BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32053_g1_i1 len=1207 path=[1:0-1206]

Length=1207
                                                                      Score     E

ref|XP_007012867.1|  1-aminocyclopropane-1-carboxylate                  466   1e-160   
ref|XP_009785509.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    462   3e-159   
ref|XP_002514144.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    462   4e-159   Ricinus communis
ref|XP_009627991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    462   5e-159   
gb|KDP33817.1|  hypothetical protein JCGZ_07388                         461   2e-158   
ref|XP_011077965.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    457   5e-157   
ref|XP_006451440.1|  hypothetical protein CICLE_v10008993mg             457   8e-157   
ref|XP_002309227.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    456   8e-157   Populus trichocarpa [western balsam poplar]
gb|AAX84675.1|  ACC oxidase ACCO2                                       454   1e-155   Manihot esculenta [manioc]
gb|EYU27306.1|  hypothetical protein MIMGU_mgv1a025521mg                453   2e-155   
dbj|BAG15873.1|  ACC oxidase                                            452   4e-155   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009352635.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    451   9e-155   
ref|XP_011010059.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    451   1e-154   
ref|XP_004287539.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    449   1e-153   
ref|XP_008242414.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    447   2e-153   
emb|CDP21221.1|  unnamed protein product                                447   3e-153   
ref|XP_002279746.3|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    447   5e-153   Vitis vinifera
gb|EYU27232.1|  hypothetical protein MIMGU_mgv1a024882mg                447   5e-153   
ref|NP_001234037.1|  1-aminocyclopropane-1-carboxylate oxidase          447   5e-153   
ref|XP_007202367.1|  hypothetical protein PRUPE_ppa009228mg             447   6e-153   
ref|XP_010262178.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    447   6e-153   
ref|NP_179549.1|  1-aminocyclopropane-1-carboxylate oxidase 1           446   2e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090031.1|  1-aminocyclopropane-1-carboxylate oxidase 1        445   2e-152   
ref|XP_010242185.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    445   2e-152   
ref|XP_010242183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    445   3e-152   
ref|XP_008337682.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    444   5e-152   
ref|XP_010416898.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    444   6e-152   
emb|CAI51311.2|  1-aminocyclopropane-1-carboxylate oxidase              444   7e-152   Capsicum chinense [bonnet pepper]
ref|XP_010489154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    444   9e-152   
ref|NP_001275149.1|  ACC oxidase                                        442   4e-151   
ref|XP_010495929.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    442   4e-151   
ref|XP_004288926.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    441   1e-150   
emb|CDX81937.1|  BnaC08g36640D                                          441   2e-150   
ref|XP_006298182.1|  hypothetical protein CARUB_v10014231mg             441   2e-150   
ref|XP_010523564.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    440   4e-150   
emb|CDY21655.1|  BnaA09g44060D                                          439   5e-150   
ref|XP_009102154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    439   9e-150   
gb|KFK40326.1|  hypothetical protein AALP_AA3G360100                    439   1e-149   
ref|XP_002883982.1|  hypothetical protein ARALYDRAFT_343239             437   4e-149   
ref|XP_010667334.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    436   6e-149   
ref|XP_003525310.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    436   7e-149   
emb|CDY58326.1|  BnaCnng33000D                                          436   7e-149   
ref|XP_006408876.1|  hypothetical protein EUTSA_v10002047mg             436   7e-149   
gb|KHM99846.1|  1-aminocyclopropane-1-carboxylate oxidase 1             436   8e-149   
emb|CDY70340.1|  BnaCnng67880D                                          434   3e-148   
gb|ACU24150.1|  unknown                                                 434   4e-148   Glycine max [soybeans]
ref|XP_011093716.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    434   4e-148   
ref|XP_009117531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    434   9e-148   
ref|XP_010242182.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    432   4e-147   
ref|XP_003530544.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    431   8e-147   
ref|XP_010049724.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    430   3e-146   
ref|XP_010047583.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    429   3e-146   
ref|XP_003529081.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    429   3e-146   
gb|KHN16682.1|  1-aminocyclopropane-1-carboxylate oxidase 1             429   4e-146   
ref|XP_007160235.1|  hypothetical protein PHAVU_002G304200g             424   4e-144   
ref|XP_003620934.1|  1-aminocyclopropane-1-carboxylate oxidase          423   1e-143   
gb|AFK34864.1|  unknown                                                 421   6e-143   
emb|CAN80122.1|  hypothetical protein VITISV_010647                     417   2e-141   Vitis vinifera
ref|XP_004513099.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    416   5e-141   
gb|KHN40333.1|  1-aminocyclopropane-1-carboxylate oxidase 1             404   1e-136   
ref|XP_004141049.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   2e-131   
ref|XP_004157916.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    390   8e-131   
emb|CAA64798.1|  ACC oxidase                                            387   1e-129   Cucumis melo [Oriental melon]
ref|XP_008459274.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   1e-128   
ref|XP_010925034.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    366   2e-121   
ref|XP_008793240.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   3e-120   
gb|AAP13098.1|  1-aminocyclopropane-1-carboxylic acid oxidase           363   3e-120   Elaeis guineensis
ref|XP_009402922.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   3e-120   
ref|XP_008805775.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   3e-119   
ref|XP_009400531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   3e-117   
ref|XP_010915230.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   6e-117   
ref|XP_008782557.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    354   7e-117   
ref|XP_010925427.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    351   2e-115   
gb|ABK59094.1|  1-amino-cyclopropane-1-carboxylic acid oxidase 3        340   4e-111   Manihot esculenta [manioc]
ref|XP_007026207.1|  Ethylene-forming enzyme                            340   6e-111   
gb|KHG22879.1|  1-aminocyclopropane-1-carboxylate oxidase               340   7e-111   
gb|AEM62885.1|  ACC oxidase 6                                           339   2e-110   
gb|ADK39027.1|  1-aminocyclopropane-1-carboxylic acid oxidase           338   2e-110   
ref|XP_006449820.1|  hypothetical protein CICLE_v10015965mg             338   3e-110   
gb|AFZ76981.1|  ACC oxidase                                             338   4e-110   
gb|EMS68745.1|  1-aminocyclopropane-1-carboxylate oxidase 1             337   4e-110   
dbj|BAA21541.1|  1-aminocyclopropane-1-carboxylic acid oxidase          338   5e-110   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010099139.1|  1-aminocyclopropane-1-carboxylate oxidase          338   5e-110   
dbj|BAG06705.1|  1-aminocyclopropane-1-carboxylate oxidase              338   6e-110   Ficus carica
emb|CAA71738.1|  1-aminocyclopropane-1-carboxylate oxidase              337   7e-110   Betula pendula [white birch]
gb|AEM62878.1|  ACC oxidase 2                                           337   7e-110   
gb|AAZ83343.1|  ACC oxidase 2                                           337   1e-109   Gossypium hirsutum [American cotton]
ref|XP_002438605.1|  hypothetical protein SORBIDRAFT_10g022640          336   1e-109   Sorghum bicolor [broomcorn]
gb|AEM62879.1|  ACC oxidase 3                                           337   1e-109   
gb|AAZ83342.1|  ACC oxidase 1                                           336   2e-109   Gossypium hirsutum [American cotton]
ref|XP_004966039.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   2e-109   
gb|AAC98808.1|  ACC oxidase                                             336   3e-109   Carica papaya [mamon]
gb|AEM62880.1|  ACC oxidase 3                                           335   4e-109   
gb|AAB70883.1|  1-aminocyclopropane-1-carboxylate oxidase               335   5e-109   Pelargonium x hortorum [bedding geranium]
gb|AEM62883.1|  ACC oxidase 5                                           335   7e-109   
gb|AAK57516.1|  ACC oxidase                                             334   1e-108   Carica papaya [mamon]
emb|CAJ56066.1|  ACC oxidase                                            334   1e-108   Vigna radiata [mung bean]
emb|CAN85571.1|  ACC oxidase 3                                          334   1e-108   Hevea brasiliensis [jebe]
gb|AEM62884.1|  ACC oxidase 5                                           334   2e-108   
ref|XP_008782558.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   2e-108   
ref|XP_007160496.1|  hypothetical protein PHAVU_002G326600g             333   2e-108   
gb|AEM62877.1|  ACC oxidase 1                                           333   2e-108   
gb|AAF64528.1|AF254125_1  ACC oxidase                                   333   2e-108   Carica papaya [mamon]
ref|NP_001233928.1|  1-aminocyclopropane-1-carboxylate oxidase 4        333   3e-108   
ref|XP_006383841.1|  aminocyclopropane carboxylate oxidase family...    333   3e-108   
ref|XP_011000640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   3e-108   
ref|XP_003563715.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   4e-108   
gb|AHA06004.1|  1-aminocyclopropane-1-carboxylate oxidase               333   4e-108   
gb|AHL69752.1|  aminocyclopropanecarboxylate oxidase                    333   4e-108   
sp|Q8S932.1|ACCO_DIOKA  RecName: Full=1-aminocyclopropane-1-carbo...    332   5e-108   Diospyros kaki [Japanese persimmon]
sp|P31237.1|ACCO_ACTDE  RecName: Full=1-aminocyclopropane-1-carbo...    332   5e-108   Actinidia deliciosa [Chinese gooseberry]
emb|CAH64841.1|  1-aminocyclopropane-1-carboxylate oxidase              332   6e-108   Carica papaya [mamon]
emb|CAJ56065.1|  ACC oxidase                                            332   6e-108   Vigna radiata [mung bean]
emb|CAN85572.1|  ACC oxidase 1                                          332   7e-108   Hevea brasiliensis [jebe]
gb|ACL68417.3|  ACC oxidase                                             332   7e-108   
emb|CAN85569.1|  ACC oxidase 1                                          332   8e-108   Hevea brasiliensis [jebe]
emb|CAJ56064.1|  ACC oxidase                                            332   8e-108   Vigna radiata [mung bean]
ref|XP_011096014.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   8e-108   
ref|XP_002316589.1|  aminocyclopropane carboxylate oxidase family...    332   9e-108   Populus trichocarpa [western balsam poplar]
gb|AAK07883.1|AF315316_1  ACC oxidase                                   332   9e-108   Vigna radiata var. radiata [golden gram]
gb|AGN52989.1|  ACC oxidase                                             332   1e-107   
gb|AAP41850.1|  1-aminocyclopropane-1-carboxylate oxidase               331   2e-107   Hevea brasiliensis [jebe]
ref|NP_001267871.1|  aconitase 2, mitochondrial                         331   2e-107   
dbj|BAB89352.1|  1-aminocyclopropane-1-carboxylate oxidase              331   2e-107   Diospyros kaki [Japanese persimmon]
gb|ABI33224.1|  ACC oxidase                                             331   2e-107   Camellia sinensis [black tea]
gb|ABF61805.1|  1-aminocyclopropane-1-carboxylate oxidase               331   3e-107   Medicago sativa [alfalfa]
gb|EMT12779.1|  1-aminocyclopropane-1-carboxylate oxidase               330   3e-107   
gb|ABK96379.1|  unknown                                                 330   3e-107   Populus trichocarpa x Populus deltoides
gb|AEM65196.1|  ACC oxidase                                             330   3e-107   
ref|XP_009355918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   4e-107   
ref|XP_002535327.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    330   4e-107   Ricinus communis
emb|CAJ56067.1|  ACC oxidase                                            330   5e-107   Vigna radiata [mung bean]
ref|XP_011086213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   6e-107   
ref|XP_003534723.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   6e-107   
dbj|BAH15311.1|  ACC oxidase 1                                          330   6e-107   Lactuca sativa [cultivated lettuce]
ref|XP_010052892.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   6e-107   
gb|ABO32691.1|  ACC oxidase ACO3                                        330   7e-107   Nicotiana attenuata
gb|ACX71872.1|  ACC oxidase 1                                           330   7e-107   Lithospermum erythrorhizon
ref|XP_010688910.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   7e-107   
gb|ACY76262.1|  ACC oxidase                                             329   8e-107   Dimocarpus longan [longan]
ref|XP_010943257.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   9e-107   
ref|XP_009802116.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   9e-107   
emb|CAN85573.1|  ACC oxidase 2                                          329   9e-107   Hevea brasiliensis [jebe]
ref|XP_008224728.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   1e-106   
gb|AAL37174.1|AF320071_1  1-aminocyclopropane-1-carboxylate oxidase     329   1e-106   Carica papaya [mamon]
sp|P05116.2|ACCO1_SOLLC  RecName: Full=1-aminocyclopropane-1-carb...    329   1e-106   Solanum lycopersicum
ref|XP_010035505.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   1e-106   
gb|ACS71641.1|  ACC oxidase                                             329   1e-106   Dorcoceras hygrometricum
gb|AGN74918.1|  1-aminocyclopropane-1-carboxylate oxidase               328   2e-106   
ref|XP_003594161.1|  1-aminocyclopropane-1-carboxylate oxidase          328   3e-106   
ref|XP_006357981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   3e-106   
ref|XP_010110622.1|  1-aminocyclopropane-1-carboxylate oxidase 3        328   3e-106   
ref|XP_010430292.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   3e-106   
ref|XP_007211643.1|  hypothetical protein PRUPE_ppa008813mg             328   3e-106   
gb|AEM62881.1|  ACC oxidase 4                                           328   3e-106   
emb|CAH58646.1|  aminocyclopropan-1-carboxylate oxidase                 328   3e-106   Plantago major [cart-track plant]
sp|Q08506.1|ACCO1_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    328   3e-106   Petunia x hybrida [garden petunia]
gb|AEM62882.1|  ACC oxidase 4                                           328   3e-106   
ref|XP_006391897.1|  hypothetical protein EUTSA_v10023595mg             328   4e-106   
emb|CAA67216.1|  ACC oxidase                                            327   4e-106   Malus domestica [apple tree]
ref|NP_001275482.1|  1-aminocyclopropane-1-carboxylate oxidase          327   4e-106   
ref|XP_010051539.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    327   5e-106   
ref|XP_006656182.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   6e-106   
sp|Q08507.1|ACCO3_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    327   6e-106   Petunia x hybrida [garden petunia]
gb|AAF36484.1|AF129074_1  1-aminocyclopropane-1-carboxylate oxidase     327   7e-106   Prunus persica
ref|XP_009113083.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   7e-106   
gb|ACO91560.1|  1-aminocyclopropane-1-carboxylate oxidase               327   7e-106   Paeonia suffruticosa [moutan peony]
gb|AHN13883.1|  1-aminocyclopropane-1-carboxylate oxidase 1             327   7e-106   
gb|AEK70335.1|  1-aminocyclopropane-1-carboxylate oxidase               327   1e-105   
dbj|BAA19605.1|  ACC-oxidase                                            326   1e-105   Vigna angularis [azuki bean]
ref|NP_001289250.1|  1-aminocyclopropane-1-carboxylate oxidase 1        327   1e-105   
ref|XP_010473457.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   1e-105   
ref|XP_007141655.1|  hypothetical protein PHAVU_008G214200g             327   1e-105   
gb|AFU90135.1|  1-aminocyclopropane-1-carboxylate oxidase               326   1e-105   
ref|XP_010686763.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    326   1e-105   
gb|EAZ01418.1|  hypothetical protein OsI_23452                          325   1e-105   Oryza sativa Indica Group [Indian rice]
gb|AAC48977.1|  1-aminocyclopropane-1-carboxylate oxidase               326   1e-105   Pelargonium x hortorum [bedding geranium]
sp|Q08508.1|ACCO4_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    326   2e-105   Petunia x hybrida [garden petunia]
emb|CDP05674.1|  unnamed protein product                                326   2e-105   
emb|CAI64500.1|  1-aminocyclopropane-1-carboxylate oxidase 2            325   2e-105   Prunus domestica subsp. insititia [damson plum]
ref|XP_008371045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   2e-105   
gb|KHN32985.1|  1-aminocyclopropane-1-carboxylate oxidase               326   2e-105   
gb|ABL67954.2|  1-aminocyclopropane-1-carboxylate oxidase               326   2e-105   Ipomoea nil [qian niu]
sp|Q00985.1|ACCO1_MALDO  RecName: Full=1-aminocyclopropane-1-carb...    325   2e-105   Malus domestica [apple tree]
dbj|BAF33504.1|  ACC synthase                                           325   3e-105   Orobanche minor
emb|CBI28867.3|  unnamed protein product                                325   3e-105   
ref|XP_003549632.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   3e-105   
gb|EYU27738.1|  hypothetical protein MIMGU_mgv1a010275mg                325   3e-105   
dbj|BAB83762.1|  1-aminocyclopropane-1-carboxylic acid oxidase          325   3e-105   Phaseolus lunatus
ref|XP_010035511.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   4e-105   
ref|XP_010418231.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   4e-105   
sp|Q09052.1|ACCO1_BRAJU  RecName: Full=1-aminocyclopropane-1-carb...    325   4e-105   Brassica juncea [brown mustard]
ref|XP_010546539.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   4e-105   
gb|ABW91147.1|  ACC oxidase 2                                           325   5e-105   Ziziphus jujuba [Chinese jujube]
dbj|BAD61848.1|  putative 1-aminocyclopropane-1-carboxylic acid o...    324   5e-105   Oryza sativa Japonica Group [Japonica rice]
emb|CAA71140.1|  1-aminocyclopropane-1-carboxylic acid oxidase          325   6e-105   Rumex palustris
ref|XP_011047191.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   6e-105   
emb|CAA58232.1|  1-amniocyclopropane-1-carboxylate oxidase              324   7e-105   Nicotiana tabacum [American tobacco]
gb|AHW85523.1|  1-aminocyclopropane-1-carboxylate oxidase               324   7e-105   
gb|ABC69167.2|  1-aminocyclopropane-1-carboxylate oxidase               324   7e-105   Paeonia suffruticosa [moutan peony]
dbj|BAG30908.1|  ACC oxidase                                            325   7e-105   Capsicum chinense [bonnet pepper]
ref|XP_004486198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   7e-105   
ref|XP_008440054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   8e-105   
gb|KDP30812.1|  hypothetical protein JCGZ_13755                         324   8e-105   
emb|CDP05673.1|  unnamed protein product                                324   8e-105   
gb|KHN44761.1|  1-aminocyclopropane-1-carboxylate oxidase               324   8e-105   
gb|AGV54270.1|  1-aminocyclopropane-1-carboxylic acid oxidase           324   8e-105   
ref|XP_010035508.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   9e-105   
gb|ADR73045.1|  ACC oxidase 2 isoform A                                 324   9e-105   
gb|ACT22772.1|  ACC oxidase 2                                           324   1e-104   Lepidium sativum
ref|XP_002302856.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    324   1e-104   Populus trichocarpa [western balsam poplar]
gb|AFK45850.1|  unknown                                                 324   1e-104   
ref|NP_001242835.1|  uncharacterized protein LOC100819184               324   1e-104   
gb|AAD28196.2|AF115261_1  1-aminocyclopropane-1-carboxylate oxidase     324   1e-104   Trifolium repens [creeping white clover]
ref|XP_004172177.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    324   1e-104   
ref|XP_008805606.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   1e-104   
ref|XP_010035512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   1e-104   
ref|XP_009791489.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   1e-104   
gb|AFI41198.1|  ACC oxidase 2                                           324   1e-104   
ref|NP_176428.1|  1-aminocyclopropane-1-carboxylate oxidase 2           324   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009768154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   2e-104   
ref|XP_003545591.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   2e-104   
gb|AAB97368.1|  1-aminocyclopropane-1-carboxylate oxidase               323   2e-104   Rumex palustris
ref|XP_004134785.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   2e-104   
gb|AAC27484.1|  ACC oxidase                                             323   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241899.1|  1-aminocyclopropane-1-carboxylate oxidase-like     323   2e-104   
emb|CAD21844.1|  ACC oxidase 1                                          323   2e-104   Fagus sylvatica
gb|AAA32981.1|  amino-cyclopropane-carboxylic acid oxidase              323   2e-104   Brassica napus [oilseed rape]
sp|P54847.1|ACCO3_CUCME  RecName: Full=1-aminocyclopropane-1-carb...    323   3e-104   Cucumis melo [Oriental melon]
ref|XP_009148622.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   3e-104   
emb|CAA57285.1|  ACC oxidase                                            323   3e-104   Brassica oleracea
emb|CDY34603.1|  BnaC08g41620D                                          323   3e-104   
ref|XP_009630256.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   4e-104   
ref|XP_003545587.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   4e-104   
ref|XP_004293334.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   4e-104   
dbj|BAE20198.1|  aco                                                    322   4e-104   Tulipa gesneriana
sp|O48882.1|ACCO2_MALDO  RecName: Full=1-aminocyclopropane-1-carb...    323   5e-104   Malus domestica [apple tree]
gb|AAN86821.1|  1-aminocyclopropane-1-carboxylate oxidase 2             322   5e-104   Betula pendula [white birch]
gb|KHN44760.1|  1-aminocyclopropane-1-carboxylate oxidase               322   5e-104   
dbj|BAF33502.1|  ACC oxidase                                            322   6e-104   Phelipanche ramosa
gb|AGE15421.1|  1-aminocyclopropane-1-carboxylate oxidase               322   6e-104   
ref|XP_002888029.1|  hypothetical protein ARALYDRAFT_475105             322   7e-104   
gb|AFJ75134.1|  ACC oxidase                                             321   7e-104   
ref|XP_003616884.1|  1-aminocyclopropane-1-carboxylate oxidase          322   8e-104   
gb|AAB70884.1|  1-aminocyclopropane-1-carboxylate oxidase               322   8e-104   Pelargonium x hortorum [bedding geranium]
gb|AAC48922.1|  1-aminocyclopropane-1-carboxylate oxidase homolog       322   8e-104   Vigna radiata [mung bean]
gb|ACU24032.1|  unknown                                                 322   1e-103   Glycine max [soybeans]
gb|AAB71421.1|  1-aminocyclopropapne-1-carboxylic acid oxidase          321   1e-103   Helianthus annuus
gb|AFO63022.1|  ACC oxidase                                             321   1e-103   
gb|AAA33708.1|  ethylene-forming enzyme                                 322   1e-103   Petunia x hybrida [garden petunia]
gb|KHN00185.1|  1-aminocyclopropane-1-carboxylate oxidase               321   1e-103   
ref|XP_010035504.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   1e-103   
ref|XP_009604053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   1e-103   
gb|AFJ75398.1|  1-aminocyclopropane-1-carboxylic acid oxidase           321   1e-103   
dbj|BAJ90796.1|  predicted protein                                      321   1e-103   
ref|XP_010035513.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-103   
emb|CDY32039.1|  BnaA03g60430D                                          321   2e-103   
gb|EYU33867.1|  hypothetical protein MIMGU_mgv1a010647mg                320   2e-103   
gb|AFJ75135.1|  ACC oxidase                                             320   2e-103   
gb|AAA99793.1|  1-aminocyclopropane-1-carboxylic acid oxidase           321   2e-103   Nicotiana glutinosa
gb|AGF95124.1|  1-aminocyclopropane-1-carboxylate oxidase               322   2e-103   
ref|XP_006351971.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-103   
gb|ABW91146.1|  ACC oxidase 1                                           321   2e-103   Ziziphus jujuba [Chinese jujube]
ref|XP_007049183.1|  Ethylene-forming enzyme                            321   2e-103   
gb|ABK58140.1|  1-amino-cyclopropane-1-carboxylic acid oxidase          321   2e-103   Manihot esculenta [manioc]
ref|XP_009609240.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-103   
ref|XP_009781832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-103   
ref|XP_009123393.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-103   
ref|XP_010533786.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    321   3e-103   
gb|KDO78383.1|  hypothetical protein CISIN_1g018920mg                   322   3e-103   
dbj|BAE20196.1|  aco                                                    320   3e-103   Tulipa gesneriana
ref|XP_010035510.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-103   
ref|XP_004502173.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-103   
gb|KDP30813.1|  hypothetical protein JCGZ_13756                         320   3e-103   
ref|XP_003566807.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   3e-103   
ref|XP_009413270.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-103   
ref|XP_008650459.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   3e-103   
ref|XP_003519448.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-103   
dbj|BAE20197.1|  aco                                                    320   3e-103   Tulipa gesneriana
gb|AAR99394.1|  ACC oxidase ACO1                                        320   3e-103   
ref|XP_002320487.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    320   4e-103   
ref|XP_009387204.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   4e-103   
ref|XP_003578206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   4e-103   
gb|AEC32837.1|  1-aminocyclopropane-1-carboxylate oxidase               320   5e-103   
dbj|BAA94601.1|  1-aminocyclopropane-1-carboxylate oxidase              320   5e-103   
gb|AAC12934.1|  1-aminocyclopropane-1-carboxylic acid oxidase           320   5e-103   
gb|ABA01476.1|  ACC oxidase ACO4                                        320   5e-103   
gb|KHG03155.1|  1-aminocyclopropane-1-carboxylate oxidase 1             319   6e-103   
ref|XP_006584893.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   6e-103   
ref|XP_006306083.1|  hypothetical protein CARUB_v10011493mg             320   6e-103   
ref|XP_010035506.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   7e-103   
ref|XP_009118157.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   7e-103   
dbj|BAH15312.1|  ACC oxidase 2                                          319   8e-103   
gb|AFO63019.1|  ACC oxidase                                             319   9e-103   
ref|XP_010035507.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   1e-102   
ref|XP_004251527.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   1e-102   
dbj|BAB32502.1|  1-aminocyclopropane-1-carboxylate oxidase              319   1e-102   
gb|AEP19803.1|  ACC oxidase 1                                           319   1e-102   
ref|XP_008803519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   1e-102   
gb|ABI95858.1|  1-aminocyclopropane-1-carboxylate oxidase               318   1e-102   
ref|XP_007147675.1|  hypothetical protein PHAVU_006G144900g             318   1e-102   
gb|AIR72293.1|  1-amino-cyclopropane-1-carboxylic acid oxidase          318   2e-102   
gb|KHN44756.1|  1-aminocyclopropane-1-carboxylate oxidase               318   2e-102   
gb|AFK49530.1|  unknown                                                 318   2e-102   
gb|AFJ75133.1|  ACC oxidase                                             318   2e-102   
ref|XP_006595831.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   2e-102   
emb|CDY08654.1|  BnaC04g19630D                                          318   2e-102   
sp|Q43792.1|ACCO_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...    318   2e-102   
sp|P07920.1|ACCO2_SOLLC  RecName: Full=1-aminocyclopropane-1-carb...    318   2e-102   
gb|AFK41584.1|  unknown                                                 318   3e-102   
gb|AEC32838.1|  1-aminocyclopropane-1-carboxylate oxidase               318   3e-102   
ref|XP_010913394.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   3e-102   
gb|ABL67953.2|  1-aminocyclopropane-1-carboxylate oxidase               317   3e-102   
gb|AAA99792.1|  1-aminocyclopropane-1-carboxylic acid oxidase           318   4e-102   
gb|ABB97398.1|  ACC oxidase                                             317   4e-102   
ref|XP_009410048.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   4e-102   
gb|AAL78058.1|  ripening-induced ACC oxidase                            317   4e-102   
gb|ADB03782.1|  1-aminocyclopropane-1-carboxylate oxidase               317   4e-102   
ref|XP_009789991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   5e-102   
gb|AAC67233.1|  ACC oxidase 2                                           317   6e-102   
ref|NP_001280183.1|  1-aminocyclopropane-1-carboxylate oxidase          317   6e-102   
gb|ABO65266.1|  1-aminocyclopropane-1-carboxylate oxidase               317   6e-102   
emb|CAA64856.1|  1-aminocyclopropane-1-carboxylate oxidase              317   7e-102   
ref|NP_001234638.1|  1-aminocyclopropane-1-carboxylate oxidase          317   7e-102   
ref|XP_002889907.1|  predicted protein                                  317   7e-102   
emb|CAA60576.1|  1-aminocyclopropane-1-carboxylate oxidase              317   8e-102   
gb|AFO63015.1|  ACC oxidase                                             317   8e-102   
ref|XP_009629716.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   8e-102   
gb|AFO63018.1|  ACC oxidase                                             317   8e-102   
dbj|BAE20195.1|  aco                                                    317   8e-102   
ref|XP_002455837.1|  hypothetical protein SORBIDRAFT_03g026000          318   9e-102   
ref|XP_007215698.1|  hypothetical protein PRUPE_ppa008791mg             317   1e-101   
dbj|BAC66950.1|  ACC oxidase                                            316   1e-101   
gb|ADR73046.1|  ACC oxidase 2 isoform B                                 316   1e-101   
dbj|BAK00833.1|  predicted protein                                      316   1e-101   
ref|XP_004304079.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   1e-101   
gb|AAD28198.2|AF115263_1  1-aminocyclopropane-1-carboxylate oxidase     315   2e-101   
gb|AAC49833.1|  1-aminocyclopropane-1-carboxylic acid oxidase           315   2e-101   
gb|AGC25242.1|  ACC oxidase                                             315   3e-101   
emb|CAI64499.1|  1-aminocyclopropane-1-carboxylate oxidase 1            315   3e-101   
dbj|BAC53656.1|  1-aminocyclopropene-1-carboxylate oxidase              315   3e-101   
ref|XP_009365121.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   3e-101   
ref|NP_171994.1|  1-aminocyclopropane-1-carboxylate oxidase             315   3e-101   
ref|XP_006348170.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   3e-101   
ref|XP_002892259.1|  hypothetical protein ARALYDRAFT_887679             315   3e-101   
gb|AAD28197.2|AF115262_1  1-aminocyclopropane-1-carboxylate oxidase     315   4e-101   
gb|KHG21578.1|  1-aminocyclopropane-1-carboxylate oxidase 3             315   4e-101   
gb|ABY26553.1|  ACC oxidase                                             315   5e-101   
ref|NP_001281047.1|  1-aminocyclopropane-1-carboxylate oxidase 1        315   5e-101   
dbj|BAA83466.1|  ACC oxidase                                            315   5e-101   
ref|XP_009593567.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   6e-101   
gb|KFK43467.1|  hypothetical protein AALP_AA1G128800                    315   6e-101   
gb|AAB00556.1|  1-aminocyclopropane-1-carboxylate oxidase               314   6e-101   
ref|XP_010522369.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   6e-101   
ref|XP_004969420.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   7e-101   
gb|KHG24527.1|  1-aminocyclopropane-1-carboxylate oxidase               314   7e-101   
ref|XP_006660677.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   7e-101   
ref|NP_172665.1|  1-aminocyclopropane-1-carboxylate oxidase             314   7e-101   
gb|AAL35971.1|  1-aminocyclopropanecarboxylic acid oxidase              314   7e-101   
gb|AAF65472.1|AF252628_1  1-aminocyclopropane-1-carboxylate oxidase     314   8e-101   
prf||1909340A  Pch313 protein                                           314   9e-101
ref|XP_003601593.1|  1-aminocyclopropane-1-carboxylate oxidase          314   9e-101   
ref|XP_010252569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   1e-100   
emb|CAA47251.1|  ethylene-forming enzyme                                314   1e-100   
ref|XP_008348143.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   1e-100   
gb|AAS16934.1|  1-aminocyclopropane-1-carboxylate oxidase 2             313   1e-100   
emb|CAA82646.1|  ethylene forming enzyme (EFE)                          313   1e-100   
emb|CAC39107.1|  ACC oxidase                                            313   2e-100   
ref|XP_006418070.1|  hypothetical protein EUTSA_v10008207mg             313   2e-100   
gb|AAR00930.1|U86045_1  1-aminocyclopropane-1-carboxylate oxidase       313   2e-100   
gb|AEM42994.1|  ACC oxidase                                             313   2e-100   
emb|CAH65725.1|  1-aminocyclopropane-1-carboxylate oxidase              312   3e-100   
gb|AFK29447.1|  1-aminocyclopropane-1-carboxylate oxidase               313   3e-100   
emb|CAA11200.1|  ACC oxidase                                            312   3e-100   
ref|XP_010457570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   4e-100   
ref|XP_008654990.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    312   4e-100   
gb|AFK42210.1|  unknown                                                 312   4e-100   
gb|EEC84681.1|  hypothetical protein OsI_31599                          312   4e-100   
ref|NP_001233867.1|  1-aminocyclopropane-1-carboxylate oxidase          312   4e-100   
ref|XP_011047006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   5e-100   
emb|CDY18281.1|  BnaC05g03040D                                          312   5e-100   
sp|P19464.1|ACCO_PERAE  RecName: Full=1-aminocyclopropane-1-carbo...    312   5e-100   
gb|ABK97619.1|  1-aminocyclopropane-1-carboxylic acid oxidase           312   5e-100   
ref|NP_001234024.1|  1-aminocyclopropane-1-carboxylate oxidase 1        311   5e-100   
emb|CAE53174.1|  1-aminocyclopropane-1-carboxylate oxidase              312   6e-100   
gb|AAK43970.1|AF370155_1  putative 1-aminocyclopropane-1-carboxyl...    312   6e-100   
gb|AAA33273.1|  amino-cyclopropane carboxylic acid oxidase              312   6e-100   
gb|ACU82854.3|  1-aminocyclopropane-1-carboxylate oxidase               312   6e-100   
ref|NP_001275208.1|  1-aminocyclopropane-1-carboxylate oxidase          312   6e-100   
gb|AAU10090.1|  1-aminocyclopropane-1-carboxylate oxidase               312   6e-100   
gb|AGG20315.1|  1-aminocyclopropane-1-carboxylate oxidase 4             311   8e-100   
ref|NP_001063329.1|  Os09g0451000                                       312   8e-100   
sp|P31528.1|ACCO_DIACA  RecName: Full=Probable 1-aminocyclopropan...    311   8e-100   
ref|XP_004954061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   8e-100   
gb|AFK29449.1|  1-aminocyclopropane-1-carboxylate oxidase               311   9e-100   
gb|ABC02397.1|  1-aminocyclopropane-1-carboxylate oxidase               311   9e-100   
ref|NP_001149427.1|  1-aminocyclopropane-1-carboxylate oxidase 1        311   1e-99    
ref|XP_009119214.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   1e-99    
gb|KFK40603.1|  hypothetical protein AALP_AA2G017200                    311   1e-99    
gb|AAZ83344.1|  ACC oxidase 3                                           311   1e-99    
gb|AAB02051.1|  1-aminocyclopropane-1-carboxylate oxidase               311   1e-99    
ref|XP_003616886.1|  1-aminocyclopropane-1-carboxylate oxidase          311   2e-99    
gb|AAT99445.1|  ripening related ACC oxidase 2                          310   2e-99    
sp|A2Z1W9.1|ACCO1_ORYSI  RecName: Full=1-aminocyclopropane-1-carb...    311   2e-99    
gb|ABV45543.1|  1-aminocyclopropane-1-carboxylate oxidase               310   2e-99    
ref|XP_007144188.1|  hypothetical protein PHAVU_007G135600g             310   2e-99    
gb|AAB05171.1|  ACC oxidase                                             310   2e-99    
ref|NP_001063330.1|  Os09g0451400                                       310   3e-99    
gb|KFK42831.1|  hypothetical protein AALP_AA1G045000                    310   4e-99    
ref|XP_010484553.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    310   4e-99    
gb|AFK48521.1|  unknown                                                 310   4e-99    
gb|AAO13735.1|AF252853_1  putative 1-aminocyclopropane-1-carboxyl...    310   4e-99    
gb|AIS71925.1|  1-aminocyclopropane-1-carboxylate oxidase 1             310   5e-99    
gb|ACU23807.1|  unknown                                                 306   5e-99    
ref|NP_001275812.1|  ACC oxidase                                        310   5e-99    
gb|AAS09956.1|  1-aminocyclopropane-1-carboxylate oxidase               310   5e-99    
emb|CDY53397.1|  BnaAnng12450D                                          309   6e-99    
ref|XP_006447653.1|  hypothetical protein CICLE_v10015962mg             309   6e-99    
ref|XP_009790903.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   7e-99    
gb|KDO54311.1|  hypothetical protein CISIN_1g020953mg                   309   7e-99    
gb|ABY53430.1|  1-aminocyclopropane-1-carboxylate oxidase               309   7e-99    
gb|ABM74187.1|  1-aminocyclopropane-1-carboxylate oxidase               309   1e-98    
gb|EPS72760.1|  hypothetical protein M569_01997                         308   1e-98    
emb|CAA67119.1|  ACC oxidase                                            308   1e-98    
ref|XP_009613638.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   2e-98    
ref|XP_002273430.3|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   2e-98    
ref|XP_006302557.1|  hypothetical protein CARUB_v10020664mg             308   2e-98    
gb|ACH99202.1|  1-aminocyclopropane-1-carboxylate oxidase               308   2e-98    
emb|CAH18930.1|  1-aminocyclopropane-1-carboxylate oxidase              308   2e-98    
ref|XP_010475176.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   2e-98    
pdb|1W9Y|A  Chain A, The Structure Of Acc Oxidase                       307   4e-98    
ref|XP_003529653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    307   4e-98    
ref|XP_002452894.1|  hypothetical protein SORBIDRAFT_04g034520          307   4e-98    
emb|CAD44265.2|  putative aminocyclopropane carboxylate oxidase         307   4e-98    
gb|AEZ06406.1|  1-aminocycloproane-1-carboxylate oxidase                306   5e-98    
ref|XP_006305365.1|  hypothetical protein CARUB_v10009749mg             307   6e-98    
gb|KHG23673.1|  1-aminocyclopropane-1-carboxylate oxidase               306   8e-98    
emb|CAA59749.1|  1-aminocyclopropane-1-carboxylate oxidase (ACC o...    306   9e-98    
ref|XP_004956981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    306   9e-98    
gb|ABW20470.1|  ACC oxidase                                             306   1e-97    
gb|AGM48542.1|  1-aminocyclopropane-1-carboxylate oxidase               306   2e-97    
dbj|BAD60999.1|  1-aminocyclopropane-1-carboxylate oxidase              306   2e-97    
gb|AAP94014.1|  ACC oxidase AC02                                        304   2e-97    
ref|XP_006647976.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    305   3e-97    
dbj|BAK03337.1|  predicted protein                                      305   3e-97    
gb|KCW82486.1|  hypothetical protein EUGRSUZ_C03881                     304   3e-97    
ref|NP_001284392.1|  1-aminocyclopropane-1-carboxylate oxidase 1        305   4e-97    
dbj|BAD60998.1|  1-aminocyclopropane-1-carboxylate oxidase              305   4e-97    
emb|CDP04457.1|  unnamed protein product                                305   4e-97    
ref|XP_004956979.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    305   4e-97    
ref|XP_010493627.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    305   5e-97    
gb|KDP20691.1|  hypothetical protein JCGZ_21162                         304   5e-97    
gb|ACU24286.1|  unknown                                                 304   6e-97    
ref|XP_006661299.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    306   7e-97    
dbj|BAI39989.1|  ACC oxidase                                            304   8e-97    
ref|NP_001130227.1|  1-aminocyclopropane-1-carboxylate oxidase 1A...    303   1e-96    
gb|ABG78034.1|  1-aminocyclopropane-1-carboxylate oxidase               301   2e-96    
gb|AAM20919.1|AF441282_1  1-aminocyclopropane-1-carboxylate oxidase     301   2e-96    
ref|XP_008651663.1|  PREDICTED: uncharacterized protein LOC100382...    303   3e-96    
ref|XP_007141649.1|  hypothetical protein PHAVU_008G213800g             301   4e-96    
gb|AHJ14562.1|  ACC oxidase                                             303   4e-96    
sp|Q39705.1|ACCO2_DORSP  RecName: Full=1-aminocyclopropane-1-carb...    302   6e-96    
dbj|BAH80550.1|  1-aminocyclopropane-1-carboxylate oxidase              300   7e-96    
gb|AAC67234.1|  ACC oxidase 3                                           301   9e-96    
ref|XP_008342143.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    301   9e-96    
gb|AFV50550.1|  1-aminocyclopropane-1-carboxylate oxidase               299   2e-95    
ref|XP_006837262.1|  hypothetical protein AMTR_s00112p00098670          300   2e-95    
gb|AAC05506.1|  1-aminocyclopropane-1-carboxylate oxidase               300   2e-95    
sp|P31239.1|ACCO_PEA  RecName: Full=1-aminocyclopropane-1-carboxy...    300   2e-95    
gb|AAR00506.1|  1-aminocyclopropane-1-carboxylate oxidase               300   2e-95    
gb|ACO37154.1|  ACC oxidase                                             298   3e-95    
ref|XP_010057880.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    300   4e-95    
ref|NP_001267694.1|  1-aminocyclopropane-1-carboxylate oxidase 1-...    300   4e-95    
emb|CAB97173.1|  putative 1-aminocyclopropane-1-carboxylic acid o...    300   4e-95    
ref|XP_004507658.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    299   5e-95    
ref|XP_010270047.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    298   1e-94    
gb|ACS34759.1|  1-aminocyclopropane-1-carboxylate oxidase               298   1e-94    
gb|AAP94013.1|  ACC oxidase AC01                                        296   1e-94    
gb|ACA63697.1|  1-aminocyclopropane-1-carboxylic acid oxidase           296   2e-94    
ref|XP_003570545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    298   2e-94    
ref|XP_007012868.1|  1-aminocyclopropane-1-carboxylate                  294   2e-94    
gb|ABR53742.1|  1-aminocyclopropane-1-carboxylate oxidase 2             295   4e-94    
ref|XP_002462474.1|  hypothetical protein SORBIDRAFT_02g026280          296   9e-94    
dbj|BAF36562.1|  ACC oxidase                                            296   9e-94    
sp|P31238.1|ACCO1_DORSP  RecName: Full=1-aminocyclopropane-1-carb...    296   1e-93    
ref|XP_006417277.1|  hypothetical protein EUTSA_v10008225mg             296   1e-93    
gb|AFK29147.1|  ACC-oxidase                                             294   1e-93    
ref|NP_001048259.1|  Os02g0771600                                       295   2e-93    
ref|NP_001105235.1|  ACC oxidase20                                      295   2e-93    
gb|ADN65042.1|  1-aminocyclopropane-1-carboxylate oxidase               295   2e-93    
gb|KHN44758.1|  1-aminocyclopropane-1-carboxylate oxidase               295   3e-93    
gb|KHN38493.1|  1-aminocyclopropane-1-carboxylate oxidase               294   3e-93    
ref|NP_001241509.1|  uncharacterized protein LOC100815336               294   3e-93    
gb|AAC05507.1|  1-aminocyclopropane-1-carboxylate oxidase               295   3e-93    
gb|ABK32881.1|  1-aminocyclopropane-1-carboxylic acid oxidase           295   3e-93    
emb|CAD21843.1|  ACC oxidase 1                                          293   6e-93    
gb|AFO63016.1|  ACC oxidase                                             293   1e-92    
gb|ABU23719.1|  1-aminocyclopropane-1-carboxylate oxidase               291   1e-92    
gb|AFF19571.1|  1-aminocyclopropane-1-carboxylate oxidase               293   2e-92    
gb|KHG24528.1|  1-aminocyclopropane-1-carboxylate oxidase               291   2e-92    



>ref|XP_007012867.1| 1-aminocyclopropane-1-carboxylate [Theobroma cacao]
 gb|EOY30486.1| 1-aminocyclopropane-1-carboxylate [Theobroma cacao]
Length=306

 Score =   466 bits (1200),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 261/303 (86%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVID  +L GE+RS+TM LLH ACE+WGFF V+NHGID +LME VK++V  +YE++L
Sbjct  1     MEIPVIDLDELHGEKRSQTMALLHEACEKWGFFQVDNHGIDMKLMERVKELVNTYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++VKC++NK ES+ + DWEST+FIWH PTSNINE+ N      KTM++YI QL
Sbjct  61    KESFYESEIVKCLKNK-ESMSNMDWESTFFIWHRPTSNINEIPNLSEEHCKTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEKN+IKE+F+GSKG ++GTKVA YP+CPNPELVRGLREHTDAG
Sbjct  120   IKLAEKLSELMCENLGLEKNYIKEAFTGSKGPAVGTKVAKYPQCPNPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+QVPGLEF KD  WV+IPPSKNN IFVNTGDQVE+LSNG YKS LHRVLA+ 
Sbjct  180   GIILLLQDEQVPGLEFLKDGAWVQIPPSKNNTIFVNTGDQVEVLSNGRYKSVLHRVLAEK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKLLYPN+  FQDYLK Y +TKF +K PRFE+MK + A
Sbjct  240   NGSRLSIATFYNPAGDALISPAPKLLYPNHYRFQDYLKLYSTTKFSEKDPRFESMKTM-A  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>ref|XP_009785509.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
sylvestris]
Length=301

 Score =   462 bits (1190),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFSKL GEERS TM LLHHACE+WGFFM+ENH ID  LM+NVK++V QHYE ++
Sbjct  1     MEIPVIDFSKLDGEERSATMALLHHACEKWGFFMIENHEIDTNLMDNVKQLVIQHYEANM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+RFY S++   +E KKE + + DWEST+F+WH P+SNI E++    +    ++ YI+QL
Sbjct  61    KKRFYKSELTMSLE-KKEKLSNTDWESTFFLWHRPSSNIYEIEGLSTDLCNAVDGYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             + +AE LSELMCENLGLEK++IKE+FSGSKG S+GTKVAIYP+CP PELVRGLREHTDAG
Sbjct  120   INLAENLSELMCENLGLEKSYIKEAFSGSKGPSVGTKVAIYPQCPRPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+QVPGLEFFKD  WVKIPPSKNNRIFVNTGDQ+EILSNGMYKS  HRV+A+ 
Sbjct  180   GIILLLQDEQVPGLEFFKDGHWVKIPPSKNNRIFVNTGDQIEILSNGMYKSIQHRVMAEK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DGNRLSIATFYNPA +A+ISPAPKLLYP ++ FQDYL  Y  TKF +KGPRFE+ K L A
Sbjct  240   DGNRLSIATFYNPAGEAIISPAPKLLYPCHLRFQDYLNLYSKTKFAEKGPRFESAKTL-A  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>ref|XP_002514144.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF48098.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=308

 Score =   462 bits (1190),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 256/304 (84%), Gaps = 2/304 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS+L GE RSK + +L  ACE+WGFF VENHGID++LME VK++V  HYE +L
Sbjct  1     MEIPVIDFSQLKGENRSKMLAVLQEACEKWGFFQVENHGIDKKLMEKVKQLVNSHYEQNL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K ++NK  +  D DWES+YFIWH PTSNIN++ N   +F K+M++YI QL
Sbjct  61    KETFYKSEIAKRLDNKGNT-SDIDWESSYFIWHRPTSNINDIPNLQEDFGKSMDEYITQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +++AE++SELMCENLGLEK+ IKE+FSG  G S+GTKVA YP CP PELVRGLREHTDAG
Sbjct  120   IELAEKISELMCENLGLEKDDIKEAFSGDGGPSVGTKVAKYPRCPQPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF KD +WV+IPPSKNNRIFVNTGDQ+E+LSNG YKSTLHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFLKDGEWVEIPPSKNNRIFVNTGDQLEVLSNGRYKSTLHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL-Q  184
             +G+RLSIATFYNPA DA+ISPAPKLLYPNN  FQDYLK Y +TKF DKGPRFE+MKK+  
Sbjct  240   NGSRLSIATFYNPAGDAIISPAPKLLYPNNYTFQDYLKLYSTTKFLDKGPRFESMKKMTN  299

Query  183   ANGH  172
              NGH
Sbjct  300   GNGH  303



>ref|XP_009627991.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
tomentosiformis]
Length=301

 Score =   462 bits (1189),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 258/303 (85%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFSKL GE+RS TM LLH ACE+WGFFM+ENHGID  LM+NVK++V QHYE ++
Sbjct  1     MEIPVIDFSKLEGEDRSATMALLHRACEKWGFFMIENHGIDTNLMDNVKQLVIQHYEANM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+RFY S++   +E KKESI + DWEST+F+WH P+SNI E++    +  K ++ YI+QL
Sbjct  61    KQRFYESELPMSLE-KKESISNTDWESTFFLWHRPSSNIYEIEGLSKDLCKAVDGYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE LSELMCENLGLEK++IKE+FSGS+G S+GTKVAIYP+CP PELVRGLREHTDAG
Sbjct  120   IKLAENLSELMCENLGLEKSYIKEAFSGSQGPSVGTKVAIYPQCPRPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD++VPGLEFFKD  WVKIPPSKNNRIFVNTGDQ+EILSNGMYKS  HRV+A+ 
Sbjct  180   GIILLLQDEKVPGLEFFKDGHWVKIPPSKNNRIFVNTGDQIEILSNGMYKSIQHRVMAEK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DGNRLSIATFYNPA +A+ISPA KLLYP ++ FQDYL  Y  TKF +KGPRFE+ K L A
Sbjct  240   DGNRLSIATFYNPAGEAIISPASKLLYPCHLRFQDYLNLYSKTKFAEKGPRFESAKTL-A  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>gb|KDP33817.1| hypothetical protein JCGZ_07388 [Jatropha curcas]
Length=306

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 215/303 (71%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS+  GE RSK M  LH ACE+WGFF++ENH IDRELME VK++V  HYE++L
Sbjct  1     MEIPVIDFSEFNGENRSKMMATLHEACEKWGFFLIENHEIDRELMEKVKQLVNSHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+RFY S++ K + NK  +  D DWESTYFIWH PTSNI+E+ N P  F K+M++YI QL
Sbjct  61    KKRFYESEIAKRLNNKGNA-SDIDWESTYFIWHRPTSNIHEIPNLPEGFCKSMDEYITQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE++SELMCENLGLE+++IKE+FSG KG S+GTKVA YP+C  PELVRGLREHTDAG
Sbjct  120   IKMAEKISELMCENLGLEEDYIKEAFSGKKGPSVGTKVAKYPQCSQPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF KD QWV+IPPSKNNRIFVNTGDQ+E+LSNG YKS LHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFCKDGQWVEIPPSKNNRIFVNTGDQLEVLSNGRYKSALHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKL+YP++  FQDYLK Y +TKF DKGPRFE+MKK+  
Sbjct  240   NGSRLSIATFYNPAGDAIISPAPKLMYPSSYSFQDYLKLYATTKFSDKGPRFESMKKM-T  298

Query  180   NGH  172
             NG 
Sbjct  299   NGQ  301



>ref|XP_011077965.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Sesamum 
indicum]
Length=309

 Score =   457 bits (1176),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 255/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPV+DFSKL GEERS+TM  LH AC +WGFFM+ENHGID ELM+ VK +V +HYE++L
Sbjct  1     MEIPVLDFSKLEGEERSETMASLHDACAKWGFFMIENHGIDVELMKKVKLLVNRHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S++ K +EN    I D DWESTYFIWH P SNINEL +   +    M+ YI+QL
Sbjct  61    KASFYDSEMAKNLENGG-YISDKDWESTYFIWHRPCSNINELTSLSGDLHNAMDDYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +KVAE++SEL+CENLG+EKNHI E+FSGS+G S+GTKVAIYP+CP+PE +RGLREHTDAG
Sbjct  120   IKVAEKISELICENLGIEKNHIMEAFSGSRGPSVGTKVAIYPQCPHPEHIRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +WVKIPPSKNNR+FVNTGDQVEILSNG YKS LHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFFKDGKWVKIPPSKNNRLFVNTGDQVEILSNGAYKSALHRVMAMK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DGNRLSIATFYNPA DA+ISPAPKLL P++ CF+DYL  Y  TKFGDK  RF+++K + A
Sbjct  240   DGNRLSIATFYNPAGDAIISPAPKLLLPSHYCFRDYLNLYTKTKFGDKDLRFQSLKNM-A  298

Query  180   NGH*SAL  160
             NGH S L
Sbjct  299   NGHPSIL  305



>ref|XP_006451440.1| hypothetical protein CICLE_v10008993mg [Citrus clementina]
 ref|XP_006475453.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Citrus 
sinensis]
 gb|ESR64680.1| hypothetical protein CICLE_v10008993mg [Citrus clementina]
 gb|KDO57731.1| hypothetical protein CISIN_1g021636mg [Citrus sinensis]
Length=310

 Score =   457 bits (1175),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 258/305 (85%), Gaps = 2/305 (1%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             E+ IPVIDF++L GE R KTM LLH ACE+WGFF V+NHGID++LME VK++V  HYE+ 
Sbjct  2     EIPIPVIDFNELEGENRKKTMALLHQACEKWGFFQVDNHGIDKKLMEKVKQLVNSHYEEY  61

Query  903   LKERFYASDVVKCVENK-KESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIE  727
             LK  FY S++VK +E + K +IRD DWEST+FIWH P+SNINE++N   +F  TME YI 
Sbjct  62    LKGGFYDSELVKSLEKENKNNIRDVDWESTFFIWHRPSSNINEIRNLSEDFRNTMEDYIA  121

Query  726   QLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTD  547
             QL+K+AE+LSELMCENLGLEK++IK +FSG KG S+GTKVA YP+CP PELVRGLREHTD
Sbjct  122   QLIKLAEKLSELMCENLGLEKSYIKNAFSGEKGPSVGTKVAKYPQCPYPELVRGLREHTD  181

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
             AGGIILLLQDDQVPGLEFFKD +WVKIPPS+NN IFVNTGDQVE+LSNG Y+S LHRV+ 
Sbjct  182   AGGIILLLQDDQVPGLEFFKDGEWVKIPPSRNNTIFVNTGDQVEVLSNGRYQSALHRVMP  241

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             + +G+RLSIATFYNPA+DA+ISPA KLLYP+   FQDYLK YG+TKF DK PR E+MK++
Sbjct  242   EKNGSRLSIATFYNPANDAIISPAIKLLYPSYYSFQDYLKLYGTTKFSDKVPRLESMKEI  301

Query  186   QANGH  172
              ANGH
Sbjct  302   -ANGH  305



>ref|XP_002309227.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|EEE92750.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
Length=303

 Score =   456 bits (1174),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 214/303 (71%), Positives = 253/303 (83%), Gaps = 5/303 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVID S+L GE RSKTM LLH ACE+WGFF VENHG++++LM+ VK++V  HYE++L
Sbjct  1     MEIPVIDLSQLEGENRSKTMALLHQACEKWGFFQVENHGLEKKLMDKVKQLVNAHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K + NK     D DWES++FIWH PTSNINE+ N   N  + M++YI QL
Sbjct  61    KESFYESEIAKGLMNKG----DVDWESSFFIWHRPTSNINEIHNLSENLRQIMDEYIAQL  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +++AE+LS+LM ENLGL+K++IKESFSG+KG S+GTKVA YPECP PELVRGLREHTDAG
Sbjct  117   IQLAEKLSQLMSENLGLDKDYIKESFSGAKGPSVGTKVAKYPECPRPELVRGLREHTDAG  176

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+ VPGLEF  D  W+KIPPSKNN IFVNTGDQVE+LSNG YKSTLHRV+A  
Sbjct  177   GIILLLQDEHVPGLEFSNDGGWIKIPPSKNNTIFVNTGDQVEVLSNGRYKSTLHRVMAGK  236

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DG+RLSIATFYNPA DA+ISPAPKL YP+N  FQDYLK Y +TKF DKGPRFEAMKK+ A
Sbjct  237   DGSRLSIATFYNPAGDAIISPAPKLSYPHNYTFQDYLKLYATTKFSDKGPRFEAMKKI-A  295

Query  180   NGH  172
             NGH
Sbjct  296   NGH  298



>gb|AAX84675.1| ACC oxidase ACCO2 [Manihot esculenta]
Length=306

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 215/303 (71%), Positives = 253/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS+L GE RSK M LLH ACE+WGFF VENHGID+ LME VK++V  HYE++L
Sbjct  1     MEIPVIDFSELNGENRSKMMGLLHEACEKWGFFQVENHGIDKSLMEKVKQLVNFHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             +E FYAS + K + N   +  D DWES+YFIWH PTSNI+E+ N P  F K M++YI QL
Sbjct  61    EESFYASAIAKRLNNPGNT-SDIDWESSYFIWHRPTSNISEIPNLPQEFCKWMDEYITQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE++SEL+ ENLGLEK+HIKE F G +G S+GTKVA YP+CP PELVRGLREHTDAG
Sbjct  120   IKLAEKISELISENLGLEKDHIKEVFKGDRGPSVGTKVAKYPKCPQPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF KD +WV+IPPSKNNRIF+NTGDQ+E+LSNG YKS LHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFLKDGKWVEIPPSKNNRIFINTGDQLEVLSNGRYKSALHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKLLYP+N  FQDYLK Y +TKF DK PRFE+MKK+ A
Sbjct  240   NGSRLSIATFYNPAGDAIISPAPKLLYPSNYSFQDYLKLYATTKFLDKEPRFESMKKM-A  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>gb|EYU27306.1| hypothetical protein MIMGU_mgv1a025521mg [Erythranthe guttata]
Length=309

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 253/302 (84%), Gaps = 2/302 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS+L GE+RS TM LLH ACE+WGFFM+ENHGID+++ME VK ++  HYE ++
Sbjct  1     MEIPVIDFSELDGEKRSNTMVLLHEACEKWGFFMIENHGIDKDIMEKVKLLMNTHYEVNM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY SD  K +E+  E I+D DWEST+F+WH P SNIN+L     +  K M++YIEQL
Sbjct  61    KESFYNSDTAKKMESN-EFIKDKDWESTFFVWHRPNSNINDLSGLSKDLQKAMDEYIEQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE LSELMCENLG++K+ IK++FSGS G ++GTK A+YP+CPNPEL+RGLREHTDAG
Sbjct  120   IKLAENLSELMCENLGIDKDRIKDAFSGSVGPTVGTKAAVYPQCPNPELIRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +WVKIPPSKNNRIF+NTGDQ+EILSNG+YKS LHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFFKDGKWVKIPPSKNNRIFINTGDQIEILSNGVYKSALHRVMAMK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DGNRLSIATFYNP  DA+ISPAP+LL PN V F+DYL  Y  TKFGDKG RF+++K + A
Sbjct  240   DGNRLSIATFYNPCGDAVISPAPELLLPNCVRFRDYLSFYSKTKFGDKGFRFQSLKNM-A  298

Query  180   NG  175
             NG
Sbjct  299   NG  300



>dbj|BAG15873.1| ACC oxidase [Bruguiera gymnorhiza]
Length=306

 Score =   452 bits (1163),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 251/302 (83%), Gaps = 2/302 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +  GE+RSKTM LLH ACE+WGFFMV+NHGID  LME VK++V  HYE++L
Sbjct  1     MEIPVIRLDEADGEDRSKTMSLLHQACEKWGFFMVDNHGIDEVLMEKVKQLVNCHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++   + N  E+  D DWEST+FIWH P SNI+E+   P N  K M++YI QL
Sbjct  61    KESFYESEIANKL-NNNENTPDTDWESTFFIWHRPKSNIHEIPKLPGNLCKAMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK HIKE+FSGSKG S+GTKVA YP+CP PELVRGLREHTDAG
Sbjct  120   IKLAEKLSELMCENLGLEKCHIKEAFSGSKGPSVGTKVAKYPQCPQPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD+VPGLEF KD +WV+IPPSKNN IFVNTGDQ+E+LSNG YKS LHRV+A  
Sbjct  180   GIILLLQDDRVPGLEFLKDGEWVEIPPSKNNTIFVNTGDQIEVLSNGRYKSALHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA+DA+ISP+P+LLYPNN  FQ+YLKHY ++KF DK PRFE MKK+ A
Sbjct  240   NGSRLSIATFYNPANDAIISPSPRLLYPNNYSFQEYLKHYATSKFADKEPRFEHMKKM-A  298

Query  180   NG  175
             NG
Sbjct  299   NG  300



>ref|XP_009352635.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Pyrus 
x bretschneideri]
Length=305

 Score =   451 bits (1161),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 253/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF++L GE RSKTM LLH ACE+WGFF VENHGID++LM+ VK+++ ++YE++L
Sbjct  1     MEIPVIDFNELNGEARSKTMALLHQACEKWGFFQVENHGIDKKLMDKVKQLINEYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             +E FY S++ K ++  +E   + DWES++FIWH PTSNI  + NF  +  KTM +YI QL
Sbjct  61    RESFYKSEIAKSLD--QEVTSEVDWESSFFIWHRPTSNIEGIPNFSEDHCKTMNEYIAQL  118

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK HIK++FSG KG S+GTKVA YP+CP PELVRGLREHTDAG
Sbjct  119   IKMAEKLSELMCENLGLEKGHIKDAFSGGKGPSVGTKVAKYPQCPQPELVRGLREHTDAG  178

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF KD +W  IPPSKNN +FVN GDQVE+LSNG YKS LHRVLA  
Sbjct  179   GIILLLQDDQVPGLEFLKDGEWFAIPPSKNNTMFVNIGDQVEVLSNGRYKSVLHRVLADK  238

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKLLYPN++ FQDYLKHY +TKF DKG RFE MK++ A
Sbjct  239   NGSRLSIATFYNPAGDAIISPAPKLLYPNHLRFQDYLKHYATTKFSDKGLRFETMKQM-A  297

Query  180   NGH  172
             N H
Sbjct  298   NNH  300



>ref|XP_011010059.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Populus 
euphratica]
Length=303

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 212/303 (70%), Positives = 252/303 (83%), Gaps = 5/303 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVID S+L GE RSKTM LLH ACE+WGFF VENHG++++LM+ VK++V  HYE++L
Sbjct  1     MEIPVIDLSQLEGENRSKTMALLHQACEKWGFFQVENHGLEKKLMDKVKQLVNAHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K + NK     D DWES++FIWH PTSNINE+ N   N  + M++YI QL
Sbjct  61    KESFYESEIAKGLMNK----CDVDWESSFFIWHRPTSNINEIHNLSENLRQIMDEYIAQL  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +++AE+LS+LM ENLGL+K++IKE FSG+KG S+GTKVA YPECP PELVRGLREHTDAG
Sbjct  117   IQLAEKLSQLMSENLGLDKDYIKEKFSGAKGPSVGTKVAKYPECPRPELVRGLREHTDAG  176

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+ VPGLEF  D  W+KIPPSKNN IFVNTGDQVE+LSNG YKSTLHRV+A  
Sbjct  177   GIILLLQDEHVPGLEFSNDGGWIKIPPSKNNTIFVNTGDQVEVLSNGRYKSTLHRVMAGK  236

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKL YP+N  FQDYLK Y +TKF DKGPRFEAMKK+ A
Sbjct  237   EGSRLSIATFYNPAGDAIISPAPKLSYPHNYTFQDYLKLYATTKFSDKGPRFEAMKKI-A  295

Query  180   NGH  172
             NGH
Sbjct  296   NGH  298



>ref|XP_004287539.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 250/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF ++ GEER KTM LLH ACE+WGFF +ENHGID++LM+ VK++V  +YE++L
Sbjct  1     MEIPVIDFGEINGEERGKTMALLHQACEQWGFFQIENHGIDKQLMDKVKQLVNAYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ + +E  K+   D DWE+T+F+WH PTSNI  + N   +  KTM +YI QL
Sbjct  61    KESFYQSEIARSLE--KDDTSDKDWETTFFVWHRPTSNIEAIPNISEDLCKTMNEYIAQL  118

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             + +AE+LSELMCENLGLEK+ IK +FSGSKG S+GTKVA YP+C  PE VRGLREHTDAG
Sbjct  119   INLAEKLSELMCENLGLEKDDIKNAFSGSKGPSVGTKVAKYPQCSQPERVRGLREHTDAG  178

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +WV IPPSKNN IFVNTGDQ+E+LSNG YKSTLHRVL   
Sbjct  179   GIILLLQDDQVPGLEFFKDGKWVAIPPSKNNTIFVNTGDQLEVLSNGRYKSTLHRVLTDK  238

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKLLYPN+  FQDYL  Y +TKF DKGPRFE+MK++ A
Sbjct  239   NGSRLSIATFYNPAGDALISPAPKLLYPNSFRFQDYLNLYAATKFNDKGPRFESMKQM-A  297

Query  180   NGH  172
             NG+
Sbjct  298   NGN  300



>ref|XP_008242414.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Prunus 
mume]
Length=300

 Score =   447 bits (1151),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 251/300 (84%), Gaps = 2/300 (1%)
 Frame = -2

Query  1086  REMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYED  907
             +EM IPVIDF +L GEERSKTM LLH ACE+WGFF VENHGID++LME VK+++ ++YE+
Sbjct  2     KEMGIPVIDFGELNGEERSKTMDLLHQACEKWGFFQVENHGIDKQLMEKVKQLINKYYEE  61

Query  906   SLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIE  727
             +LKE FY S++ K +E    S  + DWES++FIWH PTSNI ++ N  ++   TM +YI 
Sbjct  62    NLKESFYKSEMAKSLEQDITS--EKDWESSFFIWHRPTSNIEDIPNLSDDLRITMNEYIP  119

Query  726   QLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTD  547
             QL+K+AE+LSELMCENLGL+K +IK++F   KG S+GTKVA YP+CP PELVRGLREHTD
Sbjct  120   QLIKMAEKLSELMCENLGLKKGYIKDAFCAGKGPSVGTKVAKYPQCPQPELVRGLREHTD  179

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
             AGGIILLLQDDQVPGLEFFKD +WV IPPSKNNRIFVN GDQVE+LSNG YKS LHRV+A
Sbjct  180   AGGIILLLQDDQVPGLEFFKDGEWVAIPPSKNNRIFVNIGDQVEVLSNGRYKSVLHRVMA  239

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               +G+RLSIATFYNPA DA+ISPAP+LLYPN+V FQDYLK Y +TKF DKG RFE+MK++
Sbjct  240   DKNGSRLSIATFYNPAGDAIISPAPRLLYPNHVRFQDYLKFYATTKFSDKGRRFESMKQI  299



>emb|CDP21221.1| unnamed protein product [Coffea canephora]
 emb|CDP03180.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   447 bits (1151),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 246/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF K+ GE R +T+ LLH ACE+WGFFM+ENH ID ELM  VK +V QHYE ++
Sbjct  1     MEIPVIDFKKIEGESRKETLSLLHQACEKWGFFMIENHSIDVELMVKVKALVNQHYEQNM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K RFY SDV K + +K E  R+ DWES +FIWH P SNIN+  N P +F KTM++YI+QL
Sbjct  61    KGRFYNSDVAKSLVDK-EITRNIDWESAFFIWHRPVSNINQFANLPMDFQKTMDEYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE LSELM ENLGLEK+ IK++FSGSKG S+GTKVA YP CP PE VRGLREHTDAG
Sbjct  120   IKLAETLSELMSENLGLEKSFIKQAFSGSKGPSVGTKVAKYPRCPRPEQVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD+VPGLEFFKD +WV+IPPSKNNRIFVNTGDQ+E+LSNG+YKS LHRV+A  
Sbjct  180   GIILLLQDDEVPGLEFFKDGEWVEIPPSKNNRIFVNTGDQLEVLSNGIYKSALHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPA KLL+P    FQ+YLK Y  TKF DK PR E+MKKL  
Sbjct  240   NGSRLSIATFYNPAGDAIISPASKLLHPGGFSFQEYLKIYAETKFADKAPRLESMKKL-T  298

Query  180   NG  175
             NG
Sbjct  299   NG  300



>ref|XP_002279746.3| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Vitis 
vinifera]
 emb|CBI27928.3| unnamed protein product [Vitis vinifera]
 gb|AFU66006.1| 1-aminocyclopropane-1-carboxylic acid oxidase 3 [Vitis vinifera]
Length=306

 Score =   447 bits (1150),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 251/303 (83%), Gaps = 1/303 (0%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME+P+IDF KL GE+R++T  LLH ACE+WGFF ++NHG+D++LME VK +V  HYE+ +
Sbjct  1     MEVPMIDFDKLDGEKRAETKALLHQACEKWGFFQIDNHGVDKKLMEKVKHLVNTHYEEIM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S++ K +E+K E+  + DWES++F+WH PTSNI+E  N   +  KTM++YI QL
Sbjct  61    KRSFYESEIAKALEDK-ETASNIDWESSFFLWHRPTSNIDEFTNISEDLRKTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AE+LSELMCENLGLEK +I+E+FSG+ G S+GTKVA YP+CP PELVRGLREHTDAG
Sbjct  120   FKLAEKLSELMCENLGLEKGYIREAFSGNAGPSVGTKVAKYPQCPRPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF+KD +WV IPPSKNN IFVNTGDQ+E+LSNG YKSTLHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFYKDGEWVVIPPSKNNTIFVNTGDQIEVLSNGRYKSTLHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNP+ DA+ISPAPKLLYP++  FQDYLK Y +TKF DKGPRFE+MK +  
Sbjct  240   NGSRLSIATFYNPSGDAIISPAPKLLYPDHFRFQDYLKLYATTKFADKGPRFESMKNMAI  299

Query  180   NGH  172
               H
Sbjct  300   GHH  302



>gb|EYU27232.1| hypothetical protein MIMGU_mgv1a024882mg [Erythranthe guttata]
Length=310

 Score =   447 bits (1150),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 249/300 (83%), Gaps = 2/300 (1%)
 Frame = -2

Query  1074  IPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKE  895
             IPVIDFS+L GE+RS TM LLH ACE+WGFFM+ENHGID+++ME VK ++  HYED++KE
Sbjct  4     IPVIDFSELDGEKRSNTMVLLHEACEKWGFFMIENHGIDKDIMEKVKLLMNTHYEDNMKE  63

Query  894   RFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMK  715
              FY SD  K ++   E I+D DWEST+FIWH P SNIN+L     +  K M++YIEQL+K
Sbjct  64    SFYNSDTAKKMD-INEFIKDKDWESTFFIWHRPNSNINDLSGLSKDLQKAMDEYIEQLIK  122

Query  714   VAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGI  535
             +AE LSELMCENLG++K+ IK++FSGS G ++GTK A+YP+CP PEL+RGLREHTDAGGI
Sbjct  123   LAENLSELMCENLGIDKDRIKDAFSGSVGPTVGTKAAVYPQCPKPELIRGLREHTDAGGI  182

Query  534   ILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG  355
             ILLLQDDQVPGLEFFKD +WVKIPPSKNNRIF+NT DQ+EILSNG+YKS LHRV+A  DG
Sbjct  183   ILLLQDDQVPGLEFFKDGKWVKIPPSKNNRIFINTRDQIEILSNGVYKSALHRVMAMKDG  242

Query  354   NRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQANG  175
             NRLSIATFYNP  DA+ISPAP+LL PN V FQDYL  Y  TKFGDKG RF+++K + ANG
Sbjct  243   NRLSIATFYNPCGDAVISPAPELLLPNCVRFQDYLSFYSKTKFGDKGFRFQSLKNM-ANG  301



>ref|NP_001234037.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
 emb|CAG29395.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
Length=301

 Score =   447 bits (1149),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 250/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME+PVIDFSKL GEER  TM LLH ACE+WGFFM+ENHGID  LM+NVK+ V QHYE ++
Sbjct  1     MEMPVIDFSKLEGEERCATMSLLHQACEKWGFFMIENHGIDSYLMDNVKQFVNQHYEANM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+RFY S++   +E K  +I + DWEST+F+WH P SNI E++       K ++ YI+QL
Sbjct  61    KKRFYESELPMSLE-KNGNISNTDWESTFFVWHRPASNIYEIQGLSKELCKAVDDYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE LSELMCENLGL K++IKE+FSGSKG S+GTKVAIYP+CP P+LVRGLREHTDAG
Sbjct  120   IKLAENLSELMCENLGLAKSYIKEAFSGSKGPSVGTKVAIYPQCPRPDLVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+QVPGLEFFKD  WV IPPSKNNR+FVN GDQ+EIL+NGMYKS  HRV+A+ 
Sbjct  180   GIILLLQDEQVPGLEFFKDGHWVNIPPSKNNRLFVNIGDQIEILTNGMYKSIRHRVMAEK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DGNRLSIATFYNPA +A+ISPA KLLYP ++ FQDYL  Y  TKF +KGPRFE+ K+L A
Sbjct  240   DGNRLSIATFYNPAGEAIISPASKLLYPCHLRFQDYLNLYSKTKFAEKGPRFESAKRL-A  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>ref|XP_007202367.1| hypothetical protein PRUPE_ppa009228mg [Prunus persica]
 gb|EMJ03566.1| hypothetical protein PRUPE_ppa009228mg [Prunus persica]
Length=300

 Score =   447 bits (1149),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 250/300 (83%), Gaps = 2/300 (1%)
 Frame = -2

Query  1086  REMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYED  907
             +EM IPVIDF +L GEERSKTM LLH ACE+WGFF VENHGID++LME VK+++ ++YE+
Sbjct  2     KEMGIPVIDFDELNGEERSKTMDLLHQACEKWGFFQVENHGIDKQLMEKVKQLINKYYEE  61

Query  906   SLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIE  727
             +LKE FY S++ K +E    S  + DWES++FIWH PTSNI ++ N  ++   TM +YI 
Sbjct  62    NLKESFYKSEMAKSLEQDITS--EKDWESSFFIWHRPTSNIEDIPNLSDDLRITMNEYIP  119

Query  726   QLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTD  547
             QL+K+AE+LSELMCENLGL K +IK++F   KG S+GTKVA YP+CP PELVRGLREHTD
Sbjct  120   QLIKMAEKLSELMCENLGLNKGYIKDAFCAGKGPSVGTKVAKYPQCPQPELVRGLREHTD  179

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
             AGGIILLLQDDQVPGLEFFKD +WV IPPSKNNRIFVN GDQVE+LSNG YKS LHRV+A
Sbjct  180   AGGIILLLQDDQVPGLEFFKDGEWVAIPPSKNNRIFVNIGDQVEVLSNGRYKSVLHRVMA  239

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               +G+RLSIATFYNPA DA+ISPAP+LLYPN+V FQDYLK Y +TKF DKG RFE+MK++
Sbjct  240   DKNGSRLSIATFYNPAGDAIISPAPRLLYPNHVRFQDYLKFYATTKFSDKGRRFESMKQI  299



>ref|XP_010262178.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Nelumbo 
nucifera]
Length=302

 Score =   447 bits (1149),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 203/302 (67%), Positives = 254/302 (84%), Gaps = 2/302 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M+IPV+DF+ L GE+RS+TM LLH ACE+WGFF V NHG+D ELME VK++V +HY+   
Sbjct  1     MDIPVVDFNGLNGEKRSETMALLHQACEKWGFFQVVNHGVDGELMEKVKQLVNKHYDKCT  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E++  +  D DWE+T+FIWH PTSNI+E K+    F + M++YI+Q+
Sbjct  61    KESFYESEIAKGLESRGVT-SDVDWETTFFIWHRPTSNIDEFKDLSKEFREAMDEYIKQV  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK+++  +FSG+ G S+GTK+A YP+CP PEL+RGLREHTDAG
Sbjct  120   IKLAEKLSELMCENLGLEKSYLMNAFSGTAGPSVGTKLAKYPQCPRPELIRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +WV+IPPSK+N IFVNTGDQVE+LSNGMYKS LHRV+A  
Sbjct  180   GIILLLQDDQVPGLEFFKDGKWVQIPPSKDNTIFVNTGDQVEVLSNGMYKSALHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DG+RLSIATFYNP  DA+ISPAPKLLYP++ C+QDYLK Y +TKF DKG RFE+MKK+ A
Sbjct  240   DGSRLSIATFYNPTGDAIISPAPKLLYPSHYCYQDYLKLYSATKFTDKGSRFESMKKM-A  298

Query  180   NG  175
             NG
Sbjct  299   NG  300



>ref|NP_179549.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Arabidopsis thaliana]
 sp|Q9ZUN4.1|ACCO1_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; Short=AtACO1 [Arabidopsis thaliana]
 gb|AAK44010.1|AF370195_1 putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
 gb|AAD10157.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis thaliana]
 gb|AAL33783.1| putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
 gb|AEC06898.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Arabidopsis thaliana]
Length=310

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 247/301 (82%), Gaps = 2/301 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF++L GE+RSKTM LL HAC++WGFFMV+NHGID+ELME VKKM+  HYE
Sbjct  6     EREMEIPVIDFAELDGEKRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWES++FI H PTSNI ++ N     SKTM++Y+
Sbjct  66    EHLKEKFYQSEMVKALSEGKTS--DADWESSFFISHKPTSNICQIPNISEELSKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL++  I  +FSG KG + GTKVA YPECP PEL+RGLREHT
Sbjct  124   CQLHKFAERLSKLMCENLGLDQEDIMNAFSGPKGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEFFKD +WV IPPSKNN IFVNTGDQ+EILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDKGPR E MKK
Sbjct  244   TVKHGSRLSIATFYNPAGDAIISPAPKLLYPSGYRFQDYLKLYSTTKFGDKGPRLETMKK  303

Query  189   L  187
             +
Sbjct  304   M  304



>ref|XP_010090031.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Morus notabilis]
 gb|EXB38828.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Morus notabilis]
Length=306

 Score =   445 bits (1145),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/302 (69%), Positives = 252/302 (83%), Gaps = 2/302 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF++L G++RS+TM LLH ACE+WG F + +HGID +LME VK++V  HYE +L
Sbjct  1     MEIPVIDFNELNGDKRSETMALLHQACEKWGCFQIRSHGIDTKLMERVKQLVNIHYEQNL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K++FY S++ K  E+K  +  D DWES++FIWH P SN+ E +N P +F  T+++YI QL
Sbjct  61    KKQFYESEIAKRFESKGHT-SDVDWESSFFIWHRPISNMEEFENLPKDFCSTVDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK+ IK +FSG+KG S+GTKVA YP+CPNPELVRGLREHTDAG
Sbjct  120   LKLAEKLSELMCENLGLEKDFIKSAFSGTKGPSVGTKVAKYPQCPNPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGL+F KD++W+ IPPSKNN IFVNTGDQVEILSNG YKS LHRV+A  
Sbjct  180   GIILLLQDDQVPGLQFLKDDEWIAIPPSKNNTIFVNTGDQVEILSNGRYKSVLHRVMADK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPA KLLYPN+  FQDYLK Y +TKF DK PRFEAMKK+  
Sbjct  240   NGSRLSIATFYNPAGDAIISPAQKLLYPNHFRFQDYLKLYATTKFADKAPRFEAMKKM-V  298

Query  180   NG  175
             NG
Sbjct  299   NG  300



>ref|XP_010242185.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 isoform 
X3 [Nelumbo nucifera]
Length=303

 Score =   445 bits (1145),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 204/298 (68%), Positives = 244/298 (82%), Gaps = 0/298 (0%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF++L G++RS+TM LLHHACE+WGFF V NHG+D ELME VK +   HY+  +
Sbjct  2     MEIPVIDFNELNGDKRSETMALLHHACEKWGFFQVVNHGVDGELMEKVKGLFNIHYDKCM  61

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S+  K +         ADWE+T+FI H PTSNI+E       F + M++YI+Q+
Sbjct  62    KGSFYESETAKRLMESGGVTSGADWETTFFICHRPTSNIDEFTALSKEFCEAMDEYIKQV  121

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK+++  +FSGS G S+GTK+A YP+CP PE VRGLREHTDAG
Sbjct  122   IKLAEKLSELMCENLGLEKSYLMSAFSGSAGPSVGTKLAKYPQCPQPEFVRGLREHTDAG  181

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKDEQWV+IPPSKNN +FVNTGDQVE+LSNG YKSTLHRV+A  
Sbjct  182   GIILLLQDDQVPGLEFFKDEQWVQIPPSKNNTLFVNTGDQVEVLSNGRYKSTLHRVMAGK  241

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             DG+RLSIATFYNPA DA+ISPAPKLLYPN+ CFQDYLK Y +TKF DKGPRFE+MKK+
Sbjct  242   DGSRLSIATFYNPAGDAIISPAPKLLYPNHYCFQDYLKLYATTKFADKGPRFESMKKI  299



>ref|XP_010242183.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 isoform 
X2 [Nelumbo nucifera]
Length=311

 Score =   445 bits (1145),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 204/298 (68%), Positives = 244/298 (82%), Gaps = 0/298 (0%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF++L G++RS+TM LLHHACE+WGFF V NHG+D ELME VK +   HY+  +
Sbjct  10    MEIPVIDFNELNGDKRSETMALLHHACEKWGFFQVVNHGVDGELMEKVKGLFNIHYDKCM  69

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S+  K +         ADWE+T+FI H PTSNI+E       F + M++YI+Q+
Sbjct  70    KGSFYESETAKRLMESGGVTSGADWETTFFICHRPTSNIDEFTALSKEFCEAMDEYIKQV  129

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK+++  +FSGS G S+GTK+A YP+CP PE VRGLREHTDAG
Sbjct  130   IKLAEKLSELMCENLGLEKSYLMSAFSGSAGPSVGTKLAKYPQCPQPEFVRGLREHTDAG  189

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKDEQWV+IPPSKNN +FVNTGDQVE+LSNG YKSTLHRV+A  
Sbjct  190   GIILLLQDDQVPGLEFFKDEQWVQIPPSKNNTLFVNTGDQVEVLSNGRYKSTLHRVMAGK  249

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             DG+RLSIATFYNPA DA+ISPAPKLLYPN+ CFQDYLK Y +TKF DKGPRFE+MKK+
Sbjct  250   DGSRLSIATFYNPAGDAIISPAPKLLYPNHYCFQDYLKLYATTKFADKGPRFESMKKI  307



>ref|XP_008337682.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Malus 
domestica]
Length=305

 Score =   444 bits (1143),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 250/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDF++L GE RSKTM LL  ACE+WGFF VENHGID++LM+ VK+++ ++YE++L
Sbjct  1     MEIPVIDFNELNGEARSKTMALLDQACEKWGFFQVENHGIDKKLMDKVKQLINEYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             +  FY S++ K ++  +E     DWES++FIWH PTSNI  + NF  +  KTM +YI QL
Sbjct  61    RASFYKSEIAKSLD--QEVTSKVDWESSFFIWHRPTSNIEGIPNFSEDHCKTMNEYIAQL  118

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGLEK HIK++FSG KG S+GTKVA YP+CP PELVRGLREHTDAG
Sbjct  119   IKMAEKLSELMCENLGLEKGHIKDAFSGGKGPSVGTKVAKYPQCPQPELVRGLREHTDAG  178

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF KD +W  IPPSKNN +FVN GDQVE+LSNG YKS LHRVLA  
Sbjct  179   GIILLLQDDQVPGLEFLKDGEWFAIPPSKNNTMFVNIGDQVEVLSNGRYKSVLHRVLADK  238

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNPA DA+ISPAPKLLYPN++ FQDYLKHY +TKF DKG RFE MK++  
Sbjct  239   NGSRLSIATFYNPAGDAIISPAPKLLYPNHLRFQDYLKHYATTKFSDKGLRFETMKQM-X  297

Query  180   NGH  172
             +GH
Sbjct  298   DGH  300



>ref|XP_010416898.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Camelina 
sativa]
Length=310

 Score =   444 bits (1143),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/306 (69%), Positives = 248/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF +L  E RSKTM LL HAC++WGFFMV+NHGID+ELM+ VKKM+  HYE
Sbjct  6     EREMEIPVIDFGELDRENRSKTMSLLDHACDKWGFFMVDNHGIDKELMDKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE FY S++VK +   + S  DADWES++FI H P SNI ++ N     SKTM++Y+
Sbjct  66    EHLKEEFYQSEMVKALSEGRTS--DADWESSFFISHKPASNICKIPNISEELSKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL++  + ++FSGSKG + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAERLSKLMCENLGLDEEDMTKAFSGSKGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEFFKD +W+ IPPSKNN IFVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFFKDGKWISIPPSKNNTIFVNTGDQVEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDKGPR E MKK
Sbjct  244   TVKQGSRLSIATFYNPAGDAIISPAPKLLYPSGFRFQDYLKLYSTTKFGDKGPRLETMKK  303

Query  189   LQANGH  172
             ++ NGH
Sbjct  304   ME-NGH  308



>emb|CAI51311.2| 1-aminocyclopropane-1-carboxylate oxidase [Capsicum chinense]
Length=301

 Score =   444 bits (1141),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 251/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFSKL G+ERS TM LL  ACE+WGFFM+ENHGID  LM+NVK++V QHYE ++
Sbjct  1     MEIPVIDFSKLEGDERSATMGLLRQACEKWGFFMIENHGIDIYLMDNVKQLVNQHYEANM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+RFY S+V   ++ KKE+I + DWEST+F+WH P+SNI E++       K ++ YI+QL
Sbjct  61    KKRFYESEVSISLQ-KKENISNTDWESTFFVWHRPSSNIYEIQGLSKELCKAVDAYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +++AE LSELMCENLGLEK++IKE+FS SKG S+GTKVAIYP+CP P+LVRGLREHTDAG
Sbjct  120   IELAENLSELMCENLGLEKSYIKEAFSRSKGPSVGTKVAIYPQCPRPDLVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+QVPGLEFFKD  WV IPPSKNNR+FVN GDQ+EILSNGMYKS  HRV+A+ 
Sbjct  180   GIILLLQDEQVPGLEFFKDGHWVDIPPSKNNRLFVNIGDQIEILSNGMYKSIQHRVMAEK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DGNRLSIA FYNP  +A+ISPAPKLLYP+++ F DYL  Y  TKF +KGPRFE  K L A
Sbjct  240   DGNRLSIAPFYNPNGEAIISPAPKLLYPSHLRFHDYLNLYSKTKFAEKGPRFEYAKTL-A  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>ref|XP_010489154.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Camelina 
sativa]
Length=310

 Score =   444 bits (1142),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 248/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIP +DF +L GE RSKTM LL HAC++WGFFMV+NHGID+ELME VKKM+  HYE
Sbjct  6     EREMEIPGVDFGELDGENRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE FY S++VK +   K S  DADWES++FI H PTSNI ++ N     SKTM++Y+
Sbjct  66    EHLKEEFYQSEMVKALSEGKTS--DADWESSFFISHKPTSNICKIPNISEELSKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL++  + ++FSGSKG + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAESLSKLMCENLGLDEEDMMKAFSGSKGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEFFKD +WV IPPSKNN IFVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQVEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDKG R E MKK
Sbjct  244   TVKQGSRLSIATFYNPAGDAIISPAPKLLYPSGFRFQDYLKLYSTTKFGDKGLRLETMKK  303

Query  189   LQANGH  172
             ++ NGH
Sbjct  304   ME-NGH  308



>ref|NP_001275149.1| ACC oxidase [Solanum tuberosum]
 gb|AAM29183.1| ACC oxidase [Solanum tuberosum]
Length=312

 Score =   442 bits (1137),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 248/301 (82%), Gaps = 2/301 (1%)
 Frame = -2

Query  1074  IPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKE  895
             IPVIDFSKL GEERS TM LLH ACE+WGFFM+ENHGID  LM+NVK++V QHYE ++K+
Sbjct  14    IPVIDFSKLEGEERSATMSLLHQACEKWGFFMIENHGIDTYLMDNVKQLVNQHYEANMKK  73

Query  894   RFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMK  715
             RFY S++   +E KK +I + DWEST+F+WH PTSNI E++       K ++ YI+QL++
Sbjct  74    RFYESELPMSLE-KKGNISNTDWESTFFVWHRPTSNIYEIQGLSKELCKAVDDYIDQLIE  132

Query  714   VAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGI  535
             +AE LSELMCENLGLEK+ IKE F  ++  S+GTKVAIYP+CP P+LVRGLREHTDAGGI
Sbjct  133   LAENLSELMCENLGLEKSCIKEHFQAARVPSVGTKVAIYPQCPRPDLVRGLREHTDAGGI  192

Query  534   ILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG  355
             ILLLQD+QVPGLEFFKD  WV IPPSKNNR+FVN GDQ+EILSNGMYKS  HRV+A+ DG
Sbjct  193   ILLLQDEQVPGLEFFKDGHWVNIPPSKNNRLFVNIGDQIEILSNGMYKSIRHRVMAEKDG  252

Query  354   NRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQANG  175
             NRLSIATFYNPA +A+ISPAPKLLYP ++ FQDYL  Y  TKF +KGPRFE+ K L ANG
Sbjct  253   NRLSIATFYNPAGEAIISPAPKLLYPCHLRFQDYLNLYSKTKFAEKGPRFESAKTL-ANG  311

Query  174   H  172
             H
Sbjct  312   H  312



>ref|XP_010495929.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Camelina 
sativa]
Length=310

 Score =   442 bits (1137),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 210/306 (69%), Positives = 247/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF +L GE R+KTM LL HAC++WGFF V+NHGID+ELME VK+M+  HYE
Sbjct  6     EREMEIPVIDFGELDGENRTKTMSLLDHACDKWGFFTVDNHGIDKELMEKVKQMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE FY S++VK +   K S  DADWES++FI H PTSNI ++ N     SKTM++Y+
Sbjct  66    EHLKEEFYQSEMVKALSEGKTS--DADWESSFFISHKPTSNICKIPNISEELSKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL++  + ++FSGSKG + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAESLSKLMCENLGLDEEDMMKAFSGSKGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEFFKD +WV IPPSKNN IFVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQVEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDK PR E MK 
Sbjct  244   TVKQGSRLSIATFYNPAGDAIISPAPKLLYPSGFRFQDYLKLYSTTKFGDKSPRLETMKN  303

Query  189   LQANGH  172
             ++ NGH
Sbjct  304   IE-NGH  308



>ref|XP_004288926.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Fragaria 
vesca subsp. vesca]
Length=307

 Score =   441 bits (1133),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 248/303 (82%), Gaps = 1/303 (0%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIP+IDF ++ GE RSKTM LLH ACE+WGFF ++N+GID++LME VK++V  HYE++L
Sbjct  1     MEIPIIDFGEINGEGRSKTMALLHQACEQWGFFQIDNYGIDKKLMEKVKQLVNAHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY SD+ +C+E K + I D DWE+ +++WH PTSNI E+ N   +F K M +YI QL
Sbjct  61    KESFYQSDIDRCLE-KDDDISDKDWETAFYVWHLPTSNIEEIPNISEDFCKAMNEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             + +AE+LSELMCENLGLEKN IK++FSGSKG  +GTKVA YP+C  PE VRGLREHTDAG
Sbjct  120   INLAEKLSELMCENLGLEKNDIKKAFSGSKGPCVGTKVAKYPKCSQPERVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIIL+LQ+DQ+PGLEFFKD +WV IPP K N IFVNTGD +E+L+NG YKST+HRV+   
Sbjct  180   GIILMLQEDQIPGLEFFKDGKWVPIPPCKKNTIFVNTGDLLEVLTNGRYKSTVHRVMTDK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DG+RLSIATFYNPA DA+ISPAPKLLYPN+  FQDYLK Y +TKF DKGPRFE MK++  
Sbjct  240   DGSRLSIATFYNPAGDALISPAPKLLYPNSFRFQDYLKLYATTKFNDKGPRFETMKQMAH  299

Query  180   NGH  172
             NG+
Sbjct  300   NGN  302



>emb|CDX81937.1| BnaC08g36640D [Brassica napus]
Length=310

 Score =   441 bits (1133),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/302 (68%), Positives = 243/302 (80%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDFS+L GE R KTM LL HAC++WGFFMV+NHG+D+ELME VKKM+  HYE
Sbjct  6     EREMEIPVIDFSELDGENRIKTMSLLDHACDKWGFFMVDNHGVDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             D LKE+FY S++ K +   K S  DADWES++FIWH PTSNI  + N  +   KTM++Y+
Sbjct  66    DHLKEKFYQSEMAKALSEGKTS--DADWESSFFIWHKPTSNICRIPNISDELIKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K+AE LS LMCENLGL + +I  +FSG +G + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKLAERLSNLMCENLGLSQEYITNAFSGPEGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEF KD +WV IPPSKNN IFVNTGDQ+EILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFLKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSAVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                DG RLS+ATFYNPA DA+ISPAP+LLYP+   FQDYLK Y +TKFGDKG RF  MKK
Sbjct  244   TLKDGCRLSLATFYNPAGDAVISPAPELLYPSGYQFQDYLKLYSTTKFGDKGSRFHTMKK  303

Query  189   LQ  184
             ++
Sbjct  304   ME  305



>ref|XP_006298182.1| hypothetical protein CARUB_v10014231mg [Capsella rubella]
 gb|EOA31080.1| hypothetical protein CARUB_v10014231mg [Capsella rubella]
Length=310

 Score =   441 bits (1133),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 245/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF +L GE RSKTM LL HAC++WGFFMV+NHGID+ELME VKK++  HYE
Sbjct  6     EREMEIPVIDFGELDGENRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKLINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE FY S++VK +     S  DADWES++FI H PTSNI ++ N     SKTM++Y+
Sbjct  66    EHLKEDFYQSEMVKALSEGNTS--DADWESSFFISHKPTSNICKIPNISEELSKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL++  I ++FSGSKG + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAERLSKLMCENLGLDQEDIIKAFSGSKGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEFFKD +WV IPPSKNN IF+NTGDQ+EILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFINTGDQLEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDK PR E MKK
Sbjct  244   TVKHGSRLSIATFYNPAGDAVISPAPKLLYPSGFQFQDYLKLYSTTKFGDKSPRLETMKK  303

Query  189   LQ  184
             ++
Sbjct  304   ME  305



>ref|XP_010523564.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Tarenaya 
hassleriana]
Length=308

 Score =   440 bits (1131),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 247/302 (82%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF +L GE R+KTM LL HACE+WG FMV+NHGID++LME VK+++  HYE
Sbjct  6     EREMEIPVIDFGELDGENRTKTMALLDHACEKWGCFMVDNHGIDKKLMEKVKQLINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWEST+FIWH P SNI E+ N      KTM++Y+
Sbjct  66    EHLKEKFYQSEIVKALSQGKSS--DADWESTFFIWHKPLSNICEIPNISEELCKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE+LS+LMCENLGL++++I ++F GSKG S GTKVA YPECP+PELVRGLREHT
Sbjct  124   SQLHKFAEKLSKLMCENLGLDEDYIMKAFHGSKGPSFGTKVAKYPECPHPELVRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGII LLQDD+VPGLEF KD  WV IPPSKNN +FVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIISLLQDDEVPGLEFLKDGNWVPIPPSKNNTLFVNTGDQVEILSNGRYKSFIHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP++  FQDYLK Y STKFG+KG RFE MKK
Sbjct  244   TVKKGSRLSIATFYNPAGDAIISPAPKLLYPSSFRFQDYLKLYSSTKFGNKGSRFETMKK  303

Query  189   LQ  184
             L+
Sbjct  304   LE  305



>emb|CDY21655.1| BnaA09g44060D [Brassica napus]
Length=310

 Score =   439 bits (1130),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 242/300 (81%), Gaps = 2/300 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDFS+L GE R KTM LL HAC++WGFFMV+NHG+D+ELME VKKM+  HYE
Sbjct  6     EREMEIPVIDFSELDGENRIKTMSLLDHACDKWGFFMVDNHGVDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             D LKE+FY S++VK +   K S  DADWES++FIWH PTS+I ++ N  +   KTM++Y+
Sbjct  66    DHLKEKFYQSEMVKALSEGKTS--DADWESSFFIWHKPTSSICKIPNISDELIKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS LMCENLGL + +I  +FSG +G + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAERLSNLMCENLGLSQEYITNAFSGPEGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEF KD +WV IPPSKNN IFVNTGDQ+EILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFLKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSAVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                DG RLSIATFYNPA DA+ISPAP+LLYP+   FQDYLK Y +TKFGDKG RF  MKK
Sbjct  244   TVKDGCRLSIATFYNPAGDAVISPAPELLYPSGYQFQDYLKLYSTTKFGDKGSRFHTMKK  303



>ref|XP_009102154.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Brassica 
rapa]
Length=310

 Score =   439 bits (1128),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 203/302 (67%), Positives = 246/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             ++EMEIPVIDFS+L GE R+KTM LL HAC++WGFFMV+NHGID+ELM+ VK+++  HYE
Sbjct  6     EKEMEIPVIDFSELDGENRTKTMSLLDHACDKWGFFMVDNHGIDKELMDKVKQLINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWEST+F+WH PTSNI+++ N  +   KTM++Y+
Sbjct  66    EHLKEKFYQSEMVKALSEGKTS--DADWESTFFVWHKPTSNISKVSNISDELIKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL + HI  +FSG +G   GTKVA YPECP+PEL+RGLREHT
Sbjct  124   SQLHKFAERLSKLMCENLGLPREHIVNAFSGIEGPVFGTKVAKYPECPHPELIRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEF KD +WV IPPSKNN IFVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFLKDGKWVPIPPSKNNTIFVNTGDQVEILSNGKYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPA ++LYP+   FQDYLK Y +TKFGDKG RF  MKK
Sbjct  244   TMKQGSRLSIATFYNPAGDAIISPAQEMLYPSGYRFQDYLKLYSTTKFGDKGSRFNTMKK  303

Query  189   LQ  184
             ++
Sbjct  304   ME  305



>gb|KFK40326.1| hypothetical protein AALP_AA3G360100 [Arabis alpina]
Length=310

 Score =   439 bits (1128),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 207/302 (69%), Positives = 244/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +RE+EIPVIDF +L GE RSKTM LL HAC++WGFFM++NHGID+ELME VKKM+  HYE
Sbjct  6     EREIEIPVIDFGELDGENRSKTMSLLDHACDKWGFFMIDNHGIDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWES +FI H PTSNI+E+ N     SK M++Y+
Sbjct  66    EHLKEKFYQSEMVKALNEGKTS--DADWESNFFICHKPTSNISEIPNISEELSKMMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL++  I  +FSGS+G + GTKVA YPECP PEL+RGLREHT
Sbjct  124   TQLHKFAERLSKLMCENLGLDQEEIMNAFSGSQGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQD+QVPGLEF KD +WV IPPSKNN IFVN GDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDEQVPGLEFLKDGKWVPIPPSKNNTIFVNLGDQVEILSNGKYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDKG RFE MKK
Sbjct  244   TMKHGSRLSIATFYNPAGDAVISPAPKLLYPSGYRFQDYLKIYSTTKFGDKGSRFETMKK  303

Query  189   LQ  184
             ++
Sbjct  304   IE  305



>ref|XP_002883982.1| hypothetical protein ARALYDRAFT_343239 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60241.1| hypothetical protein ARALYDRAFT_343239 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   437 bits (1124),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 245/301 (81%), Gaps = 2/301 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF +L GE RSKTM LL HAC++WGFFMV+NHGID+ELME VKKM+  +YE
Sbjct  6     EREMEIPVIDFGELDGENRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSYYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWES++FI H PTSN  E+ N     SKTM++Y+
Sbjct  66    EHLKEKFYQSEMVKALSEGKTS--DADWESSFFISHKPTSNFCEILNISVERSKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LM ENLGL++ +I  +FSGSKG + GTKVA YPECP PEL+RGLREHT
Sbjct  124   CQLHKFAERLSKLMSENLGLDQEYIMNAFSGSKGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEFFKD +W  IPPSKNN IFVNTGDQ+EILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFFKDGKWFPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPAPKLLYP+   FQDYLK Y +TKFGDKGPR E+MKK
Sbjct  244   TVKHGSRLSIATFYNPAGDAIISPAPKLLYPSGYRFQDYLKLYSTTKFGDKGPRLESMKK  303

Query  189   L  187
             +
Sbjct  304   M  304



>ref|XP_010667334.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Beta 
vulgaris subsp. vulgaris]
Length=303

 Score =   436 bits (1122),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 196/298 (66%), Positives = 250/298 (84%), Gaps = 0/298 (0%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M +P I+F++L G +R++T+ LLHHACE WGFF +ENHGID+ELME VK+ + ++YE++L
Sbjct  1     MAMPTINFAELEGAKRNETLMLLHHACENWGFFQIENHGIDKELMEKVKQFINKYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+ F+ SD+ K +  +KE + ++DWES++FIWH P SN+N+  +F  +F KTM+ YI++L
Sbjct  61    KDSFFKSDLSKALAIRKEIVSNSDWESSFFIWHRPKSNLNDFGDFSQDFRKTMDDYIDEL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +KV E+LSELMCENLGLEK++IK++F GSKG ++GTKVAIYPECPNPELVRGLREHTDAG
Sbjct  121   VKVGEKLSELMCENLGLEKDYIKKTFKGSKGPAVGTKVAIYPECPNPELVRGLREHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +W KIPPSKNN IFVN GDQ+E+LSNG YKS LHRV+A  
Sbjct  181   GIILLLQDDQVPGLEFFKDGEWFKIPPSKNNTIFVNLGDQIEVLSNGKYKSILHRVMAGK  240

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNPA DA+I+PA  +LYP N  FQDYLK Y STKF DKG RF+++K +
Sbjct  241   NGSRLSIATFYNPAGDAVITPAKYMLYPGNYKFQDYLKLYSSTKFLDKGERFQSIKDM  298



>ref|XP_003525310.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Glycine 
max]
Length=307

 Score =   436 bits (1122),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 254/304 (84%), Gaps = 3/304 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFSKL G++R  TM LLH ACE+WG FMVENH ID +LM  VK+++  +YE++L
Sbjct  1     MEIPVIDFSKLNGDKRGDTMALLHEACEKWGCFMVENHEIDTQLMGKVKQLINAYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E K+++  D DWEST+FIWH PTSNINE+ N      +TM++YI QL
Sbjct  61    KESFYQSEIAKRLE-KQQNTSDIDWESTFFIWHRPTSNINEISNISQELCQTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGS-KGESIGTKVAIYPECPNPELVRGLREHTDA  544
             +K+ E+LSELM ENLGLEK++IK++FSG+ +G ++GTKVA YP+CP PELVRGLREHTDA
Sbjct  120   LKLGEKLSELMSENLGLEKDYIKKAFSGNGEGPAVGTKVAKYPQCPRPELVRGLREHTDA  179

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEFFKD +WV+IPPSKNN IFVNTGDQVE+LSNG+Y+S +HRV+  
Sbjct  180   GGIILLLQDDEVPGLEFFKDGKWVEIPPSKNNAIFVNTGDQVEVLSNGLYRSVVHRVMPD  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQ  184
             N+G+R+SIATFYNP  DA+ISPAPKLLYP+N  + DYLK YGSTKFG+K PRFE+MK + 
Sbjct  240   NNGSRISIATFYNPIGDAIISPAPKLLYPSNFRYGDYLKLYGSTKFGEKAPRFESMKNM-  298

Query  183   ANGH  172
              NGH
Sbjct  299   INGH  302



>emb|CDY58326.1| BnaCnng33000D [Brassica napus]
Length=310

 Score =   436 bits (1122),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 244/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             ++EMEIPVIDFS+L GE R+KTM LL HAC++WGFFMV+NHGID+ELM+ VKK++  HYE
Sbjct  6     EKEMEIPVIDFSELDGENRTKTMSLLDHACDKWGFFMVDNHGIDKELMDKVKKLINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWEST+F+WH PTSNI+++ N  +   KTM++Y+
Sbjct  66    EHLKEKFYQSEMVKALSEGKTS--DADWESTFFVWHKPTSNISKVPNISDELIKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS+LMCENLGL + HI  +FSG +G   GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAERLSKLMCENLGLPQEHIMNAFSGLEGPVFGTKVAKYPECPRPELIRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEF KD +WV +PPSKNN IFVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFLKDGKWVPVPPSKNNTIFVNTGDQVEILSNGKYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA DA+ISPA ++LYP+   FQDYLK Y +TKFGDKG RF   KK
Sbjct  244   TMKQGSRLSIATFYNPAGDAIISPAQEMLYPSGYRFQDYLKLYSTTKFGDKGSRFHTTKK  303

Query  189   LQ  184
             ++
Sbjct  304   ME  305



>ref|XP_006408876.1| hypothetical protein EUTSA_v10002047mg [Eutrema salsugineum]
 gb|ESQ50329.1| hypothetical protein EUTSA_v10002047mg [Eutrema salsugineum]
Length=311

 Score =   436 bits (1122),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 205/302 (68%), Positives = 244/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDF +L GE R+KTM LL HAC++WGFFMV+NHGID+ELME VKKM+  HYE
Sbjct  6     EREMEIPVIDFGELDGENRTKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             + LKE+FY S++VK +   K S  DADWES++FIWH PTSNI ++ N  +   KTM++Y+
Sbjct  66    EHLKEKFYQSEMVKGLGEGKTS--DADWESSFFIWHKPTSNICQIPNISDELIKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K AE LS LMCENLGL +++I ++FSG +G + GTKVA YPECP PEL+RGLREHT
Sbjct  124   SQLHKFAERLSNLMCENLGLGQDYIMKAFSGLEGPAFGTKVAKYPECPRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEF KD +WV IPPSKNN IFVNTGDQVEILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFLKDGKWVSIPPSKNNTIFVNTGDQVEILSNGRYKSVVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                 G+RLSIATFYNPA D+ ISPAP+LLYP+   FQDYLK Y +TKFGDKG R   MKK
Sbjct  244   TVKHGSRLSIATFYNPAGDSTISPAPELLYPSGYRFQDYLKLYSTTKFGDKGSRLHTMKK  303

Query  189   LQ  184
             ++
Sbjct  304   ME  305



>gb|KHM99846.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Glycine soja]
Length=307

 Score =   436 bits (1122),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 254/304 (84%), Gaps = 3/304 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFSKL G++R  TM LLH ACE+WG FMVENH ID +LM  VK+++  +YE++L
Sbjct  1     MEIPVIDFSKLNGDKRGDTMALLHEACEKWGCFMVENHEIDTQLMGKVKQLINAYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E K+++  D DWEST+FIWH PTSNINE+ N      +TM++YI QL
Sbjct  61    KESFYQSEIAKRLE-KQQNTSDIDWESTFFIWHRPTSNINEISNISQELCQTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGS-KGESIGTKVAIYPECPNPELVRGLREHTDA  544
             +K+ E+LSELM ENLGLEK++IK++FSG+ +G ++GTKVA YP+CP PELVRGLREHTDA
Sbjct  120   LKLGEKLSELMSENLGLEKDYIKKAFSGNGEGPAVGTKVAKYPQCPRPELVRGLREHTDA  179

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEFFKD +WV+IPPSKNN IFVNTGDQVE+LSNG+Y+S +HRV+  
Sbjct  180   GGIILLLQDDKVPGLEFFKDGKWVEIPPSKNNAIFVNTGDQVEVLSNGLYRSVVHRVMPD  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQ  184
             N+G+R+SIATFYNP  DA+ISPAPKLLYP+N  + DYLK YGSTKFG+K PRFE+MK + 
Sbjct  240   NNGSRISIATFYNPIGDAIISPAPKLLYPSNFRYGDYLKLYGSTKFGEKAPRFESMKNM-  298

Query  183   ANGH  172
              NGH
Sbjct  299   INGH  302



>emb|CDY70340.1| BnaCnng67880D [Brassica napus]
Length=302

 Score =   434 bits (1117),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 201/299 (67%), Positives = 243/299 (81%), Gaps = 2/299 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS+L GE R+KTM LL HAC++WGFFMV+NHGID+ELM+ +K+++  HYE+ L
Sbjct  1     MEIPVIDFSELDGENRTKTMSLLDHACDKWGFFMVDNHGIDKELMDKLKQLINSHYEEHL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE+FY S++VK +   K S  DADWEST+F+WH PTSNI+++ N  +   KTM++Y+ QL
Sbjct  61    KEKFYQSEMVKALSEGKTS--DADWESTFFVWHKPTSNISKVSNISDELIKTMDEYVSQL  118

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K AE LS+LMCENLGL + HI  +FSG +G   GTKVA YPECP+PEL+RGLREHTDAG
Sbjct  119   HKFAERLSKLMCENLGLPREHIVNAFSGIEGPVFGTKVAKYPECPHPELIRGLREHTDAG  178

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF KD +WV IPPSKNN IFVNTGDQVEILSNG YKS +HRV+   
Sbjct  179   GIILLLQDDQVPGLEFLKDGKWVPIPPSKNNTIFVNTGDQVEILSNGRYKSVVHRVMTMK  238

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQ  184
              G+RLSIATFYNPA DA+ISPA ++LYP+   FQDYLK Y +TKFGDKG RF  MKK++
Sbjct  239   QGSRLSIATFYNPAGDAIISPAQEMLYPSGYRFQDYLKLYSTTKFGDKGSRFNTMKKME  297



>gb|ACU24150.1| unknown [Glycine max]
Length=307

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 253/304 (83%), Gaps = 3/304 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFSKL G++R   M LLH ACE+WG FMVENH ID +LM  VK+++  +YE++L
Sbjct  1     MEIPVIDFSKLNGDKRGDAMALLHEACEKWGCFMVENHEIDTQLMGKVKQLINAYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E K+++  D DWEST+FIWH PTSNINE+ N      +TM++YI QL
Sbjct  61    KESFYQSEIAKRLE-KQQNTSDIDWESTFFIWHRPTSNINEISNISQELCQTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGS-KGESIGTKVAIYPECPNPELVRGLREHTDA  544
             +K+ E+LSELM ENLGLEK++IK++FSG+ +G ++GTKVA YP+CP PELVRGLREHTDA
Sbjct  120   LKLGEKLSELMSENLGLEKDYIKKAFSGNGEGPAVGTKVAKYPQCPRPELVRGLREHTDA  179

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEFFKD +WV+IPPSKNN IFVNTGDQVE+LSNG+Y+S +HRV+  
Sbjct  180   GGIILLLQDDEVPGLEFFKDGKWVEIPPSKNNAIFVNTGDQVEVLSNGLYRSVVHRVMPD  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQ  184
             N+G+R+SIATFYNP  DA+ISPAPKLLYP+N  + DYLK YGSTKFG+K PRFE+MK + 
Sbjct  240   NNGSRISIATFYNPIGDAIISPAPKLLYPSNFRYGDYLKLYGSTKFGEKAPRFESMKNM-  298

Query  183   ANGH  172
              NGH
Sbjct  299   INGH  302



>ref|XP_011093716.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Sesamum 
indicum]
Length=306

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 248/307 (81%), Gaps = 2/307 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVID S L  E+RS+TM LLH AC++WGFFM+ENHG+D+ELM+ +K +   HYE+++
Sbjct  1     MEIPVIDLSMLETEKRSETMALLHQACQKWGFFMIENHGVDKELMDKMKLLTKMHYEETM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K+ FY S+  K ++N    I   DWEST+FI H P SNIN+L     +  KTME+YI+QL
Sbjct  61    KDSFYNSETAKSLDNNG-YISKKDWESTFFISHRPNSNINDLNTLSQDLRKTMEEYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LS+LMCENLG+EKN I E+FSGSKG S+GTKVA+YP CP PEL+RGLREHTDAG
Sbjct  120   IKLAEKLSKLMCENLGIEKNCIIEAFSGSKGPSVGTKVAMYPHCPRPELIRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GI+LLLQDDQVPGLEF KD +WVKIPPS NNRIF+NTGDQ+EILSNG Y+S LHRV+A  
Sbjct  180   GIVLLLQDDQVPGLEFLKDGEWVKIPPSMNNRIFINTGDQIEILSNGTYRSALHRVMAMK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             DG+RLSIATFYNP+ DA+ISPA +LL P++V FQDYL HY  TKF DKG RF+++K  +A
Sbjct  240   DGDRLSIATFYNPSGDAIISPASELLLPSHVRFQDYLNHYSKTKFEDKGLRFQSLKN-KA  298

Query  180   NGH*SAL  160
             NGH   L
Sbjct  299   NGHQGVL  305



>ref|XP_009117531.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Brassica 
rapa]
Length=310

 Score =   434 bits (1115),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 240/300 (80%), Gaps = 2/300 (1%)
 Frame = -2

Query  1089  DREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYE  910
             +REMEIPVIDFS+L GE R KTM LL HAC++WGFFMV+NHG+D+ELME VKKM+  HYE
Sbjct  6     EREMEIPVIDFSELDGENRIKTMSLLDHACDKWGFFMVDNHGVDKELMEKVKKMINSHYE  65

Query  909   DSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYI  730
             D LKE+FY S++VK +   K S  DADWES++FIWH PTS+I ++ N  +   KTM++Y+
Sbjct  66    DHLKEKFYQSEMVKALSEGKTS--DADWESSFFIWHKPTSSICKIPNISDELIKTMDEYV  123

Query  729   EQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHT  550
              QL K A  LS LMCENLGL + +I  +FSG +G + GTKVA YPEC  PEL+RGLREHT
Sbjct  124   SQLHKFAARLSNLMCENLGLSQEYITNAFSGPEGPAFGTKVAKYPECLRPELMRGLREHT  183

Query  549   DAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVL  370
             DAGGIILLLQDDQVPGLEF KD +WV IPPSKNN IFVNTGDQ+EILSNG YKS +HRV+
Sbjct  184   DAGGIILLLQDDQVPGLEFLKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSAVHRVM  243

Query  369   AQNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
                DG RLSIATFYNPA DA+ISPAP+LLYP+   FQDYLK Y +TKFGDKG RF  MKK
Sbjct  244   TVKDGCRLSIATFYNPAGDAVISPAPELLYPSGYQFQDYLKLYSTTKFGDKGSRFHTMKK  303



>ref|XP_010242182.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 isoform 
X1 [Nelumbo nucifera]
Length=313

 Score =   432 bits (1111),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 238/292 (82%), Gaps = 0/292 (0%)
 Frame = -2

Query  1062  DFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYA  883
             DF++L G++RS+TM LLHHACE+WGFF V NHG+D ELME VK +   HY+  +K  FY 
Sbjct  18    DFNELNGDKRSETMALLHHACEKWGFFQVVNHGVDGELMEKVKGLFNIHYDKCMKGSFYE  77

Query  882   SDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEE  703
             S+  K +         ADWE+T+FI H PTSNI+E       F + M++YI+Q++K+AE+
Sbjct  78    SETAKRLMESGGVTSGADWETTFFICHRPTSNIDEFTALSKEFCEAMDEYIKQVIKLAEK  137

Query  702   LSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLL  523
             LSELMCENLGLEK+++  +FSGS G S+GTK+A YP+CP PE VRGLREHTDAGGIILLL
Sbjct  138   LSELMCENLGLEKSYLMSAFSGSAGPSVGTKLAKYPQCPQPEFVRGLREHTDAGGIILLL  197

Query  522   QDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLS  343
             QDDQVPGLEFFKDEQWV+IPPSKNN +FVNTGDQVE+LSNG YKSTLHRV+A  DG+RLS
Sbjct  198   QDDQVPGLEFFKDEQWVQIPPSKNNTLFVNTGDQVEVLSNGRYKSTLHRVMAGKDGSRLS  257

Query  342   IATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             IATFYNPA DA+ISPAPKLLYPN+ CFQDYLK Y +TKF DKGPRFE+MKK+
Sbjct  258   IATFYNPAGDAIISPAPKLLYPNHYCFQDYLKLYATTKFADKGPRFESMKKI  309



>ref|XP_003530544.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Glycine 
max]
Length=307

 Score =   431 bits (1109),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 248/304 (82%), Gaps = 3/304 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS L G++R  TM LLH ACE+WG FMVENH ID +LME +K+++  +YE+ L
Sbjct  1     MEIPVIDFSNLNGDKRGDTMALLHEACEKWGCFMVENHEIDTQLMEKLKQLINTYYEEDL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E K+++  D DWE T+FIWH PTSNINE+ N      +TM++YI QL
Sbjct  61    KESFYQSEIAKRLE-KQQNTSDIDWEITFFIWHRPTSNINEIPNISRELCQTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGS-KGESIGTKVAIYPECPNPELVRGLREHTDA  544
             +K+ E+LSELM ENLGLEK++IK++FSGS +G ++GTKVA YP+CP PELVRGLREHTDA
Sbjct  120   LKLGEKLSELMSENLGLEKDYIKKAFSGSGEGPAVGTKVAKYPQCPRPELVRGLREHTDA  179

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEFFKD +WV+IPP KNN +FVNTGDQVE+LSNG+YKS LHRV+  
Sbjct  180   GGIILLLQDDKVPGLEFFKDGKWVEIPPPKNNAVFVNTGDQVEVLSNGLYKSVLHRVMPD  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQ  184
             N G+R SIATFYNP  DA+ISPAPKLLYP+N  + DYLK YGSTKFG+K PRFE MK + 
Sbjct  240   NSGSRTSIATFYNPIGDAIISPAPKLLYPSNFRYGDYLKLYGSTKFGEKAPRFECMKNM-  298

Query  183   ANGH  172
              NGH
Sbjct  299   TNGH  302



>ref|XP_010049724.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
 gb|KCW82489.1| hypothetical protein EUGRSUZ_C03886 [Eucalyptus grandis]
Length=307

 Score =   430 bits (1105),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIP+ID S+L GE RSKTM LLHH+CE+WG F ++NHG+D ELME VK  V  HYE++L
Sbjct  1     MEIPMIDLSELDGENRSKTMALLHHSCEKWGCFKIKNHGVDPELMEKVKHFVNTHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S+  KC+EN   +  D DWE T+FIWH P SNI +  N  N+  KTM++YI QL
Sbjct  61    KASFYESETAKCLENANGATSDLDWECTFFIWHRPKSNIEDFPNLSNDLRKTMDEYIAQL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+LSELMCENLGL K+HIK +FSG  G S+GTKVA YPECP PE VRGLREHTDAG
Sbjct  121   VKLAEKLSELMCENLGLGKDHIKRAFSGKDGPSVGTKVAKYPECPYPEKVRGLREHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGL+F  D QWV IPPS N+ IFVNTGDQ+E+LSNG YKS  HRV+A  
Sbjct  181   GIILLLQDDQVPGLQFLHDGQWVPIPPSTNDTIFVNTGDQLEVLSNGRYKSVWHRVMAVE  240

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
              G+RLS+ATFYNPA DA+ISPAPKLLYP    F +YLK Y +TKF +K PRFE+MK + +
Sbjct  241   SGSRLSVATFYNPAGDAVISPAPKLLYPEKYTFGEYLKLYATTKFQEKEPRFESMKSVMS  300

Query  180   NGH  172
             NG+
Sbjct  301   NGN  303



>ref|XP_010047583.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Eucalyptus 
grandis]
 gb|KCW79536.1| hypothetical protein EUGRSUZ_C00906 [Eucalyptus grandis]
Length=305

 Score =   429 bits (1104),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 202/297 (68%), Positives = 243/297 (82%), Gaps = 2/297 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME+PVIDFS+L GE+RSKTM LLH ACE++GFF +ENHG+D++LME VK  V  HYE +L
Sbjct  1     MEVPVIDFSQLDGEKRSKTMALLHDACEKFGFFKIENHGVDKKLMEKVKHFVDSHYEQNL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S+  K +EN     RD DWES++FI H P SNINE  N   +  K M+ YI+QL
Sbjct  61    KETFYDSEAAKRLENG--HTRDIDWESSFFISHRPKSNINEFPNLSEDLRKAMDDYIDQL  118

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             + +AE+LSELMCENLGL+K+HIK+ FSG KG S+GTKVA YP+CP+P+ V GLREHTDAG
Sbjct  119   IMLAEKLSELMCENLGLDKDHIKKVFSGEKGPSVGTKVARYPQCPHPDRVMGLREHTDAG  178

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF K+  W++IPPSKNN IFVNTGDQVE+LSNG YKS LHRV+A+ 
Sbjct  179   GIILLLQDDQVPGLEFLKEGNWIQIPPSKNNAIFVNTGDQVEVLSNGRYKSALHRVMAKK  238

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             +G+RLSIATFYNPA+DA+ISPAPKLLYPN+  F DYLK Y +TKF DK PRFE++KK
Sbjct  239   NGSRLSIATFYNPATDAIISPAPKLLYPNHFSFGDYLKLYATTKFLDKEPRFESLKK  295



>ref|XP_003529081.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like isoform 
X1 [Glycine max]
 ref|XP_006583573.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like isoform 
X2 [Glycine max]
Length=306

 Score =   429 bits (1104),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 251/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M IPVIDFS L G++R +TM LL  AC++WGFF++ENH ID+ LME VK+++  HYE++L
Sbjct  1     MAIPVIDFSTLNGDKRGETMALLDEACQKWGFFLIENHEIDKNLMEKVKELINIHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E KK++  D DWES +FIWH PTSNI ++ N      +TM+QYI+QL
Sbjct  61    KEGFYQSEIAKTLE-KKQNTSDIDWESAFFIWHRPTSNIKKITNISQELCQTMDQYIDQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             + +AE+LSELM ENLGLEKN+IKE+FSG+ G ++GTKVA YP+CP+PELVRGLREHTDAG
Sbjct  120   VTLAEKLSELMSENLGLEKNYIKEAFSGTNGPAMGTKVAKYPQCPHPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +WV+IPPSKNN IFVNTGDQVE+LSNG YKS +HRV+   
Sbjct  180   GIILLLQDDQVPGLEFFKDGKWVEIPPSKNNAIFVNTGDQVEVLSNGFYKSVVHRVMPDK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIA+FYNP  +A+ISPA KLLYP+N  + DYL+ YG+TKFG+KGPRFE++K +  
Sbjct  240   NGSRLSIASFYNPVGEAIISPANKLLYPSNYRYGDYLELYGNTKFGEKGPRFESIKNM-T  298

Query  180   NGH  172
             NGH
Sbjct  299   NGH  301



>gb|KHN16682.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Glycine soja]
Length=307

 Score =   429 bits (1104),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 202/304 (66%), Positives = 248/304 (82%), Gaps = 3/304 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVIDFS L G++R  TM LLH ACE+WG FMVENH ID +LME +K+++  +YE+ L
Sbjct  1     MEIPVIDFSNLNGDKRGDTMALLHEACEKWGCFMVENHEIDTQLMEKLKQLINTYYEEDL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E K+++  D DWE T+FIWH PTSNINE+ N      +TM++YI QL
Sbjct  61    KESFYQSEIAKRLE-KEQNTSDIDWEITFFIWHRPTSNINEIPNISRELCQTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGS-KGESIGTKVAIYPECPNPELVRGLREHTDA  544
             +K+ E+LSELM ENLGLEK++IK++FSGS +G ++GTKVA YP+CP PELVRGLREHTDA
Sbjct  120   LKLGEKLSELMSENLGLEKDYIKKAFSGSGEGPAVGTKVAKYPQCPRPELVRGLREHTDA  179

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEFFKD +WV+IPP KNN +FVNTGDQVE+LSNG+YKS +HRV+  
Sbjct  180   GGIILLLQDDKVPGLEFFKDGKWVEIPPPKNNAVFVNTGDQVEVLSNGLYKSVVHRVMPD  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQ  184
             N G+R SIATFYNP  DA+ISPAPKLLYP+N  + DYLK YGSTKFG+K PRFE MK + 
Sbjct  240   NSGSRTSIATFYNPIGDAIISPAPKLLYPSNFRYGDYLKLYGSTKFGEKAPRFECMKNM-  298

Query  183   ANGH  172
              NGH
Sbjct  299   TNGH  302



>ref|XP_007160235.1| hypothetical protein PHAVU_002G304200g [Phaseolus vulgaris]
 gb|ESW32229.1| hypothetical protein PHAVU_002G304200g [Phaseolus vulgaris]
Length=307

 Score =   424 bits (1091),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 248/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIP IDFS+L G++R  TM LLH ACE+ GFFMVENH I+  LME VK+++ ++YE++L
Sbjct  1     MEIPTIDFSELNGDKRGDTMALLHKACEQ-GFFMVENHEIETRLMEKVKQLINRYYEENL  59

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S+  K +E K+E+  D DWES++FIWH PTS+IN++ N        M++Y+EQL
Sbjct  60    KESFYQSETAKRLE-KQENASDIDWESSFFIWHRPTSSINQIPNISQELCLAMDEYVEQL  118

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +++ E+LSELM ENLGLEK+++K++FSGS G ++GTKVA YPECP PELVRGLREHTDAG
Sbjct  119   LRLGEKLSELMSENLGLEKDYMKKAFSGSDGPAVGTKVAKYPECPRPELVRGLREHTDAG  178

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEFFKD +WVKIPPSKNN IFVNTGDQVE+LSNG YKS  HRV+   
Sbjct  179   GIILLLQDDQVPGLEFFKDGKWVKIPPSKNNAIFVNTGDQVEVLSNGSYKSVRHRVMPHK  238

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+R+SIATFYNP  +A+ISPAPKLLYP+N  + DYLK Y STKFG+KGPRFE+MK +  
Sbjct  239   NGSRISIATFYNPIPEAIISPAPKLLYPSNFLYGDYLKLYSSTKFGEKGPRFESMKNM-T  297

Query  180   NGH  172
             NGH
Sbjct  298   NGH  300



>ref|XP_003620934.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES77152.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=303

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 255/305 (84%), Gaps = 4/305 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M IPVIDFS L G++R +TM LLH AC++WG F++ENH I+ +LME VKK++  +YE++L
Sbjct  1     MAIPVIDFSTLNGDKRGETMALLHEACQKWGCFLIENHDIEGKLMEKVKKVINSYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E KKE+  D DWES++FIWH PTSNI ++ N   +  +TM++YI++L
Sbjct  61    KESFYQSEIAKRLE-KKENTCDVDWESSFFIWHRPTSNIRKIPNLSEDLCQTMDEYIDKL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSK--GESIGTKVAIYPECPNPELVRGLREHTD  547
             ++VAE LS++M ENLGLEK++IK++FSG+   G ++GTKVA YPECP PELVRGLREHTD
Sbjct  120   VQVAETLSQMMSENLGLEKDYIKKAFSGNNNNGPAMGTKVAKYPECPYPELVRGLREHTD  179

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
             AGGIILLLQDD+VPGLEFFKD +W++IPPSKNN IFVNTGDQ+E+LSNG+YKS +HRV+ 
Sbjct  180   AGGIILLLQDDKVPGLEFFKDGKWIEIPPSKNNAIFVNTGDQIEVLSNGLYKSVVHRVMP  239

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               +G+RLSIA+FYNP  +A+ISPAPKLLYP+N C+ DYL+ YG TKFGDKGPRFE++K  
Sbjct  240   DKNGSRLSIASFYNPVGEAIISPAPKLLYPSNYCYGDYLELYGKTKFGDKGPRFESIKN-  298

Query  186   QANGH  172
             +ANG+
Sbjct  299   KANGN  303



>gb|AFK34864.1| unknown [Medicago truncatula]
Length=303

 Score =   421 bits (1082),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 254/305 (83%), Gaps = 4/305 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M IPVIDFS L G++R +TM LLH AC++WG F++ENH I+ +LME VKK++  +YE++L
Sbjct  1     MAIPVIDFSTLNGDKRGETMALLHEACQKWGCFLIENHDIEGKLMEKVKKVINSYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++ K +E KKE+  D DWES++FIWH P SNI ++ N   +  +TM++YI++L
Sbjct  61    KESFYQSEIAKRLE-KKENTCDVDWESSFFIWHRPASNIRKIPNLSEDLCQTMDEYIDKL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSK--GESIGTKVAIYPECPNPELVRGLREHTD  547
             ++VAE LS++M ENLGLEK++IK++FSG+   G ++GTKVA YPECP PELVRGLREHTD
Sbjct  120   VQVAETLSQMMSENLGLEKDYIKKAFSGNNNNGPAMGTKVAKYPECPYPELVRGLREHTD  179

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
             AGGIILLLQDD+VPGLEFFKD +W++IPPSKNN IFVNTGDQ+E+LSNG+YKS +HRV+ 
Sbjct  180   AGGIILLLQDDKVPGLEFFKDGKWIEIPPSKNNAIFVNTGDQIEVLSNGLYKSVVHRVMP  239

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               +G+RLSIA+FYNP  +A+ISPAPKLLYP+N C+ DYL+ YG TKFGDKGPRFE++K  
Sbjct  240   DKNGSRLSIASFYNPVGEAIISPAPKLLYPSNYCYGDYLELYGKTKFGDKGPRFESIKN-  298

Query  186   QANGH  172
             +ANG+
Sbjct  299   KANGN  303



>emb|CAN80122.1| hypothetical protein VITISV_010647 [Vitis vinifera]
Length=295

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 241/303 (80%), Gaps = 12/303 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME+P+IDF KL GE+R++T  LLH ACE+WGFF ++NHG+D++LME VK +V  HYE+ +
Sbjct  1     MEVPMIDFDKLDGEKRAETKALLHQACEKWGFFQIDNHGVDKKLMEKVKHLVNTHYEEIM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S++ K +E+K E+  + DWES++F+WH PTSNI+E  N   +  KTM++YI QL
Sbjct  61    KRSFYESEIAKALEDK-ETASNIDWESSFFLWHRPTSNIDEFTNISEDLRKTMDEYIAQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AE+LSELMCENLGLEK +I+E+FSG+ G S+GTK           LVRGLREHTDAG
Sbjct  120   FKLAEKLSELMCENLGLEKGYIREAFSGNAGPSVGTK-----------LVRGLREHTDAG  168

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDDQVPGLEF+KD +WV IPPSKNN IFVNTGDQ+E+LSNG YKS LHRV+A  
Sbjct  169   GIILLLQDDQVPGLEFYKDGEWVVIPPSKNNTIFVNTGDQIEVLSNGRYKSXLHRVMADK  228

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSIATFYNP+ DA+ISPAPKLLYP++  FQDYLK Y +TKF DKGPRFE+MK +  
Sbjct  229   NGSRLSIATFYNPSGDAIISPAPKLLYPDHFRFQDYLKLYATTKFADKGPRFESMKNMAI  288

Query  180   NGH  172
               H
Sbjct  289   GHH  291



>ref|XP_004513099.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Cicer 
arietinum]
Length=301

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 248/303 (82%), Gaps = 2/303 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M IPVIDFS L G++R +T+ LLH AC+ WG F++ENH I+ +LME VKK +  +YE++L
Sbjct  1     MAIPVIDFSTLNGDKRGETLALLHDACKNWGCFLIENHEIEGKLMEKVKKTINSYYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KE FY S++VK +E KK +  D DWES +FIWH PTSNI ++ N      +TM++YIE+L
Sbjct  61    KESFYQSEIVKRLEKKKNT-SDIDWESAFFIWHRPTSNIRQIPNLSEELCQTMDEYIEKL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +++AE LSELM ENLGLEK++IK++FSGS G ++GTKVA YPECP PELVRGLREHTDAG
Sbjct  120   VELAENLSELMSENLGLEKDYIKKAFSGSNGPAMGTKVAKYPECPYPELVRGLREHTDAG  179

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD++PGLEFFKD +W++IPPSKNN IFVNTGDQ+E+LSNG+YKS +HRV+   
Sbjct  180   GIILLLQDDKIPGLEFFKDGKWIEIPPSKNNAIFVNTGDQIEVLSNGLYKSVVHRVMPDK  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLS+A+FYNP  DA+ISPAPKLLYP++  + DYL+ YG TKFG+K PRFE++K + A
Sbjct  240   NGSRLSVASFYNPIGDAIISPAPKLLYPSSYRYGDYLELYGKTKFGEKAPRFESIKNM-A  298

Query  180   NGH  172
             N H
Sbjct  299   NEH  301



>gb|KHN40333.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Glycine soja]
Length=287

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 236/284 (83%), Gaps = 2/284 (1%)
 Frame = -2

Query  1023  MKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYASDVVKCVENKKES  844
             M LL  AC++WGFF++ENH ID+ LME VK+++  HYE++LKE FY S++ K +E KK++
Sbjct  1     MALLDEACQKWGFFLIENHEIDKNLMEKVKELINIHYEENLKEGFYQSEIAKTLE-KKQN  59

Query  843   IRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEELSELMCENLGLEK  664
               D DWES +FIWH PTSNI ++ N      +TM+QYI+QL+ +AE+LSELM ENLGLEK
Sbjct  60    TSDIDWESAFFIWHRPTSNIKKIPNISQELCQTMDQYIDQLVTLAEKLSELMSENLGLEK  119

Query  663   NHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLLQDDQVPGLEFFKD  484
             N+IKE+FSG+ G ++GTKVA YP+CP+PELVRGLREHTDAGGIILLLQDDQVPGLEFFKD
Sbjct  120   NYIKEAFSGTNGPAMGTKVAKYPQCPHPELVRGLREHTDAGGIILLLQDDQVPGLEFFKD  179

Query  483   EQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLSIATFYNPASDAMI  304
              +WV+IPPSKNN IFVNTGDQVE+LSNG YKS +HRV+   +G+RLSIA+FYNP  +A+I
Sbjct  180   GKWVEIPPSKNNAIFVNTGDQVEVLSNGFYKSVVHRVMPDKNGSRLSIASFYNPVGEAII  239

Query  303   SPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQANGH  172
             SPA KLLYP+N  + DYL+ YG+TKFG+KGPRFE++K +  NGH
Sbjct  240   SPANKLLYPSNYRYGDYLELYGNTKFGEKGPRFESIKNM-TNGH  282



>ref|XP_004141049.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Cucumis 
sativus]
 gb|KGN60544.1| hypothetical protein Csa_2G000520 [Cucumis sativus]
Length=300

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/293 (63%), Positives = 230/293 (78%), Gaps = 3/293 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M+IP IDF +L  + R  T+ +LH AC+ WGFF+VENHGI+  ++E VK +V +HY++ +
Sbjct  1     MKIPTIDFKQLNEDNRGNTLSILHEACQNWGFFVVENHGIEERVLEKVKLLVNKHYDEKM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQ-YIEQ  724
             KE FY SDV K +   K ++ + DWES +FI H PTSNI+++ N      K ME+ YI +
Sbjct  61    KEEFYNSDVAKNL--GKITLSNVDWESAFFISHKPTSNISQVSNTSQPLCKAMEEEYIPE  118

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             ++K+AE+LSELMCENLGL+K+HIK+ F+G+ G S+GTKVA YPECP P+LVRGLREHTDA
Sbjct  119   IIKIAEKLSELMCENLGLQKSHIKQLFNGTNGPSVGTKVAKYPECPQPDLVRGLREHTDA  178

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDDQVPGLEF  D +W KIPPSKNN IFVN GDQ+E+LSNG YKS LHRVLA+
Sbjct  179   GGIILLLQDDQVPGLEFQIDGRWFKIPPSKNNAIFVNIGDQIEVLSNGKYKSILHRVLAE  238

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRF  205
               G+RLSIATFYNPA+DA+ISPAP+LLYP    F DYLK Y +TKFGDK  RF
Sbjct  239   KHGSRLSIATFYNPATDALISPAPELLYPGGYRFGDYLKFYNTTKFGDKEKRF  291



>ref|XP_004157916.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Cucumis 
sativus]
Length=300

 Score =   390 bits (1002),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 231/293 (79%), Gaps = 3/293 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M+IP IDF +L  + R  T+ +LH AC+ WGFF+VENHGI+  ++E VK +V +HY++ +
Sbjct  1     MKIPTIDFKQLNEDNRGNTLSILHEACQNWGFFVVENHGIEERVLEKVKLLVNKHYDEKM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQ-YIEQ  724
             KE FY SDV K +   K ++ + DWES +FI H PTSNI+++ N      K ME+ YI +
Sbjct  61    KEEFYNSDVAKNL--GKITLSNVDWESAFFISHKPTSNISQVSNTSQPLCKAMEEEYIPE  118

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             ++K+AE+LSELMCENLGL+K+HIK+ F+G+ G S+GTKVA YPECP P+LVRGLREHTDA
Sbjct  119   IIKIAEKLSELMCENLGLQKSHIKQLFNGTNGPSVGTKVAKYPECPQPDLVRGLREHTDA  178

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDDQVPGLEF  D +W KIPPSK+N IFVN GDQ+E+LSNG YKS LHRVLA+
Sbjct  179   GGIILLLQDDQVPGLEFQIDGRWFKIPPSKDNAIFVNIGDQIEVLSNGKYKSILHRVLAE  238

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRF  205
               G+RLSIATFYNPA+DA+ISPAP+LLYP +  F DYLK Y +TKFGDK  RF
Sbjct  239   KHGSRLSIATFYNPATDALISPAPELLYPGDYRFGDYLKFYNTTKFGDKEKRF  291



>emb|CAA64798.1| ACC oxidase [Cucumis melo]
Length=300

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 232/299 (78%), Gaps = 3/299 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M+IP IDF++L  +    T+ +LH AC+ WGFF+VENHGI+  ++E VK +V +HY++++
Sbjct  1     MKIPTIDFNQLNEDNEGNTLSILHEACQNWGFFLVENHGIEERVLEKVKLLVNKHYDENM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQ-YIEQ  724
             KE FY SDV K +   K ++ + DWEST+FI H PTSN+++  N P    K ME+ YI +
Sbjct  61    KEEFYNSDVAKNL--GKITLSNVDWESTFFISHKPTSNVSQFCNIPQPLCKAMEEEYIPE  118

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             ++K+AE+LSELMCENLGL+K+HIK+ F+G+ G S+GTKVA YPECP P+LVRGLREHTDA
Sbjct  119   IIKIAEKLSELMCENLGLQKSHIKQLFNGTNGPSVGTKVAKYPECPQPDLVRGLREHTDA  178

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDDQVPGLEF  D +W KIPPSKNN IFVN GDQ+E+L+NG YKS LHRVLA+
Sbjct  179   GGIILLLQDDQVPGLEFQIDGRWFKIPPSKNNAIFVNIGDQIEVLTNGKYKSILHRVLAE  238

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               G+RLSIATFYNPA+DA+I PAP+L YP    F DYLK Y +TKFGDK  RF   + +
Sbjct  239   KHGSRLSIATFYNPATDALIFPAPELSYPGGYRFGDYLKFYNTTKFGDKEKRFSDFQSI  297



>ref|XP_008459274.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Cucumis 
melo]
Length=300

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 232/299 (78%), Gaps = 3/299 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M+IP IDF++L  + +  T+ +LH AC+ WGFF+VENHGI+  ++E VK +V +HY++++
Sbjct  1     MKIPTIDFNQLNEDNKGNTLSILHEACQNWGFFLVENHGIEERVLEKVKLLVNKHYDENM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQ-YIEQ  724
             KE FY SDV K +   K ++ + DWEST+FI H PTSN+++  N      K ME+ YI +
Sbjct  61    KEEFYNSDVAKNL--GKITLSNMDWESTFFISHKPTSNVSQFCNISQPLCKAMEEEYIPE  118

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             ++K+AE+LSELMCENLGL+K+HIK+ F+G+ G S+GTKVA YPECP P+LVRGLREHTDA
Sbjct  119   IIKIAEKLSELMCENLGLQKSHIKQLFNGTNGPSVGTKVAKYPECPQPDLVRGLREHTDA  178

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDDQVPGLEF  D +W KIPPSKNN IFVN GDQ+E+L+NG YKS LHRVLA+
Sbjct  179   GGIILLLQDDQVPGLEFQIDGRWFKIPPSKNNAIFVNIGDQIEVLTNGKYKSILHRVLAE  238

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               G+RLSIATFYNPA+DA+I PAP+L YP    F DYLK Y +TKFGDK  RF   + +
Sbjct  239   KHGSRLSIATFYNPATDALIFPAPELSYPGGYRFGDYLKFYNTTKFGDKEKRFSDFQSI  297



>ref|XP_010925034.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Elaeis 
guineensis]
Length=300

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 222/300 (74%), Gaps = 5/300 (2%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             +M +PVI+  +L G+ R++T  LLH ACE+WGFF VENHGI   LME VK +V  HYE+ 
Sbjct  3     DMAVPVINLRELDGDRRTETKSLLHEACEKWGFFWVENHGIKEALMEKVKGLVNSHYEEY  62

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSN-INELKNFPNNFSKTMEQYIE  727
             LK+ FY S++   +  + +S  +ADWESTYFI H P SN I+++      F + ME YI 
Sbjct  63    LKQSFYESELAMGLGPQTQS-SEADWESTYFIQHQPESNNIHDIPGHEIEFCEAMEDYIR  121

Query  726   QLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTD  547
             QL+K+AE L+ELM ENLGL+K ++KE+FS +    +GTKVA YP+CP PELV GLR  TD
Sbjct  122   QLIKLAETLAELMSENLGLDKCYLKEAFSPA---FVGTKVAKYPQCPQPELVMGLRARTD  178

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
              GGIILLLQDD VPGLEFFK  +WV I P K+NRIFVN GDQVE++SNG+YKS LHRV A
Sbjct  179   GGGIILLLQDDMVPGLEFFKHGKWVPITPKKDNRIFVNLGDQVEVMSNGLYKSILHRVAA  238

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
               DG+RLSIATFYNP +DA+ISPAPKLLYP    F+DYL +Y  TKF DKG RF+ +K +
Sbjct  239   DKDGSRLSIATFYNPGADAIISPAPKLLYPGGYRFKDYLDYYTGTKFSDKGARFQTIKDM  298



>ref|XP_008793240.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Phoenix 
dactylifera]
Length=294

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 226/299 (76%), Gaps = 9/299 (3%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI+  ++ GE +SKTM LLH ACE+WGFF +ENHGID  LM+ +K +V QHYE+S+
Sbjct  1     MEIPVINLGEIEGERKSKTMSLLHEACEKWGFFWLENHGIDEGLMDKIKGLVNQHYEESM  60

Query  900   KERFYASDVVKCVE-NKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             KE FY+SD+ K +  N K S  D DWES++F  H P SNIN++   P    + M++Y+ Q
Sbjct  61    KESFYSSDLAKELGCNIKAS--DVDWESSFFYHHQPDSNINDI---PELLCEVMQEYVAQ  115

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
              +K+AE L+ L+ ENLGLEK+++KE+FS      +GTKVA YPEC  PELV GLR HTDA
Sbjct  116   SIKLAERLAGLLSENLGLEKDYMKEAFSEP---FVGTKVAKYPECSQPELVMGLRGHTDA  172

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEF KD +WV +PP+K  RIFVN GDQVE++SNG+YKS  H VLA 
Sbjct  173   GGIILLLQDDKVPGLEFLKDGEWVPVPPTKGYRIFVNLGDQVEVMSNGIYKSVQHHVLAD  232

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
              +G+RLSI TFYNP ++A+ISPAPKL+YP    FQDYL +Y +TKF DK  RF+ +K++
Sbjct  233   RNGSRLSIVTFYNPGANAIISPAPKLVYPGCYRFQDYLNYYSTTKFSDKLARFQTIKEM  291



>gb|AAP13098.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Elaeis guineensis]
Length=297

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 221/299 (74%), Gaps = 5/299 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M +PVI+  +L G+ R++T  LLH ACE+WGFF VENHGI   LME VK +V  HYE+ L
Sbjct  1     MAVPVINLRELDGDRRTETKSLLHEACEKWGFFWVENHGIKEALMEKVKGLVNSHYEEYL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSN-INELKNFPNNFSKTMEQYIEQ  724
             K+ FY S++   +  + +S  +ADWESTYFI H P SN I+++      F + ME YI Q
Sbjct  61    KQSFYESELAMGLGPQTQS-SEADWESTYFIQHQPESNNIHDIPGHEIEFCEAMEDYIRQ  119

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L+K+AE L+ELM ENLGL+K ++KE+FS +    +GTKVA YP+CP P+L+ GLR  TD 
Sbjct  120   LIKLAETLAELMSENLGLDKCYLKEAFSPA---FVGTKVAKYPQCPQPKLLMGLRARTDG  176

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD VPGLEFFK  +WV I P K+NRIFVN GDQVE++SNG+YKS LHRV A 
Sbjct  177   GGIILLLQDDMVPGLEFFKHGKWVPITPKKDNRIFVNLGDQVEVMSNGLYKSILHRVAAD  236

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
              DG+RLSIATFYNP +DA+ISPAPKLLYP    F+DYL +Y  TKF DKG RF+ +K +
Sbjct  237   KDGSRLSIATFYNPGADAIISPAPKLLYPGGYRFKDYLDYYTGTKFSDKGARFQTIKDM  295



>ref|XP_009402922.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Musa 
acuminata subsp. malaccensis]
Length=293

 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 225/297 (76%), Gaps = 7/297 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI+  +L GE+RSKTM LLH AC++WGFF +ENHGI+  +ME VK++V QHYE+S+
Sbjct  1     MEIPVINLGELEGEKRSKTMSLLHDACQKWGFFWLENHGIEDGVMEEVKQLVKQHYEESM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             +E FY S++ + +    ++  D DWE+++F  H P  NIN+L   P      M+QY+EQ+
Sbjct  61    RESFYESELAQGLRRGTKA-SDVDWETSFFYRHRPDPNINDL---PELVRDAMKQYVEQV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+EL+ ENLGL   ++K +F+      +GTKVA+YP+C NPELV GLR HTDAG
Sbjct  117   VKLAEKLAELLSENLGLANTYLKNAFAEP---FVGTKVAMYPKCSNPELVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD VPGLEF KD +WV +PP++ +RIFVN GDQVE++SNG+YKS  HRVLA  
Sbjct  174   GIILLLQDDTVPGLEFLKDGEWVAVPPAQGHRIFVNLGDQVEVVSNGVYKSIRHRVLADG  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
              G+RLSIATFYNP +DA+ISPA +L+YP+   FQDYL +Y  TKF DK  RF+ MK+
Sbjct  234   TGSRLSIATFYNPGADAIISPAAELVYPSRYRFQDYLDYYTKTKFSDKASRFQNMKQ  290



>ref|XP_008805775.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Phoenix 
dactylifera]
Length=293

 Score =   360 bits (925),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 225/299 (75%), Gaps = 9/299 (3%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI+  ++ GE +SKTM LLH ACE+WGFF ++NHGID ELM+ VK +V QHYE S+
Sbjct  1     MEIPVINLGEMEGERKSKTMSLLHEACEKWGFFWIDNHGIDEELMDKVKGLVNQHYEGSM  60

Query  900   KERFYASDVVKCV-ENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             KE FY S+  K +  N K S  D DWE  +F  H P SN+N++   P    + M++Y+ Q
Sbjct  61    KESFYNSERAKELGPNIKAS--DVDWECGFFYRHQPDSNVNDI---PELLREAMQEYVAQ  115

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             ++K+AE L+EL+ ENLGLEK+++K++FS      +GTKVA YP+C  PE+V GLR HTDA
Sbjct  116   MIKLAERLAELLSENLGLEKDYLKKAFSEP---FVGTKVAKYPKCSQPEMVMGLRSHTDA  172

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEF KD +WV IPP++  RIFVN GDQVE++SNG YKS  HRVLA+
Sbjct  173   GGIILLLQDDKVPGLEFLKDGEWVAIPPTEGYRIFVNLGDQVEVVSNGTYKSVRHRVLAE  232

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
              +G+RLSIATFYNP  +A+ISPA +LLYP+   FQDYL +Y +TKF DK  RF+ +K++
Sbjct  233   KNGSRLSIATFYNPGGNAVISPASRLLYPSGYRFQDYLNYYSTTKFSDKVARFQNIKEM  291



>ref|XP_009400531.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Musa 
acuminata subsp. malaccensis]
Length=296

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 216/298 (72%), Gaps = 4/298 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME+PVID ++   EERSK M   H  C  WGFF VENHG+   LME +K+ V  HY+  L
Sbjct  1     MEVPVIDLAEFESEERSKAMSRFHQVCGNWGFFWVENHGVAVALMEEMKRHVYSHYDKCL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             KERFY S++ K +  + ++  + DWE+TYF+ H P S+  +       F + M+ Y+ QL
Sbjct  61    KERFYDSELAKGLGPQTDAA-EVDWETTYFVQHQPESSTEDDLGLGVEFREAMDAYVSQL  119

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AE+L+EL+ ENLGL+ +H+K++F+      +GTKVA+YP+CP PELV GLR H+DAG
Sbjct  120   TKLAEKLAELVSENLGLDDDHLKKTFAPP---FVGTKVAMYPQCPQPELVTGLRGHSDAG  176

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD VPGLEF+KD +WV + P+K NRIFVN GDQVE++SNG+Y+S  HRVLA  
Sbjct  177   GIILLLQDDTVPGLEFYKDGEWVPVTPNKGNRIFVNFGDQVEVVSNGLYRSMWHRVLADK  236

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
              G+RLS+ATFYNP  DA++ PAPKLLYP    FQDYL +Y  TKF DKG RF+A+K++
Sbjct  237   HGSRLSVATFYNPGGDAIVGPAPKLLYPGGYRFQDYLHYYFGTKFSDKGARFQAVKEM  294



>ref|XP_010915230.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Elaeis 
guineensis]
Length=293

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 229/299 (77%), Gaps = 9/299 (3%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI+  ++ G  +S+TM LLH ACE+WGFF +ENHG+D  LM+ VK +V QHYE+S+
Sbjct  1     MEIPVINLGEMEGVRKSETMSLLHEACEKWGFFWLENHGVDESLMDKVKALVNQHYEESM  60

Query  900   KERFYASDVVKCV-ENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             KE FY+S++ K +  N K S  + DWE ++F  H P SNIN++   P    + M++++ Q
Sbjct  61    KESFYSSELAKELGPNIKAS--EVDWECSFFYRHQPDSNINDI---PEPLREAMQEFVAQ  115

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L+K+AE L+EL+ ENLGLEK+++K++FS      +GTKVA YP+C +PE+V GLR HTDA
Sbjct  116   LIKLAERLAELLSENLGLEKDYLKKAFSEP---FVGTKVAKYPKCSDPEMVMGLRGHTDA  172

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDDQVPGLEF KD +WV IPP++  RIFVN GDQVE++SNG+YKS  HRVLA 
Sbjct  173   GGIILLLQDDQVPGLEFLKDGEWVAIPPTEGYRIFVNLGDQVEVVSNGIYKSVRHRVLAD  232

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
              +G+RLSIATFYNP ++A+ISPA +L+YP+   F+DYL +Y +TKF DK  RF+ +K++
Sbjct  233   KNGSRLSIATFYNPGANAVISPASRLVYPSCYRFEDYLNYYTTTKFSDKIARFQNIKEM  291



>ref|XP_008782557.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like isoform 
X1 [Phoenix dactylifera]
Length=293

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 225/299 (75%), Gaps = 9/299 (3%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI+  ++ GE +SKTM LLH ACE+WGFF ++NHGID ELM+ VK +V QHYE+S+
Sbjct  1     MEIPVINLGEMEGEGKSKTMSLLHEACEKWGFFWLDNHGIDEELMDKVKGLVNQHYEESM  60

Query  900   KERFYASDVVKCV-ENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             KE FY+S++ K +  N K S  D DWE  +F  H P SNIN++   P    + M++Y+ Q
Sbjct  61    KESFYSSELAKELGPNIKAS--DVDWECGFFYRHQPDSNINDI---PELLREAMQEYVAQ  115

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L+K+AE L+EL+ ENLGLEK+++K++FS      +GTKVA YP+C  PE+V GLR HTDA
Sbjct  116   LIKLAERLAELLSENLGLEKDYLKKAFSEP---FVGTKVAKYPKCSQPEMVMGLRSHTDA  172

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILLLQDD+VPGLEF KD +WV IPP++  RIFVN GDQVE++SNG+YKS  H VLA 
Sbjct  173   GGIILLLQDDKVPGLEFLKDGEWVAIPPTEGYRIFVNLGDQVEVVSNGIYKSVRHHVLAD  232

Query  363   NDGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
              +G+RLSIATFYNP   A+ISPA +L+YP+   F+DYL +Y +TKF DK  RF  +K++
Sbjct  233   KNGSRLSIATFYNPGGHAVISPASRLVYPSCYRFEDYLNYYSTTKFSDKIARFRNIKEM  291



>ref|XP_010925427.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Elaeis 
guineensis]
Length=296

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 225/300 (75%), Gaps = 7/300 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M++PVI+  ++ GE++SKTM LLH ACE+WGFF +ENHGID  LM+ VK +V QHYE+S+
Sbjct  1     MDVPVINLGEIDGEKKSKTMSLLHEACEKWGFFWLENHGIDESLMDKVKGLVNQHYEESM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY+SD+ K +    ++  + DWES++F  H P SNI+++   P    + M++Y+EQ 
Sbjct  61    KVSFYSSDLAKELGCHIKA-SEVDWESSFFYRHQPDSNIDDI---PELLREAMQEYVEQS  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+ L+ ENLGLEK+++K++FS      +GTKVA YP CP+PELV GLR HTDAG
Sbjct  117   IKLAEKLAALLSENLGLEKDYLKKAFSEP---FVGTKVAKYPTCPHPELVMGLRRHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD+VPGLEF KD +W  IPP+K  RIF N GDQVE++SNG+YKS  H + A  
Sbjct  174   GIILLLQDDEVPGLEFLKDGEWAPIPPTKGYRIFANLGDQVEVVSNGIYKSVQHHIHANK  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G+RLSI TFYNP  +A+I PAPKL+YP+   FQDYL +Y +TKF DK  RF+ +K++ A
Sbjct  234   NGSRLSIVTFYNPGPNAIICPAPKLVYPSCYRFQDYLNYYTTTKFSDKLARFQTIKEMLA  293



>gb|ABK59094.1| 1-amino-cyclopropane-1-carboxylic acid oxidase 3 [Manihot esculenta]
Length=312

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 217/304 (71%), Gaps = 11/304 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL+GEER  TM+++  ACE WGFF + NHGI  ELM+ V+++  +HY+  +++R
Sbjct  5     PVIDLSKLSGEERKPTMEMIQDACENWGFFELVNHGISHELMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN+ E+ +    + KTM+++ E+L K+
Sbjct  65    FKEMVASKGLEAVQSEISDLDWESTFFLRHLPVSNMAEIPDLDEEYRKTMKEFAEELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L E++CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLEVLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW  +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWFDVPPMKHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP SDA+I PAP L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVEKEAEKSQVYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKL  187
             MK +
Sbjct  303   MKAM  306



>ref|XP_007026207.1| Ethylene-forming enzyme [Theobroma cacao]
 gb|EOY28829.1| Ethylene-forming enzyme [Theobroma cacao]
Length=319

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 217/310 (70%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             E   PVIDFSKL GEER  TM+++  ACE WGFF + NHGI  EL++ V+++  +HY   
Sbjct  2     ETTFPVIDFSKLDGEERGATMEMIKDACENWGFFELMNHGISHELLDTVERLTKEHYRKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +E  +  I D DWEST+F+ H P SNI+E+ +    + K M+++  +
Sbjct  62    MEQRFKEMVASKGLEAVQFEINDLDWESTFFLRHLPESNISEIPDLEEEYRKVMKEFAVE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AE+L  L+CENLGLEK ++K  F GS+G + GTKV+ YP CP P+L++GLR HTDA
Sbjct  122   LEKLAEQLLNLLCENLGLEKGYLKNVFYGSRGPTFGTKVSNYPPCPKPDLIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD+QW+ +PP K++ I +N GDQVE+++NG YKS LHRV+AQ
Sbjct  182   GGIILLFQDDKVSGLQLLKDDQWIDVPPMKHS-IVINLGDQVEVITNGKYKSVLHRVIAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGP  211
              DG R+SIA+FYNP SDA+I PAP L         LYP  V F+DY+K Y   KF  K P
Sbjct  241   TDGTRMSIASFYNPGSDAVIYPAPALLEKEAETSQLYPKFV-FEDYMKLYAGLKFQAKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKTMES  309



>gb|KHG22879.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=319

 Score =   340 bits (872),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 221/310 (71%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             E+  PVID SK+ GEER  TM ++  ACE WGFF + NHGI  ELM+ V+K+  +HY+  
Sbjct  2     EVAFPVIDLSKINGEERGATMDMIKDACENWGFFELTNHGISHELMDTVEKLTKEHYKKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +E  +  I D DWEST+F+ H P SN+ E+ +   ++ K M+Q+  +
Sbjct  62    MEDRFKEMVTSKGLEVVQSEITDMDWESTFFLRHLPESNLYEIPDLEYDYRKVMKQFAVE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AE+L +++CENLGLE+ ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDA
Sbjct  122   LEKLAEKLLDILCENLGLEQGYLKKVFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD+QW+ +PP K++ I +N GDQ+E+++NG YKS +HRVLAQ
Sbjct  182   GGIILLFQDDKVSGLQLLKDDQWIDVPPLKHS-IVINLGDQLEVITNGKYKSVMHRVLAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGP  211
              DG R+SIA+FYNP SDA+I PAP L+         YP  V F+DY+K Y + KF DK P
Sbjct  241   TDGTRMSIASFYNPGSDAVIYPAPALVDKEAEKPIAYPKFV-FEDYMKVYPALKFEDKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKTMES  309



>gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis]
Length=317

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 220/305 (72%), Gaps = 10/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL GEER+ +M+++  ACE WGFF + NHGI  ELM+ V+ +   HY+  +++R
Sbjct  5     PVIDMEKLNGEERAASMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   ++ KTM+++ E+L K+
Sbjct  65    FKEMVASKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEEDYRKTMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLG+EK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEQLLDLLCENLGIEKGYLKKAFYGSKGPTFGTKVSNYPPCPRPELIKGLRAHTDAGGLI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD++WV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDKWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP SDA+I PAP L        +YP  V F+DY+K Y   KF  K PRFEAM
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEEQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFEAM  302

Query  195   KKLQA  181
             K ++ 
Sbjct  303   KAMET  307



>gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Betula luminifera]
Length=318

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL GEER +TM+L+  ACE WGFF + NHGI  +L++ V+K+  +HY   ++ER
Sbjct  5     PVIDMEKLNGEERGETMELIEDACENWGFFELVNHGISHDLLDTVEKLNKEHYRKCMEER  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +   ++ K M+++ E L K+
Sbjct  65    FKDMVASKGLEAAQSEVSDMDWESTFFLRHLPASNISEIPDLDEDYRKAMKEFAEDLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+SF GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEQLLDLLCENLGLEKGYLKKSFYGSKGPNFGTKVSSYPPCPKPELIQGLRAHTDAGGLI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP +++ I +N GDQ+E+++NG YKS LHRVLAQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGKWVDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVLAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP SDA+I PAP L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVEKEAEKGQVYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK  ++ 
Sbjct  303   MKATEST  309



>ref|XP_006449820.1| hypothetical protein CICLE_v10015965mg [Citrus clementina]
 ref|XP_006467364.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Citrus 
sinensis]
 gb|ESR63060.1| hypothetical protein CICLE_v10015965mg [Citrus clementina]
 gb|KDO78384.1| hypothetical protein CISIN_1g018920mg [Citrus sinensis]
Length=318

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 219/306 (72%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+ID SKL G+ERS TM++++ ACE WGFF + NHGI  EL++ V+++  +HY   + +R
Sbjct  5     PIIDLSKLNGDERSATMEMINDACENWGFFELVNHGISHELLDTVQRLTKEHYGKCMDQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SN+ E+ +  +++ K M+++  +L KV
Sbjct  65    FKQMVASKGLEAVQSEVNDLDWESTFFLRHLPVSNMAEIPDLEDDYRKAMKEFAVELEKV  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L EL+CENLGLE+ ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLELLCENLGLEEGYLKKVFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP K++ I +N GDQ+E+++NG YKS LHRV+AQ +GN
Sbjct  185   LLFQDDEVSGLQLLKDDQWVDVPPMKHS-IVINLGDQLEVITNGKYKSVLHRVIAQTEGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEAVNSQVYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK ++ 
Sbjct  303   MKNMET  308



>gb|AFZ76981.1| ACC oxidase [Boehmeria nivea]
Length=326

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 220/318 (69%), Gaps = 16/318 (5%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             ++++   PVID SKL GEER+ TM++++ ACE WGFF + NHGI  ELM+ V+++  +HY
Sbjct  1     MEQQNTFPVIDMSKLNGEERASTMEMINDACENWGFFELMNHGISHELMDIVERLTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
                +++RF      K +E  +  I D DWEST+F+ H P SNI E+ +  +++   M ++
Sbjct  61    RKCMEQRFKEMVATKGLEAVQSEITDLDWESTFFLRHLPFSNIAEIPDLGDDYRSAMREF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
               +L K+AE+L EL+CENLGLEK +IKE F GSKG + GTKV+ YP CP PEL++GLR H
Sbjct  121   AAELEKLAEQLLELLCENLGLEKGYIKEVFYGSKGPNFGTKVSNYPPCPKPELIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD QWV +PP +++ I +N GDQ+E+++NG YKS LHRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKL--------------LYPNNVCFQDYLKHYGS  235
             + Q DGNR+S+A+FYNP SDA+I PAP L              +YP  V F DY+K Y  
Sbjct  240   VTQTDGNRMSLASFYNPGSDAVIYPAPALVGDQGEADEKKSSVVYPKFV-FDDYMKLYAG  298

Query  234   TKFGDKGPRFEAMKKLQA  181
              KF  K PRFEAMK +++
Sbjct  299   LKFQAKEPRFEAMKAMES  316



>gb|EMS68745.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Triticum urartu]
Length=293

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 217/296 (73%), Gaps = 7/296 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L GE+RS+T+ LLH AC +WGFF +ENHGI+ +LM+  KK+V +HYE ++
Sbjct  1     MEIPVIKMDELHGEKRSETLALLHDACAQWGFFWLENHGINDDLMDRTKKLVNKHYEQNM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++ FY+S++ K +   K +  + DWE ++   H P SNI+++   P     T+ +Y E++
Sbjct  61    EKNFYSSEIAKTIGPDKVT-SNVDWECSFMYHHQPKSNIHDI---PELLRTTVPEYAEEV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+E+M ENLGL+KN++K++F+     SIG KVA YP C +PE+V GLR HTDAG
Sbjct  117   VKLAEQLAEVMSENLGLDKNYLKKAFTKP---SIGIKVAKYPRCSHPEVVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GII L QDD VPGL+F KD +W+ IPP+K NRIFVN GDQ+E++SNG+YKS  H+VL   
Sbjct  174   GIIFLFQDDLVPGLQFMKDGRWISIPPTKGNRIFVNLGDQIEVISNGIYKSICHQVLPNQ  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMK  193
             +G+RLSIATFYNP +DA+I PAP L YP+   FQDYL  Y +TKF DK  RF+  K
Sbjct  234   NGSRLSIATFYNPGADAIIFPAPNLTYPSQYRFQDYLNFYSATKFTDKVSRFQTTK  289



>dbj|BAA21541.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Actinidia deliciosa]
Length=317

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 221/307 (72%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL G+ERS TM+ ++ ACE WGFF + NHGI  ELM+ V+++  +HY+  +++R
Sbjct  3     PVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKCMEQR  62

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   +  K M+++ E+L K+
Sbjct  63    FKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEKLEKL  122

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++FSGSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  123   AEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPLPELIKGLRAHTDAGGII  182

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD++V GL+  K+ +W+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  183   LLFQDNKVSGLQLLKEGEWIDVPPMKHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  241

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  242   RMSIASFYNPGSDAVIYPAPALVDKEEDQQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  300

Query  201   AMKKLQA  181
             AMK +++
Sbjct  301   AMKAMES  307



>ref|XP_010099139.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus notabilis]
 gb|EXB77011.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus notabilis]
Length=322

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 222/312 (71%), Gaps = 13/312 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             ++  PVID +KL GEER +TM+L++ ACE WGFF + NHGI  ELM+ V+++  +HY   
Sbjct  3     QITFPVIDMAKLNGEERKETMELINDACENWGFFELMNHGISHELMDAVERLTKEHYRKC  62

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K ++  +  I D DWEST+F+ H P SN++E+ +  +++ K M+++  +
Sbjct  63    MEQRFKEMVASKGLDVVQSEINDLDWESTFFLRHRPVSNMSEIPDLDDDYRKAMKEFAAE  122

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             + K+AE L +L+CENLGLEK +IK+ F GSKG + GTKV+ YP CP P+L++GLR HTDA
Sbjct  123   VEKLAEHLLDLLCENLGLEKAYIKKVFFGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDA  182

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  183   GGIILLFQDDKVSGLQLLKDGQWINVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVVAQ  241

Query  363   NDGNRLSIATFYNPASDAMISPAPKL-----------LYPNNVCFQDYLKHYGSTKFGDK  217
              DGNR+S+A+FYNP SDA+I PAP L           LYP  V F DY+K Y   KF DK
Sbjct  242   TDGNRMSLASFYNPGSDAVIYPAPALVEKAAKQESQVLYPKFV-FDDYMKLYAGLKFQDK  300

Query  216   GPRFEAMKKLQA  181
              PRFEAMK +++
Sbjct  301   EPRFEAMKAVES  312



>dbj|BAG06705.1| 1-aminocyclopropane-1-carboxylate oxidase [Ficus carica]
Length=322

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 222/312 (71%), Gaps = 13/312 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             ++  PVID +KL G+ER  TM+L++ ACE WGFF V NHGI  ELM+ V+++  +HY   
Sbjct  3     QITFPVIDMTKLNGDERKTTMELINDACENWGFFEVMNHGISHELMDTVERLTKEHYRKC  62

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K ++  +  I+D DWEST+F+ H P SN++E+ +  +++ K M+++  +
Sbjct  63    MEQRFKEMVATKGLDVVQSEIKDLDWESTFFLRHLPVSNMSEIPDLGDDYRKVMKEFAAE  122

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AE L +L+CENLGLEK +IK  F GSKG + GTKV+ YP CP P+L++GLR HTDA
Sbjct  123   LEKLAEHLLDLLCENLGLEKGYIKSVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDA  182

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  183   GGIILLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGRYKSVMHRVVAQ  241

Query  363   NDGNRLSIATFYNPASDAMISPAP-----------KLLYPNNVCFQDYLKHYGSTKFGDK  217
              DGNR+S+A+FYNP SDA+I PAP           K++YP  V F DY+K Y   KF  K
Sbjct  242   PDGNRMSLASFYNPGSDAVIYPAPALVEKAAEQETKVVYPKFV-FDDYMKLYAGLKFQAK  300

Query  216   GPRFEAMKKLQA  181
              PRFEAMK +++
Sbjct  301   EPRFEAMKAVES  312



>emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betula pendula]
Length=318

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/308 (52%), Positives = 218/308 (71%), Gaps = 11/308 (4%)
 Frame = -2

Query  1074  IPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKE  895
              PVID  KL GEER  TM+L+  ACE WGFF + NHGI  +L++ V+K+  +HY   ++E
Sbjct  4     FPVIDMEKLNGEERGATMELIEDACENWGFFELVNHGISHDLLDTVEKLNKEHYRKCMEE  63

Query  894   RFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMK  715
             RF      K +E  +  +RD DWEST+F+ H P SN++E+ +   ++ K M+++   L K
Sbjct  64    RFKDMVASKGLEAAQSEVRDMDWESTFFLRHLPASNMSEIPDLDEDYRKAMKEFAGNLEK  123

Query  714   VAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGI  535
             +AE+L +L+CENLGLEK ++K+SF GSKG + GTKV+ YP CP PEL++GLR HTDAGG+
Sbjct  124   LAEQLLDLLCENLGLEKGYLKKSFYGSKGPNFGTKVSNYPPCPKPELIQGLRAHTDAGGL  183

Query  534   ILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG  355
             ILL QDD+V GL+  KD +WV +PP +++ I +N GDQ+E+++NG YKS LHRVLAQ DG
Sbjct  184   ILLFQDDKVSGLQLLKDGKWVDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVLAQPDG  242

Query  354   NRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             NR+S+A+FYNP SDA+I PAP L         +YP  V F+DY+K Y   KF  K PRFE
Sbjct  243   NRMSLASFYNPGSDALIYPAPVLVEKEAEKGQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  301

Query  201   AMKKLQAN  178
             AMK +++ 
Sbjct  302   AMKAMEST  309



>gb|AEM62878.1| ACC oxidase 2 [Actinidia deliciosa]
Length=319

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 221/307 (72%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL G+ERS TM+ ++ ACE WGFF + NHGI  ELM+ V+++  +HY+  +++R
Sbjct  5     PVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   +  K M+++ E+L K+
Sbjct  65    FKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++FSGSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPLPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD++V GL+  K+ +W+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDNKVSGLQLLKEGEWIDVPPMKHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVDKEEDQQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQA  181
             AMK +++
Sbjct  303   AMKAMES  309



>gb|AAZ83343.1| ACC oxidase 2 [Gossypium hirsutum]
Length=319

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 220/310 (71%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             E+  PVID SK+ GEER  TM ++  ACE WGFF + NHGI  ELM+ V+K+  +HY+  
Sbjct  2     EVAFPVIDLSKINGEERGATMDMIKDACENWGFFELTNHGISHELMDTVEKLTKEHYKKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +E  +  I D DWEST+F+ H P SN+ E+ +   ++ K M+Q+  +
Sbjct  62    MEDRFKEMVTSKGLEVVQSEITDMDWESTFFLRHLPESNLYEIPDLEYDYRKVMKQFAVE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AE+L +++CENLGLE+  +K+ F GSKG + GTKV+ YP CP P+L++GLR HT+A
Sbjct  122   LEKLAEKLLDILCENLGLEQGSLKKVFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTEA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD+QW+ +PP K++ I +N GDQ+E+++NG YKS +HRVLAQ
Sbjct  182   GGIILLFQDDKVSGLQLLKDDQWIDVPPLKHS-IVINLGDQLEVITNGKYKSVMHRVLAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGP  211
              DG R+SIA+FYNP SDA+I PAP L+         YP  V F+DY+K Y + KF DK P
Sbjct  241   TDGTRMSIASFYNPGSDAVIYPAPALVDKEAEKPIAYPKFV-FEDYMKVYPALKFEDKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKTMES  309



>ref|XP_002438605.1| hypothetical protein SORBIDRAFT_10g022640 [Sorghum bicolor]
 gb|EER89972.1| hypothetical protein SORBIDRAFT_10g022640 [Sorghum bicolor]
Length=293

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 219/298 (73%), Gaps = 7/298 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L GE+RS+T+ LLH+AC +WGFF +ENHG++ +LM  +K +V +HYE  +
Sbjct  1     MEIPVIKMDQLHGEKRSETLSLLHNACAQWGFFWLENHGVNEDLMNKMKDLVNKHYEQDM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++ FY+S+  K ++ +K S  + DWE ++   H P SN +++   P     T+ +Y E++
Sbjct  61    EKNFYSSEKAKILDYEKAS-SNVDWECSFMYRHQPKSNSHDI---PELLRATVFEYAEEV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+ +M ENLGL+K++I+++FS     S+G KVA YP C +PELV GLREHTDAG
Sbjct  117   IKLAEQLAAVMSENLGLDKDYIEQAFSKP---SVGIKVAKYPRCSHPELVMGLREHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QD+ VPGLEF KD +W+ IPP++ NRIFVN GDQ+E+++NG+YKS  HRVL   
Sbjct  174   GIILLFQDELVPGLEFLKDGKWIAIPPTEGNRIFVNLGDQIEVMTNGIYKSICHRVLPNK  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNP +DA+I PAPKL YP+   FQDYL  Y +TKF DK  RF+  K +
Sbjct  234   NGSRLSIATFYNPGADAIIYPAPKLTYPSQYRFQDYLNFYSTTKFTDKVSRFQTTKAI  291



>gb|AEM62879.1| ACC oxidase 3 [Actinidia chinensis]
Length=319

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 221/307 (72%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL G+ERS TM+ ++ ACE WGFF + NHGI  ELM+ V+++  +HY+  +++R
Sbjct  5     PVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   +  K+M+++ E+L K+
Sbjct  65    FKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKSMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++FSGSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPQPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD++V GL+  K+ +W+ +PP K + I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDNKVSGLQLLKEGEWIDVPPMK-HAIVINIGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP S+A+I PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSEAVIYPAPALVDKEEDQQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQA  181
             AMK +++
Sbjct  303   AMKAMES  309



>gb|AAZ83342.1| ACC oxidase 1 [Gossypium hirsutum]
Length=319

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 218/310 (70%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             E+  PVIDFSKL GEER+  M+++  ACE WGFF + NHGI  ELM+ V+++  +HY   
Sbjct  2     ELTFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +E  +  I D DWEST+F+ H P SN++E+ +   ++ K M+++  +
Sbjct  62    MEQRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAVE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AE+L +L+CENLGLE  ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDA
Sbjct  122   LEKLAEQLLDLLCENLGLEPGYLKKVFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD QW+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  182   GGIILLFQDDKVSGLQLLKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGP  211
              DG R+SIA+FYNP SDA+I PAP LL         YP  V F+DY+  Y   KF  K P
Sbjct  241   TDGTRMSIASFYNPGSDAVIYPAPALLEKEADKSQVYPKFV-FEDYMNLYADLKFQAKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKTVES  309



>ref|XP_004966039.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Setaria 
italica]
Length=292

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/298 (54%), Positives = 219/298 (73%), Gaps = 8/298 (3%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L GE+RS+T+ LLH+AC +WGFF +ENHG++ +LM  VK++V +HYE  +
Sbjct  1     MEIPVIKIDQLYGEKRSETLSLLHNACAQWGFFWLENHGVNEDLMNKVKELVNKHYEQEM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
              E FY+S++ K +  +K S  + DWE ++   H P SNI+++   P     T+ QY E++
Sbjct  61    -ENFYSSEMAKVLGCEKVS-SNVDWECSFMYRHQPKSNIHDI---PELLRTTVFQYAEEV  115

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+  M ENLGL+K++I+++FS     S+G KVA YP C +PELV GLREHTDAG
Sbjct  116   IKLAEQLAAAMSENLGLDKDYIEKAFSKP---SVGIKVAKYPRCSHPELVMGLREHTDAG  172

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQD+ VPGLEF KD +W+ +PP++ NRIFVN GDQ+E+++NG+YKS  HRV    
Sbjct  173   GIILLLQDELVPGLEFLKDGKWIPVPPTEGNRIFVNLGDQIEVMTNGIYKSICHRVRPNK  232

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNP +DA+I PAPKL YP+   FQDYL  Y +TKF DK  RF+  K +
Sbjct  233   NGSRLSIATFYNPGADAIICPAPKLTYPSQYRFQDYLNFYSTTKFTDKVSRFQTTKAM  290



>gb|AAC98808.1| ACC oxidase [Carica papaya]
 emb|CAE53415.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
 emb|CAH68522.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 219/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER+ TM+L+H ACE WGFF + NHGI  +LM+ V+++  +HY+  +++R
Sbjct  5     PVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F        +E  +  I D DWEST+F+ H P SN++E+ +  +++ K M+++   L K+
Sbjct  65    FKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVGLQKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE++ +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQMLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDQWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVIYPAPSLVEKEAEKNQIYPKFV-FDDYMKLYVGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>gb|AEM62880.1| ACC oxidase 3 [Actinidia deliciosa]
Length=319

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 219/307 (71%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL G+ERS TM+ ++ ACE WGFF + NHGI  ELM+ V+++  +HY+  +++R
Sbjct  5     PVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   +  K M+++ E+L K+
Sbjct  65    FKEMVATKGLEALQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++FSGSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPQPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD++V GL+  K+ +W+ +PP K + I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDNKVSGLQLLKEGEWIDVPPMK-HAIVINIGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP S+A+I PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSEAVIYPAPALVDKEEDQQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQA  181
             AMK ++ 
Sbjct  303   AMKAMET  309



>gb|AAB70883.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
Length=323

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 217/303 (72%), Gaps = 10/303 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID   L GEERS  M ++  ACE WGFF ++NHGI  ELM+ V+++  +HY   +++R
Sbjct  5     PVIDMEMLNGEERSAAMNMIKDACENWGFFEIKNHGISHELMDKVERLTKEHYAKFMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K ++  +  I D DWEST+F+ H PTSNI+E+ +  +++   M+++ E+L K+
Sbjct  65    FKEMVASKGLDATQSEIDDLDWESTFFLRHLPTSNISEIPDLEHDYRLAMKEFAERLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPELIKGLRAHTDAGGLI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +W+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGRWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNP SDA+I PAP L        +YP  V F+DY+K Y   KF  K PRFEAM
Sbjct  244   RMSLASFYNPGSDAVIYPAPALIEEENQNPIYPKFV-FEDYMKLYAGLKFQAKEPRFEAM  302

Query  195   KKL  187
             K +
Sbjct  303   KAM  305



>gb|AEM62883.1| ACC oxidase 5 [Actinidia chinensis]
Length=318

 Score =   335 bits (858),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 219/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GE+R  TM+L++ ACE WGFF + NHGI  EL++ V++M  +HY+  +++R
Sbjct  5     PVINMQKLNGEQRGATMELINDACENWGFFELVNHGISIELLDRVERMTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  +   DWEST+F+ H P SNI+E+ +  + + K M+++  +L  +
Sbjct  65    FKELVASKALEGVQAEVTTMDWESTFFLRHLPQSNISEVPDLDDEYRKVMKEFALKLENL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F+G+KG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFNGTKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEAESKEIYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK ++AN
Sbjct  303   MKAMEAN  309



>gb|AAK57516.1| ACC oxidase [Carica papaya]
 gb|AAS16933.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Carica papaya]
 gb|AAT99444.1| ripening related ACC oxidase 1 [Carica papaya]
Length=318

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER+ TM+L+H ACE WGFF + NHGI  +LM+ V+++  +HY   +++R
Sbjct  5     PVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F        +E  +  I D DWEST+F+ H P SN++E+ +  +++ K M+++   L K+
Sbjct  65    FKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVGLQKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE++ +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQMLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDQWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVIYPAPSLVEKEAEKNQIYPKFV-FDDYMKLYVGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>emb|CAJ56066.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/306 (51%), Positives = 216/306 (71%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER   M+++  ACE WGFF + NHGI  ELM+ V+K+  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN++E  +   ++ K M+Q+ E+L K+
Sbjct  65    FKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEHLLDLLCENLGLEKRYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+ FKD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLFKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVISPAPALVKESDETSQVYPKFV-FNDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK + +
Sbjct  303   MKAVSS  308



>emb|CAN85571.1| ACC oxidase 3 [Hevea brasiliensis]
Length=318

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 219/311 (70%), Gaps = 12/311 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  KL GEER+ TM  +  ACE WGFF + +HGI+ E ++ V++M   HY   +
Sbjct  1     MEFPVINLEKLNGEERASTMAKIKDACENWGFFELLDHGIEPEFLDTVERMTKGHYRKCM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K +EN +  I+D DWEST+++ H P SNI ++ +  + + K M+++  +L
Sbjct  61    EQRFKEMMAGKGLENVQTEIKDLDWESTFYLRHLPESNIAQVPDLDDEYRKVMKEFAAKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K++F GS+G + GTKV+ YP CP P+L++GLR HTDAG
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVSNYPPCPKPDLIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ 
Sbjct  181   GIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVEHRVVAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAP----------KLLYPNNVCFQDYLKHYGSTKFGDKGP  211
             DG R+SIA+FYNP SDA+I PAP          KL+YP  V F+DY+K Y   KF  K P
Sbjct  240   DGTRMSIASFYNPGSDALIYPAPALVEKAAEQKKLVYPKFV-FEDYMKLYAGLKFQAKEP  298

Query  210   RFEAMKKLQAN  178
             RFEAMK +++N
Sbjct  299   RFEAMKAVESN  309



>gb|AEM62884.1| ACC oxidase 5 [Actinidia deliciosa]
Length=318

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GE+R  TM+L++ ACE WGFF + NHGI  EL++ V++M  +HY+  +++R
Sbjct  5     PVINMEKLNGEQRGATMELINDACENWGFFELVNHGISIELLDRVERMTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  +   DWEST+F+ H P SNI+E+ +  + + K M+++  +L  +
Sbjct  65    FKELVASKALEGVQAEVTTMDWESTFFLRHLPQSNISEVPDLDDEYRKVMKEFALKLENL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F G+KG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFHGTKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEAESKEIYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK ++AN
Sbjct  303   MKAMEAN  309



>ref|XP_008782558.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like isoform 
X2 [Phoenix dactylifera]
Length=274

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/280 (58%), Positives = 210/280 (75%), Gaps = 9/280 (3%)
 Frame = -2

Query  1023  MKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYASDVVKCV-ENKKE  847
             M LLH ACE+WGFF ++NHGID ELM+ VK +V QHYE+S+KE FY+S++ K +  N K 
Sbjct  1     MSLLHEACEKWGFFWLDNHGIDEELMDKVKGLVNQHYEESMKESFYSSELAKELGPNIKA  60

Query  846   SIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEELSELMCENLGLE  667
             S  D DWE  +F  H P SNIN++   P    + M++Y+ QL+K+AE L+EL+ ENLGLE
Sbjct  61    S--DVDWECGFFYRHQPDSNINDI---PELLREAMQEYVAQLIKLAERLAELLSENLGLE  115

Query  666   KNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLLQDDQVPGLEFFK  487
             K+++K++FS      +GTKVA YP+C  PE+V GLR HTDAGGIILLLQDD+VPGLEF K
Sbjct  116   KDYLKKAFSEP---FVGTKVAKYPKCSQPEMVMGLRSHTDAGGIILLLQDDKVPGLEFLK  172

Query  486   DEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLSIATFYNPASDAM  307
             D +WV IPP++  RIFVN GDQVE++SNG+YKS  H VLA  +G+RLSIATFYNP   A+
Sbjct  173   DGEWVAIPPTEGYRIFVNLGDQVEVVSNGIYKSVRHHVLADKNGSRLSIATFYNPGGHAV  232

Query  306   ISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             ISPA +L+YP+   F+DYL +Y +TKF DK  RF  +K++
Sbjct  233   ISPASRLVYPSCYRFEDYLNYYSTTKFSDKIARFRNIKEM  272



>ref|XP_007160496.1| hypothetical protein PHAVU_002G326600g [Phaseolus vulgaris]
 gb|ESW32490.1| hypothetical protein PHAVU_002G326600g [Phaseolus vulgaris]
Length=310

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 221/305 (72%), Gaps = 12/305 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+F  + GE+R  T++ +  ACE WGFF + NHGI  EL+++V+K+  +HY  S+++R
Sbjct  5     PVINFENINGEKRKATLEKIEDACENWGFFELVNHGIPLELLDSVEKLTKEHYRKSMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E  K  ++D DWEST+F+ H P SNI+E+ +   ++ K M+++ ++L K+
Sbjct  65    FKEAVASKGLEGIKGEMKDMDWESTFFLRHLPDSNISEIPDLSEDYRKAMKEFAQKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVANYPPCPKPELVKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+A++DG 
Sbjct  185   LLLQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIAKSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNPA DA+I PAP LL          YP  V F+DY++ Y + KF  K PRFE
Sbjct  244   RMSIASFYNPAGDAVIYPAPPLLERKTEVIDKVYPKFV-FEDYMRLYTTLKFQPKKPRFE  302

Query  201   AMKKL  187
             AMK +
Sbjct  303   AMKSV  307



>gb|AEM62877.1| ACC oxidase 1 [Actinidia chinensis]
 gb|AEY77404.1| ACC oxidase-like protein [Actinidia deliciosa]
Length=319

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 218/307 (71%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL GEER+ TM+ +  ACE WGFF + NHGI  ELM+ V+++  +HY   +++R
Sbjct  5     PVIDMEKLNGEERAPTMEKIKDACENWGFFELVNHGISHELMDTVERLTKEHYNKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   +  K M+++ E+L K+
Sbjct  65    FKEMVATKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CEN+GLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENVGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPRPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD++V GL+  KD +W+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDNKVSGLQLLKDGEWIDVPPMKHS-IVINIGDQLEVITNGKYKSVMHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA++ PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVMYPAPALVDKEEDQQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQA  181
             AMK +++
Sbjct  303   AMKAMES  309



>gb|AAF64528.1|AF254125_1 ACC oxidase [Carica papaya]
Length=318

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER+ TM+L+H ACE WGFF + NHGI  +LM+ V+++  +HY+  +++R
Sbjct  5     PVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F        +E  +  I D DWEST+F+ H P SN++E+ +  +++ K M+++   L K+
Sbjct  65    FKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVGLQKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE++ +L+CENLGLEK ++K+ F GSKG + GTKV  YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQMLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVRNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             L+ QDD+V GL+  KD+QWV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LVFQDDKVSGLQLLKDDQWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVIYPAPSLVEKEAEKNQIYPKFV-FDDYMKLYVGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>ref|NP_001233928.1| 1-aminocyclopropane-1-carboxylate oxidase 4 [Solanum lycopersicum]
 sp|P24157.1|ACCO4_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase 4; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=Protein pHTOM5 [Solanum lycopersicum]
 emb|CAA41689.1| ethylene-forming enzyme [Solanum lycopersicum]
 emb|CAA90904.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
Length=316

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 217/304 (71%), Gaps = 8/304 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+   L G+ER+KTM+++  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIINLENLNGDERAKTMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H PTSNI+++ +    + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KDEQW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDEQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             R+S+A+FYNP +DA+I PAP L+      YP  V F DY+K Y   KF  K PRFEAMK 
Sbjct  244   RMSLASFYNPGNDAVIYPAPSLIEESKQVYPKFV-FDDYMKLYAGLKFQPKEPRFEAMKA  302

Query  189   LQAN  178
             ++AN
Sbjct  303   MEAN  306



>ref|XP_006383841.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|ERP61638.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
Length=318

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER  TM++++ ACE WGFF + NHGI  +L++ V+++  +HY   +++R
Sbjct  5     PVIDLSKLNGEERKPTMEVINDACENWGFFELVNHGISHDLLDAVERLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN+ E+ +   ++ KTM+++  +L  +
Sbjct  65    FKEMVASKGLEAVQSEIDDLDWESTFFLRHLPESNLAEIPDLGEDYRKTMKEFALELEGL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++++ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLRKVFCGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP K++ I +N GDQ+E+++NG YKS LHRVLAQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVLHRVLAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP+L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPELVEKEEKESQIYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAVEST  309



>ref|XP_011000640.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
 ref|XP_011014997.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
 ref|XP_011014999.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
Length=318

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 217/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER  TM+ +  ACE WGFF + NHGI  +L++ V+++  +HY   +++R
Sbjct  5     PVIDLSKLNGEERKPTMEKIEDACENWGFFELVNHGISHDLLDTVERLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN+ E+ +   ++ K M+++  ++ K+
Sbjct  65    FKEMVASKGLEAVQSEISDLDWESTFFLRHLPESNMAEIPDLEEDYRKVMKEFALEVEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+ FKD QW+ +PP K++ I +N GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLFKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA++ PAP L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVMYPAPALVEKEAEESQIYPKFV-FEDYMKLYAGLKFQAKQPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>ref|XP_003563715.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Brachypodium 
distachyon]
Length=293

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 217/298 (73%), Gaps = 7/298 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L G++RS T+ LLH AC +WGFF +ENHG++ ELM+ +K +V +HYE  +
Sbjct  1     MEIPVIKMDELHGKKRSATLSLLHDACAQWGFFWLENHGVNDELMDKIKSLVNKHYEQDI  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++ FY+S++ K + + K +  + DWE +    H P SNI+++   P     T+ +Y E++
Sbjct  61    EKNFYSSEMAKTLGSDKGA-SNVDWECSCMYHHQPESNIHDI---PQLLRTTLPEYAEEV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE L+E+M ENLGL+K+++K++FS     S+G KVA YP C +PELV GLR HTDAG
Sbjct  117   VKLAERLAEVMSENLGLDKDYLKKAFSKP---SVGIKVAKYPRCNHPELVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD VPGLEF KD +W+ IPP++ NRIFVN GDQ+E++SNG+YKS  H+VL   
Sbjct  174   GIILLFQDDLVPGLEFKKDGRWIPIPPTEGNRIFVNLGDQIEVMSNGIYKSICHQVLPNK  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNP +DA+I PAPKL YP+   FQDYL  Y ++KF DK  RFE  K +
Sbjct  234   NGSRLSIATFYNPGADAIIFPAPKLTYPSQYRFQDYLNFYSTSKFSDKVSRFEITKTV  291



>gb|AHA06004.1| 1-aminocyclopropane-1-carboxylate oxidase [Lupinus luteus]
Length=317

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 219/306 (72%), Gaps = 10/306 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P++D  KL  EER  TM ++  ACE WGFF + NHGI  ELM+ V+++  +HY+  +++R
Sbjct  5     PIVDIGKLNTEERVPTMDIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I+D DWEST+F+ H P SNI+E  +  +++ K M+++ ++L K+
Sbjct  65    FNEMVTSKSLESVQSEIKDLDWESTFFLRHLPVSNISETPDLDDDYRKVMKEFAQELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+LV+GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLVKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL--------YPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNP +DA+I+PAP  +        YP  V F DY+K Y   KF +K PRFEAM
Sbjct  244   RMSLASFYNPGNDAVIAPAPIFVKENETSQAYPKFV-FDDYMKLYAGLKFQEKEPRFEAM  302

Query  195   KKLQAN  178
             K +++ 
Sbjct  303   KAVEST  308



>gb|AHL69752.1| aminocyclopropanecarboxylate oxidase [Picrorhiza kurrooa]
Length=318

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 220/309 (71%), Gaps = 11/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++  KL GEERS TM+++  ACE WGFF + NHGI  E M+ V+++  +HY+ ++++R
Sbjct  5     PVVNMEKLNGEERSATMEMIKDACENWGFFELVNHGIAPEFMDIVERLTKEHYKRAMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +    + K M+++  QL K+
Sbjct  65    FKEMVESKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEEEYRKVMKEFAAQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEDLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP +++ I +N GDQ+E+++NG YKS LHRVLAQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVLAQTDGN  243

Query  351   -RLSIATFYNPASDAMISPAPKLL--------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
              R+SIA+FYNP SDA+I PAP L+        YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   GRMSIASFYNPGSDAVIYPAPALVEKEESEDAYPKFV-FEDYMKLYAGVKFQAKEPRFEA  302

Query  198   MKKLQANGH  172
              K ++ NG+
Sbjct  303   FKAMERNGN  311



>sp|Q8S932.1|ACCO_DIOKA RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Diospyros kaki]
 dbj|BAB89351.1| 1-aminocyclopropane-1-carboxylate oxidase [Diospyros kaki]
Length=318

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 217/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  K+ GEER+ TM L++ ACE WGFF + NHGI  ELM+ V+++   HY+  +++R
Sbjct  5     PVINMEKMNGEERAATMGLINDACENWGFFELVNHGIPPELMDTVERVTKAHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWESTYF+ H P SNI+E+ +    + + M+ + E+L K+
Sbjct  65    FKELVASKALEGIQAEVTDMDWESTYFLRHLPQSNISEVPDLDEEYRRVMKDFAERLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K++F G+KG + GTKVA YP CP  +L++GLR HTDAGGII
Sbjct  125   AEYLLDLLCENLGLEKGYLKKAFYGTKGPNFGTKVANYPPCPKADLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP K++ I +N GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVLHRVVAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP +DA+I PAP L         +YP  V F DY+K Y + KF  K PRFEA
Sbjct  244   RMSIASFYNPGNDAVIYPAPALVEKEVEEKEVYPKFV-FDDYMKLYAALKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK ++AN
Sbjct  303   MKAVEAN  309



>sp|P31237.1|ACCO_ACTDE RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Actinidia deliciosa]
 gb|AAA18566.1| tomato and apple ACC oxidase homologue [Actinidia deliciosa]
Length=319

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 217/306 (71%), Gaps = 12/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL GEER+ TM+ +  ACE WGFF + NHGI  ELM+ V+++  +HY   +++R
Sbjct  5     PVIDMEKLNGEERAPTMEKIKDACENWGFFELVNHGISHELMDTVERLTKEHYNKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   +  K M+++ E+L K+
Sbjct  65    FKEMVATKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CEN+GLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENVGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPRPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD++V GL+  KD +W+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDNKVSGLQLLKDGEWIDVPPMKHS-IVINIGDQLEVITNGKYKSVMHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA++ PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVMYPAPALVDKEEDQQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQ  184
             AMK ++
Sbjct  303   AMKAME  308



>emb|CAH64841.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 217/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER+ TM+L+H ACE WGFF + NHGI  +LM+ V+++  +HY   +++R
Sbjct  5     PVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F        +E  +  I D DWEST+F+ H P SN++E+ +  +++ K M+++   L K+
Sbjct  65    FKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVGLQKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE++ +L+CENLG EK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQMLDLLCENLGFEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDQWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVIYPAPSLVEKEAEKNQIYPKFV-FDDYMKLYVGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>emb|CAJ56065.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 215/306 (70%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER   M+++  ACE WGFF + NHGI  ELM+ V+K+  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN++E  +   ++ K M+Q+ E+L K+
Sbjct  65    FKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDEVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVISPAPALVKESDETSQVYPKFV-FNDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK + +
Sbjct  303   MKAVSS  308



>emb|CAN85572.1| ACC oxidase 1 [Hevea brasiliensis]
Length=312

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/304 (52%), Positives = 210/304 (69%), Gaps = 11/304 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL+ EER  TM+++H ACE WGFF + NHG+  ELM+ V+ +  +HY   +++R
Sbjct  5     PVIDLSKLSDEERKPTMEMIHDACENWGFFELVNHGMSPELMDTVEILTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST F+ H P SN  E+ +    + KTM ++  +L K+
Sbjct  65    FKEMVARKGLEAVQSEINDLDWESTLFLSHLPVSNTAEIPDLDEEYRKTMNEFAAELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD V GL+  KD QW+ +PP K + I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDVVSGLQLLKDGQWIDVPPMKRS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L+         YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEAEKTPGYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKL  187
             MK +
Sbjct  303   MKAM  306



>gb|ACL68417.3| ACC oxidase [Dimocarpus longan]
 gb|ACY72567.1| 1-aminocyclopropane-1-carboxylate oxidase [Dimocarpus longan]
Length=315

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/306 (52%), Positives = 215/306 (70%), Gaps = 12/306 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  K+ G ER  TM+ +  ACE WGFF + NHGI  EL++ V++M  +HY   L
Sbjct  1     MEFPVINMEKMNGVERVATMEKIKDACENWGFFELVNHGIPHELLDTVERMTKEHYRKCL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K +E  +  I+D DWEST+F+ H P SNI++L +  + F KTM+++ ++L
Sbjct  61    QQRFKELVASKALEGVETEIKDMDWESTFFVRHRPESNISQLPDLDDEFRKTMKEFAQKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K++F GS+G S GTKV+ YP CP P+L++GLR HTDAG
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKKAFYGSRGPSFGTKVSNYPPCPKPDLIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ 
Sbjct  181   GIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGP  211
             DG R+SIA+FYNP SDA+I PAP LL          YP  V F++Y+  Y   KF  K P
Sbjct  240   DGTRMSIASFYNPGSDAVIYPAPALLEKEAEEKTQVYPKFV-FEEYMNLYAKLKFQAKEP  298

Query  210   RFEAMK  193
             RFEA+K
Sbjct  299   RFEAIK  304



>emb|CAN85569.1| ACC oxidase 1 [Hevea brasiliensis]
Length=312

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/304 (52%), Positives = 212/304 (70%), Gaps = 11/304 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL+ EER  TM+++H ACE WGFF + NHG+  ELM+ V+ +  +HY   +++R
Sbjct  5     PVIDLSKLSDEERKPTMEMIHDACENWGFFELVNHGMSPELMDTVEILTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST F+ H P SN+ E+ +    + KTM ++  +L K+
Sbjct  65    FKEMVARKGLEAVQSEINDLDWESTLFLSHLPVSNMAEIPDLDEEYRKTMNEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD V GL+  KD QW+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDVVSGLQLLKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L+         YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEAEKTPGYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKL  187
             MK +
Sbjct  303   MKAM  306



>emb|CAJ56064.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 215/306 (70%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER   M+++  ACE WGFF + NHGI  ELM+ V+K+  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN++E  +   ++ K M+Q+ E+L K+
Sbjct  65    FKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVISPAPALVKESDETSQVYPKFV-FNDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK + +
Sbjct  303   MKAVSS  308



>ref|XP_011096014.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Sesamum 
indicum]
Length=317

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/304 (51%), Positives = 213/304 (70%), Gaps = 10/304 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++  KL GEER+ TM ++  ACE WGFF + NHGI  E ++ V+++  +HY   +++R
Sbjct  5     PVVNMEKLNGEERTATMAVIKDACENWGFFELLNHGIAPEFLDTVERLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +    + K M+++  QL K+
Sbjct  65    FKEMVASKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLDEEYRKVMKEFAAQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPMRHS-IVVNIGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP SDA+I PAP L        LYP  V F+DY+K Y   KF  K PRFEA 
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEEKKDLYPKFV-FEDYMKLYAGLKFQAKEPRFEAF  302

Query  195   KKLQ  184
             K +Q
Sbjct  303   KTMQ  306



>ref|XP_002316589.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|EEE97201.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
Length=318

 Score =   332 bits (851),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 217/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER  TM+ +  ACE WGFF + NHGI  +L++ V++   +HY   +++R
Sbjct  5     PVIDLSKLNGEERKPTMEKIEDACENWGFFELVNHGISHDLLDTVERRTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN+ E+ +   ++ K M+++  ++ K+
Sbjct  65    FKEMVASKGLEGVQSEISDLDWESTFFLRHLPESNMAEIPDLEEDYRKVMKEFALEVEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+ FKD QW+ +PP K++ I +N GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLFKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA++ PAP+L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVMYPAPELVEKEAEESQIYPKFV-FEDYMKLYAGLKFQAKKPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>gb|AAK07883.1|AF315316_1 ACC oxidase [Vigna radiata]
 gb|AAC48921.1| 1-aminocylopropane-1-carboxylate oxidase homolog [Vigna radiata]
 prf||2102361A aminocyclopropane carboxylate oxidase
Length=317

 Score =   332 bits (851),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 215/306 (70%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER   M+++  ACE WGFF + NHGI  ELM+ V+K+  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERGTAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN++E  +   ++ K M+Q+ E+L K+
Sbjct  65    FKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVISPAPALVKESDETSQVYPKFV-FNDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK + +
Sbjct  303   MKAVSS  308



>gb|AGN52989.1| ACC oxidase [Euphorbia esula]
Length=313

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 217/314 (69%), Gaps = 16/314 (5%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  KL GEER+ TM  +  ACE WGFF + NHGI+ E M+ V+ M   HY+  +
Sbjct  1     MEFPVINMEKLNGEERAATMAKIKDACENWGFFEILNHGIETEFMDRVESMTKGHYQKCM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K +++ +  I+D DWEST+ I H P SNI+E+ +  +++ K M+++  +L
Sbjct  61    EQRFKEMVASKGLDSVQTEIKDLDWESTFHIRHLPQSNISEIPDLADDYRKLMKEFAGKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K +F GSKG + GTKV+ YP CP P+L++GLR HTDAG
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKNTFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD +WV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ 
Sbjct  181   GIILLFQDDKVSGLQLLKDGEWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVVAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLL--------------YPNNVCFQDYLKHYGSTKFG  223
             DG R+S+A+FYNP SDA+I PAP LL              YP  V F+DY+K Y + KF 
Sbjct  240   DGTRMSLASFYNPGSDAVIYPAPALLENEAEDDQKKNQLVYPKFV-FEDYMKLYAALKFQ  298

Query  222   DKGPRFEAMKKLQA  181
              K PRFEAMK + A
Sbjct  299   AKEPRFEAMKAVAA  312



>gb|AAP41850.1| 1-aminocyclopropane-1-carboxylate oxidase [Hevea brasiliensis]
 emb|CAN85570.1| ACC oxidase 2 [Hevea brasiliensis]
Length=318

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 216/311 (69%), Gaps = 12/311 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  KL GEER+ TM  +  ACE WGFF + NHGI+ E M+ V++M   HY   +
Sbjct  1     MEFPVINLGKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFMDTVERMTKGHYRKCM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K +E  +  I+D DWEST+F+ H P SNI ++ +  + + K M+ +  +L
Sbjct  61    EQRFKEMVASKGLEGVQTEIKDMDWESTFFLRHLPESNIAQVPDLDDEYRKVMKDFAAKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K++F GS+G + GTKV+ YP CP P+L++GLR HTDAG
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKKAFYGSRGPNFGTKVSNYPPCPKPDLIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ 
Sbjct  181   GIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVEHRVVAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGP  211
             DG R+SIA+FYNP +DA+I PAP L          +YP  V F+DY+K Y   KF  K P
Sbjct  240   DGTRMSIASFYNPGNDAVIYPAPALVEKEAEEKKQVYPKFV-FEDYMKLYAGLKFQPKEP  298

Query  210   RFEAMKKLQAN  178
             RFEAMK +++N
Sbjct  299   RFEAMKAVESN  309



>ref|NP_001267871.1| aconitase 2, mitochondrial [Vitis vinifera]
 gb|AFU66005.1| 1-aminocyclopropane-1-carboxylic acid oxidase 2 [Vitis vinifera]
Length=318

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 212/307 (69%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GEER  TM+++  ACE WGFF + NHGI  E M+ V+K+   HY   +++R
Sbjct  5     PVINMEMLNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I+D DWEST+F+ H P SN+++  +    + K M+ +  +L K+
Sbjct  65    FKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYRKVMKDFALKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDTVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVLHRVVAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP +DA+I PAP LL         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGNDAVIYPAPALLEKEAEKDQVYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK ++A+
Sbjct  303   MKNVEAS  309



>dbj|BAB89352.1| 1-aminocyclopropane-1-carboxylate oxidase [Diospyros kaki]
Length=320

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/308 (51%), Positives = 217/308 (70%), Gaps = 13/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GE R   M+ L +ACE WGFF V NHGI  ELM++V+++  +HY+  +++R
Sbjct  5     PVINMEILNGEGREAAMEKLRNACENWGFFEVVNHGISHELMDSVERLTKEHYKKFMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P+SN++EL +  +++ K M+++ E L K+
Sbjct  65    FKEMVASKGLEVVQSEINDLDWESTFFLRHLPSSNLSELPDLEDDYKKAMKEFAEDLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L + +CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEQLLDYLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPRPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPLKHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL-----------LYPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+SIA+FYNP SDA+I PAP L           +YP  V F+DY+K Y   KF  K PRF
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEADHEQKQVYPKFV-FEDYMKLYAGLKFQAKEPRF  302

Query  204   EAMKKLQA  181
             EAMK ++ 
Sbjct  303   EAMKAMET  310



>gb|ABI33224.1| ACC oxidase [Camellia sinensis]
Length=320

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 216/308 (70%), Gaps = 13/308 (4%)
 Frame = -2

Query  1068  VIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERF  889
             VI+  KL GEER  TM+L+  ACE WGFF + NHGI  E+M+ V++M  +HY+  +++RF
Sbjct  6     VINMEKLNGEERGATMELIKDACENWGFFELMNHGISHEMMDTVERMTKEHYKKCMEQRF  65

Query  888   YASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVA  709
                   K +E  +  + + DWEST+ + H P SNI+E+ +  + + K M+++  +L K+A
Sbjct  66    KEVVASKALEGVQAEVTNMDWESTFHLRHLPQSNISEVPDLNDEYRKVMKEFAAKLEKLA  125

Query  708   EELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIIL  529
             EEL +L+CENLGLEK ++K++F G+KG + GTKV+ YP CP P+L++GLR HTDAGGIIL
Sbjct  126   EELLDLLCENLGLEKGYLKKAFYGTKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGIIL  185

Query  528   LLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNR  349
             L QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ DGNR
Sbjct  186   LFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGNR  244

Query  348   LSIATFYNPASDAMISPAPK-----------LLYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             +SIA+FYNP +DA+I PAP            L+YP    F DY+K Y + KF  K PRFE
Sbjct  245   MSIASFYNPGNDAVIYPAPALVNEGSDDQTNLVYP-KFMFDDYMKLYATVKFQAKEPRFE  303

Query  201   AMKKLQAN  178
             AMK  +AN
Sbjct  304   AMKATEAN  311



>gb|ABF61805.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago sativa]
Length=317

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 216/306 (71%), Gaps = 10/306 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER  TM+++  ACE WGFF   NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVVDMGKLNTEERKATMEMIKDACENWGFFECVNHGISIELMDKVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++ E+L K+
Sbjct  65    FKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMPHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAPKLL--------YPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP +DA+ISPA  LL        YP  + F DY+K Y   KF  K PRFEAM
Sbjct  244   RMSIASFYNPGNDAVISPASTLLKEDETSEIYPKFI-FDDYMKLYMGLKFQAKEPRFEAM  302

Query  195   KKLQAN  178
              K  ++
Sbjct  303   MKAMSS  308



>gb|EMT12779.1| 1-aminocyclopropane-1-carboxylate oxidase [Aegilops tauschii]
Length=293

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 216/296 (73%), Gaps = 7/296 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L GE+RS+T+ LLH AC +WGFF +ENHGI+ +LM+  K++V +HY+ ++
Sbjct  1     MEIPVIKMDELHGEKRSETLSLLHDACAQWGFFWLENHGINDDLMDRTKELVNKHYDQNM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             +  FY+S++ K +   K +  + DWE ++   H P SNI+++   P      + +Y E++
Sbjct  61    ENNFYSSEIAKTIGPDKVT-SNVDWECSFMYHHQPKSNIHDI---PELLRTKVPEYAEEV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+E+M ENLGL+K+++K++F+     SIG KVA YP C +PE+V GLR HTDAG
Sbjct  117   VKLAEQLAEVMSENLGLDKDYLKKAFTKP---SIGIKVAKYPRCSHPEVVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD VPGL+F KD +W+ IPP+K NRIFVN GDQ+E++SNG+YKS  H+V+   
Sbjct  174   GIILLFQDDLVPGLQFMKDGRWISIPPTKGNRIFVNLGDQIEVISNGIYKSICHQVVPNQ  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMK  193
             +G+RLSIATFYNP +DA+I PAP L YP+   FQDYL  Y +TKF DK  RF+  K
Sbjct  234   NGSRLSIATFYNPGADAIIFPAPNLTYPSQYRFQDYLNFYSATKFTDKVSRFQTTK  289



>gb|ABK96379.1| unknown [Populus trichocarpa x Populus deltoides]
Length=318

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER  TM++++ ACE WGFF + NHGI  +L++ V+++  +HY   +++R
Sbjct  5     PVIDLSKLNGEERKPTMEVINDACENWGFFELVNHGISHDLLDAVERLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN+ E+ +   ++ KTM+++  +L  +
Sbjct  65    FKEMVASKGLEAVQSEIDDLDWESTFFLRHLPESNLAEIPDLGEDYRKTMKEFALELEGL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++++ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLRKVFCGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP K++ I +N GDQ+E+++NG YKS LHRVLAQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVLHRVLAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP+L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPELVEKEEEESQIYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAVEST  309



>gb|AEM65196.1| ACC oxidase [Garcinia mangostana]
Length=320

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 220/309 (71%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D SKL GEER  TM+++  ACE WGFF + NHGI  ELM+ ++++  +HY+ SL+E+
Sbjct  5     PVVDLSKLNGEERKPTMEIIKDACENWGFFELMNHGISHELMDTLERLTKEHYKKSLEEK  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN++E+ +   ++ K M+++  +L K+
Sbjct  65    FKELVAAKGLEAVQSEITDLDWESTFFLRHLPVSNMDEIPDLSLDYRKVMKEFALELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K +F+G+KG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKRAFNGTKGPTFGTKVSKYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG-  355
             LL QDD++ GL+  KD  WV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKISGLQLLKDGHWVDVPPMKHS-IVINLGDQLEVITNGKYKSVVHRVIAQTDGE  243

Query  354   NRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRF  205
              R+SIA+FYNP SDA+I PAP+L          +YP  V F+DY+K Y   KF  K PRF
Sbjct  244   GRMSIASFYNPGSDAIIYPAPELVEKGQEENGQIYPKFV-FEDYMKLYACLKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             EAMK ++ +
Sbjct  303   EAMKAMETS  311



>ref|XP_009355918.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Pyrus 
x bretschneideri]
 dbj|BAD61004.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=314

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 215/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S + GEER+ T++ ++ ACE WGFF + NHGI  EL++ V+KM   HY+ ++++R
Sbjct  5     PVVDMSLVNGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F    V K ++  +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+
Sbjct  65    FKEMVVAKGLDAVQSQIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AETLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPP-MHHSIVINLGDQIEVITNGKYKSIMHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA ISPAP LL         YP    F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFISPAPALLEKKSEETPTYP-KFLFDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>ref|XP_002535327.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF27056.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=315

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 217/305 (71%), Gaps = 11/305 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D SKL GEE+  TM+L+  ACE WGFF + NHGI  EL++ V+++  +HY+  +++R
Sbjct  5     PVVDLSKLNGEEKKPTMELIKDACENWGFFELVNHGISHELLDIVERLTKEHYKKFMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN+ E+ +    +  TM+++ ++L K+
Sbjct  65    FKEMVASKGLEAVQSEINDLDWESTFFLRHLPISNMAEIPDLDEEYRNTMKEFAKELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLE+ ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEKLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP K++ I +N GDQ+E++SNG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWVDVPPMKHS-IVINLGDQLEVISNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVICPAPALVEEEAEKRQVYPKFV-FEDYMKLYVGLKFEGKEPRFEA  302

Query  198   MKKLQ  184
             MK ++
Sbjct  303   MKAVE  307



>emb|CAJ56067.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 215/306 (70%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER   M+++  ACE WGFF + NHGI  ELM+ V+++  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DW+ST+F+ H P SN++E  +   ++ K M+Q+ E+L K+
Sbjct  65    FKEMVANKGLESVQSEINDLDWDSTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEHLLDLLCENLGLEKRYLKQVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ + +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-VVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVISPAPALVKESDETSQVYPKFV-FNDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK + +
Sbjct  303   MKAVSS  308



>ref|XP_011086213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Sesamum 
indicum]
Length=317

 Score =   330 bits (846),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 213/304 (70%), Gaps = 10/304 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GE R+ TM+++  ACE WGFF V NHGI  E M+ V+K+  +HY   +++R
Sbjct  5     PVINMEKLNGEGRAATMEMIKDACENWGFFEVVNHGIAPEFMDTVEKLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SN++++ +    + + M+++  QL K+
Sbjct  65    FKEMVAKKGLEAVQSEINDLDWESTFFLRHLPVSNMSQVPDLEAEYRRVMKEFAAQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGI+
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIV  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNPASDA+I PAP L        LYP    F+DY+KHY   KF  K PRFEA 
Sbjct  244   RMSLASFYNPASDAVIYPAPALVEKEQTRDLYP-KFLFEDYMKHYLGVKFQAKEPRFEAF  302

Query  195   KKLQ  184
             K ++
Sbjct  303   KNME  306



>ref|XP_003534723.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
 gb|KHN40848.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 214/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER   M+++  ACE WGFF + NHGI  ELM+ V+K+  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERPAAMEIIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN+++  +   ++ KTM+++  +L K+
Sbjct  65    FKEMVTSKGLESVQSEINDLDWESTFFLRHLPLSNVSDNADLDQDYRKTMKKFALELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAVISPAPALVKELDETSQVYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>dbj|BAH15311.1| ACC oxidase 1 [Lactuca sativa]
Length=310

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 213/301 (71%), Gaps = 11/301 (4%)
 Frame = -2

Query  1053  KLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYASDV  874
             KL GEERS TM+L+  ACE WGFF + NHGI  EL++ V+KM  +HY+  +++RF     
Sbjct  3     KLNGEERSATMELIKDACENWGFFELLNHGISHELLDKVEKMTKEHYKKCMEQRFKDMVA  62

Query  873   VKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEELSE  694
              K +E  K  + D DWEST+F+ H PTSNI+E+ +  + +   M+ +  +L K+AEEL +
Sbjct  63    AKALEGLKAEVTDIDWESTFFLRHLPTSNISEVPDLEDEYRNLMKDFAGKLEKLAEELLD  122

Query  693   LMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLLQDD  514
             L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGIILL QDD
Sbjct  123   LLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGIILLFQDD  182

Query  513   QVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLSIAT  334
             +V GL+  KD +W+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG R+SIA+
Sbjct  183   KVSGLQLLKDGEWIDVPPMRHS-IVINLGDQIEVITNGKYKSVMHRVIAQTDGTRMSIAS  241

Query  333   FYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             FYNP +DA+I PA  LL         YP  V F DY+K Y   KF  K PRFEAMK ++A
Sbjct  242   FYNPGNDAVIFPALALLTEATEKEQSYPKFV-FDDYMKLYAKLKFQAKEPRFEAMKGVEA  300

Query  180   N  178
             N
Sbjct  301   N  301



>ref|XP_010052892.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus 
grandis]
 gb|KCW77022.1| hypothetical protein EUGRSUZ_D01368 [Eucalyptus grandis]
Length=319

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 218/312 (70%), Gaps = 13/312 (4%)
 Frame = -2

Query  1080  MEI-PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             MEI PVI+  KL GEER  TM+++  ACE WGFF + NHGI  ELM+ V+++   HY++ 
Sbjct  1     MEIFPVINLEKLNGEERGVTMEMIRDACENWGFFELVNHGISHELMDTVERLTKGHYKEC  60

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             ++ +F      K +E  +  I D DWEST+F+ H P SNI+E+ +   ++ K M ++  +
Sbjct  61    MERKFKEMVASKGLEAVQSEIGDIDWESTFFLRHLPVSNISEVPDLKEDYRKVMREFALE  120

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             + K+AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CPNPEL +GLR HTDA
Sbjct  121   IEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPTFGTKVSNYPPCPNPELFKGLRAHTDA  180

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD +W+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ
Sbjct  181   GGIILLFQDDKVGGLQLLKDGKWIDVPPLRHS-IVINLGDQLEVITNGKYKSVEHRVIAQ  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKG  214
             +DGNR+SIA+FYNP SDA+I PAP LL          YP  V F+DY+K Y   KF  K 
Sbjct  240   SDGNRMSIASFYNPGSDAVICPAPALLKKEAGEEGQAYPKFV-FEDYMKLYARLKFQAKE  298

Query  213   PRFEAMKKLQAN  178
             PRFEAMK  ++ 
Sbjct  299   PRFEAMKATEST  310



>gb|ABO32691.1| ACC oxidase ACO3 [Nicotiana attenuata]
Length=316

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++   L  E+R+ TM+ +  ACE WGFF V NHGI  EL++ V+K+   HY+  ++ER
Sbjct  5     PVVNMELLNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEER  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I+D DWEST+F+ H P SNI+E+ +  + + K M+++ E+L K+
Sbjct  65    FKEMVASKGLEAVQTEIKDLDWESTFFLKHLPVSNISEVPDLEDEYRKIMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLE+ ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD++W+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDKWIDVPPMRHS-IVINLGDQLEVITNGKYKSVEHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL-------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMK  193
             R+SIA+FYNP SDA+I PAP+LL       YP  V F+DY+K Y   KF  K PRFEAMK
Sbjct  244   RMSIASFYNPGSDAVIYPAPELLEKENKAIYPKFV-FEDYMKLYAGLKFQAKEPRFEAMK  302

Query  192   KLQAN  178
              ++  
Sbjct  303   AVETT  307



>gb|ACX71872.1| ACC oxidase 1 [Lithospermum erythrorhizon]
Length=317

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 217/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G+ER  TM+++  ACE+WGFF + NHGI  +LM+ V+++   HY+ S++ R
Sbjct  5     PIINLEKLNGDERGATMEMIKDACEKWGFFELVNHGISHDLMDTVERLTKGHYKKSMEHR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K ++  +  I D DWEST+F+ H P  NI+E+ +  + + +TM Q+ ++L K+
Sbjct  65    FKEMVASKGLDAVQAEINDLDWESTFFLKHLPLPNISEVPDLDDEYRETMRQFAKELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K +F GSKG + GTKV+ YPECP P+L++GLR HTDAGGII
Sbjct  125   AEDLLDLLCENLGLEKGYLKNAFYGSKGPTFGTKVSNYPECPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD++WV +PP +++ I +N GDQ+EI++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDKWVDVPPMRHS-IVINIGDQLEIITNGKYKSVMHRVVAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAP---------KLLYPN-NVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP  DA+I PAP         K+LY      F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGGDAVIYPAPALLEKEAEEKVLYSGLKFVFEDYMKLYAGLKFQAKEPRFE  303

Query  201   AMKKLQA  181
             AMK +++
Sbjct  304   AMKAIES  310



>ref|XP_010688910.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Beta 
vulgaris subsp. vulgaris]
Length=320

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 215/309 (70%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GE R  TM  +H ACE WGFF + NHGI  ++M+ V+++  +HY+  +++R
Sbjct  5     PVINLEKLNGEHREATMAKIHDACENWGFFELMNHGIPHDMMDTVERITKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +EN    I+D DWEST+F+ H P SN+ EL +  + + K M+++  +L K+
Sbjct  65    FNELVASKGLENVSTEIKDMDWESTFFLRHLPDSNMAELPDLDDEYKKLMKEFALRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K+ F GSK  + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKVFYGSKAPNYGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVVNLGDQLEVITNGRYKSVLHRVVAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNPASDA+I PAP L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPASDAVICPAPSLAEKDAEDQKQIYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQANG  175
             AMK +  NG
Sbjct  303   AMKNV-GNG  310



>gb|ACY76262.1| ACC oxidase [Dimocarpus longan]
Length=315

 Score =   329 bits (844),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 214/306 (70%), Gaps = 12/306 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  K+ G ER  TM+ +  ACE WGFF +  HGI  EL++ V++M  +HY   L
Sbjct  1     MEFPVINMEKMNGVERVATMEKIKDACENWGFFELVKHGIPHELLDTVERMTKEHYRKCL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      + +E  +  I+D DWEST+F+ H P SNI++L +  + F KTM+++ ++L
Sbjct  61    QQRFKELVASRALEGVETEIKDMDWESTFFVRHRPESNISQLPDLDDEFRKTMKEFAQKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K++F GS+G S GTKV+ YP CP P+L++GLR HTDAG
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKKAFYGSRGPSFGTKVSNYPPCPKPDLIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ 
Sbjct  181   GIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGP  211
             DG R+SIA+FYNP SDA+I PAP LL          YP  V F++Y+  Y   KF  K P
Sbjct  240   DGTRMSIASFYNPGSDAVIYPAPALLEKEAEEKTQVYPKFV-FEEYMNLYAKLKFQAKEP  298

Query  210   RFEAMK  193
             RFEA+K
Sbjct  299   RFEAIK  304



>ref|XP_010943257.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Elaeis 
guineensis]
Length=320

 Score =   329 bits (844),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 218/311 (70%), Gaps = 19/311 (6%)
 Frame = -2

Query  1074  IPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKE  895
              PVI+  KL GEER KTM+LL  ACE WGFF + NHGI RELM+ V+++   HY    ++
Sbjct  5     FPVINMEKLEGEEREKTMELLRDACENWGFFELLNHGISRELMDEVERLTKGHYRKCREQ  64

Query  894   RF--YASDVVKCVENKKES--IRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIE  727
             RF  +AS   K +E  K+S    + DWEST+F+ H P SN+ E+ +  + + K M+++  
Sbjct  65    RFKEFAS---KALEEGKQSDTTNNMDWESTFFLCHLPESNMCEIPDLDDKYRKAMKEFAV  121

Query  726   QLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTD  547
              + K+AE L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTD
Sbjct  122   GIEKLAERLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKVSNYPPCPRPELIKGLRAHTD  181

Query  546   AGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLA  367
             AGGIILL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E++SNG YKS +HRVLA
Sbjct  182   AGGIILLFQDDRVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVISNGKYKSVMHRVLA  240

Query  366   QNDGNRLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDK  217
             + DGNR+SIA+FYNP SDA+I PAP LL          YP  V F+DY+K Y   KF  K
Sbjct  241   RTDGNRMSIASFYNPGSDAVIFPAPSLLEKEAERKNEAYPKFV-FEDYMKLYVGQKFQAK  299

Query  216   GPRFEAMKKLQ  184
              PRFEAMK L+
Sbjct  300   EPRFEAMKDLE  310



>ref|XP_009802116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
sylvestris]
Length=316

 Score =   329 bits (844),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++   L  E+R+ TM+ +  ACE WGFF V NHGI  EL++ V+K+   HY+  ++ER
Sbjct  5     PVVNMELLNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEER  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I+D DWEST+F+ H P SNI+E+ +  + + K M+++ E+L K+
Sbjct  65    FKEMVASKGLEAVQTEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLE+ ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD++W+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDKWIDVPPMRHS-IVINLGDQLEVITNGKYKSVEHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL-------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMK  193
             R+SIA+FYNP SDA+I PAP+LL       YP  V F+DY+K Y   KF  K PRFEAMK
Sbjct  244   RMSIASFYNPGSDAVIYPAPELLEKENKVIYPKFV-FEDYMKLYAGLKFQAKEPRFEAMK  302

Query  192   KLQAN  178
              ++  
Sbjct  303   AVETT  307



>emb|CAN85573.1| ACC oxidase 2 [Hevea brasiliensis]
Length=318

 Score =   329 bits (844),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 216/311 (69%), Gaps = 12/311 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  KL GEER+ TM  +  ACE WGFF + NHGI+ E M+ V++M   HY   +
Sbjct  1     MEFPVINLGKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFMDTVERMTKGHYRKCM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K +E  +  I+D DWEST+F+ H P SNI ++ +  + + K M+ +  +L
Sbjct  61    EQRFKEMVASKGLEGVQTEIKDMDWESTFFLRHLPESNIAQVPDLDDEYRKVMKDFAAKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K++F GS+G + GTKV+ YP CP P+L++GLR HTDAG
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKKAFYGSRGPNFGTKVSNYPPCPKPDLIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD QW+ +PP +++ I +N GD++E+++NG YKS  HRV+AQ 
Sbjct  181   GIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDKLEVITNGKYKSVEHRVVAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGP  211
             DG R+SIA+FYNP +DA+I PAP L          +YP  V F+DY+K Y   KF  K P
Sbjct  240   DGTRMSIASFYNPGNDAVIYPAPALVEKEAEEKKQVYPKFV-FEDYMKLYAGLKFQPKEP  298

Query  210   RFEAMKKLQAN  178
             RFEAMK +++N
Sbjct  299   RFEAMKAVESN  309



>ref|XP_008224728.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Prunus 
mume]
Length=318

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 215/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S++ GE+R  TM+ ++ ACE WGFF + NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVVDLSQINGEKREATMEKINDACENWGFFELVNHGISHELMDTVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +   ++ K M+++  +L K+
Sbjct  65    FKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQPDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             RLSIA+FYNP  DA I PAP LL         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RLSIASFYNPGDDAFICPAPALLEKETEKISAYPKFV-FDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>gb|AAL37174.1|AF320071_1 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 216/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID SKL GEER+ TM+L+H ACE WGFF + NHGI  +LM+ V+++  +HY   +++R
Sbjct  5     PVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F        +E  +  I D DWEST+F+ H P SN++E+ +  +++ K M+++   L K+
Sbjct  65    FKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVGLQKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE++ +L+CENLGL+K ++K+ F GSKG + GTKV+ YP CP P+L+ GLR HTDAGGII
Sbjct  125   AEQMLDLLCENLGLQKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIEGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD +V GL+  KD+QWV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDGKVSGLQLLKDDQWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP  DA+I PAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPGDDAVIYPAPSLVEKEAEKNQIYPKFV-FDDYMKLYVGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>sp|P05116.2|ACCO1_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=Protein pTOM 13 [Solanum lycopersicum]
 emb|CAA41212.1| 1-Aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
 gb|ADO32577.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
Length=315

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 216/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G+ER+ TM+++  ACE WGFF + NHGI  E+M+ V+KM   HY+  +++R
Sbjct  5     PIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H PTSNI+++ +    + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KDEQW+ +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDEQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVLHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PA  L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIYPAKTLVEKEAEESTQVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++++
Sbjct  303   AMKAMESD  310



>ref|XP_010035505.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
 gb|KCW46926.1| hypothetical protein EUGRSUZ_K00740 [Eucalyptus grandis]
Length=320

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 217/309 (70%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GEER+ TM  +  ACE WGFF + NHGI  ELM+ V++M   HY+  +++R
Sbjct  5     PVINIENLNGEERAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+ + H P SNI ++ +  +++ K M+++  +L K+
Sbjct  65    FRELVASKGLEYVETEVHDLDWESTFHLKHLPVSNIYQIPDLDDDYRKVMKEFAVKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGI+
Sbjct  125   AEELMDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIV  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDSQWVDVPPMRHS-IVVNLGDQIEVITNGKYKSVLHRVVAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL-----------YPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+SIA+FYNP SDAMI PAP L+           YP  V F+DY+K Y + KF  K PRF
Sbjct  244   RMSIASFYNPGSDAMIHPAPALVESKPKEAGEAAYPKFV-FEDYMKLYAALKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             +AMK ++++
Sbjct  303   QAMKAMESS  311



>gb|ACS71641.1| ACC oxidase [Boea hygrometrica]
Length=317

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 216/306 (71%), Gaps = 10/306 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL G+ERS TM+++  ACE WGFF + NHGI  E M+ V+++  +HY+ ++++R
Sbjct  5     PVINMEKLNGDERSATMEIIKDACENWGFFELVNHGISPEFMDTVERLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+++ H P SNI E+ +    + + ++++ EQL K+
Sbjct  65    FKEMVSSKGLESVQSEITDLDWESTFYLRHLPVSNITEIPDLEQEYRRVLKEFGEQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K++F G+KG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AENLLDLLCENLGLEKGYLKKAFYGAKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPMRHS-IVVNIGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP SDA+I PAP L        LYP  V F+DY+K Y   KF  K PRFEA 
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEEKKDLYPKFV-FEDYMKLYAGLKFQAKEPRFEAF  302

Query  195   KKLQAN  178
             K + + 
Sbjct  303   KAIGST  308



>gb|AGN74918.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus alba]
Length=319

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 212/308 (69%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL GEER  TM+ +  ACE WGFF + NHGI  E ++ V+KM   HY   +++R
Sbjct  5     PIINLEKLNGEERKTTMEQIKDACENWGFFELVNHGIPHEFLDTVEKMTKDHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +  + + K M ++ +QL K+
Sbjct  65    FKELVASKGLEAVQAEVNDMDWESTFFLRHLPVSNISEIPDLDDEYRKVMREFAKQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD  W+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGHWIDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I P P L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIYPEPTLVEKEAEEKNQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++ +
Sbjct  303   AMKAVETS  310



>ref|XP_003594161.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|ABD32649.1| 2OG-Fe(II) oxygenase [Medicago truncatula]
 gb|AES64412.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AFK40757.1| unknown [Medicago truncatula]
Length=317

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 215/306 (70%), Gaps = 10/306 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER  TM+++  ACE WGFF   NH I  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVVDMGKLNTEERKATMEMIKDACENWGFFECVNHSISIELMDKVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++ E+L K+
Sbjct  65    FKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMPHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAPKLL--------YPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP +DA+ISPA  LL        YP  + F DY+K Y   KF  K PRFEAM
Sbjct  244   RMSIASFYNPGNDAVISPASTLLKEDETSEIYPKFI-FDDYMKLYMGLKFQAKEPRFEAM  302

Query  195   KKLQAN  178
              K  ++
Sbjct  303   MKAMSS  308



>ref|XP_006357981.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4-like [Solanum 
tuberosum]
Length=318

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 215/306 (70%), Gaps = 10/306 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+   L G+ERS T++L+  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIINLENLNGDERSNTLELIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+++ +  N + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISQVPDLDNEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENL LEK ++K +F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLELEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KDEQW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDEQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL--------YPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNP +DA+I PAP L+        YP  V F DY+K Y   KF  K PRFEAM
Sbjct  244   RMSLASFYNPGNDAVIYPAPALIEAEESKQVYPKFV-FDDYMKLYAGLKFQAKEPRFEAM  302

Query  195   KKLQAN  178
             K ++AN
Sbjct  303   KAMEAN  308



>ref|XP_010110622.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Morus notabilis]
 gb|EXC27244.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Morus notabilis]
Length=319

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 211/308 (69%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL GEER  TM+ +  ACE WGFF + NH I  E ++ V+KM   HY   +++R
Sbjct  5     PIINLEKLNGEERKTTMEQIKDACENWGFFELVNHSIPHEFLDTVEKMTKDHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +  + + K M ++ +QL K+
Sbjct  65    FKELVASKGLEAVQAEVNDMDWESTFFLRHLPVSNISEIPDLDDEYRKVMREFAKQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD  W+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGHWIDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIYPAPTLVEKEAEEKNQVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++  
Sbjct  303   AMKAVETT  310



>ref|XP_010430292.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Camelina 
sativa]
Length=320

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 217/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ PV+D SKL GEER +TM L++ ACE WGFF + NHGI  +LM+ ++KM   HY
Sbjct  1     MEKNMKFPVVDLSKLDGEERDQTMALINEACENWGFFEIMNHGIPHDLMDKIEKMTKGHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++  +  + D DWEST+++ H P SN+++L +  + +   M+ +
Sbjct  61    KTYQEQKFNDMLKSKGLDKLETEVEDVDWESTFYVRHLPQSNLSDLSDMSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              E+L  +AE+L +L+CENLGLEK ++K++F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GERLENLAEDLLDLLCENLGLEKGYLKKAFRGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  WV +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWVDVPPL-NHSIVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNPASDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPASDAEISPATSLVEKDSDYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNASA  307



>ref|XP_007211643.1| hypothetical protein PRUPE_ppa008813mg [Prunus persica]
 gb|EMJ12842.1| hypothetical protein PRUPE_ppa008813mg [Prunus persica]
Length=318

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 215/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S++ GE+R  TM+ ++ ACE WGFF + NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVVDLSQINGEKREATMEKMNDACENWGFFELVNHGISHELMDTVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +   ++ K M+++  +L K+
Sbjct  65    FKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQPDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA I PAP LL         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFICPAPALLEKETENISAYPKFV-FDDYMKLYSGLKFHAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>gb|AEM62881.1| ACC oxidase 4 [Actinidia chinensis]
Length=317

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 216/305 (71%), Gaps = 10/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+ID  KL GEER+ TM+++  ACE WGFF + NHGI  ELM+ V+ +   HY+  +++R
Sbjct  5     PIIDMEKLNGEERAATMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI E+ +   ++ KTM+++ E+L K+
Sbjct  65    FKEMVANKGLEAVQSEINDLDWESTFFLRHLPVSNIFEIPDLEEDYRKTMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENL +EK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEQLLDLLCENLEIEKGYLKKAFYGSKGPTFGTKVSNYPPCPCPELIKGLRAHTDAGGLI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  K  +WV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKGGEWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP SDA+I PAP L        +YP  V F+DY+K Y   KF  K PRF+AM
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEEQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFKAM  302

Query  195   KKLQA  181
             K ++ 
Sbjct  303   KAMET  307



>emb|CAH58646.1| aminocyclopropan-1-carboxylate oxidase [Plantago major]
Length=318

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 215/308 (70%), Gaps = 11/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++   L G+ERS TM ++  ACE WGFF + NHGI  E M+ V+K+   HY  S+++R
Sbjct  5     PVVNMENLNGDERSSTMDIIKDACENWGFFELVNHGIAPEFMDTVEKLTKDHYRRSMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +  + + K M+++  QL K+
Sbjct  65    FNEMVANKGLEAVQSEIEDLDWESTFFLRHLPVSNISEIPDLQDEYRKVMKEFASQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEVLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP +++ I +N GDQ+E+++NG YKS +HRVLAQ DG+
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVLAQTDGS  243

Query  351   -RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
              R+S+A+FYNP SDA+I PAP L        LYP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   GRMSLASFYNPGSDAVIYPAPALVEKEDSKDLYPKFV-FEDYMKLYSGVKFQAKEPRFEA  302

Query  198   MKKLQANG  175
              K +++N 
Sbjct  303   FKAMESNA  310



>sp|Q08506.1|ACCO1_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; Short=ACCO; AltName: Full=Ethylene-forming 
enzyme; Short=EFE [Petunia x hybrida]
 gb|AAC37381.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=319

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 213/308 (69%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I   K+ G ER+ TM+++  ACE WGFF + NHGI RE+M+ V+KM   HY+  +++R
Sbjct  5     PIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +    + + M  + ++L K+
Sbjct  65    FKELVASKALEGVQAEVTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQKDGA  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PAP L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVEKEAEENKQVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++ +
Sbjct  303   AMKAMETD  310



>gb|AEM62882.1| ACC oxidase 4 [Actinidia deliciosa]
Length=317

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 216/305 (71%), Gaps = 10/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+ID  KL GEER+ TM+++  ACE WGFF + NHGI  ELM+ V+ +   HY+  +++R
Sbjct  5     PIIDMEKLNGEERAATMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI E+ +   ++ KTM+++ E+L K+
Sbjct  65    FKEMVANKGLEAVQSEINDLDWESTFFLRHLPVSNIFEIPDLEEDYRKTMKEFAEKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENL +EK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEQLLDLLCENLEIEKGYLKKAFYGSKGPTFGTKVSNYPPCPCPELIKGLRAHTDAGGLI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  K  +WV +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKGGEWVDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP SDA+I PAP L        +YP  V F+DY+K Y   KF  K PRF+AM
Sbjct  244   RMSIASFYNPGSDAVIYPAPALVEKEEQKQVYPKFV-FEDYMKLYAGLKFQAKEPRFKAM  302

Query  195   KKLQA  181
             K ++ 
Sbjct  303   KAMET  307



>ref|XP_006391897.1| hypothetical protein EUTSA_v10023595mg [Eutrema salsugineum]
 gb|ESQ29183.1| hypothetical protein EUTSA_v10023595mg [Eutrema salsugineum]
Length=320

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 220/309 (71%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PV+D SKL GEER +TM L++ ACE WGFF + N G+  +LM+NV+KM  +HY
Sbjct  1     MEKNIKFPVVDLSKLNGEERDQTMALINDACENWGFFEIVNDGLPHDLMDNVEKMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             + S++++F      K ++N +  + D DWEST+++ H P SN+N++ +  + +  TM+ +
Sbjct  61    KKSMEQKFNDMLKSKGLDNLETEVEDVDWESTFYLRHLPESNLNDIPDMSDEYRMTMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEDLLDLLCENLGLEKGYLKKMFHGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGG+ILL QDD+V GL+  KD  WV +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGLILLFQDDKVSGLQLLKDGDWVDVPPL-NHSIVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP SDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPGSDAEISPATSLVGKETEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNASA  307



>emb|CAA67216.1| ACC oxidase [Malus domestica]
 emb|CAA04895.1| ACC oxidase [Malus domestica]
Length=314

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 217/302 (72%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S + GEER+ T++ ++ ACE WGFF + NHG+  EL++ V+KM   HY+ ++++R
Sbjct  5     PVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +++ +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+
Sbjct  65    FKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR H+DAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHSDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPM-HHSIVINLGDQIEVITNGKYKSVMHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP +DA ISPAP +L         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGNDAFISPAPAVLEKKTGDAPTYPKFV-FDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>ref|NP_001275482.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
 gb|AAK68075.1|AF384820_1 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
Length=315

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 215/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G+ER+ TM+++  ACE WGFF + NHGI  E+M+ V KM   HY+  +++R
Sbjct  5     PIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVDKMTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H PTSNI+++ +    + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDGEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNAFFGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KDEQW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDEQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PA  L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIYPAKTLVEKEAEESTQVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++++
Sbjct  303   AMKAMESD  310



>ref|XP_010051539.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase 1-like [Eucalyptus grandis]
Length=305

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 210/302 (70%), Gaps = 2/302 (1%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIP+ID S+L GE RSKT+ +LHHACE+WG F V NHG+D E M+ VK+ V  HYE++L
Sbjct  1     MEIPMIDLSELGGENRSKTLAILHHACEKWGCFKVTNHGVDPEPMKKVKRFVNTHYEENL  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             K  FY S + +C+++   +  D D E  +FIWH+  SNI +  N  N+    M++YI Q+
Sbjct  61    KATFYVSKIAECLKHANSTTPDLDXEXPFFIWHYLKSNIEDFLNLSNDSGAVMDEYIAQV  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+ ++LS L+CENLGL+K+HI+ +FSG    S+G KVA YPECP  + + GL EH +AG
Sbjct  121   IKLVKKLSGLICENLGLDKDHIERAFSGRNRPSMGMKVAKYPECPYTKRLWGLWEHINAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GII++LQDD+V GLEF  + QWV I  S    I VNTGDQ+E+++N  YKS LH V+A+ 
Sbjct  181   GIIVMLQDDRVSGLEFLHEGQWVPILRSNYASICVNTGDQIEVVTNRQYKSVLHHVMAEK  240

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQA  181
             +G  LS+ATFYNP  DA+I PA KLLYP    F DY   + +TKF  K  R E+M+KL +
Sbjct  241   NGCWLSVATFYNPMDDAIILPATKLLYPGKYAFGDY--SHAATKFQGKELRLESMRKLMS  298

Query  180   NG  175
             NG
Sbjct  299   NG  300



>ref|XP_006656182.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Oryza 
brachyantha]
Length=293

 Score =   327 bits (837),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/298 (52%), Positives = 213/298 (71%), Gaps = 7/298 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L  E+R + + LLH AC +WGFF +ENHG++ ELM  +K++V +HYE ++
Sbjct  1     MEIPVIKMDELHVEKRPEMLSLLHDACAQWGFFWLENHGVNEELMNKIKRLVNKHYEQNM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RFY S++ K +        + DWE ++   H P SNI ++   P     T  +Y E+L
Sbjct  61    EKRFYDSEMAKNL-GPDNVASNVDWECSFMYRHQPKSNIYDI---PELVRTTFPEYAEEL  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE+L+E+M ENLGL+K+++K++FS     S+G KVA YP C NPELV GLR HTDAG
Sbjct  117   IKLAEQLAEVMSENLGLDKDYLKKAFSKP---SVGIKVAKYPRCSNPELVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD VPGLEF KD +W+ IPP++ NRIFVN GDQ+E++SNG+YKS  H+V+   
Sbjct  174   GIILLLQDDLVPGLEFLKDGKWMPIPPTQANRIFVNLGDQIEVMSNGIYKSICHQVVPNR  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNP  DA++ PAPKL YP+   F+DYL  Y +TKF DK  RF+  K +
Sbjct  234   NGSRLSIATFYNPGPDAIVFPAPKLTYPSQYRFKDYLDFYSTTKFTDKVSRFQNTKMI  291



>sp|Q08507.1|ACCO3_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 3; Short=ACC 
oxidase 3; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Petunia x hybrida]
 gb|AAA33697.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=320

 Score =   327 bits (839),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 214/309 (69%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G ER  TM+++  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIINLEKLNGSERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +  + + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVLHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL-----------LYPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+S+A+FYNP SDA+I PAP L           +YP  V F DY+K Y   KF  K PRF
Sbjct  244   RMSLASFYNPGSDAVIYPAPTLVEKEADQECKQVYPKFV-FDDYMKLYAGLKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             EAMK  +A+
Sbjct  303   EAMKAREAD  311



>gb|AAF36484.1|AF129074_1 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
Length=318

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 214/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S++ GE+R   M+ ++ ACE WGFF + NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVVDLSQITGEKREAAMEKMNDACENWGFFELVNHGISHELMDTVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +   ++ K M+++  +L K+
Sbjct  65    FKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQPDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA I PAP LL         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFICPAPALLEKETENISAYPKFV-FDDYMKLYSGLKFHAKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAMEST  309



>ref|XP_009113083.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Brassica 
rapa]
 emb|CAA57284.1| ACC oxidase [Brassica oleracea]
 emb|CAC39108.1| ACC oxidase [Brassica rapa subsp. rapa]
 emb|CDY19546.1| BnaC09g13570D [Brassica napus]
 emb|CDY12944.1| BnaA09g13300D [Brassica napus]
Length=320

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 218/309 (71%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PV+D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+NV+KM  +HY
Sbjct  1     MEKNIKFPVVDLSKLIGEERDQTMALINDACENWGFFEIVNHGLPHDLMDNVEKMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             + S++++F      K +EN +  + D DWEST+++ H P SN+ ++ +  + +   M+ +
Sbjct  61    KISMEQKFNDMLKSKGLENLEREVEDVDWESTFYLRHLPQSNLYDIPDMSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEDLLDLLCENLGLEKGYLKKVFHGTKGPTFGTKVSNYPACPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGRYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP SDA ISPA  L      YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPGSDAEISPASSLACKETEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNANA  307



>gb|ACO91560.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia suffruticosa]
Length=312

 Score =   327 bits (838),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 217/302 (72%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEER+ TM++++ ACE WGFF + NHGI  E M+ V+K+  +HY+  ++++
Sbjct  5     PVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKCMEQK  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E +   I D DWEST+ + H P SN+ E+ +  + + K M+++  ++  +
Sbjct  65    FKELVASKALETE---INDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFASKIETL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGG+I
Sbjct  122   AEELLDLICENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGLI  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  182   LLFQDDRVSGLQLLKDDQWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  240

Query  351   RLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             R+S+A+FYNP SDA+I PAP LL      YP  + F+DY+K Y   KF  K PRFEAMK 
Sbjct  241   RMSLASFYNPGSDAVIYPAPALLGKEAQVYPKFI-FEDYMKLYAGLKFQAKEPRFEAMKA  299

Query  189   LQ  184
             ++
Sbjct  300   VE  301



>gb|AHN13883.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Coffea arabica]
Length=319

 Score =   327 bits (838),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 215/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L G++R+ TM ++  ACE WGFF + NHGI  E+M+ V+++   HY+  +++R
Sbjct  5     PVINMKNLNGDKRASTMDIIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +  + +   M+++  +L K+
Sbjct  65    FKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTLMKEFAVRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPELIKGLRPHTDAGGVI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  K +QWV +PP K++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKGDQWVDVPPMKHS-IVVNLGDQLEVITNGKYKSVLHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP +DA+I PAP LL          YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGNDAVIYPAPALLEKEAEERKEVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
              MK ++AN
Sbjct  303   LMKNVEAN  310



>gb|AEK70335.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
 gb|AFA51947.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
 gb|AIE48275.1| ACC oxidase [Paeonia lactiflora]
Length=312

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 215/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEER+ TM++++ ACE WGFF + NHGI  E M+ V+K+  +HY+  ++++
Sbjct  5     PVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKCMEQK  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E +   I D DWEST+ + H P SN+ E+ +  + + K M+++  +L  +
Sbjct  65    FKELVASKALETE---INDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFASKLETL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGG+I
Sbjct  122   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGLI  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  182   LLFQDDRVSGLQLLKDGQWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  240

Query  351   RLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             R+S+A+FYNP SDA+I PAP LL      YP  + F DY+K Y   KF  K PRFEAMK 
Sbjct  241   RMSLASFYNPGSDAVIYPAPALLGKDAQVYPKFI-FDDYMKLYAGLKFQAKEPRFEAMKA  299

Query  189   LQ  184
             L+
Sbjct  300   LE  301



>dbj|BAA19605.1| ACC-oxidase [Vigna angularis]
Length=310

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 213/303 (70%), Gaps = 12/303 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   + GEER   ++ +  ACE WGFF + NHGI  EL++ V+++  +HY   +++R
Sbjct  5     PVINLENINGEERKAVLEKIEDACENWGFFELVNHGIPLELLDTVERLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E  +  I+D DWEST+F+ H P SNI+E+ +    + K M+ + ++L K+
Sbjct  65    FKEAVASKGLEGVQGEIKDMDWESTFFLRHLPHSNISEIPDLSEEYRKAMKDFAQKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVANYPPCPKPELVKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+A+ DG 
Sbjct  185   LLLQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIARTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNPA DA+I PAP LL          YP  V F+DY++ Y + KF  K PRFE
Sbjct  244   RMSIASFYNPAGDAVIYPAPALLERKTQVIDKVYPKFV-FEDYMRLYATLKFQPKEPRFE  302

Query  201   AMK  193
             AMK
Sbjct  303   AMK  305



>ref|NP_001289250.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Pyrus x bretschneideri]
 dbj|BAA76387.1| ACC oxidase [Pyrus pyrifolia]
 gb|ABO38176.1| ACC oxidase [Pyrus pyrifolia]
 gb|ABY51681.2| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x bretschneideri]
 gb|ACJ12491.1| 1-aminocyclopropane-1-carboxylate [Pyrus x bretschneideri]
 gb|AFA46526.1| ACC oxidase [Pyrus pyrifolia]
Length=314

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 214/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S + GEER  T++ ++ ACE WGFF + NHGI  EL++ V+KM   HY+ ++++R
Sbjct  5     PVVDLSLVNGEERVATLEKINDACENWGFFELVNHGISTELLDTVEKMTKDHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K ++  +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+
Sbjct  65    FKEMVAAKGLDAVQSEIHDLDWESTFFLRHLPSSNISEVPDLEEDYRKTMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR H+DAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHSDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPM-HHSIVINLGDQIEVITNGKYKSVMHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA ISPAP +L         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFISPAPAVLEKKTEDAPTYPKFV-FDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>ref|XP_010473457.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Camelina 
sativa]
Length=320

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 217/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ PV+D SKL GEER +TM L++ ACE WGFF + NHGI  +LM+ ++KM   HY
Sbjct  1     MEKNMKFPVVDLSKLDGEERDQTMALINEACENWGFFEIMNHGIPHDLMDKIEKMTKGHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++  +  + D DWEST+++ H P SN++++ +  + +   M+ +
Sbjct  61    KTYQEQKFNDMLKSKGLDKLETEVEDVDWESTFYVRHLPQSNLSDISDMSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              E+L  +AE+L +L+CENLGLEK ++K++F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GERLENLAEDLLDLLCENLGLEKGYLKKAFRGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNPASDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPASDAEISPATSLVEKDSDYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNASA  307



>ref|XP_007141655.1| hypothetical protein PHAVU_008G214200g [Phaseolus vulgaris]
 gb|ESW13649.1| hypothetical protein PHAVU_008G214200g [Phaseolus vulgaris]
Length=315

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 216/304 (71%), Gaps = 12/304 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+F KL GEER   M+ +  ACE WGFF + +HGI  +L++ V+++  +HYE  ++ER
Sbjct  5     PVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKCMEER  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  S   K +E  +  ++D DWEST+ + H P SNI+E+ +  + + K M+ +  +L K+
Sbjct  65    FKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFALRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GS+G + GTKVA YP CPNPELV+GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCPNPELVKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWVDVPPMRHS-IVVNIGDQLEVITNGKYKSVEHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP+L          LYP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIYPAPELLEKEAEEKAQLYPKFV-FEDYMKLYADLKFQAKEPRFE  302

Query  201   AMKK  190
             A K+
Sbjct  303   AFKE  306



>gb|AFU90135.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
Length=312

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 215/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEER+ TM++++ ACE WGFF + NHGI  E M+ V+K+  +HY+  ++++
Sbjct  5     PVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKCMEQK  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E +   I D DWEST+ + H P SN+ E+ +  + + K M+++  +L  +
Sbjct  65    FKELVASKALETE---INDMDWESTFQLRHLPISNMAEIPDLDDEYRKVMKEFASKLETL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGG+I
Sbjct  122   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGLI  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  182   LLFQDDRVSGLQLLKDGQWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  240

Query  351   RLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             R+S+A+FYNP SDA+I PAP LL      YP  + F DY+K Y   KF  K PRFEAMK 
Sbjct  241   RMSLASFYNPGSDAVIYPAPALLGKDAQVYPKFI-FDDYMKLYAGLKFQAKEPRFEAMKA  299

Query  189   LQ  184
             L+
Sbjct  300   LE  301



>ref|XP_010686763.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Beta 
vulgaris subsp. vulgaris]
Length=318

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 218/307 (71%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+++  KL G+ER+  M+ +  ACE WGFF V NH I  +L++ V++M  +HY+  ++++
Sbjct  5     PIVNMEKLYGDERNVVMEKIKDACENWGFFEVVNHPISTQLLDTVERMTKEHYKKCMEQK  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F     +K +EN +  I D DWEST+++ HHP SNI ++ +  + + K M+++  ++ K+
Sbjct  65    FKEMVALKGLENTQSEIDDIDWESTFYLRHHPISNITDIPDLNDEYRKVMKEFAGEIEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F G+ G + GTKV+ YP CP P L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGANGPTFGTKVSNYPPCPKPNLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP K++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMKHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP L         +YP  V F+DY+K Y   KF +K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPTLVEKQEEKCSVYPKFV-FEDYMKLYAGLKFQEKEPRFEA  302

Query  198   MKKLQAN  178
             MK +++ 
Sbjct  303   MKAVEST  309



>gb|EAZ01418.1| hypothetical protein OsI_23452 [Oryza sativa Indica Group]
Length=293

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 214/298 (72%), Gaps = 7/298 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L GE+RS+T++LLH AC +WGFF +ENHGI+ +LM  +K +V +HYE S+
Sbjct  1     MEIPVIKMDELHGEKRSETLQLLHDACAQWGFFWLENHGINEDLMYKIKGLVNKHYEQSM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++ FY S+  K +      + + DWE ++   H P SNI+++   P     T+ +Y E++
Sbjct  61    EKNFYNSETAKNL-GPDNVVSNVDWECSFMYRHQPESNIHDI---PELVCTTLPEYAEEV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE L+E+M ENLGL+K+++K++FS     S+G K A YP C +PE V GLR HTDAG
Sbjct  117   IKLAERLAEVMSENLGLDKDYLKKAFSNP---SVGIKAAKYPRCSHPEFVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD VPGLEF KD +W+ IPP++ NRIFVN GDQVE++SNG+YKS  H+V+   
Sbjct  174   GIILLLQDDLVPGLEFLKDGRWMPIPPTQGNRIFVNLGDQVEVISNGIYKSICHQVVPNK  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNP  DA++ PA KL YP+   F+DYL+ Y +TKF DK  RF+  K +
Sbjct  234   NGSRLSIATFYNPGPDAIVFPAQKLTYPSQYRFKDYLEFYSTTKFTDKVSRFQTTKMI  291



>gb|AAC48977.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
 prf||2104412A aminocyclopropane carboxylate oxidase
Length=318

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 216/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEER+ TM+ +  ACE WGFF + NHGI  EL++ V+KM  +HY   +++R
Sbjct  5     PVINMEKLNGEERAATMEKIKDACENWGFFELLNHGIPYELLDTVEKMTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+++ +  + + K M+++  +L K+
Sbjct  65    FKEMVASKGLEGVEVEVEDLDWESTFFLKHLPESNISQVPDLQDEYRKVMKEFAAKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+ ENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGG+I
Sbjct  125   AEELLDLLSENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGLI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS  HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGKWVDVPPM-HHSIVINLGDQLEVITNGKYKSIEHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP LL         YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPALLEKETEEKQVYPKFV-FEDYMKLYSGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             MK ++AN
Sbjct  303   MKAVEAN  309



>sp|Q08508.1|ACCO4_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase 4; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Petunia x hybrida]
 gb|AAA33698.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=319

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 214/308 (69%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+   L G ER  TM+++  ACE WGFF + NHGI  E+M+ V+K    HY+  +++R
Sbjct  5     PIINLENLCGAERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKFTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +  + + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVPHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNPASDA+I PAP L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPASDAVIYPAPALVERDAEENKQIYPKFV-FDDYMKLYARLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++A+
Sbjct  303   AMKAMEAD  310



>emb|CDP05674.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 215/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L G++R+ TM ++  ACE WGFF + NHGI  E+M+ V+++   HY+  +++R
Sbjct  5     PVINMKNLNGDKRASTMDIIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +  + +   M+++  +L K+
Sbjct  65    FKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTIMKEFAVRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPELIKGLRPHTDAGGVI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  K +QWV +PP K++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKGDQWVDVPPMKHS-IVVNLGDQLEVITNGKYKSVLHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP +DA+I PAP LL          YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGNDAVIYPAPALLEKEAEERKEVYPKFV-FDDYMKLYVGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
              MK ++AN
Sbjct  303   LMKNMEAN  310



>emb|CAI64500.1| 1-aminocyclopropane-1-carboxylate oxidase 2 [Prunus domestica 
subsp. insititia]
Length=304

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 212/302 (70%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S++ GE+R   M+ ++ ACE WGFF + NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVVDLSQINGEKRGAAMEKINDACENWGFFELVNHGISHELMDTVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +   ++ K M+++  +L K+
Sbjct  65    FKEMVANKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS +HRVLAQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVLAQPDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA I PAP LL         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFICPAPALLEKETEKISVYPKFV-FDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>ref|XP_008371045.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Malus 
domestica]
Length=330

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 214/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D   + GEER+ T++ ++ ACE WGFF + NHGI  EL++ V+KM   HY+ ++++R
Sbjct  5     PVVDMDLINGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+
Sbjct  65    FKEMVAAKGLEAVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +W+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWMDVPPV-HHSIVINLGDQIEVITNGKYKSIMHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA ISPAP LL         YP    F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFISPAPALLEKKSEETPTYP-KFLFDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>gb|KHN32985.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 213/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER+  M+++  ACE WGFF + NHGI  ELM+ V+++  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN+++  +    + KTM+++  +L K+
Sbjct  65    FKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEEYRKTMKKFALELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ D  
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQADDT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAVISPAPALVKELDETSQVYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>gb|ABL67954.2| 1-aminocyclopropane-1-carboxylate oxidase [Ipomoea nil]
Length=319

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 217/307 (71%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+ ++L  EER   M+ +  ACE WGFF + +HGI  ELM+ V+K+   HY+  +++R
Sbjct  5     PIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K ++  +  I D DWEST+F+ H P SNI+E+ +  +++ K M+++  +L K+
Sbjct  65    FKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ FSGSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AENLLDLLCENLGLEKGYLKKPFSGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD++WV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDDKWVDVPPMRHS-IVVNIGDQLEVITNGKYKSVLHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PAP L+          YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIFPAPALVEKEAEENKHKYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQA  181
             AMK +++
Sbjct  303   AMKTMES  309



>sp|Q00985.1|ACCO1_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=PAE12; AltName: Full=Protein AP4 [Malus 
domestica]
 emb|CAA43662.1| ethylene related [Malus domestica]
 gb|AAA33412.1| ripening-related protein [Malus sylvestris]
 emb|CAA74328.1| ACC oxidase [Malus domestica]
 gb|AAC36461.1| ACC oxidase [Malus domestica]
 gb|ABA03055.1| ACC oxidase [Malus domestica]
 prf||1905416A aminocyclopropane carboxylate oxidase
Length=314

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 216/302 (72%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D S + GEER+ T++ ++ ACE WGFF + NHG+  EL++ V+KM   HY+ ++++R
Sbjct  5     PVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +++ +  I D DWEST+F+ H P+SNI+E+ +    + KTM+++  +L K+
Sbjct  65    FKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR H+DAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHSDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWVDVPPM-HHSIVINLGDQIEVITNGKYKSVMHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP +D+ ISPAP +L         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGNDSFISPAPAVLEKKTEDAPTYPKFV-FDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>dbj|BAF33504.1| ACC synthase [Orobanche minor]
Length=311

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 218/306 (71%), Gaps = 12/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEERS TM+++  ACE WGFF V NHGI  E M++V+++  +HY+  +++R
Sbjct  5     PVINMEKLNGEERSATMEMIKDACENWGFFEVMNHGIAPEFMDSVERLTKEHYKKCMEKR  64

Query  891   FYASDVVKC-VENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMK  715
             F      K  +E  +  I D DWEST+F+ H P SNI+E+ +  + + K M+++  QL K
Sbjct  65    FEEMVASKGNIEALQSEINDLDWESTFFLTHLPVSNISEIPHLQDEYRKVMKEFAVQLEK  124

Query  714   VAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGI  535
             +AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGI
Sbjct  125   LAEQLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGI  184

Query  534   ILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG  355
             ILL QDD+V GL+  KD +WV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG
Sbjct  185   ILLFQDDKVSGLQLLKDGKWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDG  243

Query  354   N-RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
               R+S+A+FYNP SDA+I PAP L        LYP  V F+DY+K Y   KF  K PRFE
Sbjct  244   TGRMSLASFYNPGSDAVIYPAPSLVEKAENNELYPEFV-FEDYMKLYAGLKFHAKEPRFE  302

Query  201   AMKKLQ  184
             A KK++
Sbjct  303   AFKKIE  308



>emb|CBI28867.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/300 (52%), Positives = 208/300 (69%), Gaps = 11/300 (4%)
 Frame = -2

Query  1050  LAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYASDVV  871
             L GEER  TM+++  ACE WGFF + NHGI  E M+ V+K+   HY   +++RF      
Sbjct  4     LNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKCMEQRFKELVAA  63

Query  870   KCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEELSEL  691
             K +E  +  I+D DWEST+F+ H P SN+++  +    + K M+ +  +L K+AEEL +L
Sbjct  64    KALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYRKVMKDFALKLEKLAEELLDL  123

Query  690   MCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLLQDDQ  511
             +CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGIILL QDD 
Sbjct  124   LCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDT  183

Query  510   VPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLSIATF  331
             V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGNR+SIA+F
Sbjct  184   VSGLQLLKDGQWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVLHRVVAQTDGNRMSIASF  242

Query  330   YNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQAN  178
             YNP +DA+I PAP LL         YP  V F DY+K Y   KF  K PRFEAMK ++A+
Sbjct  243   YNPGNDAVIYPAPALLEKEAEKDQVYPKFV-FDDYMKLYAGLKFQAKEPRFEAMKNVEAS  301



>ref|XP_003549632.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
 gb|KHN03507.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=319

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 214/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELM-ENVKKMVTQHYEDSLKE  895
             PV+D   L  EERS TM+++  ACE WGFF + NHGI  ELM + V++M  +HY+  +++
Sbjct  5     PVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGISIELMMDTVERMTKEHYKKCMEQ  64

Query  894   RFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMK  715
             RF      K +E+ +  I D DWEST+F+ H P SNI+E+ +   ++ K M+ +  +L K
Sbjct  65    RFQEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLDEDYRKVMKDFAVELEK  124

Query  714   VAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGI  535
             +AE + EL+CENLGLEK ++K+ F GSKG + GTKV+ YP CP PEL++GLR HTDAGGI
Sbjct  125   LAELVLELLCENLGLEKGYLKKVFCGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDAGGI  184

Query  534   ILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG  355
             ILL QD +V GL+  KD  W+ +PP +++ I +N GDQ+E+++NG YKS +HRV+ Q DG
Sbjct  185   ILLFQDHKVSGLQLLKDAHWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVITQTDG  243

Query  354   NRLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             NR+SIA+FYNP +DA+I+PAP L        +YP  V F DY+K Y   KF DK PRFEA
Sbjct  244   NRMSIASFYNPGNDALIAPAPALVKEDETSQVYPKFV-FDDYMKLYAGLKFQDKEPRFEA  302

Query  198   MKKLQAN  178
             MK  +++
Sbjct  303   MKATESS  309



>gb|EYU27738.1| hypothetical protein MIMGU_mgv1a010275mg [Erythranthe guttata]
Length=317

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 212/305 (70%), Gaps = 10/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++  KL G+ERS TM+L+  AC  WGFF + NHGI  E M+ V+K+  +HY  S++ R
Sbjct  5     PVVNMEKLNGDERSATMELIEDACANWGFFELVNHGISPEFMDRVEKLTKEHYRKSMEAR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K ++  +  I D DWEST+F+ H P SNI+E+ +  + + K M+++  +L  +
Sbjct  65    FKEMVASKGLDAVQSEIEDLDWESTFFLRHLPISNISEVPDLEDEYRKVMKEFAGKLEVL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD  WV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGDWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNP SDA+I PAP L        LYP  V F+DY+K Y   KF  K PRFEA 
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVENKESKDLYPKFV-FEDYMKLYAGVKFQAKEPRFEAF  302

Query  195   KKLQA  181
             K L+ 
Sbjct  303   KNLET  307



>dbj|BAB83762.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus lunatus]
Length=315

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/303 (52%), Positives = 215/303 (71%), Gaps = 12/303 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+F +L GEER  TM+ +  ACE WGFF + NHGI  +L++ V+++  +HY+  ++ER
Sbjct  5     PVINFERLNGEERKDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYQKCMEER  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  ++D DWEST+ + H P SNI+E+ +  + + K M+ +  +L K+
Sbjct  65    FKELMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFALRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GS+G + GTKVA YP CPNPELV+GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCPNPELVKGLRPHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWVDVPPMRHS-IVVNIGDQLEVITNGKYKSVEHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP+L          LYP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIYPAPELLEKEAEEKAQLYPKFV-FEDYMKLYAKLKFQAKEPRFE  302

Query  201   AMK  193
             A K
Sbjct  303   AFK  305



>ref|XP_010035511.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46933.1| hypothetical protein EUGRSUZ_K00747 [Eucalyptus grandis]
Length=320

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 214/309 (69%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GE+R+ TM  +  ACE WGFF + NHGI  E M+ V++M   HY   + +R
Sbjct  5     PVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTVERMTKGHYRKCMDQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +EN +  + D DWEST+ + H P SNI+++ +  +++ K M+++  +L K+
Sbjct  65    FRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAVKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GS G + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPKPELIKGLRAHTDAGGVI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQIEVITNGKYKSVLHRVVAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL-----------YPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+SIA+FYNP SDA I PAP L+           YP  V F+DY+K Y + KF  K PRF
Sbjct  244   RMSIASFYNPGSDAAIYPAPALMESKAEEASKAAYPKFV-FEDYMKLYAALKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             +AMK ++++
Sbjct  303   QAMKAMESS  311



>ref|XP_010418231.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Camelina 
sativa]
Length=320

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 216/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M  PV+D SKL GEER +TM L++ ACE WGFF + NHGI  +LM+ ++KM   HY
Sbjct  1     MEKNMTFPVVDLSKLDGEERDQTMALINEACENWGFFEIMNHGIPHDLMDKIEKMTKGHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++  +  + D DWEST+++ H P SN++++ +  + +   M+ +
Sbjct  61    KTYQEQKFNDMLKSKGLDKLETEVEDVDWESTFYVRHLPQSNLSDISDMSDEYRTPMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              E+L  +AE+L +L+CENLGLEK ++K++F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GERLENLAEDLLDLLCENLGLEKGYLKKAFRGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNPASDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPASDAEISPATSLVEKDSDYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNASA  307



>sp|Q09052.1|ACCO1_BRAJU RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Brassica juncea]
 emb|CAA77807.1| ethylene-forming enzyme [Brassica juncea]
Length=320

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 217/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PV+D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+N +KM  +HY
Sbjct  1     MEKNIKFPVVDLSKLIGEERDQTMALINDACENWGFFEIVNHGLPHDLMDNAEKMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             + S++++F      K +EN +  + D DWEST+++ H P SN+ ++ +  + +   M+ +
Sbjct  61    KISMEQKFNDMLKSKGLENLEREVEDVDWESTFYLRHLPQSNLYDIPDMSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEDLLDLLCENLGLEKGYLKKVFHGTKGPTFGTKVSNYPACPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVTGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGRYKSMMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP SDA ISPA  L      YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPGSDAEISPASSLACKETEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNANA  307



>ref|XP_010546539.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Tarenaya 
hassleriana]
Length=319

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/303 (51%), Positives = 210/303 (69%), Gaps = 7/303 (2%)
 Frame = -2

Query  1074  IPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKE  895
              PVID SKL GEER++TM  +  ACE WGFF + NHG+  ELM+ ++KM  +HY   L++
Sbjct  6     FPVIDLSKLDGEERAQTMAKIDDACENWGFFELVNHGVPLELMDRIEKMTKEHYRKCLEQ  65

Query  894   RFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMK  715
             RF      K ++  +  + D DWEST+F+ H P SN+ ++ +  + +   M+ + ++L  
Sbjct  66    RFQEMVQTKGLDAVQNEVNDVDWESTFFLRHLPESNLYDIPDLSDEYRAAMKDFAKRLEN  125

Query  714   VAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGI  535
             +AEEL +L+CENLGLEK ++K+ F+G+KG + GTKV+ YP CP P+LV+GLR HTDAGGI
Sbjct  126   LAEELLDLLCENLGLEKGYMKKVFNGTKGPTFGTKVSNYPPCPKPDLVKGLRAHTDAGGI  185

Query  534   ILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDG  355
             ILL QDD+V GL+  KD  W+ +PP K++ I VN GDQ+E+++NG YKS +HRV+ Q DG
Sbjct  186   ILLFQDDKVSGLQLLKDGNWIDVPPLKHS-IVVNLGDQLEVITNGKYKSVMHRVMTQTDG  244

Query  354   NRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             NR+SIA+FYNP +DA I PAP L+     YP  V F DY+K Y   KF  K PRFEAMK 
Sbjct  245   NRMSIASFYNPGNDAEIFPAPTLVEEDSDYPRFV-FDDYMKLYAGLKFQPKEPRFEAMKN  303

Query  189   LQA  181
               A
Sbjct  304   ASA  306



>gb|ABW91147.1| ACC oxidase 2 [Ziziphus jujuba]
Length=321

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 213/310 (69%), Gaps = 14/310 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID  KL GEER+ TM+ ++ ACE WGFF + NHGI  E M+ V++   +HY   +++R
Sbjct  5     PVIDMEKLNGEERAATMEKINDACENWGFFELVNHGIAPEFMDTVERQTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P  NI+E+ +    + K M+++  Q+ K+
Sbjct  65    FKEMVESKGLEVVQSEIDDLDWESTFFVRHLPVPNISEIPDLHEGYRKAMKEFAAQIEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GS G + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSNGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSIMHRVIAQPDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL------------YPNNVCFQDYLKHYGSTKFGDKGPR  208
             R+SIA+FYNP SDA+I PAP LL            YP  V F+DY+K Y   KF  K PR
Sbjct  244   RMSIASFYNPGSDAVIYPAPALLEKEANDEKKVQVYPKFV-FEDYMKLYAGLKFQAKEPR  302

Query  207   FEAMKKLQAN  178
             FEAMK +++ 
Sbjct  303   FEAMKTMEST  312



>dbj|BAD61848.1| putative 1-aminocyclopropane-1-carboxylic acid oxidase [Oryza 
sativa Japonica Group]
 gb|EAZ37429.1| hypothetical protein OsJ_21765 [Oryza sativa Japonica Group]
Length=293

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/298 (52%), Positives = 214/298 (72%), Gaps = 7/298 (2%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             MEIPVI   +L GE+RS+T++LLH AC +WGFF +ENHGI+ +LM  +K +V +HYE S+
Sbjct  1     MEIPVIKMDELHGEKRSETLQLLHDACAQWGFFWLENHGINEDLMYKIKGLVNKHYEQSM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++ FY S+  K +      + + DWE ++   H P SNI+++   P     T+ +Y E++
Sbjct  61    EKNFYNSETAKNL-GPDNVVSNVDWECSFMYRHQPESNIHDI---PELVRTTLPEYAEEV  116

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
             +K+AE L+E+M ENLGL+K+++K++FS     S+G K A YP C +PE V GLR HTDAG
Sbjct  117   IKLAERLAEVMSENLGLDKDYLKKAFSNP---SVGIKAAKYPRCSHPEFVMGLRGHTDAG  173

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILLLQDD VPGLEF KD +W+ IPP++ N+IFVN GDQVE++SNG+YKS  H+V+   
Sbjct  174   GIILLLQDDLVPGLEFLKDGRWMPIPPTQGNQIFVNLGDQVEVISNGIYKSICHQVVPNK  233

Query  360   DGNRLSIATFYNPASDAMISPAPKLLYPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKL  187
             +G+RLSIATFYNP  DA++ PA KL YP+   F+DYL+ Y +TKF DK  RF+  K +
Sbjct  234   NGSRLSIATFYNPGPDAIVFPAQKLTYPSQYRFKDYLEFYSTTKFTDKVSRFQTTKMI  291



>emb|CAA71140.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Rumex palustris]
Length=314

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 214/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME P+I+  K+ G+ER  TM ++  ACE WGFF + NHGI  E+M+ V+++  +HY+ S+
Sbjct  1     MEFPIINLEKVNGDERKATMDMIKDACENWGFFELVNHGIPVEVMDTVERLTKEHYKKSM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF        + N    + D DWE T+ + H P SNI+EL +    + K M+ +  +L
Sbjct  61    EQRFKELVASNGLVNASAEVNDVDWECTFHLKHLPDSNISELPDLEEEYRKVMKDFALRL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AE+L +L+CENLGLEK ++K++F G++G + GTKVA YP CP PEL++GLR HTDAG
Sbjct  121   EKLAEDLLDLLCENLGLEKGYLKKAFYGARGPTFGTKVANYPPCPKPELIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD++W+ +PP  ++ I VN GDQ+E+++NG YKS LHRV+AQ 
Sbjct  181   GIILLFQDDRVSGLQLLKDDEWIDVPPMPHS-IVVNLGDQLEVITNGKYKSVLHRVIAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPR  208
             DG R+SIA+FYNP SDA+I PAP+L         +YP  V F+DY+K Y + KF  K PR
Sbjct  240   DGTRMSIASFYNPGSDAVIYPAPELVEEAQEKTQVYPKFV-FEDYMKLYSALKFQAKEPR  298

Query  207   FEAMKKL  187
             FEAMK +
Sbjct  299   FEAMKAV  305



>ref|XP_011047191.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
Length=319

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 215/312 (69%), Gaps = 13/312 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI   KL GEER+ TM+ +  ACE WGFF + NHGI  EL++ V++M  +HY+  +
Sbjct  1     MEFPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHELLDTVERMTKEHYKKCM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K ++  +  I+D DWEST+++ H P SNI E+ +  + + K M+++  +L
Sbjct  61    EQRFKELVASKALDGVQTEIKDMDWESTFYLRHLPKSNIAEIPDLDDEYRKVMKEFALKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGE-SIGTKVAIYPECPNPELVRGLREHTDA  544
              K+AEEL +L+CENLGLEK ++K +F GS G  + GTKV+ YP CP P+LV+GLR HTDA
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKRAFYGSNGSPTFGTKVSNYPPCPKPDLVKGLRAHTDA  180

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ
Sbjct  181   GGIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIAQ  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKG  214
              DG R+S+A+FYNP S+A+I PAP L          +YP  V F DY+K Y   KF  K 
Sbjct  240   TDGTRMSVASFYNPGSEAVIYPAPALVEKEAEDKKKVYPKFV-FDDYMKLYAGLKFQAKE  298

Query  213   PRFEAMKKLQAN  178
             PRFEAMK +++ 
Sbjct  299   PRFEAMKAVEST  310



>emb|CAA58232.1| 1-amniocyclopropane-1-carboxylate oxidase [Nicotiana tabacum]
Length=308

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 214/298 (72%), Gaps = 9/298 (3%)
 Frame = -2

Query  1050  LAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYASDVV  871
             L  E+R+ TM+ +  ACE WGFF V NHGI  EL++ V+K+   HY+  ++ERF      
Sbjct  4     LNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEERFKEMVAS  63

Query  870   KCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEELSEL  691
             K +E  +  I+D DWEST+F+ H P SNI+E+ +  + + K M+++ E+L K+AE+L +L
Sbjct  64    KGLEAVQTEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEKLEKLAEQLLDL  123

Query  690   MCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLLQDDQ  511
             +CENLGLE+ ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGIILL QDD+
Sbjct  124   LCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDK  183

Query  510   VPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLSIATF  331
             V GL+  KD++W+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ DGNR+SIA+F
Sbjct  184   VSGLQLLKDDKWIDVPPMRHS-IVINLGDQLEVITNGKYKSVEHRVIAQPDGNRMSIASF  242

Query  330   YNPASDAMISPAPKLL-------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQAN  178
             YNP SDA+I PAP+LL       YP  V F+DY+K Y   KF  K PRFEAMK ++  
Sbjct  243   YNPGSDAVIYPAPELLEKENKVIYPKFV-FEDYMKLYAGLKFQAKEPRFEAMKAVETT  299



>gb|AHW85523.1| 1-aminocyclopropane-1-carboxylate oxidase, partial [Malus floribunda]
Length=301

 Score =   324 bits (830),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 216/299 (72%), Gaps = 11/299 (4%)
 Frame = -2

Query  1062  DFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYA  883
             D S + GEER+ T++ ++ ACE WGFF + NHG+  EL++ V++M   HY+ ++++RF  
Sbjct  1     DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVERMTKDHYKKTMEQRFKE  60

Query  882   SDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEE  703
             +   K +++ +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+AE+
Sbjct  61    TVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKLAEK  120

Query  702   LSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLL  523
             L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR H+DAGGIILL 
Sbjct  121   LLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHSDAGGIILLF  180

Query  522   QDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLS  343
             QDD+V GL+  KD++WV +PP  ++ I +N GDQ+E++SNG YKS +HRV+AQ+DG R+S
Sbjct  181   QDDKVSGLQLLKDDEWVDVPPM-HHSIVINLGDQIEVISNGKYKSVMHRVIAQSDGTRMS  239

Query  342   IATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMK  193
             IA+FYNP +DA ISPAP +L         YP  V F DY+K Y   KF  K PRFEAMK
Sbjct  240   IASFYNPGNDAFISPAPAVLEKKTGDAPTYPKFV-FDDYMKLYSGLKFQAKEPRFEAMK  297



>gb|ABC69167.2| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia suffruticosa]
Length=312

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/302 (50%), Positives = 216/302 (72%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL G ER+ TM++++ ACE WGFF + NHGI  E M+ V+K+  +HY+  ++++
Sbjct  5     PVINLEKLNGGERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKCMEQK  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E +   I D DWEST+ + H P SN+ E+ +  + + K M+++  ++  +
Sbjct  65    FKELVASKALETE---INDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFASKIETL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGG+I
Sbjct  122   AEELLDLICENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGLI  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DGN
Sbjct  182   LLFQDDRVSGLQLLKDDQWVDVPPMRHS-IVINIGDQLEVITNGKYKSVMHRVIAQTDGN  240

Query  351   RLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKK  190
             R+S+A+FYNP SDA+I PAP LL      YP  + F+DY+K Y   KF  K PRFEAMK 
Sbjct  241   RMSLASFYNPGSDAVIYPAPALLGKEAQVYPKFI-FEDYMKLYAGLKFQAKEPRFEAMKA  299

Query  189   LQ  184
             ++
Sbjct  300   VE  301



>dbj|BAG30908.1| ACC oxidase [Capsicum chinense]
Length=319

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 214/307 (70%), Gaps = 12/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G ER+ TM ++  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIINLEKLNGAERANTMGMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+++ +  + + + M  + ++L K+
Sbjct  65    FKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISDVPDLDDEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F G+KG + G+KV+ YP CP P+L++GLR HTDAGGI+
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGTKGPNFGSKVSNYPPCPKPDLIKGLRAHTDAGGIV  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVVNLGDQIEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PAP L          +YP    F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIYPAPTLVEKAKEESKQVYP-KFLFDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQA  181
             AMK ++A
Sbjct  303   AMKAMEA  309



>ref|XP_004486198.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=316

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 212/305 (70%), Gaps = 10/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P++D  KL  EER  T+  +  ACE WGFF + NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PIVDMGKLNTEERKATLDKMKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +   ++ K M+++  +L K+
Sbjct  65    FKEMVESKGLEYVQSEINDLDWESTFFLRHLPVSNISEIPDLDQDYRKVMKEFAVKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL + +CENLGLEK ++K+ F GSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEELLDYLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD++W+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDKWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNP  DA+ISPAP L        +YP  V F DY+K Y   KF  K PRFEAM
Sbjct  244   RMSLASFYNPGDDALISPAPTLVKENETSEIYPKFV-FDDYMKLYVGLKFQAKEPRFEAM  302

Query  195   KKLQA  181
             K L +
Sbjct  303   KALSS  307



>ref|XP_008440054.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Cucumis 
melo]
Length=320

 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 216/310 (70%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             EM+ PVI+ + L GE R   +  ++ ACE WGFF + NHGI  ELM+ V+K+  +HY   
Sbjct  2     EMDFPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGISHELMDKVEKLTKEHYRKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +++ +  I D DWEST+F+ H P SN++E+ +    + K M+++ ++
Sbjct  62    MEQRFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFADE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AEE+ +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP PEL++GLR HTDA
Sbjct  122   LEKLAEEVLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GG+ILL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  182   GGLILLFQDDKVSGLQLLKDGKWVDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGP  211
              DGNR+SIA+FYNP +DA+I PAP L         LYP  V F DY+K Y   KF  K P
Sbjct  241   EDGNRMSIASFYNPGNDAVIYPAPALVEGEQEKTKLYPKFV-FDDYMKLYVGLKFQAKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKAMES  309



>gb|KDP30812.1| hypothetical protein JCGZ_13755 [Jatropha curcas]
Length=319

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 213/312 (68%), Gaps = 13/312 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  KL G+ER+ TM  +  ACE WGFF + NHGI  E ++ V+++   HY   +
Sbjct  1     MEFPVINMEKLNGDERAATMAKIKDACENWGFFELLNHGIAPEFLDTVERLTKAHYRKCM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K ++  +  I+D DWEST+F+ H P SNI E+ +  + + K M+++  QL
Sbjct  61    EQRFKEMVASKGLDATQTEIKDMDWESTFFLRHLPQSNIAEIPDLDDEYRKVMKEFAAQL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGE-SIGTKVAIYPECPNPELVRGLREHTDA  544
              K+AEEL +L+CENLGLEK ++K++F GS G  + GTKV+ YP CP P+L++GLR HTDA
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKKAFYGSSGSPTFGTKVSNYPPCPKPDLIKGLRAHTDA  180

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD  WV +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ
Sbjct  181   GGIILLFQDDKVSGLQLLKDGHWVDVPPMRHS-IVINLGDQIEVITNGKYKSVEHRVVAQ  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKG  214
              DG R+SIA+FYNP SDA+I PAP LL          YP  V F+DY+K Y   KF  K 
Sbjct  240   TDGTRMSIASFYNPGSDAVIYPAPALLEKEAEEKKQIYPKFV-FEDYMKIYAGLKFHAKE  298

Query  213   PRFEAMKKLQAN  178
             PRFEA+K ++ N
Sbjct  299   PRFEALKAVETN  310



>emb|CDP05673.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 215/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+   L G++R+ TM+ +  ACE WGFF + NHGI  E+M+ V+++   HY+  +++R
Sbjct  5     PIINMKNLHGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +  + +   M+++  +L K+
Sbjct  65    FKELVASKALEGVQVEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTIMKEFAVRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPELIKGLRPHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  K +QWV +PP K++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKRDQWVDVPPMKHS-IVVNLGDQLEVITNGKYKSVLHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP +DA+I PAP LL          YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGNDAVIYPAPALLEKEAEERKEVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
              MK ++AN
Sbjct  303   LMKNVEAN  310



>gb|KHN44761.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=307

 Score =   324 bits (830),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 215/305 (70%), Gaps = 15/305 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GEER  T+  +  AC+ WGFF + NHGI  EL++ V+++  +HY   +++R
Sbjct  5     PVINLENLNGEERKATLHQIEDACQNWGFFELVNHGIPLELLDTVERLTKEHYRKCMEKR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E +   ++D DWEST+F+ H PTSNI+E+ +    +   M+++ ++L K+
Sbjct  65    FKEAVSSKGLEAE---VKDMDWESTFFLRHLPTSNISEIPDLSQEYRDAMKEFAQKLEKL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GS+G + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  122   AEELLDLLCENLGLEKGYLKNAFYGSRGPNFGTKVANYPACPKPELVKGLRAHTDAGGII  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  K+ QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ +G 
Sbjct  182   LLLQDDKVSGLQLLKNGQWVDVPPMRHS-IVVNLGDQIEVITNGRYKSVEHRVIAQTNGT  240

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNPASDA+I PAP LL          YP  V F+DY+K Y + KF  K PRFE
Sbjct  241   RMSVASFYNPASDALIYPAPALLEQKAEDTEQVYPKFV-FEDYMKLYATLKFQPKEPRFE  299

Query  201   AMKKL  187
             AMK +
Sbjct  300   AMKAV  304



>gb|AGV54270.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus vulgaris]
Length=315

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/304 (52%), Positives = 215/304 (71%), Gaps = 12/304 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+F KL GEER   M+ +  ACE WGFF + +HGI  +L++ V+++  +HYE  ++ER
Sbjct  5     PVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKCMEER  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  S   K +E  +  ++D DWEST+ + H P SNI+E+ +  + + K M+ +  +L K+
Sbjct  65    FKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFALRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GS+G + GTKVA YP CPNPELV+GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCPNPELVKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWVDVPPMRHS-IVVNIGDQLEVITNGKYKSVEHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP+L          LYP  V F+DY+  Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIYPAPELLEKEAEEKAQLYPKFV-FEDYMNLYAKLKFQAKEPRFE  302

Query  201   AMKK  190
             A K+
Sbjct  303   AFKE  306



>ref|XP_010035508.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Eucalyptus 
grandis]
 gb|KCW46932.1| hypothetical protein EUGRSUZ_K00746 [Eucalyptus grandis]
Length=320

 Score =   324 bits (831),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 214/309 (69%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GE+R+ TM  +  ACE WGFF + NHGI  E M+ V++M   HY   + +R
Sbjct  5     PVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTVERMTKGHYRKCMDQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +EN +  + D DWEST+ + H P SNI+++ +  +++ K M+++  +L K+
Sbjct  65    FRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAVKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GS G + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPKPELIKGLRAHTDAGGVI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQIEVITNGKYKSVLHRVVAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL-----------YPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+SIA+FYNP SDA+I PAP L+           YP  V F+DY+K Y + KF  K PRF
Sbjct  244   RMSIASFYNPGSDAVIYPAPALMESKAEKAGEAAYPKFV-FEDYMKLYAALKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             +AMK  +++
Sbjct  303   QAMKATESS  311



>gb|ADR73045.1| ACC oxidase 2 isoform A [Nicotiana tabacum]
Length=308

 Score =   324 bits (830),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 214/298 (72%), Gaps = 9/298 (3%)
 Frame = -2

Query  1050  LAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYASDVV  871
             L  E+R+ TM+ +  ACE WGFF V NHGI  EL++ V+K+   HY+  ++ERF      
Sbjct  4     LNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEERFKEMVAS  63

Query  870   KCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEELSEL  691
             K +E  +  I+D DWEST+F+ H P SNI+E+ +  + + K M+++ E+L K+AE+L +L
Sbjct  64    KGLEAVQTEIKDFDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEKLEKLAEQLLDL  123

Query  690   MCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLLQDDQ  511
             +CENLGLE+ ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGIILL QDD+
Sbjct  124   LCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDK  183

Query  510   VPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLSIATF  331
             V GL+  KD++W+ +PP +++ I +N GDQ+E+++NG YKS  HRV+AQ DGNR+SIA+F
Sbjct  184   VSGLQLLKDDKWIDVPPMRHS-IVINLGDQLEVITNGKYKSVEHRVIAQPDGNRMSIASF  242

Query  330   YNPASDAMISPAPKLL-------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMKKLQAN  178
             YNP SDA+I PAP+LL       YP  V F+DY+K Y   KF  K PRFEAMK ++  
Sbjct  243   YNPGSDAVIYPAPELLEKENKVIYPKFV-FEDYMKLYAGLKFQAKEPRFEAMKAVETT  299



>gb|ACT22772.1| ACC oxidase 2 [Lepidium sativum]
Length=320

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 215/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ P++D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+ ++KM   HY
Sbjct  1     MEKNMKFPIVDMSKLNGEERDQTMALINDACENWGFFEIVNHGLPHDLMDKIEKMTKDHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F  +   K ++N +  + D DWEST+++ H P SN+N++ +  + +   M+ +
Sbjct  61    KTCQEQKFNETLKSKGLDNLETEVEDVDWESTFYVRHLPQSNLNDISDISDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
               +L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GRRLENLAEDLLDLLCENLGLEKGYLKKVFRGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N  I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NYSIVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP SDA I+PA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQKEGNRMSIASFYNPGSDAEIAPATSLVGKDSEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNASA  307



>ref|XP_002302856.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|ABK95924.1| unknown [Populus trichocarpa]
 gb|EEE82129.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
Length=311

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 213/312 (68%), Gaps = 13/312 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME PVI+  KL GEER+ TM+ +  ACE WGFF + NHGI  E ++ V++M  +HY+  +
Sbjct  1     MEFPVINMEKLNGEERAATMEKIRDACENWGFFELLNHGIAHEFLDTVERMAKEHYKKGM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF      K +   +  I+D DWEST+ + H P SNI E+ +  + + K M+++  +L
Sbjct  61    EQRFKELVASKALVGVQTEIKDMDWESTFHLRHLPMSNIAEIPDLDDEYRKVMKEFALKL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGE-SIGTKVAIYPECPNPELVRGLREHTDA  544
              K+AEEL +L+CENLGLEK ++K +F GS G  + GTKV+ YP CP P+LV+GLR HTDA
Sbjct  121   EKLAEELLDLLCENLGLEKGYLKRAFCGSSGSPNFGTKVSNYPPCPKPDLVKGLRAHTDA  180

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GGIILL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ
Sbjct  181   GGIILLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIAQ  239

Query  363   NDGNRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKG  214
              DG R+SIA+FYNP +DA+I PAP L          LYP  V F DY+K Y   KF  K 
Sbjct  240   TDGTRMSIASFYNPGNDAVIYPAPALVEKEAEEKKHLYPKFV-FDDYMKLYAGLKFQAKE  298

Query  213   PRFEAMKKLQAN  178
             PRFEAMK ++ N
Sbjct  299   PRFEAMKAVETN  310



>gb|AFK45850.1| unknown [Lotus japonicus]
Length=318

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 211/301 (70%), Gaps = 10/301 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D SKL  EER  TM+L+   CE WGFF + NH I  E M+ V+++  +HY+  +++R
Sbjct  5     PVVDMSKLNTEERVATMELIKDVCENWGFFELVNHEISTEFMDTVERLTKEHYKRFMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P+SNI+E+ +   ++ K M+++  +L K+
Sbjct  65    FKEMVATKGLETVQSEIDDLDWESTFFLRHLPSSNISEVPDLDEDYRKVMKEFAVKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AENLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+S+A+FYNP  DA+ISPAP L        +YP  V F+DY+K Y   KF  K PRFE M
Sbjct  244   RMSLASFYNPGDDAVISPAPSLVKEDETSQVYPKFV-FEDYMKLYLGVKFQAKEPRFEVM  302

Query  195   K  193
             K
Sbjct  303   K  303



>ref|NP_001242835.1| uncharacterized protein LOC100819184 [Glycine max]
 gb|ACU20224.1| unknown [Glycine max]
Length=307

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 216/305 (71%), Gaps = 15/305 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   + GEER   +  +  AC+ WGFF + NHGI  EL++ V+++  +HY   +++R
Sbjct  5     PVINLENINGEERKAILDQIEDACQNWGFFELVNHGIPLELLDTVERLTKEHYRKCMEKR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E++   ++D DWEST+F+ H PTSNI+E+ +    +  TM+++ ++L K+
Sbjct  65    FKEAVSSKGLEDE---VKDMDWESTFFLRHLPTSNISEITDLSQEYRDTMKEFAQKLEKL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GS+G + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  122   AEELLDLLCENLGLEKGYLKNAFYGSRGPNFGTKVANYPACPKPELVKGLRAHTDAGGII  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  K+ QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ +G 
Sbjct  182   LLLQDDKVSGLQLLKNGQWVDVPPMRHS-IVVNLGDQIEVITNGRYKSVEHRVIAQTNGT  240

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNPASDA+I PAP LL          YP  V F+DY+K Y + KF  K PRFE
Sbjct  241   RMSVASFYNPASDALIHPAPVLLEQKAEDTEQVYPKFV-FEDYMKLYATLKFQPKEPRFE  299

Query  201   AMKKL  187
             AMK +
Sbjct  300   AMKAV  304



>gb|AAD28196.2|AF115261_1 1-aminocyclopropane-1-carboxylate oxidase [Trifolium repens]
 gb|ABB97396.1| ACC oxidase [Trifolium repens]
Length=318

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 215/307 (70%), Gaps = 11/307 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P++D  KL  EER  TM+ +  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIVDMGKLNTEERKSTMEKIKDACENWGFFELVNHGISIEMMDKVEKLTKDHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +  +++ K M+++ ++L  +
Sbjct  65    FKEMVSSKGLECVQSEINDLDWESTFFLRHLPFSNISEIPDLDDDYRKIMKEFAQKLENL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMHRVIAQTDGA  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+S+A+FYNP+ DA+ISPAP LL         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSLASFYNPSDDAIISPAPTLLKENETTSEIYPKFV-FDDYMKLYMGLKFQAKEPRFEA  302

Query  198   MKKLQAN  178
             M K  ++
Sbjct  303   MMKAMSS  309



>ref|XP_004172177.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase 3-like [Cucumis sativus]
Length=320

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 214/310 (69%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             EM+ PVI+ + L GE R   +  ++ ACE WGFF + NHGI  ELM+ V+KM  +HY   
Sbjct  2     EMDFPVINMNNLNGESRVSVLNQINDACETWGFFELVNHGIPHELMDKVEKMTKEHYRKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +++ +  I D DWEST+F+ H P SN++E+ +    + K M+++  +
Sbjct  62    MEQRFXEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFAAE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AEE+  L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP PEL++GLR HTDA
Sbjct  122   LEKLAEEILNLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GG+ILL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  182   GGLILLFQDDKVSGLQLLKDGKWVDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGP  211
              DGNR+SIA+FYNP +DA+I PAP L         LYP  V F DY+K Y   KF  K P
Sbjct  241   EDGNRMSIASFYNPGNDAVIYPAPALVEGEQEKTKLYPKFV-FDDYMKLYMGLKFQAKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKAMES  309



>ref|XP_008805606.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Phoenix 
dactylifera]
 ref|XP_008805607.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Phoenix 
dactylifera]
Length=317

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 213/309 (69%), Gaps = 17/309 (6%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  K+ G +R   M++L  ACE WGFF + NHGI  ELM+ V+++  +HYE   ++R
Sbjct  5     PVINMDKVEGNDREAGMEILREACENWGFFEILNHGIPHELMDKVERLTKEHYEKCREQR  64

Query  891   F--YASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLM  718
             F  +AS   K +E  K    D DWEST+++ H P SNI+E+ +  + + K M ++  +L 
Sbjct  65    FREFAS---KTLEGAKSDANDVDWESTFYVRHLPESNISEIHDLDDQYRKAMREFALELE  121

Query  717   KVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGG  538
             K+AE L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L+ GLR HTDAGG
Sbjct  122   KLAERLLDLLCENLGLEKGYLKKAFRGSKGPTFGTKVSSYPPCPRPDLINGLRAHTDAGG  181

Query  537   IILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQND  358
             IILL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ D
Sbjct  182   IILLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNIGDQLEVITNGRYKSVMHRVVAQTD  240

Query  357   GNRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPR  208
             GNR+SIA+FYNP SDA+I PAP L          +YP  V F+DY+K Y   KF  K PR
Sbjct  241   GNRMSIASFYNPGSDAVIFPAPALVEKEAEKKKEVYPRFV-FEDYMKLYVGQKFQAKEPR  299

Query  207   FEAMKKLQA  181
             FEA K ++ 
Sbjct  300   FEAFKAMET  308



>ref|XP_010035512.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46934.1| hypothetical protein EUGRSUZ_K00749 [Eucalyptus grandis]
Length=320

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 214/309 (69%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GE+R+ TM  ++  CE WGFF + NHGI  E M+ V++M   HY   + +R
Sbjct  5     PVINMENLNGEKRAITMDKINDVCENWGFFELVNHGIPPEFMDTVERMTKGHYRKCMDQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +EN +  + D DWEST+ + H P SNI+++ +  +++ K M+++  +L K+
Sbjct  65    FRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAVKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GS G + GTKV+ YP CP PEL++GLR HTDAGG+I
Sbjct  125   AEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPKPELIKGLRAHTDAGGVI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQIEVITNGKYKSVLHRVVAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL-----------YPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+SIA+FYNP SDA I PAP L+           YP  V F+DY+K Y + KF  K PRF
Sbjct  244   RMSIASFYNPGSDAAIYPAPALMESKAEEASKAAYPKFV-FEDYMKLYAALKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             +AMK ++++
Sbjct  303   QAMKAMESS  311



>ref|XP_009791489.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
sylvestris]
Length=320

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 215/304 (71%), Gaps = 12/304 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVID   L  E+R+ TM+ +  ACE WGF  + NHGI  ELM+ V+K+  +HY+  +++R
Sbjct  5     PVIDMEMLNTEQRAATMEKIKDACENWGFLELVNHGISHELMDTVEKLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+++ +  +++ K M+++ ++L K+
Sbjct  65    FKEMVANKGLEAVQAEIDDLDWESTFFLKHLPVSNISDVPDLVDDYRKVMKEFAQKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLE+ ++K++F G+KG + GTKVA YP CP PEL++GLR HTDAGGII
Sbjct  125   AEDLLDLLCENLGLEQGYLKKAFYGTKGPTFGTKVANYPPCPKPELIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +W+ +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGKWIDVPPMRHS-IVVNIGDQLEVITNGKYKSVEHRVIAQPDGN  243

Query  351   RLSIATFYNPASDAMISPAP----------KLLYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP SDA+I PAP          KL YP  V F+DY+K Y + KF  K PRFE
Sbjct  244   RMSIASFYNPGSDAVIFPAPELADKEEKENKLKYPKFV-FEDYMKLYAALKFQAKEPRFE  302

Query  201   AMKK  190
             AM K
Sbjct  303   AMNK  306



>gb|AFI41198.1| ACC oxidase 2, partial [Arabidopsis thaliana]
Length=320

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 215/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ PV+D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+ ++KM   HY
Sbjct  1     MEKNMKFPVVDLSKLNGEERDQTMALINEACENWGFFEIVNHGLPHDLMDKIEKMTKDHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++N +  + D DWEST+++ H P SN+N++ +  + +   M+ +
Sbjct  61    KTCQEQKFNDMLKSKGLDNLETEVEDVDWESTFYVRHLPQSNLNDISDVSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEDLLDLLCENLGLEKGYLKKVFHGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS LHRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGKYKSVLHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+S+A+FYNP SDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQQEGNRMSVASFYNPGSDAEISPATSLVEKDSEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             F AMK   A
Sbjct  299   FAAMKNASA  307



>ref|NP_176428.1| 1-aminocyclopropane-1-carboxylate oxidase 2 [Arabidopsis thaliana]
 sp|Q41931.2|ACCO2_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 2; Short=ACC 
oxidase 2; Short=AtACO2 [Arabidopsis thaliana]
 gb|AAF70838.1|AC003113_5 F2401.11 [Arabidopsis thaliana]
 gb|AAK76550.1| putative ACC oxidase [Arabidopsis thaliana]
 gb|AAL32763.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13380.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91785.1| putative ACC oxidase [Arabidopsis thaliana]
 dbj|BAF02150.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33960.1| 1-aminocyclopropane-1-carboxylate oxidase 2 [Arabidopsis thaliana]
Length=320

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 215/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ PV+D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+ ++KM   HY
Sbjct  1     MEKNMKFPVVDLSKLNGEERDQTMALINEACENWGFFEIVNHGLPHDLMDKIEKMTKDHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++N +  + D DWEST+++ H P SN+N++ +  + +   M+ +
Sbjct  61    KTCQEQKFNDMLKSKGLDNLETEVEDVDWESTFYVRHLPQSNLNDISDVSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEDLLDLLCENLGLEKGYLKKVFHGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS LHRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGKYKSVLHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+S+A+FYNP SDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQQEGNRMSVASFYNPGSDAEISPATSLVEKDSEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             F AMK   A
Sbjct  299   FAAMKNASA  307



>ref|XP_009768154.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
sylvestris]
Length=319

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 214/308 (69%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G E++ TM+++  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +  + + + M+ + ++L  +
Sbjct  65    FKELVASKGLEGVQAEVTDMDWESTFFLRHLPVSNISEVPDLDDQYREVMKDFAKRLENL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K  F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQKDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PAP L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVEKEAAESKQVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++++
Sbjct  303   AMKSIESD  310



>ref|XP_003545591.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
Length=307

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 216/307 (70%), Gaps = 15/307 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GE R  T+  +  AC+ WGFF + NHGI  EL++ V+++  +HY   +++R
Sbjct  5     PVINLENLNGEARKATLHQIEDACQNWGFFELVNHGIPLELLDTVERLTKEHYRKCMEKR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E++   ++D DWEST+F+ H PTSNI+E+ +    +   M+++ ++L K+
Sbjct  65    FKEAVSSKGLEDE---VKDMDWESTFFLRHLPTSNISEIPDLSQEYRDAMKEFAQKLEKL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GS+G + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  122   AEELLDLLCENLGLEKGYLKNAFYGSRGPNFGTKVANYPACPKPELVKGLRAHTDAGGII  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  K+ QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ +G 
Sbjct  182   LLLQDDKVSGLQLLKNGQWVDVPPMRHS-IVVNLGDQIEVITNGRYKSVEHRVIAQTNGT  240

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNPASDA+I PAP LL          YP  V F+DY+K Y + KF  K PRFE
Sbjct  241   RMSVASFYNPASDALIYPAPALLEQKAEDTEQVYPKFV-FEDYMKLYATLKFQPKEPRFE  299

Query  201   AMKKLQA  181
             AMK + +
Sbjct  300   AMKAVNS  306



>gb|AAB97368.1| 1-aminocyclopropane-1-carboxylate oxidase [Rumex palustris]
Length=314

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 214/305 (70%), Gaps = 11/305 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             ME P+I+  K+ G+ER  TM ++  ACE WGFF + NHGI  E+M+ V+++  +HY+ S+
Sbjct  1     MEFPIINLEKVNGDERKATMDMIKDACENWGFFELVNHGIPVEVMDTVERLTKEHYKKSM  60

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             ++RF        + +    + D DWE T+ + H P SNI+EL +  + + K M+ +  +L
Sbjct  61    EQRFKELVASNGLVDASAEVNDVDWECTFHLKHLPDSNISELPDLEDKYRKVMKDFALRL  120

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AE+L +L+CENL LEK ++KE+F G++G + GTKVA YP CP PEL++GLR HTDAG
Sbjct  121   EKLAEDLLDLLCENLALEKGYLKEAFYGARGPTFGTKVANYPPCPKPELIKGLRAHTDAG  180

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD++W+ +PP +++ I VN GDQ+E+++NG YKS LHRV+AQ 
Sbjct  181   GIILLFQDDRVSGLQLLKDDEWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVLHRVIAQT  239

Query  360   DGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPR  208
             +G R+SIA+FYNP SDA+I PAP+L         +YP  V F+DY+K Y + KF  K PR
Sbjct  240   EGTRMSIASFYNPGSDAVIYPAPELVEDAQEKTQVYPKFV-FEDYMKLYSALKFQAKEPR  298

Query  207   FEAMK  193
             FEAMK
Sbjct  299   FEAMK  303



>ref|XP_004134785.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Cucumis 
sativus]
 gb|KGN49070.1| ACC oxidase 2 [Cucumis sativus]
Length=320

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 214/310 (69%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             EM+ PVI+ + L GE R   +  ++ ACE WGFF + NHGI  ELM+ V+KM  +HY   
Sbjct  2     EMDFPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGIPHELMDKVEKMTKEHYRKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +++ +  I D DWEST+F+ H P SN++E+ +    + K M+++  +
Sbjct  62    MEQRFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFAAE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AEE+  L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP PEL++GLR HTDA
Sbjct  122   LEKLAEEILNLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GG+ILL QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  182   GGLILLFQDDKVSGLQLLKDGKWVDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGP  211
              DGNR+SIA+FYNP +DA+I PAP L         LYP  V F DY+K Y   KF  K P
Sbjct  241   EDGNRMSIASFYNPGNDAVIYPAPALVEGEQEKTKLYPKFV-FDDYMKLYMGLKFQAKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKAMES  309



>gb|AAC27484.1| ACC oxidase [Arabidopsis thaliana]
Length=320

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 215/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ PV+D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+ ++KM   HY
Sbjct  1     MEKNMKFPVVDLSKLNGEERDQTMALINEACENWGFFEIVNHGLPHDLMDKIEKMTKDHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++N +  + D DWEST+++ H P SN+N++ +  + +   M+ +
Sbjct  61    KTCQEQKFNDMLKSKGLDNLETEVEDVDWESTFYVRHLPQSNLNDISDVSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AE+L +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEDLLDLLCENLGLEKGYLKKVFHGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS LHRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGKYKSVLHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+S+A+FYNP SDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQQEGNRMSVASFYNPGSDADISPATSLVEKDSEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             F AMK   A
Sbjct  299   FAAMKNASA  307



>ref|NP_001241899.1| 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine max]
 gb|AEI54340.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine max]
Length=318

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/302 (50%), Positives = 212/302 (70%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER+  M+++  ACE WGFF + NHGI  ELM+ V+++  +HY+ ++++R
Sbjct  5     PVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN+++  +    + KTM+++  +L K+
Sbjct  65    FKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEEYRKTMKKFALELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS + RV+AQ D  
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMRRVIAQADDT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAVISPAPALVKELDETSQVYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>emb|CAD21844.1| ACC oxidase 1 [Fagus sylvatica]
Length=319

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 216/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEER  TM+ +  ACE WGFF + NHG+  EL++ V+++  +HY+  +++R
Sbjct  5     PVINLEKLNGEERGTTMEKIKDACENWGFFELVNHGLPHELLDTVERLAKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      + +E  +  + D DWEST+ + H P SNI+E+ +  + + K M+++  +L K+
Sbjct  65    FKELVTAQGLEGVQTEVNDLDWESTFHVRHLPQSNISEIPDLEDEYRKVMKEFALKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ +GN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVLHRVIAQTNGN  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP  DA+I PA  L          +YP  V F+DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGGDAVIYPATALVEKEAEEKNNVYPKFV-FEDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK +++N
Sbjct  303   AMKAVESN  310



>gb|AAA32981.1| amino-cyclopropane-carboxylic acid oxidase [Brassica napus]
Length=321

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 217/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PVID SKL GEER +TM L+  AC+ WGFF + NHGI  +LM+N+++M  +HY
Sbjct  1     MEKNIKFPVIDLSKLNGEERDQTMALIDDACQNWGFFELLNHGIPYDLMDNIERMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +  ++ +F      K ++  +  + D DWEST+F+ H P +N+ ++ N    +   M+ +
Sbjct  61    KQFMEHKFKEMLRSKGLDTLETEVEDIDWESTFFLHHLPQTNLYDIPNMSEQYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L K+AEEL +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CPNPE+++GLR H
Sbjct  121   GKRLEKLAEELLDLLCENLGLEKGYLKKVFRGTKGPTFGTKVSNYPPCPNPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGG+ILL QDD+V GL+  KD  WV +PP K++ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGLILLFQDDKVSGLQLLKDGDWVDVPPLKHS-IVINLGDQLEVITNGWYKSIMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP SDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   MTQKEGNRMSIASFYNPGSDAEISPAHSLVDKESEYPSFV-FDDYMKLYSGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             FEAMK   A
Sbjct  299   FEAMKNAAA  307



>sp|P54847.1|ACCO3_CUCME RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 3; Short=ACC 
oxidase 3; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Cucumis melo]
 emb|CAA64799.1| ACC oxidase [Cucumis melo]
Length=320

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 215/310 (69%), Gaps = 11/310 (4%)
 Frame = -2

Query  1083  EMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDS  904
             EM+ PVI+ + L GE R   +  ++ ACE WGFF + NHGI  ELM+ V+K+  +HY   
Sbjct  2     EMDFPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGISHELMDKVEKLTKEHYRKC  61

Query  903   LKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQ  724
             +++RF      K +++ +  I D DWEST+F+ H P SN++E+ +    + K M+++ ++
Sbjct  62    MEQRFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFADE  121

Query  723   LMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDA  544
             L K+AEE+ +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP PEL++GLR HTDA
Sbjct  122   LEKLAEEVLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDA  181

Query  543   GGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQ  364
             GG+ILL QDD+V GL   KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ
Sbjct  182   GGLILLFQDDKVSGLHVLKDGKWVDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVIAQ  240

Query  363   NDGNRLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGP  211
              DGNR+SIA+FYNP +DA+I PAP L         LYP  V F DY+K Y   KF  K P
Sbjct  241   EDGNRMSIASFYNPGNDAVIYPAPALVEGEQEKTKLYPKFV-FDDYMKLYVGLKFQAKEP  299

Query  210   RFEAMKKLQA  181
             RFEAMK +++
Sbjct  300   RFEAMKAMES  309



>ref|XP_009148622.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Brassica 
rapa]
Length=320

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 217/305 (71%), Gaps = 7/305 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PVID SKL GEER +TM L+  AC+ WGFF + NHGI  +LM+N+++M  +HY
Sbjct  1     MEKNIKFPVIDLSKLNGEERDQTMALIDDACQNWGFFELLNHGIPYDLMDNIERMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +  ++++F      K ++  +  + D DWEST+F+ H P +N+ ++ N  + +   M+ +
Sbjct  61    KKFMEQKFKEMLRSKGLDTLETEVEDIDWESTFFLHHLPQTNLYDIPNMSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AEEL +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CPNPE+++GLR H
Sbjct  121   GKRLENLAEELLDLLCENLGLEKGYLKKVFRGTKGPTFGTKVSNYPPCPNPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGG+ILL QDD+V GL+  KD  WV +PP K++ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGLILLFQDDKVSGLQLLKDGDWVDVPPLKHS-IVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP SDA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   MTQKEGNRMSIASFYNPGSDAEISPAQSLVDKESEYPSFV-FDDYMKLYSGVKFQPKEPR  298

Query  207   FEAMK  193
             FEAMK
Sbjct  299   FEAMK  303



>emb|CAA57285.1| ACC oxidase [Brassica oleracea]
Length=321

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/311 (48%), Positives = 220/311 (71%), Gaps = 8/311 (3%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PV+D SKL GEER +TM L+  AC+ WGFF + NHGI  +LM+N+++M  +HY
Sbjct  1     MEKNIKFPVVDLSKLNGEERDQTMALVDDACQNWGFFELLNHGIPYDLMDNIERMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +  ++++F      K ++  +  + + DWEST+F+ H P +N+ ++ +  + +   M+ +
Sbjct  61    KKFMEQKFKEMLRSKNLDTLETEVENVDWESTFFLHHLPQTNLYDIPDMSDEYRAAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AEEL +L+CENLGLEK ++K+ FSG+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEELLDLLCENLGLEKGYLKKVFSGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGG+ILL QDD+V GL+  KD  WV +PP K++ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGLILLFQDDKVSGLQLLKDGVWVDVPPLKHS-IVINLGDQLEVITNGKYKSIMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGP  211
             + Q +GNR+SIA+FYNP SDA ISPAP L+      YP+ V F DY+K Y   KF  K P
Sbjct  240   MTQKEGNRMSIASFYNPGSDAEISPAPSLVEKDSDEYPSFV-FDDYMKLYAGVKFQPKEP  298

Query  210   RFEAMKKLQAN  178
             RFEAMK + A 
Sbjct  299   RFEAMKNVAAT  309



>emb|CDY34603.1| BnaC08g41620D [Brassica napus]
Length=321

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/311 (48%), Positives = 220/311 (71%), Gaps = 8/311 (3%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ ++ PV+D SKL GEER +TM L+  AC+ WGFF + NHGI  +LM+N+++M  +HY
Sbjct  1     MEKNIKFPVVDLSKLNGEERDQTMALVDDACQNWGFFELLNHGIPYDLMDNIERMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +  ++++F      K ++  +  + + DWEST+F+ H P +N+ ++ +  + +   M+ +
Sbjct  61    KKFMEQKFKEMLRSKNLDTLETEVENVDWESTFFLHHLPQTNLYDIPDMSDEYRAAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AEEL +L+CENLGLEK ++K+ FSG+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEELLDLLCENLGLEKGYLKKVFSGTKGPTFGTKVSNYPPCPKPEIIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGG+ILL QDD+V GL+  KD  WV +PP K++ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGLILLFQDDKVSGLQLLKDGVWVDVPPLKHS-IVINLGDQLEVITNGKYKSIMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL------YPNNVCFQDYLKHYGSTKFGDKGP  211
             + Q +GNR+SIA+FYNP SDA ISPAP L+      YP+ V F DY+K Y   KF  K P
Sbjct  240   MTQKEGNRMSIASFYNPGSDAEISPAPSLVEKDSDEYPSFV-FDDYMKLYAGVKFQPKEP  298

Query  210   RFEAMKKLQAN  178
             RFEAMK + A 
Sbjct  299   RFEAMKNVAAT  309



>ref|XP_009630256.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
tomentosiformis]
Length=319

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 212/308 (69%), Gaps = 12/308 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  KL G ER+ TM+++  ACE WGFF + NHGI  E+M+ V+K+   HY+  +++R
Sbjct  5     PIINLEKLNGSERAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +  + + + M  + ++L  +
Sbjct  65    FKELVASKGLEGVQAEVTDMDWESTFFLRHLPVSNISEVPDLDDQYREVMRDFAKRLENL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL  L+CENLGLEK ++K  F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLYLLCENLGLEKGYLKNVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVVAQKDGT  243

Query  351   RLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNP SDA+I PAP L          +YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVEKEAAESKQVYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   AMKKLQAN  178
             AMK ++++
Sbjct  303   AMKSIESD  310



>ref|XP_003545587.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
Length=307

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 215/305 (70%), Gaps = 15/305 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GEER  T+  +  AC+ WGFF + +HGI  EL++ V+++  +HY   +++R
Sbjct  5     PVINLENLNGEERKATLNQIEDACQNWGFFELVSHGIPLELLDTVERLTKEHYRKCMEKR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E +   ++D DWEST+F+ H PTSNI+E+ +    +   M+++ ++L K+
Sbjct  65    FKEAVSSKGLEAE---VKDMDWESTFFLRHLPTSNISEIPDLSQEYRDAMKEFAQKLEKL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GS+G + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  122   AEELLDLLCENLGLEKGYLKNAFYGSRGPNFGTKVANYPACPKPELVKGLRAHTDAGGII  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  K+ QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ +G 
Sbjct  182   LLLQDDKVSGLQLLKNGQWVDVPPMRHS-IVVNLGDQIEVITNGRYKSVEHRVIAQTNGT  240

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNPASDA+I PAP LL          YP  V F+DY+K Y + KF  K PRFE
Sbjct  241   RMSVASFYNPASDALIYPAPVLLEQKAEDTEQVYPKFV-FEDYMKLYATLKFQPKEPRFE  299

Query  201   AMKKL  187
             AMK +
Sbjct  300   AMKAI  304



>ref|XP_004293334.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Fragaria 
vesca subsp. vesca]
Length=312

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 214/306 (70%), Gaps = 11/306 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV++  +L GE+R+ TM+ ++ ACE WGFF + NHGI  ELM+ V+K+  +HY   +++R
Sbjct  5     PVVNMEQLNGEKRAATMEKINDACENWGFFELMNHGISHELMDKVEKLTKEHYRKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E     I D DWEST+F+ H P SNI+++ +   ++ + M+++  +L K+
Sbjct  65    FKEMVASKGLEAVNSEIEDLDWESTFFLRHLPFSNISQVPDLDEDYREAMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+LV+GLR HTDAGG+I
Sbjct  125   AEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLVKGLRAHTDAGGVI  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP  ++ I +N GDQ+E+++NG YKS +HRVL Q DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPM-HHSIVINLGDQLEVITNGKYKSVMHRVLVQPDGN  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA+I PAP +L         YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAVICPAPAMLEKQTEECPTYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQA  181
             MK +++
Sbjct  303   MKAMES  308



>dbj|BAE20198.1| aco [Tulipa gesneriana]
Length=311

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 219/308 (71%), Gaps = 15/308 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL G ERSK M++LH AC  WGFF + NHGI  EL++ V+K+   HY+  ++ER
Sbjct  5     PVINLEKLEGGERSKVMEVLHDACANWGFFELLNHGISHELLDKVEKLTKGHYKKCMEER  64

Query  891   F--YASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLM  718
             F  +AS  ++ V   K  + + DWEST+++ H PTSN++E+ +  + + +TM++++  L 
Sbjct  65    FREFASKTLQDV--SKVDVDNLDWESTFYLRHIPTSNMSEIPDLSDEYRETMKEFVLSLE  122

Query  717   KVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGG  538
             ++AE+L +L+CENLGLEK ++K++FSGSKG + GTKV+ YP CP PEL++GLR HTDAGG
Sbjct  123   ELAEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPKPELIKGLRAHTDAGG  182

Query  537   IILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQND  358
             +ILL QDD V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS LHRV+AQ +
Sbjct  183   LILLFQDDMVSGLQLLKDGEWVDVPPI-HHSIVINLGDQIEVITNGKYKSVLHRVVAQPE  241

Query  357   GNRLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRF  205
             G R+SIA+FYNP SDA+I PA  LL         YP  V F+DY+K Y   KF  K PRF
Sbjct  242   GTRMSIASFYNPGSDAVIYPATTLLEEAKKKSEVYPKFV-FEDYMKLYAIQKFQAKEPRF  300

Query  204   EAMKKLQA  181
             E MK +++
Sbjct  301   ETMKNMES  308



>sp|O48882.1|ACCO2_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 2; Short=ACC 
oxidase 2; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Malus domestica]
 gb|AAB94031.1| 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=330

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 213/302 (71%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D   + GEER+ T++ ++ ACE WGFF + NHGI  EL++ V+KM   HY+ ++++R
Sbjct  5     PVVDMDLINGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I   DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+
Sbjct  65    FKEMVAAKGLEAVQSEIHYLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEKLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +W+ +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWMDVPPV-HHSIVINLGDQIEVITNGKYKSIMHRVIAQSDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA ISPAP LL         YP    F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAFISPAPALLEEKSEVSPTYP-KFLFDDYMKLYSGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>gb|AAN86821.1| 1-aminocyclopropane-1-carboxylate oxidase 2 [Betula pendula]
Length=315

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 213/308 (69%), Gaps = 14/308 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL G+ER  TM  ++ ACE WGFF + NH I  E ++N++++  +HY+  L++R
Sbjct  5     PVINMEKLNGDERGATMAKINDACENWGFFELVNHSIPHEFLDNLERLAKEHYKKCLEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  K  + D DWEST+ + H P SNI+E+ +  + +   ++++  +L K+
Sbjct  65    FKEMVASKALEGAKAEVNDMDWESTFHVRHLPQSNISEIPDLEDEYRNVLKEFALKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GS G + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNAFYGSNGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD QW+ +PP +++ I +N GDQ+E+++NG YKS LHRV+AQ DGN
Sbjct  185   LLFQDDKVSGLQLLKDGQWIDVPPMRHS-IVINLGDQLEVITNGKYKSILHRVIAQTDGN  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP SDA+I PAP +         +YP  V F+DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGSDAVIYPAPSMVEKETEEKNVYPKFV-FEDYMKLYAGLKFQAKEPRFEA  302

Query  198   MKKLQANG  175
             MK   ANG
Sbjct  303   MK---ANG  307



>gb|KHN44760.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=307

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 214/305 (70%), Gaps = 15/305 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L GEER  T+  +  AC+ WGFF + NHGI  EL++ V+++  +HY   +++R
Sbjct  5     PVINLENLNGEERKATLNQIEDACQNWGFFELVNHGIPLELLDTVERLTKEHYRKCMEKR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F  +   K +E +   ++D DWEST+F+ H PTSNI+E+ +    +   M+++ ++  K+
Sbjct  65    FKEAVSSKGLEAE---VKDMDWESTFFLRHLPTSNISEIPDLSQEYRDAMKEFAQKSEKL  121

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GS+G + GTKVA YP CP PELV+GLR HTDAGGII
Sbjct  122   AEELLDLLCENLGLEKGYLKNAFYGSRGPNFGTKVANYPACPKPELVKGLRAHTDAGGII  181

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LLLQDD+V GL+  K+ QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ +G 
Sbjct  182   LLLQDDKVSGLQLLKNGQWVDVPPMRHS-IVVNLGDQIEVITNGRYKSVEHRVIAQTNGT  240

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+S+A+FYNPASDA+I PAP LL          YP  V F+DY+K Y + KF  K PRFE
Sbjct  241   RMSVASFYNPASDALIYPAPALLEQKAEDTEQVYPKFV-FEDYMKLYATLKFQPKEPRFE  299

Query  201   AMKKL  187
             AMK +
Sbjct  300   AMKAI  304



>dbj|BAF33502.1| ACC oxidase [Phelipanche ramosa]
Length=318

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 213/305 (70%), Gaps = 11/305 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+  KL GEERS TM+++  ACE WGFF + NHGI  E M+ V+++  +HY+  +++R
Sbjct  5     PVINMEKLNGEERSATMEMIKDACENWGFFELVNHGITAEFMDTVERLTKEHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +  + + K M+++  QL K+
Sbjct  65    FKEMVTSKGLEAIQSEITDLDWESTFFLRHLPVSNISEIPDLEDEYRKVMKEFAGQLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F G+ G + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGTTGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD V GL+  KD +WV +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDMVSGLQLLKDGEWVDVPPMRHS-IVINIGDQIEVITNGKYKSVMHRVIAQTDGT  243

Query  351   -RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
              R+SIA+FYNP +DA+I PAP L        LYP  V F+DY++ Y   KF  K PRFEA
Sbjct  244   GRMSIASFYNPGNDAVIYPAPALVNKAENNGLYPKFV-FEDYMQLYNGVKFQAKKPRFEA  302

Query  198   MKKLQ  184
              K ++
Sbjct  303   FKNME  307



>gb|AGE15421.1| 1-aminocyclopropane-1-carboxylate oxidase [Hosta ventricosa]
Length=318

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 218/313 (70%), Gaps = 17/313 (5%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I+  +L GEE++  M +L  ACE WGFF + NHGI  ELM+ V+ M   HY+  +++R
Sbjct  5     PIINMVQLDGEEKAVAMDVLRDACENWGFFEILNHGISHELMDKVESMTKGHYKKGMEQR  64

Query  891   F--YASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLM  718
             F  +AS  ++  E    S  + DWEST+F+ H P SNI+ + +  + + K M+++  +L 
Sbjct  65    FKEFASQALEKGEELDTS--NIDWESTFFLRHLPESNISRVPDLDDEYRKVMKEFATELE  122

Query  717   KVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGG  538
             K+AE L +L+CENLGLEK ++K +F+GSKG + GTKV+ YP CP PEL +GLR HTDAGG
Sbjct  123   KLAERLLDLLCENLGLEKGYLKNAFNGSKGPTFGTKVSNYPACPRPELFKGLRAHTDAGG  182

Query  537   IILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQND  358
             IILL QDD+V GL+  KD QWV +PP++++ I VN GDQ+E+++NG YKS +HRV+AQ D
Sbjct  183   IILLFQDDKVSGLQLEKDGQWVDVPPTRHS-IVVNIGDQLEVITNGKYKSVMHRVIAQTD  241

Query  357   GNRLSIATFYNPASDAMISPAPKL----------LYPNNVCFQDYLKHYGSTKFGDKGPR  208
             GNR+SIA+FYNP+SDA+I PAP L          +YP  V F+DY+K Y   KF  K PR
Sbjct  242   GNRMSIASFYNPSSDAVIYPAPALVEKEEEKEAEIYPKFV-FEDYMKLYAVQKFQAKEPR  300

Query  207   FEAMKKLQA-NGH  172
             FE MK ++A  GH
Sbjct  301   FETMKAMEAVTGH  313



>ref|XP_002888029.1| hypothetical protein ARALYDRAFT_475105 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64288.1| hypothetical protein ARALYDRAFT_475105 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 216/309 (70%), Gaps = 7/309 (2%)
 Frame = -2

Query  1092  LDREMEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHY  913
             +++ M+ PV+D SKL GEER +TM L++ ACE WGFF + NHG+  +LM+ ++KM  +HY
Sbjct  1     MEKNMKFPVVDLSKLNGEERDQTMALINEACENWGFFEIVNHGLPHDLMDKIEKMTKEHY  60

Query  912   EDSLKERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQY  733
             +   +++F      K ++N +  + D DWEST+++ H P SN++++ +  + +   M+ +
Sbjct  61    KTCQEQKFNDMLKSKGLDNLQTEVEDIDWESTFYVRHLPQSNLSDISDVSDEYRTAMKDF  120

Query  732   IEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREH  553
              ++L  +AEEL +L+CENLGLEK ++K+ F G+KG + GTKV+ YP CP PE+++GLR H
Sbjct  121   GKRLENLAEELLDLLCENLGLEKGYLKKVFHGTKGPTFGTKVSNYPPCPKPEMIKGLRAH  180

Query  552   TDAGGIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRV  373
             TDAGGIILL QDD+V GL+  KD  W+ +PP  N+ I +N GDQ+E+++NG YKS +HRV
Sbjct  181   TDAGGIILLFQDDKVSGLQLLKDGDWIDVPPL-NHSIVINLGDQLEVITNGKYKSVMHRV  239

Query  372   LAQNDGNRLSIATFYNPASDAMISPAPKLL-----YPNNVCFQDYLKHYGSTKFGDKGPR  208
             + Q +GNR+SIA+FYNP +DA ISPA  L+     YP+ V F DY+K Y   KF  K PR
Sbjct  240   VTQQEGNRMSIASFYNPGNDAEISPATSLVEKDTEYPSFV-FDDYMKLYAGVKFQPKEPR  298

Query  207   FEAMKKLQA  181
             F AMK   A
Sbjct  299   FAAMKNASA  307



>gb|AFJ75134.1| ACC oxidase, partial [Malus domestica]
Length=301

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 214/299 (72%), Gaps = 11/299 (4%)
 Frame = -2

Query  1062  DFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKERFYA  883
             D S + GEER+ T++ ++ ACE WGFF + NHG+  EL++ V+KM   HY+ ++++RF  
Sbjct  1     DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  882   SDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKVAEE  703
                 K +++ +  I D DWEST+F+ H P+SNI+E+ +   ++ KTM+++  +L K+AE+
Sbjct  61    MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKLAEK  120

Query  702   LSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGIILLL  523
             L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR H+DAGGIILL 
Sbjct  121   LLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHSDAGGIILLF  180

Query  522   QDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGNRLS  343
             QDD+V GL+  KD +WV +PP  ++ I +N GDQ+E+++NG YKS +HRV+AQ+DG R+S
Sbjct  181   QDDKVSGLQLLKDGEWVDVPPM-HHSIVINLGDQIEVITNGKYKSVMHRVIAQSDGTRMS  239

Query  342   IATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRFEAMK  193
             IA+FYNP +DA ISPAP +L         YP  V F DY+K Y   KF  K PRFEAMK
Sbjct  240   IASFYNPGNDAFISPAPAVLEKKTGDAPTYPKFV-FDDYMKLYSGLKFQAKEPRFEAMK  297



>ref|XP_003616884.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES99842.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=318

 Score =   322 bits (825),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 216/311 (69%), Gaps = 12/311 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSL  901
             M  P+I   KL G ER  TM+ +  ACE WGFF + NHGI  +LM+ ++++  +HY   +
Sbjct  3     MNFPIISLEKLNGVERKDTMEKIKDACENWGFFELVNHGIPHDLMDTLERLTKEHYRKCM  62

Query  900   KERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQL  721
             + RF      K ++  +  ++D DWEST+ + H P SNI+E+ +  + + K M+++  +L
Sbjct  63    EHRFKEVISSKGLDVVQTEVKDMDWESTFHVRHLPESNISEIPDLSDEYRKVMKEFSLRL  122

Query  720   MKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAG  541
              K+AEEL +L+CENLGLEK ++K++F GS+G + GTKVA YP+CPNPELV+GLR HTDAG
Sbjct  123   EKLAEELLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPQCPNPELVKGLRAHTDAG  182

Query  540   GIILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQN  361
             GIILL QDD+V GL+  KD QWV +PP +++ I VN GDQ+E+++NG YKS  HRV+AQ 
Sbjct  183   GIILLFQDDKVSGLQLLKDGQWVDVPPMRHS-IVVNLGDQLEVITNGKYKSVEHRVIAQT  241

Query  360   DGNRLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGP  211
             +G R+SIA+FYNP SDA+I PAP+LL          YP  V F++Y+K Y + KF  K P
Sbjct  242   NGTRMSIASFYNPGSDAVIYPAPELLEKQTEEKHNVYPKFV-FEEYMKIYAALKFHAKEP  300

Query  210   RFEAMKKLQAN  178
             RFEA+K+   N
Sbjct  301   RFEALKESNVN  311



>gb|AAB70884.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
Length=320

 Score =   322 bits (825),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 214/309 (69%), Gaps = 11/309 (4%)
 Frame = -2

Query  1077  EIPVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLK  898
             + PVI+  KL GE R++TM  +  ACE WGFF V NHGI  EL++ V+KM  +HY+  ++
Sbjct  3     KFPVINLEKLNGEGRAETMDKIKDACENWGFFEVLNHGIPYELLDTVEKMTKEHYKKCME  62

Query  897   ERFYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLM  718
             +RF      K ++  +  + D DWEST+F+ H P SNI+++ +  +N+ K M+++  +L 
Sbjct  63    QRFKEMVTSKGLDGVEAEVEDMDWESTFFLKHLPESNISQVPDLQDNYRKVMKEFALKLE  122

Query  717   KVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGG  538
              +AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGG
Sbjct  123   NLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPKPDLIKGLRAHTDAGG  182

Query  537   IILLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQND  358
             +ILL QDD+V GL+  KD  WV +PP  ++ I +N GDQ+E+++NG YKS  HRV+AQ+D
Sbjct  183   LILLFQDDKVSGLQLLKDGNWVDVPPM-HHSIVINLGDQLEVITNGKYKSVEHRVIAQSD  241

Query  357   GNRLSIATFYNPASDAMISPAPKLL---------YPNNVCFQDYLKHYGSTKFGDKGPRF  205
             G R+SIA+FYNP SDA+I PAP LL         YP  V F+DY+K Y   KF  K PRF
Sbjct  242   GTRMSIASFYNPGSDAVIYPAPALLAKETEEKQVYPKFV-FEDYMKLYSGLKFKAKEPRF  300

Query  204   EAMKKLQAN  178
             E MK  + N
Sbjct  301   EVMKAREDN  309



>gb|AAC48922.1| 1-aminocyclopropane-1-carboxylate oxidase homolog [Vigna radiata]
Length=308

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 210/305 (69%), Gaps = 10/305 (3%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D   L  EER  TM+ +  ACE WGFF V NHGI  ELM++V ++  +HY+  ++ER
Sbjct  1     PVVDMKNLNNEERGATMEKIKDACENWGFFEVVNHGISIELMDSVDRLTKEHYKRCMEER  60

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  I D DWEST+F+ H P SNI+E+ +  +++ K M+ +  +L K+
Sbjct  61    FKEMVASKGLECAESEINDLDWESTFFLRHLPVSNISEIPDLADDYRKVMKDFAVELEKL  120

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE + EL+CENLGLEK ++K++F GSKG + GTKV+ YP CP PEL++GLR HTDAGGII
Sbjct  121   AELVLELVCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPELIKGLRAHTDAGGII  180

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD +V GL+ FKD  W+ +PP +++ I VN GDQ+E+++NG YKS +HRV+ Q DGN
Sbjct  181   LLFQDHKVSGLQLFKDGHWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVITQTDGN  239

Query  351   RLSIATFYNPASDAMISPAPKL--------LYPNNVCFQDYLKHYGSTKFGDKGPRFEAM  196
             R+SIA+FYNP +DA+I+PA  L        +YP  V F DY+K Y   KF  K PRFEAM
Sbjct  240   RMSIASFYNPGNDAVIAPAEALVKEDESSKVYPKFV-FDDYMKLYAGLKFQAKEPRFEAM  298

Query  195   KKLQA  181
             K +  
Sbjct  299   KAIDG  303



>gb|ACU24032.1| unknown [Glycine max]
Length=318

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 212/302 (70%), Gaps = 11/302 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PV+D  KL  EER+  M+++  ACE WGFF + NHGI  ELM+ V+++  ++Y+ ++++R
Sbjct  5     PVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEYYKKTMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E+ +  I D DWEST+F+ H P SN+++  +    + KTM+++  +L K+
Sbjct  65    FKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEGYRKTMKKFALELEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AE+L +L+CENLGLEK ++K+ F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD+QW+ +PP +++ I +N GDQ+E+++NG YKS + RV+AQ D  
Sbjct  185   LLFQDDKVSGLQLLKDDQWIDVPPMRHS-IVINLGDQLEVITNGKYKSVMRRVIAQADDT  243

Query  351   RLSIATFYNPASDAMISPAPKL---------LYPNNVCFQDYLKHYGSTKFGDKGPRFEA  199
             R+SIA+FYNP  DA+ISPAP L         +YP  V F DY+K Y   KF  K PRFEA
Sbjct  244   RMSIASFYNPGDDAVISPAPALVKELDETSQVYPKFV-FDDYMKLYAGLKFQAKEPRFEA  302

Query  198   MK  193
             MK
Sbjct  303   MK  304



>gb|AAB71421.1| 1-aminocyclopropapne-1-carboxylic acid oxidase [Helianthus annuus]
Length=307

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 209/301 (69%), Gaps = 12/301 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             PVI+   L G ER  TM+ ++ ACE WGFF + NHGI  +L++ V+KM   HY+  +++R
Sbjct  5     PVINMENLNGSERGVTMEKINDACENWGFFELVNHGIPHDLLDKVEKMTKDHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  K  + D DWEST+F+ H PTSNI+E+ +  + + + M+ +  +L K+
Sbjct  65    FKEMVAAKALEGVKAEVTDMDWESTFFLRHRPTSNISEIPDLVDEYRELMKDFAGKLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K++F GSKG + GTKV+ YP CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPTPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QDD+V GL+  KD +W+ +PP +++ I +N GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDDKVSGLQLLKDGEWIDVPPMRHS-IVINLGDQIEVITNGKYKSVMHRVIAQTDGT  243

Query  351   RLSIATFYNPASDAMISPAPKLL----------YPNNVCFQDYLKHYGSTKFGDKGPRFE  202
             R+SIA+FYNP +DA+I PAP LL          YP  V F DY+K Y   KF  K PRFE
Sbjct  244   RMSIASFYNPGNDAVIYPAPTLLEKEPTEKEQSYPKFV-FDDYMKLYAGLKFQAKEPRFE  302

Query  201   A  199
             A
Sbjct  303   A  303



>gb|AFO63022.1| ACC oxidase [Hordeum vulgare]
Length=312

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 209/307 (68%), Gaps = 12/307 (4%)
 Frame = -2

Query  1080  MEIPVIDFSKLAGE--ERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYED  907
             MEIPVID   L G+  +RS+TM  LH AC+ WGFF V++HG+D  LME VK+ V  HY++
Sbjct  1     MEIPVIDLQGLDGDASQRSQTMARLHEACKDWGFFWVDSHGVDAALMEEVKRFVYAHYDE  60

Query  906   SLKERFYASDVVK----CVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTME  739
              LK+RFYASD+ K      E  K    + DWE+ YFI H P +N+ +    P    + ++
Sbjct  61    HLKDRFYASDLAKDLLLPAEESKAVSGEVDWETAYFIRHRPANNVADFPEIPPATREMLD  120

Query  738   QYIEQLMKVAEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLR  559
              YI Q++ +AE L+E M  NLGL+   +K++F+      +GTK A+YP CP P+L+ GLR
Sbjct  121   VYIGQMVSLAERLAECMSLNLGLDGGRVKDTFAPP---FVGTKFAMYPACPRPDLLWGLR  177

Query  558   EHTDAGGIILLLQDDQVPGLEFFK-DEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTL  382
              HTDAGGIILLLQDD V GLEFF+ D +WV + P+K +RIFVN GDQ+E++S G Y+S L
Sbjct  178   AHTDAGGIILLLQDDVVGGLEFFRGDREWVPVGPTKGSRIFVNLGDQLEVMSGGAYRSVL  237

Query  381   HRVLAQNDGNRLSIATFYNPASDAMISPAP--KLLYPNNVCFQDYLKHYGSTKFGDKGPR  208
             HRV A  +G RLS+ATFYNP ++A+++PAP  + +YP    F DYL +Y  TKF DK  R
Sbjct  238   HRVAAVAEGRRLSVATFYNPGAEAVVAPAPTARQVYPGPYRFGDYLDYYQGTKFADKAAR  297

Query  207   FEAMKKL  187
              +A+K+L
Sbjct  298   LQAVKEL  304



>gb|AAA33708.1| ethylene-forming enzyme [Petunia x hybrida]
 prf||1909343A ethylene-forming enzyme
Length=320

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 211/309 (68%), Gaps = 13/309 (4%)
 Frame = -2

Query  1071  PVIDFSKLAGEERSKTMKLLHHACERWGFFMVENHGIDRELMENVKKMVTQHYEDSLKER  892
             P+I   K+ G ER+ TM+++  ACE WGFF + NHGI RE+M+ V+KM   HY+  +++R
Sbjct  5     PIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKCMEQR  64

Query  891   FYASDVVKCVENKKESIRDADWESTYFIWHHPTSNINELKNFPNNFSKTMEQYIEQLMKV  712
             F      K +E  +  + D DWEST+F+ H P SNI+E+ +    + + M  + ++L K+
Sbjct  65    FKELVASKALEGVQAEVTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKRLEKL  124

Query  711   AEELSELMCENLGLEKNHIKESFSGSKGESIGTKVAIYPECPNPELVRGLREHTDAGGII  532
             AEEL +L+CENLGLEK ++K +F GSKG + GTKV+  P CP P+L++GLR HTDAGGII
Sbjct  125   AEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNLPPCPKPDLIKGLRAHTDAGGII  184

Query  531   LLLQDDQVPGLEFFKDEQWVKIPPSKNNRIFVNTGDQVEILSNGMYKSTLHRVLAQNDGN  352
             LL QD +V GL+  KD QW+ +PP +++ I VN GDQ+E+++NG YKS +HRV+AQ DG 
Sbjct  185   LLFQDVKVSGLQLLKDGQWIDVPPMRHS-IVVNLGDQLEVITNGKYKSVMHRVIAQKDGA  243

Query  351   RLSIATFYNPASDAMISPAPKL-----------LYPNNVCFQDYLKHYGSTKFGDKGPRF  205
             R+S+A+FYNP SDA+I PAP L           +YP  V F DY+K Y   KF  K PRF
Sbjct  244   RMSLASFYNPGSDAVIYPAPALVEKEEAEKNKQVYPKFV-FDDYMKLYAGLKFQAKEPRF  302

Query  204   EAMKKLQAN  178
             EAMK ++ +
Sbjct  303   EAMKAMETD  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3084040644771