDLVPGLSCLSWRLGVETNNI  60

Query  711  GPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLL  544
              W    + CE +   YM   +Y  DS AVA  A  YA S+ +    +D WIFD+D+T L
Sbjct  61   IGWKTIPQECEGYVGHYMLGKQYRKDSKAVADEAFLYAQSLKLPRDGKDVWIFDVDETTL  120

Query  543  SRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
            S + Y  E       + N    +    +   P+LP SL+LYK +  LG K   I+ R + 
Sbjct  121  SNLPYYAEHGFGVEPY-NATLFNKWVMEGKAPALPESLKLYKKLLSLGIKAVFITGRAED  179

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
            Q + T  NL KVG+++W+KLIL+++    K+S+ +KS +R ++ + GY + GN GDQWSD
Sbjct  180  QRSITATNLKKVGFHSWEKLILKESSYSGKTSVGYKSNERKKLEKNGYKIVGNIGDQWSD  239

Query  183  LLGYATAVRSFKFPNLM  133
            LLG  T  R+FK P+ M
Sbjct  240  LLGTYTGNRTFKLPDPM  256



>ref|XP_010033713.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53450.1| hypothetical protein EUGRSUZ_J02696 [Eucalyptus grandis]
Length=257

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 112/211 (53%), Gaps = 6/211 (3%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YC SW+L VE +N   W+     CE +   YM  ++Y  DS  VA  A  YA S+ +   
Sbjct  45   YCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-HQYREDSKVVAREAVLYAKSLKLAGD  103

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D W+FDID+T LS + Y  E         N             P+LP +L+LY+ + K
Sbjct  104  GKDVWVFDIDETSLSNLPYYAEHGFGVEPL-NATQFGQWILTGKAPALPETLELYRELLK  162

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG K   ++ R +   N T  NL   G+  W+ LIL+ +   + +++V+KS +R +V E 
Sbjct  163  LGIKPIFLTGRPEDARNITSSNLRNAGFRTWEMLILKGSAYSETTAVVYKSSERRKVEES  222

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG     R+FK PN M
Sbjct  223  GYRIVGNIGDQWSDLLGIHVGNRTFKLPNPM  253



>ref|XP_002299744.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
 gb|EEE84549.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
Length=261

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 134/262 (51%), Gaps = 21/262 (8%)
 Frame = -2

Query  870  MQCLVMCIFLISGGtttaaaTSRPEPIIELPA---------GVGEDH---WYCESWKLAV  727
            M  L++ IF ++       ATS+  P+   P          G G+ H     C SW+LAV
Sbjct  1    MASLILQIFFLA----VILATSQGSPLSYYPLRIHLLRSKWGSGDHHIPGMSCLSWRLAV  56

Query  726  ENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDI  559
            E NN   W    E CED+   YM   +Y  DS  +   A  +A +  +    +D W+FD+
Sbjct  57   ETNNVIGWSTVPEECEDYVGHYMLGSQYREDSAVITDEAFAHAKTFKLAGDGKDIWVFDV  116

Query  558  DDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLIS  379
            D+T LS + Y  +    +  + N    +         +LP SL+LY+ +  +G K+  ++
Sbjct  117  DETTLSNLPYYAKHGFGAEPY-NSTAFNQWVFTGKALALPESLKLYRNLLSIGIKVVFLT  175

Query  378  ERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCG  199
             R + Q   T  NL   GY+ W+KLIL+ +    K+++ +KS +R ++ ++GY + GN G
Sbjct  176  GRTEDQRAVTSNNLKNAGYHIWEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGNIG  235

Query  198  DQWSDLLGYATAVRSFKFPNLM  133
            DQWSDLLG +   R+FK P+ M
Sbjct  236  DQWSDLLGTSVGNRTFKLPDPM  257



>ref|XP_009787591.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=268

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 121/212 (57%), Gaps = 8/212 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W      CE++   Y+   +Y  D  AVA+ A EYA SV +    
Sbjct  55   CLSWRLAVETNNLQNWKLVPSACENYIGHYILGKQYRHDCEAVANAAIEYAKSVKLGGDG  114

Query  582  RDAWIFDIDDTLLSRVSYC--DELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
            +D W+FDID+T LS + Y    +++  +  + N K  +    +   P++P+ L +YKT+ 
Sbjct  115  KDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNTK-FNAWVAEGKAPAIPSILGVYKTVL  173

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LG K   I+  ++S     + NL K GY NW KLIL+   D  +S++ +KS KR E+V+
Sbjct  174  SLGIKTVFITGTRESFRKVRITNLKKAGYTNWAKLILKGENDT-RSAVEYKSSKRRELVK  232

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             GY + GN GDQWSDL+G     R+FK P+ +
Sbjct  233  AGYRIIGNIGDQWSDLIGDNLGARTFKVPDPL  264



>gb|KHN39260.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=226

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 117/209 (56%), Gaps = 4/209 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHRD  577
            C+SW+L VE +N   W    + CE +  +YM  ++Y SDS  V   A  YA ++N+T + 
Sbjct  15   CKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDSKTVCREAYFYAKTINITAKT  74

Query  576  AWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGF  397
             W+FD+D+T LS + Y  +         N    +   D  + P+LP SL+LY  +  LG 
Sbjct  75   TWVFDVDETTLSNLPYFADHGF-GVELYNATAFNEWVDLGEAPALPESLKLYNKLLSLGI  133

Query  396  KIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDED-KSSLVFKSEKRIEVVEEGY  220
            KI  I+ R   Q   T  NL   GY  W+KLI +DT   + K+++ +KS +R ++ E GY
Sbjct  134  KIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTDKYNGKTAVTYKSTERQKLEENGY  193

Query  219  ILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             + GN GDQWSD+LG  T  R+FK P+ M
Sbjct  194  NIIGNIGDQWSDILGTNTGHRTFKLPDPM  222



>ref|XP_004302847.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 118/210 (56%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+L VE +N   W      CE +  +YM  ++Y  DS AV + A  YA S+N+T   
Sbjct  50   CMSWRLGVETHNIVGWTTIPAACERYVGNYMLGHQYRQDSRAVTNEALLYAKSLNLTKDG  109

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            ++ W+FDID+T LS + Y            N    +    +   P+LP SL+LY  +  L
Sbjct  110  KNLWVFDIDETSLSNLPYYAHHGF-GVELYNSTAFNAWVLEGKAPALPESLKLYNKLLAL  168

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K+  I+ R +SQ + T  NL  VGY  W+KLIL+++     +S+V+KS ++ ++ E G
Sbjct  169  GIKVAFITGRGESQRSVTEINLRYVGYLTWEKLILKNSSYTGNTSVVYKSSEKKKLEESG  228

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  229  YRIIGNIGDQWSDLLGTNVGDRTFKLPDPM  258



>ref|XP_010033828.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53662.1| hypothetical protein EUGRSUZ_J02929 [Eucalyptus grandis]
Length=257

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 111/211 (53%), Gaps = 6/211 (3%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YC SW+L VE +N   W+     CE +   YM  Y+Y  DS  VA  A  Y  S+ +   
Sbjct  45   YCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-YQYREDSKVVAREAVLYVKSLKLAGD  103

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +D W+FDID+T LS + Y  E         N             P+LP +L+LY+ + K
Sbjct  104  GKDVWVFDIDETSLSNLPYYAEHGFGVEPL-NPTQFGQWILTGKAPALPETLELYRELLK  162

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            LG K   ++ R +   N T  NL   G+  W+ LIL+ +   + +++V+KS +R +V E 
Sbjct  163  LGIKPIFLTGRSEDARNITSSNLRNAGFRTWEMLILKGSAYSETTAVVYKSSERRKVEES  222

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG     R+FK PN M
Sbjct  223  GYRIVGNIGDQWSDLLGIHVGNRTFKLPNPM  253



>ref|XP_009622654.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=267

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 121/213 (57%), Gaps = 10/213 (5%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W      CE++   Y+   +Y  D  AVA+ A EYA S+ +    
Sbjct  54   CLSWRLAVETNNLQNWKLVPSACENYIGHYILGKQYRHDCEAVANAAIEYAKSLKLGGDG  113

Query  582  RDAWIFDIDDTLLSRVSYC--DELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
            +D W+FDID+T LS + Y    +++  +  + N K  +    +   P++P+ L +YKT+ 
Sbjct  114  KDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNTK-FNAWVAEGKAPAIPSILGVYKTVL  172

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLV-FKSEKRIEVV  232
             LG K   I+  ++S     + NL K GY+NW KL L+   D D ++ V FKS KR E+V
Sbjct  173  SLGIKPVFITGTRESFKQVRIANLKKAGYSNWAKLALKG--DNDSATAVEFKSSKRTELV  230

Query  231  EEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + GY + GN GDQWSDL+G     R+FK P+ M
Sbjct  231  KAGYRIVGNIGDQWSDLIGENVGSRTFKVPDPM  263



>ref|XP_010264908.1| PREDICTED: acid phosphatase 1 [Nelumbo nucifera]
Length=258

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 118/222 (53%), Gaps = 30/222 (14%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV---  589
            YCESW++ VE NN   +D   + C D+   YMT  +Y  DS         Y  S      
Sbjct  44   YCESWRINVELNNIREFDVVPDECVDYIGKYMTSSQYQVDSERALEQCTLYLSSSFAWAG  103

Query  588  THRDAWIFDIDDTLLSRVSY-------CDELSVKS--AGFKNCKNsslddddfdlpslpa  436
              +DAWIFDIDDTLLS V Y        D+L++ S     K CK           P+L  
Sbjct  104  DGKDAWIFDIDDTLLSTVPYYKQHHFGGDKLNLSSLEGWLKQCK----------APALEH  153

Query  435  sLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILR---DTCDEDKSSL  265
            +L LY  I+  G KIFLIS R++     TV NL KVGY+ W +LILR   D C E +   
Sbjct  154  TLNLYNEIKGRGLKIFLISSRREHLREATVDNLLKVGYSGWTELILRVPEDGCQEVQK--  211

Query  264  VFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPN  139
             +K+EKR +++++GY + G   DQWS L G  TA R+FK PN
Sbjct  212  -YKAEKRKQLIDKGYRIWGIVADQWSSLKGLPTAKRTFKLPN  252



>ref|NP_001148296.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG30436.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=272

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 116/210 (55%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C+SW+ AVE N    WD     CE +  +YM    Y SDS AVA+ A  YA  +N+T   
Sbjct  61   CDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSDSRAVANEAIAYAEGLNLTGQG  120

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            ++ W+FD+D+T LS + Y  +       + N         + + P LP + +LYK +Q L
Sbjct  121  KEVWVFDVDETTLSNLPYYAKHGFGVEPY-NWSTFGAYVKEANAPVLPETQRLYKRLQAL  179

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K  +++ R++ +   T  NL   GY  + KL+L+   +   SS+ FKS +R ++ + G
Sbjct  180  GIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQ-NVKVSSIEFKSGERKKLQDAG  238

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y++ GN GDQW+DLLG     R+FK P+ M
Sbjct  239  YVIVGNIGDQWTDLLGEPEGGRTFKLPDPM  268



>gb|AFW77368.1| stem glycoprotein [Zea mays]
Length=272

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 116/210 (55%), Gaps = 6/210 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C+SW+ AVE N    WD     CE +  +YM    Y SDS AVA+ A  YA  +N+T   
Sbjct  61   CDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSDSRAVANEAIAYAEGLNLTGQG  120

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            ++ W+FD+D+T LS + Y  +       + N         + + P LP + +LYK +Q L
Sbjct  121  KEVWVFDVDETTLSNLPYYAKHGFGVEPY-NWSTFGAYVKEANAPVLPETQRLYKRLQAL  179

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G K  +++ R++ +   T  NL   GY  + KL+L+   +   SS+ FKS +R ++ + G
Sbjct  180  GIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQ-NVKVSSIEFKSGERKKLQDAG  238

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y++ GN GDQW+DLLG     R+FK P+ M
Sbjct  239  YVIVGNIGDQWTDLLGEPEGGRTFKLPDPM  268



>ref|XP_006443754.1| hypothetical protein CICLE_v10021795mg [Citrus clementina]
 ref|XP_006479461.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|ESR56994.1| hypothetical protein CICLE_v10021795mg [Citrus clementina]
 gb|KDO60368.1| hypothetical protein CISIN_1g025203mg [Citrus sinensis]
Length=256

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 114/216 (53%), Gaps = 14/216 (6%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAV---SVNV  589
            YCESW++ VE NN   ++   + C D  K YMT  +Y +DS   A   + Y     S+  
Sbjct  42   YCESWRINVELNNIREFEVVPQECIDHIKKYMTSSQYKADSQRAAEEVKLYLSGCCSLAG  101

Query  588  THRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlpslpasLQLY  421
              +DAWIFD+DDTLLS + Y      K  GF     N  +      +   P+L  +L L+
Sbjct  102  DGKDAWIFDVDDTLLSTIPY-----FKKHGFGGERLNASSWEAWMKESKAPALEHTLNLF  156

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
              I+  G KIFL+S R++S  + TV NL  VGY+ W  L LR   DE K    +K++ R 
Sbjct  157  HEIKNRGVKIFLVSSRRESLRSYTVDNLIHVGYHGWASLELRGLEDEYKKVQQYKAQVRK  216

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             +V+EGY + G  GDQWS   G     R+FK PN M
Sbjct  217  RLVKEGYRIWGVVGDQWSSFEGLPKPKRTFKLPNSM  252



>gb|AFK40440.1| unknown [Lotus japonicus]
Length=261

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 117/211 (55%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW L VE +N   W    E CE +  +YM   +Y SDS  V   A  YA S+N+    
Sbjct  48   CASWTLGVEAHNIINWKTIPEECEGYVGNYMIGQQYRSDSKTVCKQAYFYARSLNLPRDG  107

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            ++ W+FDID+T LS + Y  E         N    +L  D    P LP SL+LY  +  L
Sbjct  108  KNIWVFDIDETSLSNLPYYAEHGF-GLELYNDTAFNLWVDRAAAPVLPESLKLYNKLLSL  166

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCD-EDKSSLVFKSEKRIEVVEE  226
            G KI  ++ R  SQ +NT KNL   G+  W+KLIL++      K+++ +KS +R ++ EE
Sbjct  167  GIKIAFLTGRPLSQKDNTAKNLKLAGFYTWEKLILKEPSTYSGKTAVTYKSAERKKLEEE  226

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSD+LG  T  R+FK P+ M
Sbjct  227  GYRIIGNIGDQWSDILGTTTGNRTFKLPDPM  257



>ref|XP_004235637.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=255

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWDQET--CEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNV--TH  583
            C SW+LAVE NN   W      CED+   YM   +Y  D   V + A +YA ++ +    
Sbjct  42   CLSWRLAVETNNIQDWTSVPLQCEDYVGHYMLGKQYRDDCYNVVAAAIQYAKTIKIGKNG  101

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFK-NCKNsslddddfdlpslpasLQLYKTIQK  406
            +D W+FDID+T LS + Y     V     K N         +   P +PA+L LY T+  
Sbjct  102  KDIWVFDIDETTLSNLPYYARSDVAFGSIKYNGTKFDEWTREGKAPPVPAALFLYNTLLS  161

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +G K   IS  K+      + NL KVGY++W +LIL+   D   SS+ +KS KR E+V++
Sbjct  162  MGIKPVFISGTKEEFRQIRITNLNKVGYHSWIRLILKGVNDTG-SSVKYKSGKRGELVKD  220

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG     R+FK P+ M
Sbjct  221  GYRIVGNIGDQWSDLLGDYVGQRTFKLPDPM  251



>ref|XP_004960900.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=279

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 119/214 (56%), Gaps = 9/214 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHR-  580
            C+SW+ AVE NN   W      CE +  +YM    Y SDS AV + A  YA  + ++ + 
Sbjct  63   CDSWRFAVETNNKRGWKTIPARCERYVGNYMMGGHYRSDSRAVVNEAIAYAEGLELSGKG  122

Query  579  -DAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
             + W+FDID+T LS + Y  +    +  + N           + P+LP +L+LYK +Q L
Sbjct  123  NEVWVFDIDETALSNLPYYAKHGFGAEPY-NWTAFGAYAKQANAPALPETLRLYKRLQAL  181

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDT----CDEDKSSLVFKSEKRIEV  235
            G K  +++ R++ +   TV+NL   GY  + KL+L+ +     +    SL FKS +R ++
Sbjct  182  GIKPVILTGRREDKREATVRNLASAGYTGYLKLLLKYSICLCTNVRMHSLEFKSGERKKL  241

Query  234  VEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            V+ GY++ GN GDQWSDLLG     R+FK P+ M
Sbjct  242  VDAGYVIVGNIGDQWSDLLGAPEGDRTFKLPDPM  275



>ref|XP_003521307.1| PREDICTED: acid phosphatase 1-like [Glycine max]
 gb|KHN10773.1| Acid phosphatase 1 [Glycine soja]
Length=276

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 116/214 (54%), Gaps = 14/214 (7%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAV---SVNV  589
            YCESW++ VE NN   +    + C D  K YMT  +Y +DS+      R Y     ++  
Sbjct  62   YCESWRINVELNNIRGFSVVPQECVDHVKKYMTSSQYKADSVRAVEEIRLYMSGFCTLKD  121

Query  588  THRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlpslpasLQLY  421
              +D+WIFDID+TLLS + Y      K  GF     N  +     +    P+L  +L+L+
Sbjct  122  DGKDSWIFDIDETLLSTIPY-----YKKHGFGGEKLNATSLEEWMEKSKAPALDHTLELF  176

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
              I+  GFKIFLIS RK++  + TV NL  VGY+ W++L LR   DE      + S+ R 
Sbjct  177  HEIKNKGFKIFLISSRKENLRSPTVDNLVSVGYHGWNRLTLRGFDDELMDVKKYHSKVRQ  236

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPN  139
            ++V+EGY + G  GDQWS   G   A R+FK PN
Sbjct  237  QLVDEGYRIWGIVGDQWSTFDGLPMAKRTFKLPN  270



>ref|XP_011000941.1| PREDICTED: acid phosphatase 1-like [Populus euphratica]
Length=271

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 135/265 (51%), Gaps = 13/265 (5%)
 Frame = -2

Query  900  QYNIMSAMAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPA--GVGEDH---WYCESWK  736
            Q N M+++      +  I  IS G+  +     P  I  L +  G G  H     C SW+
Sbjct  7    QQNTMASLILQIFFLAVILAISQGSPLSY---EPLQIHLLRSKWGSGGHHIPGMSCLSWR  63

Query  735  LAVENNNAGPWDQ--ETCEDFAKSYMTDYRYLSDSMAVA--SYAREYAVSVNVTHRDAWI  568
            LAVE NN   W    E CED+   YM   +Y  DS  +   ++A      ++   +D W+
Sbjct  64   LAVETNNVIGWSTVPEDCEDYVGHYMLGSQYREDSALITDEAFAHAKTFKLDGDGKDIWV  123

Query  567  FDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIF  388
            FD+D+T LS + Y  +    +  + N    +         +LP SL+LY+ +  +G K+ 
Sbjct  124  FDVDETTLSNLPYYAKHGFGAEPY-NSTAFNQWVFTGKALALPESLKLYRRLLSIGIKVV  182

Query  387  LISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQG  208
             ++ R + Q   T  NL   GY+ W+KLIL+ +    K+++ +KS +R ++ ++GY + G
Sbjct  183  FLTGRSEDQRAVTSTNLKNAGYHIWEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIG  242

Query  207  NCGDQWSDLLGYATAVRSFKFPNLM  133
            N GDQWSDLLG +   R+FK P+ M
Sbjct  243  NIGDQWSDLLGTSVGNRTFKLPDPM  267



>ref|XP_009795136.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=261

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W      CE +   YM   +Y  D  AV   A +YA ++ +    
Sbjct  48   CLSWRLAVETNNIQNWKLVPLQCESYVGHYMLGKQYRDDCNAVVVAAIQYAKTLKIAKDG  107

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFK-NCKNsslddddfdlpslpasLQLYKTIQK  406
            +D W+FDID+T LS + Y     V     K N         +   P++P +L LY+T+  
Sbjct  108  KDVWVFDIDETTLSNLPYYARSDVAFGATKFNGTKFDGWTREGKAPAVPGALFLYRTLLA  167

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +G K   I+  K+      + NL KVGY++W KLIL+   D   SS+++KS KR E+V+ 
Sbjct  168  MGIKPVFITGTKEEFRQVRIANLKKVGYHSWVKLILKGVNDTG-SSVMYKSGKRAELVKA  226

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG     R+FK P+ M
Sbjct  227  GYRIVGNIGDQWSDLLGDFVGDRTFKLPDPM  257



>ref|XP_010091790.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXB45998.1| Acid phosphatase 1 [Morus notabilis]
Length=257

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 118/214 (55%), Gaps = 14/214 (7%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAV---SVNV  589
            YCESW++ VE NN   ++   + C  + K YMT  +Y +DS       + Y     +++ 
Sbjct  43   YCESWRINVEINNIRGFEVVPQECVGYIKKYMTSSQYKADSEKALEEVKLYLSNCCTLDG  102

Query  588  THRDAWIFDIDDTLLSRVSYCDELSVKSAGF----KNCKNsslddddfdlpslpasLQLY  421
              +DAWIFD+DDTLLS + Y      K  GF    +N  +        + P+L  +L L+
Sbjct  103  DGKDAWIFDVDDTLLSTIPYH-----KIHGFGGEKRNVTSLEAWMKKKNAPALKPTLNLF  157

Query  420  KTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRI  241
              I+  G +IFLIS R+++  ++TV NL +VGY+ W  L LR   DE +    +KS  R 
Sbjct  158  HEIKDKGLQIFLISSRRETLRSHTVDNLIEVGYHGWSGLSLRGLEDELQEVQKYKSAARQ  217

Query  240  EVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPN  139
             +V+EGY + G  GDQWS   G+ +A R+FK PN
Sbjct  218  RLVDEGYRIWGIVGDQWSSFEGHPSAKRTFKLPN  251



>ref|XP_010098162.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB74599.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=261

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 132/255 (52%), Gaps = 13/255 (5%)
 Frame = -2

Query  879  MAFMQCLVMCIFLISGGtttaaaTSRPEPIIELPAGVGE---DHWYCESWKLAVENNNAG  709
            ++F    V+       G       +    ++   +G G    D  +C SW+  +E NN  
Sbjct  6    LSFFLATVLAATSAQAGYEYPHDITNKISLLRTKSGAGVSFVDEEWCLSWRFGIETNNLV  65

Query  708  PWDQ--ETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTHR---DAWIFDIDDTLL  544
             W    E CE +   YM   +Y  DS  V   A EYA ++N+ +      W+FDID+T L
Sbjct  66   DWAMYPEECEGYIWRYMLGCQYEKDSKVVTEEAYEYAKNLNLPYDGKIHVWVFDIDETAL  125

Query  543  SRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQS  364
            + +++     +   GF+  K S+ +    + P+LPA+L+LYK +  LG K+  +S R + 
Sbjct  126  TNLNHF----IPKHGFR-AKPSNNEHALEESPALPATLELYKKLGTLGIKVVFLSLRTED  180

Query  363  QLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSD  184
               +T  NL  VGY  W+K+ILR   +   +SL FKS +R ++ E  Y + GN GDQWSD
Sbjct  181  LRTDTENNLRNVGYETWEKVILRPDSNYAGTSLEFKSGQRKKLEESKYRIVGNIGDQWSD  240

Query  183  LLGYATAVRSFKFPN  139
            LLG  + +R+FK PN
Sbjct  241  LLGTNSGLRTFKLPN  255



>ref|XP_009625321.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=257

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W      CE +   YM   +Y  D  AV   A +YA ++ +    
Sbjct  44   CLSWRLAVETNNIQNWKLVPLQCESYVGHYMLGKQYRDDCNAVIVAAIQYAKTLKIAKDG  103

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFK-NCKNsslddddfdlpslpasLQLYKTIQK  406
            +D W+FDID+T LS + Y     V     K N         +   P++P +L LY+T+  
Sbjct  104  KDVWVFDIDETTLSNLPYYARSDVAFGATKFNGTKFDEWTREGKAPAVPGALFLYRTLLA  163

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +G K   I+  K+      + NL KVGY++W KLIL+   D   SS+++KS KR E+V+ 
Sbjct  164  MGIKPVFITGTKEEFRQVRIANLKKVGYHSWVKLILKGVNDTG-SSVMYKSGKRAELVKA  222

Query  225  GYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            GY + GN GDQWSDLLG     R+FK P+ M
Sbjct  223  GYRIVGNIGDQWSDLLGDFVGDRTFKLPDPM  253



>ref|XP_004984487.1| PREDICTED: acid phosphatase 1-like isoform X1 [Setaria italica]
 ref|XP_004984488.1| PREDICTED: acid phosphatase 1-like isoform X2 [Setaria italica]
 ref|XP_004984489.1| PREDICTED: acid phosphatase 1-like isoform X3 [Setaria italica]
Length=258

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 111/219 (51%), Gaps = 8/219 (4%)
 Frame = -2

Query  774  GVGEDHWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA-  604
            G   D   C SW++ VE NNA  W      C  + K YMT  +YL D   V   A +YA 
Sbjct  39   GQAPDDAGCLSWRVMVEANNARGWRTVPAQCVGYVKGYMTRGQYLRDLAGVMEQASDYAD  98

Query  603  -VSVNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQ  427
             V       DAW+FDIDDT LS + Y +    K  G  +             P +P  L 
Sbjct  99   QVDAGADGLDAWVFDIDDTCLSNLPYYE---TKQFGAYDPSAFKAWASKEACPGIPPVLG  155

Query  426  LYKTIQKLGFKIFLISERKQSQLNN-TVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSE  250
            L+  +   GFK+FL+S R +  L   T  NL   G++ +++LI+R      +SS VFKS 
Sbjct  156  LFTALLDKGFKVFLLSGRDEETLGPCTTGNLEAEGFSGYERLIMRTPEYRGQSSSVFKSA  215

Query  249  KRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             R ++V+EGY ++GN GDQWSDL G     R FK PN M
Sbjct  216  MRKQLVDEGYRIRGNVGDQWSDLQGDCVGDRVFKIPNPM  254



>ref|XP_010322861.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 120/212 (57%), Gaps = 8/212 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W    + CE++   YM   +Y  D   VA  A EYA ++ +    
Sbjct  53   CLSWRLAVETNNLQNWRLVPKECENYVGHYMLGKQYRRDCEYVAKQAIEYAKALKLGGDG  112

Query  582  RDAWIFDIDDTLLSRVSYC--DELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQ  409
            +D W+FDID+T LS + Y    +++  +  + N K  +    +   P++P+ L +YKT+ 
Sbjct  113  KDVWVFDIDETTLSNLPYYARSDVAFGAIAYNNTK-FNAWIAEGKAPAIPSILGVYKTVL  171

Query  408  KLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVE  229
             LG K   I+  +++     + NL KVGY+NW  LIL+   D   S++ FKS KR E+V+
Sbjct  172  SLGIKPVFITGTRENFKQVRIVNLKKVGYSNWAALILKGENDSG-SAVQFKSSKRTELVK  230

Query  228  EGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
             GY + GN GDQW+DL+G     R+FK P+ M
Sbjct  231  AGYRIVGNIGDQWTDLIGENVGARTFKVPDPM  262



>ref|XP_002273448.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
 emb|CBI37173.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 115/213 (54%), Gaps = 7/213 (3%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSD-SMAVAS---YAREYAVSVN  592
            YCESW++ VE NN   +D   + C +F   YMT  +Y +D   A+     Y  +   S+ 
Sbjct  41   YCESWRINVELNNIKGFDVVPQECVEFVGKYMTSSQYKADIERAIEESVLYLSKGCCSLK  100

Query  591  VTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTI  412
               +DAWIFDIDDTL+S V Y  +         N  +          P+L  +L+ +  I
Sbjct  101  GDDKDAWIFDIDDTLVSIVPYYKKHHFGGEKL-NVTSLEEWMRKNRAPALRETLRFFNDI  159

Query  411  QKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVV  232
            +  GFKIFLIS R++   ++T  NL KVGY+ W +LILR   DE      +K++ R  +V
Sbjct  160  RGRGFKIFLISSRRECLRSSTADNLIKVGYHGWTRLILRKEADELMEVQKYKAKARQGLV  219

Query  231  EEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            +EGY + G  GDQWS   G  +A R+FK PN +
Sbjct  220  KEGYRIWGIVGDQWSSFEGTPSAKRTFKLPNPL  252



>ref|XP_008235608.1| PREDICTED: acid phosphatase 1-like isoform X1 [Prunus mume]
Length=262

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 122/230 (53%), Gaps = 21/230 (9%)
 Frame = -2

Query  774  GVGED-HWYCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYA  604
            GVG+    YCESW++ VE NN   +D   + C  + + YMT  +Y +DS         Y 
Sbjct  35   GVGDGLKKYCESWRINVEVNNIRGFDVVPQECVQYIQKYMTSSQYKADSEKALEEVTFYL  94

Query  603  VS---VNVTHRDAWIFDIDDTLLSRVSYCDELSVKSAGFK----NCKNsslddddfdlps  445
             S   +    +DAWIFD+DDTLLS + Y      K+ GF     N  +      +   P+
Sbjct  95   SSCCTLEGDGKDAWIFDVDDTLLSTIPY-----FKTHGFGGEKINATSLEAWMRESKAPA  149

Query  444  lpasLQLYKTIQKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTC------D  283
            L  +L+L+  I+  G KIFLIS R+++  +++V NL KVGY+ W  LILR         D
Sbjct  150  LEHTLKLFHEIKNRGLKIFLISSRRENLRSSSVDNLIKVGYHGWTGLILRSRFEYRGLED  209

Query  282  EDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            E      +KS+ R  +V+EGY++ G  GDQWS   G   A R+FK PN M
Sbjct  210  EFMEVQKYKSKARHRLVDEGYLIWGIIGDQWSSFEGLPIAKRTFKLPNSM  259



>gb|AFW77369.1| hypothetical protein ZEAMMB73_279889 [Zea mays]
Length=276

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 116/213 (54%), Gaps = 8/213 (4%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C+SW+ AVE N    WD     CE +  +YM    Y SDS AVA+ A  YA  +N+T   
Sbjct  61   CDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSDSRAVANEAIAYAEGLNLTGQG  120

Query  582  RDAWIFDIDDTLLSRVSYCDELSV---KSAGFKNCKNsslddddfdlpslpasLQLYKTI  412
            ++ W+FD+D+T LS + Y  +      +     N         + + P LP + +LYK +
Sbjct  121  KEVWVFDVDETTLSNLPYYAKHGFGERRRVEPYNWSTFGAYVKEANAPVLPETQRLYKRL  180

Query  411  QKLGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVV  232
            Q LG K  +++ R++ +   T  NL   GY  + KL+L+   +   SS+ FKS +R ++ 
Sbjct  181  QALGIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQ-NVKVSSIEFKSGERKKLQ  239

Query  231  EEGYILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            + GY++ GN GDQW+DLLG     R+FK P+ M
Sbjct  240  DAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPM  272



>ref|XP_009133169.1| PREDICTED: acid phosphatase 1-like [Brassica rapa]
Length=282

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 108/192 (56%), Gaps = 5/192 (3%)
 Frame = -2

Query  753  YCESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH-  583
            YCESW+LAVE NNAG W      C    ++Y    ++  D   VA YA  +A +V +   
Sbjct  48   YCESWRLAVETNNAGTWKVVPSKCVSSLETYYNGGQFDKDYNVVARYALAFAKTVKIGGD  107

Query  582  -RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQK  406
             +DAW+FD+D+TLLS + Y       S  + N K           P   ASL+LY  ++ 
Sbjct  108  GKDAWVFDVDETLLSNLEYYKANGYGSEPY-NSKKFHEWVVQGTAPGFDASLKLYTGLKN  166

Query  405  LGFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEE  226
            +GF I L++ R +++   T KNL   GY  W+ L+LR   D+ K+++ +KSE+R  +V++
Sbjct  167  IGFTIILLTGRDEAERRITEKNLHDAGYFGWEHLLLRGHEDQGKAAVKYKSEQRSRMVKK  226

Query  225  GYILQGNCGDQW  190
            GYIL GN GD W
Sbjct  227  GYILPGNTGDHW  238



>ref|XP_009381186.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=263

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 126/252 (50%), Gaps = 12/252 (5%)
 Frame = -2

Query  858  VMCIFLISGGtttaaaTSRPEPIIEL------PAGVGEDHWYCESWKLAVENNNAGPWD-  700
            +  I + S G      T R  P I L        G+  D   C SW+  VE NN   W  
Sbjct  10   LAAILMASPGARPPEGTPREPPAIHLLKPLFGSGGLPADGVTCASWRFGVETNNVRGWRT  69

Query  699  -QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--RDAWIFDIDDTLLSRVSY  529
               +CE +   YM   RY  DS  V + A  Y   + +     DAWIFDID+T+LS + Y
Sbjct  70   VPRSCEGYVGHYMLGDRYRQDSAVVTAAAAAYVEGLQIPGDGMDAWIFDIDETVLSNLPY  129

Query  528  CDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKLGFKIFLISERKQSQLNNT  349
                      + N  + +   D    P+LP SL+LY  +  LG KI  ++ R + + N T
Sbjct  130  YAHHGFGVEPY-NATSFNAWVDKGIAPALPESLKLYHKLLPLGIKIVFLTGRSEERRNVT  188

Query  348  VKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEGYILQGNCGDQWSDLLGYA  169
            + NL + GY  W+KL+L+     + +++ FK+ +R ++ E+GY + GN GDQWSD+LG  
Sbjct  189  ITNLKRAGYRTWEKLLLKGE-GVNGTAMAFKTAEREKLEEQGYRIVGNIGDQWSDILGKP  247

Query  168  TAVRSFKFPNLM  133
               R+FK P+ +
Sbjct  248  EGARTFKLPDPL  259



>ref|XP_006465744.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=264

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 116/210 (55%), Gaps = 5/210 (2%)
 Frame = -2

Query  750  CESWKLAVENNNAGPWD--QETCEDFAKSYMTDYRYLSDSMAVASYAREYAVSVNVTH--  583
            C SW+LAVE NN   W    E CE +   YM   +Y  DS AVA  A  YA S+ +    
Sbjct  52   CLSWRLAVETNNIIGWKTIPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQSLELAGDG  111

Query  582  RDAWIFDIDDTLLSRVSYCDELSVKSAGFKNCKNsslddddfdlpslpasLQLYKTIQKL  403
            R+ WIFDID+T LS + Y  +       F N    +   +  + PSLP SL LYK +  L
Sbjct  112  REIWIFDIDETSLSNLPYYAKHGFGVEPF-NSTLFNEWVNKGEAPSLPESLNLYKKLLSL  170

Query  402  GFKIFLISERKQSQLNNTVKNLCKVGYNNWDKLILRDTCDEDKSSLVFKSEKRIEVVEEG  223
            G KI  ++ R + Q + T  NL  VG+  W+ LIL+ +    ++++ +KS +R  + ++G
Sbjct  171  GIKIVFLTGRPEDQRSVTENNLKNVGFYTWENLILKGSSYSGETAVAYKSNERKRLEKKG  230

Query  222  YILQGNCGDQWSDLLGYATAVRSFKFPNLM  133
            Y + GN GDQWSDLLG     R+FK P+ M
Sbjct  231  YRIIGNIGDQWSDLLGTNAGNRTFKLPDPM  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2031864544602