BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c32038_g1_i1 len=1341 path=[1319:0-1340]

Length=1341
                                                                      Score     E

ref|XP_009777029.1|  PREDICTED: dehydration-responsive element-bi...    170   7e-46   
ref|XP_009624061.1|  PREDICTED: dehydration-responsive element-bi...    169   2e-45   
ref|XP_004228864.1|  PREDICTED: dehydration-responsive element-bi...    167   2e-45   
emb|CDP06968.1|  unnamed protein product                                167   6e-44   
ref|XP_002313656.1|  hypothetical protein POPTR_0009s14990g             164   7e-44   Populus trichocarpa [western balsam poplar]
gb|AIL00561.1|  C-repeat binding factor 2                               163   3e-43   
gb|AIL00597.1|  C-repeat binding factor 2                               163   4e-43   
gb|AIL00643.1|  C-repeat binding factor 2                               163   5e-43   
gb|AIL00570.1|  C-repeat binding factor 2                               163   5e-43   
emb|CAN79383.1|  hypothetical protein VITISV_004704                     161   6e-43   Vitis vinifera
gb|AIL00630.1|  C-repeat binding factor 2                               162   6e-43   
gb|AIL00619.1|  C-repeat binding factor 2                               162   6e-43   
gb|AIL00595.1|  C-repeat binding factor 2                               162   6e-43   
gb|AIL00569.1|  C-repeat binding factor 2                               162   6e-43   
gb|AIL00568.1|  C-repeat binding factor 2                               162   7e-43   
gb|AIL00581.1|  C-repeat binding factor 2                               162   9e-43   
gb|AIL00566.1|  C-repeat binding factor 2                               162   9e-43   
gb|ADY17812.1|  CBF2 transcription factor                               162   1e-42   
gb|AIL00644.1|  C-repeat binding factor 2                               162   1e-42   
gb|AIL00604.1|  C-repeat binding factor 2                               162   1e-42   
gb|AIL00567.1|  C-repeat binding factor 2                               162   1e-42   
gb|AAR28677.1|  CBF-like transcription factor                           162   1e-42   Vitis vinifera
gb|AIL00598.1|  C-repeat binding factor 2                               162   1e-42   
gb|AIL00580.1|  C-repeat binding factor 2                               161   1e-42   
gb|AAR28674.1|  CBF-like transcription factor                           161   2e-42   Vitis riparia [frost grape]
gb|AIL00620.1|  C-repeat binding factor 2                               161   2e-42   
gb|AIL00606.1|  C-repeat binding factor 2                               161   2e-42   
gb|AIL00587.1|  C-repeat binding factor 2                               161   2e-42   
gb|AIL00586.1|  C-repeat binding factor 2                               161   2e-42   
gb|AIL00642.1|  C-repeat binding factor 2                               161   2e-42   
gb|AIL00645.1|  C-repeat binding factor 2                               161   2e-42   
ref|XP_003539179.1|  PREDICTED: dehydration-responsive element-bi...    160   3e-42   
gb|AIL00629.1|  C-repeat binding factor 2                               160   3e-42   
gb|AIL00578.1|  C-repeat binding factor 2                               160   3e-42   
gb|AIL00577.1|  C-repeat binding factor 2                               160   3e-42   
gb|ABF61218.1|  CBF/DREB2 transcription factor                          160   3e-42   Vitis amurensis
gb|AIL00634.1|  C-repeat binding factor 2                               160   4e-42   
gb|AIL00647.1|  C-repeat binding factor 2                               160   4e-42   
ref|XP_008807522.1|  PREDICTED: dehydration-responsive element-bi...    159   4e-42   
emb|CAN75246.1|  hypothetical protein VITISV_027054                     160   5e-42   Vitis vinifera
ref|XP_002267961.1|  PREDICTED: dehydration-responsive element-bi...    159   5e-42   Vitis vinifera
gb|AIL00635.1|  C-repeat binding factor 2                               160   5e-42   
ref|XP_011090115.1|  PREDICTED: dehydration-responsive element-bi...    157   6e-42   
gb|AIL00637.1|  C-repeat binding factor 2                               160   6e-42   
gb|AIL00640.1|  C-repeat binding factor 2                               160   7e-42   
gb|AIL00608.1|  C-repeat binding factor 2                               159   8e-42   
gb|AIL00632.1|  C-repeat binding factor 2                               159   8e-42   
gb|AIL00574.1|  C-repeat binding factor 2                               159   8e-42   
gb|AIL00614.1|  C-repeat binding factor 2                               159   9e-42   
gb|AIL00636.1|  C-repeat binding factor 2                               159   9e-42   
gb|AIL00612.1|  C-repeat binding factor 2                               159   9e-42   
ref|XP_003540786.1|  PREDICTED: dehydration-responsive element-bi...    159   9e-42   
emb|CBI17075.3|  unnamed protein product                                159   1e-41   
gb|AIL00610.1|  C-repeat binding factor 2                               159   1e-41   
gb|AIL00591.1|  C-repeat binding factor 2                               159   1e-41   
gb|KHN38660.1|  Dehydration-responsive element-binding protein 1F       158   1e-41   
ref|XP_002270637.1|  PREDICTED: dehydration-responsive element-bi...    159   1e-41   Vitis vinifera
gb|AIL00605.1|  C-repeat binding factor 2                               159   1e-41   
gb|AIL00573.1|  C-repeat binding factor 2                               159   1e-41   
gb|AIL00572.1|  C-repeat binding factor 2                               159   1e-41   
gb|ABO48367.1|  C-repeat binding facor 6                                157   2e-41   Populus trichocarpa [western balsam poplar]
gb|AIL00579.1|  C-repeat binding factor 2                               159   2e-41   
gb|AIL00589.1|  C-repeat binding factor 2                               159   2e-41   
gb|AIL00571.1|  C-repeat binding factor 2                               159   2e-41   
ref|XP_010940400.1|  PREDICTED: dehydration-responsive element-bi...    157   2e-41   
gb|AIL00576.1|  C-repeat binding factor 2                               159   2e-41   
gb|AIL00651.1|  C-repeat binding factor 2                               158   2e-41   
ref|XP_007132398.1|  hypothetical protein PHAVU_011G091400g             157   2e-41   
gb|AIL00730.1|  C-repeat binding factor 3                               157   3e-41   
gb|AIL00731.1|  C-repeat binding factor 3                               157   3e-41   
gb|AIL00729.1|  C-repeat binding factor 3                               157   3e-41   
ref|XP_008807523.1|  PREDICTED: dehydration-responsive element-bi...    156   3e-41   
gb|AIL00538.1|  C-repeat binding factor 1                               157   4e-41   
gb|AIL00633.1|  C-repeat binding factor 2                               157   5e-41   
gb|KDO61045.1|  hypothetical protein CISIN_1g038285mg                   154   1e-40   
gb|AIL00704.1|  C-repeat binding factor 3                               156   1e-40   
gb|AIL00712.1|  C-repeat binding factor 3                               156   1e-40   
gb|AIL00701.1|  C-repeat binding factor 3                               155   1e-40   
gb|AIL00698.1|  C-repeat binding factor 3                               155   1e-40   
gb|AIL00702.1|  C-repeat binding factor 3                               155   1e-40   
gb|ABF61219.1|  CBF/DREB3 transcription factor                          155   1e-40   Vitis amurensis
gb|AIL00711.1|  C-repeat binding factor 3                               155   2e-40   
gb|AIL00706.1|  C-repeat binding factor 3                               155   2e-40   
ref|XP_008777348.1|  PREDICTED: dehydration-responsive element-bi...    155   2e-40   
gb|AIL00737.1|  C-repeat binding factor 3                               155   2e-40   
gb|AIL00710.1|  C-repeat binding factor 3                               155   2e-40   
gb|AIL00697.1|  C-repeat binding factor 3                               155   2e-40   
gb|AIL00557.1|  C-repeat binding factor 1                               155   3e-40   
gb|AIL00542.1|  C-repeat binding factor 1                               155   3e-40   
gb|AIL00732.1|  C-repeat binding factor 3                               155   3e-40   
ref|XP_006430282.1|  hypothetical protein CICLE_v10013766mg             153   3e-40   
ref|XP_006593271.1|  PREDICTED: dehydration-responsive element-bi...    154   3e-40   
gb|AIL00523.1|  C-repeat binding factor 1                               155   3e-40   
gb|KHN27668.1|  Dehydration-responsive element-binding protein 1F       155   4e-40   
gb|AIL00536.1|  C-repeat binding factor 1                               155   4e-40   
ref|XP_006481833.1|  PREDICTED: dehydration-responsive element-bi...    153   4e-40   
gb|ABU55656.1|  CBF1-like protein                                       155   4e-40   Vitis amurensis
gb|AIL00558.1|  C-repeat binding factor 1                               155   4e-40   
ref|XP_010243826.1|  PREDICTED: dehydration-responsive element-bi...    154   5e-40   
gb|AIL00537.1|  C-repeat binding factor 1                               155   5e-40   
gb|ABU55657.1|  CBF1-like protein                                       154   5e-40   Vitis aestivalis
gb|AIL00539.1|  C-repeat binding factor 1                               154   5e-40   
gb|AIL00521.1|  C-repeat binding factor 1                               154   5e-40   
gb|ABU55659.1|  CBF1-like protein                                       154   6e-40   Ampelopsis glandulosa var. brevipedunculata [Amur peppervine]
gb|AIL00533.1|  C-repeat binding factor 1                               154   6e-40   
gb|AIL00480.1|  C-repeat binding factor 1                               154   6e-40   
gb|AIL00514.1|  C-repeat binding factor 1                               154   6e-40   
gb|AIL00534.1|  C-repeat binding factor 1                               154   6e-40   
gb|AIL00526.1|  C-repeat binding factor 1                               154   6e-40   
gb|AIL00500.1|  C-repeat binding factor 1                               154   6e-40   
gb|AIL00699.1|  C-repeat binding factor 3                               154   6e-40   
gb|AIL00495.1|  C-repeat binding factor 1                               154   6e-40   
gb|AAR28671.1|  CBF-like transcription factor                           154   7e-40   Vitis riparia [frost grape]
gb|AIL00487.1|  C-repeat binding factor 1                               154   7e-40   
gb|AIL00682.1|  C-repeat binding factor 3                               154   7e-40   
gb|AIL00501.1|  C-repeat binding factor 1                               154   7e-40   
gb|AIL00491.1|  C-repeat binding factor 1                               154   7e-40   
gb|AIL00479.1|  C-repeat binding factor 1                               154   7e-40   
gb|ABF61217.1|  CBF/DREB1 transcription factor                          154   8e-40   Vitis amurensis
ref|XP_010242642.1|  PREDICTED: dehydration-responsive element-bi...    153   8e-40   
gb|AAR28675.1|  CBF-like transcription factor                           154   8e-40   Vitis riparia [frost grape]
gb|AIL00679.1|  C-repeat binding factor 3                               154   8e-40   
ref|XP_007150096.1|  hypothetical protein PHAVU_005G126300g             154   9e-40   
gb|AIL00700.1|  C-repeat binding factor 3                               153   1e-39   
gb|AIL00683.1|  C-repeat binding factor 3                               153   1e-39   
gb|AIL00515.1|  C-repeat binding factor 1                               153   2e-39   
gb|AIL00709.1|  C-repeat binding factor 3                               152   2e-39   
gb|AIL00506.1|  C-repeat binding factor 1                               152   3e-39   
gb|AIL00510.1|  C-repeat binding factor 1                               152   3e-39   
gb|AIL00502.1|  C-repeat binding factor 1                               152   3e-39   
gb|AIL00736.1|  C-repeat binding factor 3                               152   3e-39   
gb|AIL00738.1|  C-repeat binding factor 3                               152   3e-39   
gb|AIL00509.1|  C-repeat binding factor 1                               152   3e-39   
gb|ADY17818.1|  CBF1 transcription factor                               152   3e-39   
gb|AIL00734.1|  C-repeat binding factor 3                               152   3e-39   
gb|AIL00719.1|  C-repeat binding factor 3                               152   4e-39   
gb|AIL00559.1|  C-repeat binding factor 1                               152   4e-39   
gb|AHG97393.1|  C-repeat-binding transcription factor 3                 152   4e-39   
gb|AIL00707.1|  C-repeat binding factor 3                               152   4e-39   
gb|AIL00513.1|  C-repeat binding factor 1                               152   4e-39   
gb|AIL00520.1|  C-repeat binding factor 1                               152   4e-39   
gb|AIL00475.1|  C-repeat binding factor 1                               152   6e-39   
gb|AIL00678.1|  C-repeat binding factor 3                               151   6e-39   
gb|AIL00696.1|  C-repeat binding factor 3                               151   8e-39   
gb|AIL00508.1|  C-repeat binding factor 1                               151   9e-39   
gb|AIL00519.1|  C-repeat binding factor 1                               151   9e-39   
gb|AAR28672.1|  CBF-like transcription factor                           151   9e-39   Vitis riparia [frost grape]
gb|AIL00525.1|  C-repeat binding factor 1                               151   9e-39   
gb|AIL00691.1|  C-repeat binding factor 3                               150   1e-38   
gb|ACD45468.1|  CBF/DREB3 transcription factor                          150   1e-38   Vitis amurensis
gb|AIL00735.1|  C-repeat binding factor 3                               150   2e-38   
gb|AIL00717.1|  C-repeat binding factor 3                               150   2e-38   
gb|AAR28673.1|  CBF-like transcription factor                           150   3e-38   Vitis vinifera
gb|AIL00690.1|  C-repeat binding factor 3                               149   3e-38   
gb|ACT97164.1|  CBF3                                                    149   4e-38   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AIL00524.1|  C-repeat binding factor 1                               149   5e-38   
gb|KHN21448.1|  Dehydration-responsive element-binding protein 1F       149   5e-38   
ref|XP_003541976.1|  PREDICTED: dehydration-responsive element-bi...    149   5e-38   
ref|XP_006384650.1|  hypothetical protein POPTR_0004s19820g             148   7e-38   
gb|AIL00695.1|  C-repeat binding factor 3                               148   8e-38   
ref|XP_009379780.1|  PREDICTED: dehydration-responsive element-bi...    148   1e-37   
gb|AIL00689.1|  C-repeat binding factor 3                               147   1e-37   
ref|XP_004497619.1|  PREDICTED: dehydration-responsive element-bi...    145   3e-37   
emb|CBI17074.3|  unnamed protein product                                145   1e-36   
gb|KDP42691.1|  hypothetical protein JCGZ_23631                         144   1e-36   
ref|XP_002528599.1|  Dehydration-responsive element-binding prote...    144   2e-36   Ricinus communis
gb|AIL00718.1|  C-repeat binding factor 3                               144   3e-36   
gb|KDP34696.1|  hypothetical protein JCGZ_10901                         142   6e-36   
gb|AFV15809.1|  CBF/DREB1 transcription factor 1                        142   6e-36   
ref|XP_006594198.1|  PREDICTED: dehydration-responsive element-bi...    141   1e-35   
gb|AEW22951.1|  putative AP2 domain protein                             141   1e-35   
ref|XP_007027640.1|  Dehydration-responsive element-binding prote...    141   2e-35   
ref|XP_003537045.1|  PREDICTED: dehydration-responsive element-bi...    140   2e-35   
gb|ABQ53132.1|  putative CBF/DREB transcription factor                  140   2e-35   Rosa chinensis [China rose]
ref|XP_009405193.1|  PREDICTED: dehydration-responsive element-bi...    140   2e-35   
ref|XP_010278524.1|  PREDICTED: dehydration-responsive element-bi...    141   2e-35   
ref|XP_010654049.1|  PREDICTED: dehydration-responsive element-bi...    140   4e-35   
ref|XP_006851570.1|  hypothetical protein AMTR_s00040p00195730          143   4e-35   
gb|ABU55658.1|  CBF1-like protein                                       141   5e-35   Vitis aestivalis
ref|XP_007145241.1|  hypothetical protein PHAVU_007G222500g             139   6e-35   
ref|XP_009390140.1|  PREDICTED: dehydration-responsive element-bi...    140   8e-35   
ref|XP_008241428.1|  PREDICTED: dehydration-responsive element-bi...    137   2e-34   
ref|XP_004971403.1|  PREDICTED: dehydration-responsive element-bi...    137   4e-34   
ref|XP_010255545.1|  PREDICTED: dehydration-responsive element-bi...    137   6e-34   
ref|XP_011030036.1|  PREDICTED: dehydration-responsive element-bi...    138   6e-34   
ref|XP_008442807.1|  PREDICTED: dehydration-responsive element-bi...    135   1e-33   
gb|ABU55661.1|  CBF1-like protein                                       135   1e-33   Parthenocissus tricuspidata [Boston-ivy]
ref|XP_006413301.1|  hypothetical protein EUTSA_v10027405mg             135   2e-33   
ref|XP_006832878.1|  hypothetical protein AMTR_s00095p00096190          137   2e-33   
ref|XP_009413459.1|  PREDICTED: dehydration-responsive element-bi...    135   2e-33   
ref|XP_007204774.1|  hypothetical protein PRUPE_ppa015643mg             134   3e-33   
ref|XP_010686195.1|  PREDICTED: dehydration-responsive element-bi...    136   3e-33   
gb|AFQ59977.1|  CRT/DRE binding factor 1                                135   4e-33   
gb|ABO48363.1|  C-repeat binding facor 1                                133   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010686196.1|  PREDICTED: dehydration-responsive element-bi...    134   8e-33   
ref|NP_001267604.1|  uncharacterized protein LOC101209920               132   1e-32   
ref|XP_009611618.1|  PREDICTED: dehydration-responsive element-bi...    133   2e-32   
gb|ABV82985.1|  cold responsive transcription factor                    132   3e-32   Thlaspi arvense
gb|AHY04213.1|  putative CBFx1                                          132   3e-32   
ref|XP_009611054.1|  PREDICTED: dehydration-responsive element-bi...    132   3e-32   
ref|XP_002318846.1|  hypothetical protein POPTR_0012s13870g             133   3e-32   Populus trichocarpa [western balsam poplar]
gb|KDP22330.1|  hypothetical protein JCGZ_26161                         132   4e-32   
ref|XP_009791610.1|  PREDICTED: dehydration-responsive element-bi...    132   4e-32   
gb|AGY31291.1|  C-repeat binding factor 4b                              132   5e-32   
gb|ABK95675.1|  unknown                                                 132   5e-32   Populus trichocarpa [western balsam poplar]
gb|AET87124.1|  DREB1C                                                  131   6e-32   
ref|XP_010438876.1|  PREDICTED: dehydration-responsive element-bi...    131   6e-32   
ref|XP_007218312.1|  hypothetical protein PRUPE_ppa010935mg             132   6e-32   
ref|XP_009759325.1|  PREDICTED: dehydration-responsive element-bi...    132   7e-32   
gb|AIU92947.1|  C-repeat/dehydration-responsive element-binding f...    132   7e-32   
gb|AIU92958.1|  C-repeat/dehydration-responsive element-binding f...    132   7e-32   
gb|AIU92963.1|  C-repeat/dehydration-responsive element-binding f...    132   8e-32   
ref|NP_567721.1|  dehydration-responsive element-binding protein 1B     131   8e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ94947.1|  C-repeat binding factor                                 131   8e-32   
gb|ABV27072.1|  C-repeat binding factor 1                               130   9e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AIU92948.1|  C-repeat/dehydration-responsive element-binding f...    132   9e-32   
gb|ADE41100.1|  AP2 domain class transcription factor                   131   1e-31   
ref|XP_008364557.1|  PREDICTED: dehydration-responsive element-bi...    131   1e-31   
gb|ABV27062.1|  C-repeat binding factor 1                               130   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ACI15564.1|  DRE/CRT-binding factor 1                                130   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABV27064.1|  C-repeat binding factor 1                               130   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABV27057.1|  C-repeat binding factor 1                               130   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089199.1|  PREDICTED: dehydration-responsive element-bi...    130   1e-31   
ref|XP_002867607.1|  hypothetical protein ARALYDRAFT_492279             130   1e-31   
gb|ACE73696.1|  DREB4                                                   130   1e-31   Nicotiana tabacum [American tobacco]
gb|AAC49662.1|  transcriptional activator CBF1                          130   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305358.1|  PREDICTED: dehydration-responsive element-bi...    129   2e-31   
gb|AHH86061.1|  CRT/DRE-binding factor 3                                130   2e-31   
gb|AAV80413.1|  putative transcription factor CBF1                      129   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AIU92967.1|  C-repeat/dehydration-responsive element-binding f...    130   3e-31   
gb|ABP98989.1|  CBF/DREB1 transcription factor 3                        129   4e-31   Betula pendula [white birch]
gb|ACI42860.1|  dehydration-responsive element-binding protein 1B       129   4e-31   Rosa hybrid cultivar
gb|ABV27067.1|  C-repeat binding factor 1                               129   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AGH33881.1|  DREB70                                                  130   5e-31   
gb|ABV27070.1|  C-repeat binding factor 1                               128   6e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AFA50331.1|  dehydration-responsive element-binding protein 1        129   6e-31   
gb|AIU92956.1|  C-repeat/dehydration-responsive element-binding f...    130   6e-31   
ref|XP_006284509.1|  hypothetical protein CARUB_v10005709mg             129   6e-31   
gb|AFJ14631.1|  dehydration-responsive element-binding protein          131   7e-31   
gb|ABC79626.1|  CBF1                                                    129   8e-31   Populus tomentosa [Chinese white poplar]
gb|AIU92964.1|  C-repeat/dehydration-responsive element-binding f...    129   8e-31   
ref|NP_001234123.1|  CBF1 protein                                       128   8e-31   
gb|ACB45087.1|  CRT binding factor 1                                    128   8e-31   Solanum habrochaites
ref|XP_010317563.1|  PREDICTED: CBF1 protein isoform X1                 128   8e-31   
ref|XP_008391758.1|  PREDICTED: dehydration-responsive element-bi...    127   9e-31   
ref|XP_010448427.1|  PREDICTED: dehydration-responsive element-bi...    128   9e-31   
gb|AFA50332.1|  dehydration-responsive element-binding protein 2        128   1e-30   
dbj|BAE17131.1|  LhCBF1                                                 128   1e-30   Solanum habrochaites
gb|KDP25514.1|  hypothetical protein JCGZ_20670                         128   1e-30   
ref|XP_004308117.1|  PREDICTED: dehydration-responsive element-bi...    128   1e-30   
gb|ACB45079.1|  CRT binding factor 1                                    128   1e-30   Solanum habrochaites
gb|ADZ23480.1|  CBF transcription factor 2                              127   1e-30   
gb|AHY04214.1|  putative CBFx2                                          127   1e-30   
gb|ACZ37079.1|  CRT/DRE binding factor                                  127   1e-30   
gb|ABU55671.1|  CBF2-like protein                                       127   1e-30   Cissus antarctica [kangaroo vine]
gb|AFB83707.1|  CBF1                                                    127   2e-30   
gb|ABU55664.1|  CBF1-like protein                                       127   2e-30   Cissus antarctica [kangaroo vine]
gb|AIU92955.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
ref|XP_009371278.1|  PREDICTED: dehydration-responsive element-bi...    127   2e-30   
gb|AIU92965.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
gb|AIU92957.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
gb|AIU92962.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
gb|AIU92946.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
ref|XP_004143933.1|  PREDICTED: dehydration-responsive element-bi...    127   2e-30   
gb|AEG64738.1|  DREB protein                                            127   2e-30   
gb|AIQ82333.1|  CBF2                                                    126   2e-30   
gb|ABV27118.1|  C-repeat binding factor 2                               127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ACZ37078.1|  CRT/DRE binding factor                                  127   2e-30   
emb|CAH10191.1|  avirulence-like protein 1                              127   2e-30   Festuca arundinacea [tall fescue]
gb|ACZ37080.1|  CRT/DRE binding factor                                  127   2e-30   
gb|AHN65392.1|  dehydration-responsive element binding protein          127   2e-30   
gb|ACZ37077.1|  CRT/DRE binding factor                                  127   2e-30   
gb|AIU92949.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
gb|AIU92952.1|  C-repeat/dehydration-responsive element-binding f...    128   2e-30   
gb|AIQ82360.1|  CBF2                                                    125   3e-30   
gb|AAZ57434.1|  CRT/DRE binding factor 1                                126   3e-30   Iris lactea var. lactea
gb|AIU92950.1|  C-repeat/dehydration-responsive element-binding f...    128   3e-30   
gb|AIQ82339.1|  CBF2                                                    125   3e-30   
gb|ABV65907.2|  CRT/DRE-binding factor 1                                126   3e-30   Fragaria x ananassa
ref|XP_006421846.1|  hypothetical protein CICLE_v10007068mg             126   3e-30   
emb|CDP05249.1|  unnamed protein product                                127   3e-30   
gb|AAY43213.1|  CRT/DRE binding factor 1                                127   3e-30   
gb|AIQ82342.1|  CBF2                                                    125   3e-30   
gb|ABU55662.1|  CBF1-like protein                                       126   4e-30   
gb|AIQ82361.1|  CBF2                                                    125   4e-30   
gb|AIY26287.1|  CRT/DRE-binding factor                                  127   4e-30   
gb|AEK94313.1|  C-repeat binding factor 4                               125   4e-30   
gb|AFZ94953.1|  C-repeat binding factor 3                               126   4e-30   
dbj|BAN51850.2|  putative C-repeat binding factor 2                     127   4e-30   
gb|AIQ82363.1|  CBF2                                                    125   5e-30   
gb|AIQ82354.1|  CBF2                                                    125   5e-30   
gb|ABP98987.1|  CBF/DREB1 transcription factor 1                        125   5e-30   
gb|ADY17814.1|  CBF4 transcription factor                               126   5e-30   
ref|XP_009352989.1|  PREDICTED: dehydration-responsive element-bi...    125   5e-30   
ref|XP_010536489.1|  PREDICTED: dehydration-responsive element-bi...    126   5e-30   
gb|AGH33880.1|  DREB69                                                  126   5e-30   
ref|XP_010433630.1|  PREDICTED: dehydration-responsive element-bi...    125   6e-30   
gb|ABV27149.1|  C-repeat binding factor 3                               125   6e-30   
gb|AIU92971.1|  C-repeat/dehydration-responsive element-binding f...    126   7e-30   
gb|ADY68770.1|  DREB1/CBF transcription factor                          125   7e-30   
gb|AAR26658.1|  Cbcbf                                                   125   7e-30   
ref|NP_567719.1|  dehydration-responsive element-binding protein 1C     125   8e-30   
emb|CDY52360.1|  BnaA08g30950D                                          125   8e-30   
ref|XP_002510847.1|  Dehydration-responsive element-binding prote...    125   9e-30   
gb|EYU19514.1|  hypothetical protein MIMGU_mgv1a026630mg                125   9e-30   
gb|ABF29699.1|  AP2 domain CBF protein                                  125   9e-30   
gb|ABV27100.1|  C-repeat binding factor 2                               125   9e-30   
gb|ABH08745.1|  CBF/DREB-like transcription factor a                    125   1e-29   
gb|AHN65435.1|  dehydration-responsive element binding protein          125   1e-29   
gb|ABX00639.1|  DREB1B                                                  125   1e-29   
ref|XP_007210989.1|  hypothetical protein PRUPE_ppa021197mg             125   1e-29   
gb|ACB45078.1|  CRT binding factor 3                                    124   1e-29   
ref|XP_006285403.1|  hypothetical protein CARUB_v10006809mg             125   1e-29   
ref|XP_009137527.1|  PREDICTED: dehydration-responsive element-bi...    124   1e-29   
gb|ACZ37076.1|  CRT/DRE binding factor                                  124   1e-29   
gb|AAR20500.1|  DREB2-19                                                124   1e-29   
gb|AAC99371.1|  CRT/DRE binding factor 2                                125   1e-29   
gb|AHN65388.1|  dehydration-responsive element binding protein          125   1e-29   
gb|AAR35030.1|  CBF25                                                   125   2e-29   
gb|ACI15606.1|  DRE/CRT-binding factor 2                                124   2e-29   
gb|AIU92953.1|  C-repeat/dehydration-responsive element-binding f...    125   2e-29   
ref|XP_002457016.1|  hypothetical protein SORBIDRAFT_03g047170          125   2e-29   
gb|AHN65418.1|  dehydration-responsive element binding factor pro...    125   2e-29   
gb|AHN13909.1|  dehydration-responsive element binding factor           125   2e-29   
gb|AHN65417.1|  dehydration-responsive element binding protein          125   2e-29   
gb|ABQ18239.1|  dehydration responsive element binding protein 2-19     124   2e-29   
emb|CDX92710.1|  BnaC07g39680D                                          124   2e-29   
ref|XP_008234474.1|  PREDICTED: dehydration-responsive element-bi...    125   2e-29   
gb|ABO48365.1|  C-repeat binding facor 3                                124   2e-29   
ref|XP_011029177.1|  PREDICTED: dehydration-responsive element-bi...    124   2e-29   
gb|AHN65412.1|  dehydration-responsive element binding protein          124   2e-29   
ref|XP_008361312.1|  PREDICTED: dehydration-responsive element-bi...    124   2e-29   
gb|AAY21899.2|  C-repeat binding factor-like protein                    124   2e-29   
gb|AFL48190.1|  C-repeat binding factor 1                               125   2e-29   
ref|XP_008369501.1|  PREDICTED: dehydration-responsive element-bi...    124   2e-29   
gb|AIQ82365.1|  CBF2                                                    123   2e-29   
ref|XP_002298067.2|  dehydration responsive element binding prote...    124   3e-29   
ref|XP_009344260.1|  PREDICTED: dehydration-responsive element-bi...    125   3e-29   
gb|AFN84518.1|  AP2/ERF domain-containing transcription factor          125   3e-29   
gb|AIL00823.1|  C-repeat binding factor 4                               124   3e-29   
ref|XP_011014147.1|  PREDICTED: dehydration-responsive element-bi...    124   3e-29   
gb|AGY31293.1|  C-repeat binding factor 2                               124   3e-29   
ref|XP_009784267.1|  PREDICTED: dehydration-responsive element-bi...    124   3e-29   
gb|AGL07697.1|  CBF/DREB 3                                              124   3e-29   
gb|AIL00786.1|  C-repeat binding factor 4                               124   3e-29   
gb|ABP98988.1|  CBF/DREB1 transcription factor 2                        123   3e-29   
gb|ABV27189.1|  C-repeat binding factor 2C                              123   3e-29   
ref|XP_002280097.1|  PREDICTED: dehydration-responsive element-bi...    124   3e-29   
ref|XP_004140794.1|  PREDICTED: dehydration-responsive element-bi...    123   4e-29   
gb|ABV27106.1|  C-repeat binding factor 2                               123   4e-29   
gb|ACY79411.1|  CRT-binding factor 1                                    123   4e-29   
gb|ABI74671.1|  C-repeat binding factor 1                               124   4e-29   
ref|XP_009339654.1|  PREDICTED: dehydration-responsive element-bi...    124   4e-29   
gb|EYU19515.1|  hypothetical protein MIMGU_mgv1a026372mg                124   4e-29   
gb|KCW48355.1|  hypothetical protein EUGRSUZ_K02069                     122   4e-29   
gb|AAS77819.1|  CBF3                                                    123   4e-29   
gb|AIL00794.1|  C-repeat binding factor 4                               123   4e-29   
gb|ACF77119.1|  CBF4b                                                   124   5e-29   
gb|ABV27138.1|  C-repeat binding factor 3                               123   5e-29   
gb|AHI59143.1|  CBF4                                                    124   5e-29   
gb|ABD63908.1|  brcbf                                                   123   5e-29   
ref|XP_011101172.1|  PREDICTED: dehydration-responsive element-bi...    122   5e-29   
gb|AIQ82316.1|  CBF1                                                    122   5e-29   
gb|ACB45091.1|  CBF1-2 fusion protein                                   123   5e-29   
gb|ACB45082.1|  CRT binding factor 5                                    122   5e-29   
gb|AHN65433.1|  dehydration-responsive element binding protein          123   5e-29   
gb|ACB45088.1|  CRT binding factor 2                                    123   5e-29   
gb|ABD65969.1|  DREB1A                                                  123   5e-29   
ref|XP_009383557.1|  PREDICTED: dehydration-responsive element-bi...    124   6e-29   
gb|AIL00787.1|  C-repeat binding factor 4                               123   6e-29   
gb|AHZ90672.1|  CBF/DREB1 transcription factor 1                        123   6e-29   
ref|XP_009781787.1|  PREDICTED: dehydration-responsive element-bi...    123   6e-29   
gb|ACB45086.1|  CRT binding factor 3                                    122   6e-29   
gb|ACB45080.1|  CRT binding factor 2                                    123   6e-29   
ref|XP_008439162.1|  PREDICTED: dehydration-responsive element-bi...    122   6e-29   
gb|ACB45095.1|  CRT binding factor 3                                    123   6e-29   
ref|XP_009341269.1|  PREDICTED: dehydration-responsive element-bi...    123   6e-29   
dbj|BAA33434.1|  DREB1A                                                 122   7e-29   
gb|AAR20499.1|  DREB2-23                                                122   7e-29   
gb|AIQ82301.1|  CBF1                                                    122   7e-29   
ref|XP_007150099.1|  hypothetical protein PHAVU_005G126600g             123   7e-29   
ref|XP_007209556.1|  hypothetical protein PRUPE_ppa010909mg             123   7e-29   
gb|AAG43549.1|AF211531_1  Avr9/Cf-9 rapidly elicited protein 111B       123   7e-29   
ref|XP_007210188.1|  hypothetical protein PRUPE_ppa017761mg             123   7e-29   
emb|CAQ52596.1|  dehydration responsible element binding factor 1A      122   7e-29   
gb|AIQ82297.1|  CBF1                                                    122   7e-29   
gb|AIQ82329.1|  CBF1                                                    122   7e-29   
ref|XP_008437209.1|  PREDICTED: dehydration-responsive element-bi...    123   7e-29   
gb|ABV27129.1|  C-repeat binding factor 3                               122   7e-29   
gb|AAM18959.1|AF499032_1  CBF-like protein CBF7                         122   8e-29   
ref|NP_001274919.1|  AP2 domain CBF protein                             122   8e-29   
gb|KFK29051.1|  hypothetical protein AALP_AA7G082200                    122   9e-29   
gb|AAV80415.1|  putative transcription factor CBF2                      122   9e-29   
gb|ABV27144.1|  C-repeat binding factor 3                               122   9e-29   
gb|ABV27190.1|  C-repeat binding factor 2B                              122   9e-29   
gb|AIL00783.1|  C-repeat binding factor 4                               122   9e-29   
gb|AAZ20446.1|  CBF1                                                    122   9e-29   
ref|XP_002321877.1|  hypothetical protein POPTR_0015s13830g             123   1e-28   
gb|ABV27132.1|  C-repeat binding factor 3                               122   1e-28   
ref|NP_001280599.1|  dehydration-responsive element-binding prote...    122   1e-28   
gb|KEH38960.1|  CBF-like transcription factor                           122   1e-28   
ref|XP_004234350.1|  PREDICTED: dehydration-responsive element-bi...    122   1e-28   
gb|AAR20498.1|  DREB2-3                                                 122   1e-28   
ref|XP_004171792.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    122   1e-28   
ref|XP_010519227.1|  PREDICTED: dehydration-responsive element-bi...    122   1e-28   
ref|XP_007040121.1|  AP2/ERF domain-containing transcription fact...    122   1e-28   
ref|XP_008376515.1|  PREDICTED: dehydration-responsive element-bi...    122   1e-28   
gb|ABM21468.1|  DREB1A                                                  122   1e-28   
gb|AAW58104.1|  CBF-like transcription factor                           122   1e-28   
gb|AAM18960.1|AF499033_1  CBF-like protein CBF16                        122   1e-28   
ref|XP_006281628.1|  hypothetical protein CARUB_v10027759mg             122   1e-28   
ref|NP_567720.1|  dehydration-responsive element-binding protein 1A     122   1e-28   
ref|NP_001274894.1|  AP2 domain CBF protein                             122   1e-28   
gb|AIQ82367.1|  CBF2                                                    120   1e-28   
gb|AIL00822.1|  C-repeat binding factor 4                               122   1e-28   
gb|ACB45083.1|  CRT binding factor 4                                    121   1e-28   
gb|AIL00764.1|  C-repeat binding factor 4                               122   2e-28   
ref|XP_009344259.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-28   
gb|AHN65437.1|  dehydration-responsive element binding protein          122   2e-28   
gb|AIQ82399.1|  CBF3                                                    121   2e-28   
gb|ABC79627.1|  CBF2                                                    122   2e-28   
gb|AIQ82398.1|  CBF3                                                    120   2e-28   
ref|XP_009377921.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-28   
gb|AGY36889.1|  CBF3                                                    121   2e-28   
gb|AAR88363.1|  DREB-like protein 1                                     121   2e-28   
gb|AIQ82376.1|  CBF3                                                    120   2e-28   
gb|AIQ82369.1|  CBF3                                                    120   2e-28   
gb|AIQ82400.1|  CBF3                                                    120   2e-28   
gb|AAV80414.1|  putative transcription factor CBF3                      121   3e-28   
gb|AIL00808.1|  C-repeat binding factor 4                               121   3e-28   
ref|XP_011076240.1|  PREDICTED: dehydration-responsive element-bi...    121   3e-28   
gb|AAQ88400.1|  CaCBF1B                                                 121   3e-28   
gb|ACB45092.1|  CRT binding factor 3                                    121   3e-28   
gb|ACF77118.1|  CBF4a                                                   122   3e-28   
ref|XP_011041633.1|  PREDICTED: dehydration-responsive element-bi...    122   3e-28   
emb|CBJ94884.1|  CBF2 protein                                           120   3e-28   
ref|XP_010448428.1|  PREDICTED: dehydration-responsive element-bi...    120   4e-28   
ref|XP_010482546.1|  PREDICTED: dehydration-responsive element-bi...    120   4e-28   
gb|ABV27154.1|  C-repeat binding factor 3                               120   4e-28   
ref|XP_010444203.1|  PREDICTED: dehydration-responsive element-bi...    120   4e-28   
gb|ABV27188.1|  C-repeat binding factor 2A                              120   4e-28   
ref|XP_002299565.1|  hypothetical protein POPTR_0001s08710g             120   4e-28   
ref|XP_009106963.1|  PREDICTED: dehydration-responsive element-bi...    120   5e-28   
emb|CBJ94893.1|  CBF2 protein                                           120   5e-28   
gb|KFK26806.1|  hypothetical protein AALP_AA8G295900                    120   5e-28   
ref|XP_008674480.1|  PREDICTED: dehydration-responsive element-bi...    121   5e-28   
gb|ACX48435.1|  CBF1                                                    120   5e-28   
gb|ACY79412.1|  CRT-binding factor 1                                    120   5e-28   
gb|ABB17253.1|  DREB1-2                                                 120   5e-28   
gb|EYU19512.1|  hypothetical protein MIMGU_mgv1a025309mg                120   6e-28   
ref|XP_010433631.1|  PREDICTED: dehydration-responsive element-bi...    120   6e-28   
gb|ACJ26754.1|  AP2 domain CBF protein                                  120   6e-28   
ref|XP_006340376.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    120   6e-28   
gb|ABV27191.1|  C-repeat binding factor 3                               119   6e-28   
gb|ABP64695.1|  putative C-repeat binding protein 4                     119   7e-28   
ref|XP_008377096.1|  PREDICTED: dehydration-responsive element-bi...    120   7e-28   
ref|NP_001287933.1|  uncharacterized protein LOC103337407               120   8e-28   
gb|AAY43345.1|  CBF-like protein                                        119   8e-28   
ref|XP_010933895.1|  PREDICTED: dehydration-responsive element-bi...    119   9e-28   
ref|XP_006401879.1|  hypothetical protein EUTSA_v10015252mg             119   9e-28   
gb|KDP25515.1|  hypothetical protein JCGZ_20671                         120   9e-28   
emb|CAA18178.1|  transcriptional activator CBF1-like protein            121   1e-27   
emb|CDY52356.1|  BnaA08g30910D                                          119   1e-27   
gb|AGY36892.1|  CBF3                                                    119   1e-27   
emb|CAB81358.1|  transcriptional activator CBF1-like protein            121   1e-27   
gb|AGL07696.1|  CBF/DREB 4                                              120   1e-27   
gb|ACB45098.1|  CRT binding factor 2B                                   119   1e-27   
gb|ACL12046.1|  DREB-like protein 1                                     119   1e-27   
gb|AAR20497.1|  DREB2-2                                                 119   1e-27   
emb|CDY65499.1|  BnaUnng01150D                                          119   1e-27   
gb|AEQ35295.1|  DREB1A-like protein                                     119   1e-27   
gb|AEB69782.1|  CBF                                                     119   1e-27   
gb|AFU54606.1|  C-repeat binding factor                                 119   1e-27   
gb|ABV27147.1|  C-repeat binding factor 3                               119   2e-27   
gb|ADZ23479.1|  CBF transcription factor 1                              118   2e-27   
gb|ABA42927.1|  CBF                                                     119   2e-27   
gb|ACB45093.1|  CRT binding factor 1                                    119   2e-27   
ref|XP_009759409.1|  PREDICTED: dehydration-responsive element-bi...    118   2e-27   
gb|ABU55666.1|  CBF1-like protein                                       117   2e-27   
gb|EYU19513.1|  hypothetical protein MIMGU_mgv1a020585mg                119   2e-27   
ref|NP_001045521.1|  Os01g0968800                                       119   2e-27   
gb|AEK78854.1|  dehydration responsive element binding transcript...    118   2e-27   
gb|AIT39763.1|  C-repeat binding factor 3                               119   2e-27   
gb|AEU10136.1|  dehydration responsive element binding transcript...    118   2e-27   
gb|ABV27122.1|  C-repeat binding factor 3                               118   2e-27   
gb|ABV27058.1|  C-repeat binding factor 1                               118   2e-27   
gb|AAR11858.1|  DREB2-1                                                 118   2e-27   
emb|CDY31925.1|  BnaC09g28190D                                          118   2e-27   
ref|XP_008238783.1|  PREDICTED: dehydration-responsive element-bi...    119   2e-27   
gb|AIU39990.1|  dehydration responsive element-binding protein          119   3e-27   
ref|XP_009758148.1|  PREDICTED: dehydration-responsive element-bi...    118   3e-27   
gb|ADE41123.1|  AP2 domain class transcription factor                   118   3e-27   
gb|AEQ35294.1|  DREB1-like protein                                      118   3e-27   
gb|ABH08746.1|  CBF/DREB-like transcription factor 1                    119   3e-27   
ref|XP_002276153.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-27   
ref|XP_010442711.1|  PREDICTED: dehydration-responsive element-bi...    118   4e-27   
ref|XP_009132706.1|  PREDICTED: dehydration-responsive element-bi...    117   4e-27   
ref|XP_010438877.1|  PREDICTED: dehydration-responsive element-bi...    117   4e-27   
emb|CDY66018.1|  BnaC03g71900D                                          117   4e-27   
gb|ABF59741.1|  CBF-like transcription factor 2                         117   4e-27   



>ref|XP_009777029.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Nicotiana sylvestris]
Length=235

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 139/191 (73%), Gaps = 5/191 (3%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KRR GRKKF+ETRHP YRGVRRRN DKWVCE+REPNKKSRIWLGTF+TPE+AARAHDVAA
Sbjct  44    KRRTGRKKFKETRHPFYRGVRRRNGDKWVCEIREPNKKSRIWLGTFSTPEIAARAHDVAA  103

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG  A+LNFP ++ SLP+A S SP DI+ AALQ++N      P     S     E++
Sbjct  104   LALRGTKASLNFPESSWSLPKAQSSSPRDIQIAALQVSNKEVVSSPLKHTTSYLELEESS  163

Query  848   SSSRTID-----LPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
                 T +     L G +       F+DEEA+FN+P L+D+MAEGML+TPPAMK+GF+W D
Sbjct  164   CFQSTNNDQENSLKGYNDSCELMEFVDEEAMFNMPILIDSMAEGMLMTPPAMKRGFNWGD  223

Query  683   EGDGIDLTLWK  651
               + ++ TLWK
Sbjct  224   VEENVEFTLWK  234



>ref|XP_009624061.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Nicotiana tomentosiformis]
Length=235

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 138/190 (73%), Gaps = 4/190 (2%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KRRAGRKKF+ETRHP YRGVRRRN DKWVCE+REPNKKSRIWLGTF+TPE+AARAHDVAA
Sbjct  45    KRRAGRKKFKETRHPFYRGVRRRNGDKWVCEIREPNKKSRIWLGTFSTPEIAARAHDVAA  104

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppp----ppqfPCISRDHS  861
             LALRG  A+LNFP ++ SLP+A S SP DI+ AALQ++N            +  +     
Sbjct  105   LALRGTKASLNFPESSWSLPKAQSSSPHDIQIAALQVSNKVVSSPLKPSMSYLKLEESSC  164

Query  860   AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDE  681
              ++    +   L G +       F+DEEA+FN+P L+D+MAEGML+TPPAMK+GF+W D 
Sbjct  165   FKSPKDDQENSLKGYNDSCELMEFVDEEAMFNMPILIDSMAEGMLMTPPAMKRGFNWGDV  224

Query  680   GDGIDLTLWK  651
              + ++ TLWK
Sbjct  225   EENVEFTLWK  234



>ref|XP_004228864.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Solanum lycopersicum]
Length=180

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 14/186 (8%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KRRAGRKKF+ETRHP+YRGVR+RN +KWVCE+REPNKK+RIWLGTF TPE+AARAHDVAA
Sbjct  8     KRRAGRKKFKETRHPLYRGVRKRNGEKWVCEIREPNKKTRIWLGTFTTPELAARAHDVAA  67

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG  A LNFPG+A SLP+A S SP DI+ A LQ              ++ +    ++
Sbjct  68    LALRGSNALLNFPGSAWSLPKAKSSSPQDIQIAVLQ--------------VNEELIVSSS  113

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              S      P  D   +   F+DEEA+FN+P  +D+MAEGML+TPPAMK+GF+W D  + +
Sbjct  114   PSEEPSCKPKDDEVNSLMEFMDEEAMFNMPIFIDSMAEGMLLTPPAMKRGFNWGDVEEDV  173

Query  668   DLTLWK  651
             + TLWK
Sbjct  174   EFTLWK  179



>emb|CDP06968.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 146/197 (74%), Gaps = 16/197 (8%)
 Frame = -2

Query  1232  DQAAPVL--QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPE  1059
             +Q  P L   KR+AGR+KF+ETRHP+YRGVRRRN +KWVCE+REPNKK+RIWLGTF TPE
Sbjct  116   EQQGPFLASHKRKAGRRKFKETRHPIYRGVRRRNGNKWVCEMREPNKKTRIWLGTFQTPE  175

Query  1058  MaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC  879
             MAARAHDVAALALRG+ AALNF  +A  + RA S   +DI+ AALQ A A  P       
Sbjct  176   MAARAHDVAALALRGDDAALNFADSAWRVARAQSSLASDIQIAALQAAQAFRPSLV----  231

Query  878   ISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKG  699
                D +  ++SS + I         +A+ F+DEEAVFN+PAL+DNMAEGML+TPPAMKKG
Sbjct  232   ---DANPSSSSSPKNICC------HSATMFVDEEAVFNMPALIDNMAEGMLLTPPAMKKG  282

Query  698   FSWDD-EGDGIDLTLWK  651
             F WD+ EGD I+LTLW+
Sbjct  283   FHWDNGEGDDIELTLWR  299



>ref|XP_002313656.1| hypothetical protein POPTR_0009s14990g [Populus trichocarpa]
 gb|EEE87611.1| hypothetical protein POPTR_0009s14990g [Populus trichocarpa]
Length=220

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 131/192 (68%), Gaps = 15/192 (8%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             VL+K +AGRKKF+ETRHPVYRGVRRRN +KWVCEVREPNKKSRIW+GTF +PEMAARAHD
Sbjct  40    VLKKNKAGRKKFKETRHPVYRGVRRRNGNKWVCEVREPNKKSRIWVGTFKSPEMAARAHD  99

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             VAALAL+GE AALNF  +A  LPRA S S  DI+ AAL                +   S 
Sbjct  100   VAALALKGELAALNFLDSALILPRAKSSSARDIQRAALAA--------------TEPFSN  145

Query  857   EAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEG  678
                S S       +    NA TF DEEA+FN+P LLD+MAEG+++TPPAM +G  WDD  
Sbjct  146   MVMSCSNNCCSEKVPNHSNA-TFFDEEALFNMPGLLDSMAEGLILTPPAMARGVYWDDMA  204

Query  677   DGIDLTLWKH*Y  642
                DLTLW+  Y
Sbjct  205   CSTDLTLWEDDY  216



>gb|AIL00561.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00562.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00563.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00564.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00565.1| C-repeat binding factor 2 [Vitis labrusca]
Length=253

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 147/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G ++ F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFSTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00597.1| C-repeat binding factor 2 [Vitis labrusca]
Length=253

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    ISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G ++ F+DEEAVFN+P L
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFSTAFVDEEAVFNMPGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00643.1| C-repeat binding factor 2 [Vitis vinifera]
Length=255

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 144/217 (66%), Gaps = 27/217 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ G+KKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    ISHKRKTGKKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSAEAAS-----SSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLP  759
              SA + S     +S  +D P L       G +S                F+DEEAVFN+P
Sbjct  155   MSAGSGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMP  214

Query  758   ALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
              L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   GLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  251



>gb|AIL00570.1| C-repeat binding factor 2 [Vitis aestivalis]
Length=253

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIXHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFXTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>emb|CAN79383.1| hypothetical protein VITISV_004704 [Vitis vinifera]
Length=210

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 127/196 (65%), Gaps = 18/196 (9%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSp-----adiraaalqlanappppppqfP  882
             AHDVAALA RG  AALNFP +A  LPRA S S          + +               
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQRELETSCSEDSPQLESRKKVVGV  143

Query  881   CISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKK  702
              +    S+E A             +G+++ F+DEEA+FN+P L+++MAEG+L+ PP M  
Sbjct  144   ALEDSESSEGAP------------YGSSTVFMDEEALFNMPGLINSMAEGLLLAPPTMLG  191

Query  701   GFSWDDEGDGIDLTLW  654
             GFSWDD     DL+LW
Sbjct  192   GFSWDDTTSYTDLSLW  207



>gb|AIL00630.1| C-repeat binding factor 2 [Vitis labrusca]
Length=249

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  20    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  79

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  80    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  139

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  140   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFXTAFV  199

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  200   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  245



>gb|AIL00619.1| C-repeat binding factor 2 [Vitis labrusca]
Length=250

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFXTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00595.1| C-repeat binding factor 2 [Vitis labrusca]
Length=252

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 144/217 (66%), Gaps = 27/217 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSAEAAS-----SSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLP  759
              SA + S     +S  +D P L       G +S                F+DEEAVFN+P
Sbjct  152   MSAGSGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMP  211

Query  758   ALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
              L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   GLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  248



>gb|AIL00569.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00584.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00585.1| C-repeat binding factor 2 [Vitis labrusca]
Length=253

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFXTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00568.1| C-repeat binding factor 2 [Vitis aestivalis]
Length=253

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 147/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIXHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL----DFFGNAST---------------FL  786
                    +  + SA   +   +S  +D P L       G +S                F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00581.1| C-repeat binding factor 2 [Vitis cinerea]
 gb|AIL00582.1| C-repeat binding factor 2 [Vitis cinerea]
 gb|AIL00583.1| C-repeat binding factor 2 [Vitis cinerea]
Length=250

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 147/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL----DFFGNAST---------------FL  786
                    +  + SA   +   +S  +D P L       G +S                F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00566.1| C-repeat binding factor 2 [Vitis labrusca]
Length=253

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 147/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL----DFFGNAST---------------FL  786
                    +  + SA   +   +S  +D P L       G +S                F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|ADY17812.1| CBF2 transcription factor [Vitis amurensis]
Length=250

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSIVDTPQLKSQKKVEGVSSVDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM KGFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCKGFSWDDAVSHIDLSLWIH  246



>gb|AIL00644.1| C-repeat binding factor 2 [Vitis cinerea]
Length=250

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 147/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL----DFFGNAST---------------FL  786
                    +  + SA   +   +S  +D P L       G +S                F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLXSQKKVVGVSSVDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWXH  246



>gb|AIL00604.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00607.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00621.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSXEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00567.1| C-repeat binding factor 2 [Vitis labrusca]
Length=253

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    ISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AAR28677.1| CBF-like transcription factor [Vitis vinifera]
Length=253

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ G+KKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    ISHKRKTGKKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        I  +
Sbjct  95    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFIMDN  154

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSPVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00598.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00599.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00600.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00601.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00602.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00603.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSGEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00580.1| C-repeat binding factor 2 [Vitis cinerea]
Length=250

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 147/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL----DFFGNAST---------------FL  786
                    +  + SA   +   +S  +D P L       G +S                F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSXVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AAR28674.1| CBF-like transcription factor [Vitis riparia]
Length=250

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00620.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana---ppppppqfPCISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP      P +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSXEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00606.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00638.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKSXEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00587.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00588.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00593.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00594.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00596.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00617.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00618.1| C-repeat binding factor 2 [Vitis rupestris]
Length=250

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00586.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00592.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00642.1| C-repeat binding factor 2 [Vitis riparia]
Length=253

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 140/215 (65%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    IXHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
              AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    XAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEA FN+P L
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKXXEKAGDGFXTAFVDEEAXFNMPGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00645.1| C-repeat binding factor 2 [Vitis palmata]
 gb|AIL00646.1| C-repeat binding factor 2 [Vitis rubra]
Length=250

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWIH  246



>ref|XP_003539179.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Glycine max]
Length=236

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 121/190 (64%), Gaps = 7/190 (4%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHPVYRGVR+RN +KWVCE+REP KKSR+W+GT+ TPEMAARAHDVA
Sbjct  48    HKRKAGRKKFRETRHPVYRGVRQRNGNKWVCEIREPIKKSRVWVGTYPTPEMAARAHDVA  107

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHS---  861
              LAL G +A  NFP +   LP A S S             A           S  H+   
Sbjct  108   VLALSGTSAKFNFPDSVSLLPLAKSHS---AVDIREAAKAASIEAFIPNTAFSSSHNNSN  164

Query  860   -AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
               E  ++  T    G+    + + F DEEAV+N+P LLD+MAEG+LITPP+MK+   WDD
Sbjct  165   FGENGNAEDTCLNIGMHDDESETMFFDEEAVYNMPGLLDSMAEGLLITPPSMKRAMDWDD  224

Query  683   EGDGIDLTLW  654
              G  IDLTLW
Sbjct  225   IGCVIDLTLW  234



>gb|AIL00629.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        ++ +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVTDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSXEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00578.1| C-repeat binding factor 2 [Vitis aestivalis]
Length=253

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 145/226 (64%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPXKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGXRKILETSSVVDTPQLKSQKKVVGVSSXDSKSWEKAGDGFPTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00577.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00631.1| C-repeat binding factor 2 [Vitis labrusca]
Length=253

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 144/226 (64%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIXHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHD AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDXAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKXXEKAGDGFXTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEA FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAXFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|ABF61218.1| CBF/DREB2 transcription factor [Vitis amurensis]
Length=253

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 145/226 (64%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKK R+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCISHKRKTGRKKLRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSIVDTPQLKSQKKVEGVSSVDSKSWEKAGDGFPTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM KGFSWDD    IDL+LW H
Sbjct  204   DEEAVFNMPGLIDSMAEGLLLTPPAMCKGFSWDDAVSHIDLSLWIH  249



>gb|AIL00634.1| C-repeat binding factor 2 [Vitis cinerea]
Length=250

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL----DFFGNAST---------------FL  786
                    +  + SA   +   +S  +D P L       G +S                F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNXPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00647.1| C-repeat binding factor 2 [Vitis palmata]
Length=250

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 146/226 (65%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  21    VSSDSRCPSRCISXKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHDVAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  81    PTPEMAARAHDVAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  140

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  141   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKSWEKAGDGFPTAFV  200

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEAVFN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  201   DEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWIH  246



>ref|XP_008807522.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Phoenix dactylifera]
Length=207

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 122/185 (66%), Gaps = 22/185 (12%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KRRAGRKKFRETRHPVY GVR RN  KWVCEVREP KKSRIWLGT+ATPEMAARAHD+AA
Sbjct  43    KRRAGRKKFRETRHPVYHGVRERNGGKWVCEVREPRKKSRIWLGTYATPEMAARAHDIAA  102

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG+AA LNFP +A +LP   S S  D                     I R  S  A 
Sbjct  103   MALRGQAALLNFPDSAWTLPPPASSSAED---------------------IRRAASKAAE  141

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
                 T+ LP       A+ F+DEEA+FN P LLD+MA G+++TPPAM+KGF WD     +
Sbjct  142   MFRPTVSLPAPQ-AQPAAVFVDEEALFNKPGLLDDMARGLMLTPPAMQKGFDWDGVECQM  200

Query  668   DLTLW  654
             DL+LW
Sbjct  201   DLSLW  205



>emb|CAN75246.1| hypothetical protein VITISV_027054 [Vitis vinifera]
Length=253

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 142/217 (65%), Gaps = 29/217 (13%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ G+KKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    ISHKRKTGKKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        I  +
Sbjct  95    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFIMDN  154

Query  866   HSA---EAASSSRTIDLPGL---------------------DFFGNASTFLDEEAVFNLP  759
              SA   +   +S  +D P L                     D F  A  F+DEEA FN+P
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKXWEKAGDGFXTA--FVDEEAXFNMP  212

Query  758   ALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
              L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  213   GLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>ref|XP_002267961.1| PREDICTED: dehydration-responsive element-binding protein 1B 
[Vitis vinifera]
 gb|AAR28676.1| CBF-like transcription factor [Vitis vinifera]
 gb|AIL00721.1| C-repeat binding factor 3 [Vitis vinifera]
 gb|AIL00722.1| C-repeat binding factor 3 [Vitis labrusca]
 gb|AIL00723.1| C-repeat binding factor 3 [Vitis labrusca]
 gb|AIL00724.1| C-repeat binding factor 3 [Vitis vinifera]
 gb|AIL00725.1| C-repeat binding factor 3 [Vitis vinifera]
 gb|AIL00726.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00727.1| C-repeat binding factor 3 [Vitis vinifera]
 gb|AIL00728.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 140/213 (66%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG  AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                    +G+++ F+DEEA+FN+P L
Sbjct  144   HVTPCSEELETSCSEDSPQLESRKKVVGVALEDSESSEGAPYGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00635.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        ++ +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVTDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>ref|XP_011090115.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Sesamum indicum]
Length=178

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 126/187 (67%), Gaps = 20/187 (11%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KR +GRK F+ETRHPVYRGVRRR+  KWVCEVREPNKKS+IWLGTF+ PEMAA AHDVAA
Sbjct  7     KRSSGRKVFKETRHPVYRGVRRRSRGKWVCEVREPNKKSKIWLGTFSNPEMAAVAHDVAA  66

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG+ A LNFP +   LPR  S S  DI++AA Q A              RD   +  
Sbjct  67    LALRGDNAMLNFPSSTYRLPRPHSSSHQDIKSAAAQAAREFKDE------FERDRGEDE-  119

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW--DDEGD  675
                        D  G    F+DEEA+F++P LLD+MAEGML+TPPAMKKGF+W   DE +
Sbjct  120   -----------DNIGYRDGFVDEEALFSMPILLDSMAEGMLLTPPAMKKGFNWTSQDEDE  168

Query  674   GIDLTLW  654
              IDLTLW
Sbjct  169   VIDLTLW  175



>gb|AIL00637.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00648.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana---ppppppqfPCISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP      P +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVXDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSXEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00640.1| C-repeat binding factor 2 [Vitis vinifera]
 gb|AIL00641.1| C-repeat binding factor 2 [Vitis labrusca]
 gb|AIL00650.1| C-repeat binding factor 2 [Vitis vinifera]
Length=253

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 141/217 (65%), Gaps = 29/217 (13%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ G KKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    IXHKRKTGXKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
              AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    XAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSA---EAASSSRTIDLPGL---------------------DFFGNASTFLDEEAVFNLP  759
              SA   +   +S  +D P L                     D F  A  F+DEEA+FN+P
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKXXEKAGDGFXTA--FVDEEAMFNMP  212

Query  758   ALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
              L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  213   GLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00608.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00609.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 144/215 (67%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKLKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana---ppppppqfPCISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP      P ++ +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVTDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00632.1| C-repeat binding factor 2 [Vitis vinifera]
Length=253

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 140/215 (65%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ G KKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    IXHKRKTGXKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
              AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    XAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEA+FN+P L
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKRREKAGDGFXTAFVDEEAMFNMPGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00574.1| C-repeat binding factor 2 [Vitis vinifera]
Length=253

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 145/226 (64%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHD AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDAAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKRREKAGDGFXTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00614.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00622.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00623.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00624.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00625.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00639.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00649.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSXEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00636.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 141/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVXDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00612.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00616.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00626.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00627.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00628.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVXDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>ref|XP_003540786.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Glycine max]
 gb|KHN21118.1| Dehydration-responsive element-binding protein 1F [Glycine soja]
Length=229

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHPVYRGVR+RN +KWVCE+REP KKSRIW+GT+ TPEMAARAHDVA
Sbjct  49    HKRKAGRKKFRETRHPVYRGVRQRNRNKWVCEIREPIKKSRIWVGTYPTPEMAARAHDVA  108

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEA  852
              LAL G +A  NFP +   LP A S S  DIR AA     A    P      S  ++ + 
Sbjct  109   VLALSGTSANFNFPDSVSLLPLAKSRSAVDIREAAKATTTAEAFIPNTVFACSHKNAEDT  168

Query  851   ASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDG  672
               +    D         +  F DEEAV+N+P LLD+MAEG+LITPP+MK+   WDD G  
Sbjct  169   CLNIGMHD-------DGSEMFFDEEAVYNMPGLLDSMAEGLLITPPSMKRAMDWDDIGCV  221

Query  671   IDLTLW  654
             IDLTLW
Sbjct  222   IDLTLW  227



>emb|CBI17075.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 138/205 (67%), Gaps = 19/205 (9%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHD AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDAAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfP----CISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLI  723
                     +    + E A              G  + F+DEEA+FN+P L+D+MAEG+L+
Sbjct  144   SSSSTPFVMDNMSAGEKAGD------------GFRTAFVDEEAMFNMPGLIDSMAEGLLL  191

Query  722   TPPAMKKGFSWDDEGDGIDLTLWKH  648
             TPPAM +GFSWDD    IDL+LW H
Sbjct  192   TPPAMCEGFSWDDAVSHIDLSLWNH  216



>gb|AIL00610.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00611.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00613.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKLKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVXDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00591.1| C-repeat binding factor 2 [Vitis rupestris]
 gb|AIL00615.1| C-repeat binding factor 2 [Vitis rupestris]
Length=250

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|KHN38660.1| Dehydration-responsive element-binding protein 1F [Glycine soja]
Length=236

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 121/190 (64%), Gaps = 7/190 (4%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHPV+RGVR+RN +KWVCE+REP KKSR+W+GT+ TPEMAARAHDVA
Sbjct  48    HKRKAGRKKFRETRHPVFRGVRQRNGNKWVCEIREPIKKSRVWVGTYPTPEMAARAHDVA  107

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHS---  861
              LAL G +A  NFP +   LP A S S             A           S  H+   
Sbjct  108   VLALSGTSAKFNFPDSVSLLPLAKSHS---AVDIREAAKAASIEAFIPNTAFSSSHNNSN  164

Query  860   -AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
               E  ++  T    G+    + + F DEEAV+N+P LLD+MAEG+LITPP+MK+   WDD
Sbjct  165   FGENGNAEDTCLNIGMHDDESETMFFDEEAVYNMPGLLDSMAEGLLITPPSMKRAMDWDD  224

Query  683   EGDGIDLTLW  654
              G  IDLTLW
Sbjct  225   IGCVIDLTLW  234



>ref|XP_002270637.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Vitis vinifera]
 gb|AIL00575.1| C-repeat binding factor 2 [Vitis vinifera]
Length=253

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 146/228 (64%), Gaps = 32/228 (14%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHD AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDAAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGL---------------------DFFGNAST  792
                    +  + SA   +   +S  +D P L                     D F  A  
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKRREKAGDGFRTA--  201

Query  791   FLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             F+DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  202   FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00605.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 141/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00573.1| C-repeat binding factor 2 [Vitis vinifera]
Length=255

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 140/228 (61%), Gaps = 30/228 (13%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana------  909
              TPEMAARAHD AALALRG  A+LNFP +A  LPR  S S  D++ AA+Q A A      
Sbjct  84    PTPEMAARAHDXAALALRGHXASLNFPDSAWRLPRXRSSSAGDVQFAAIQAAKAFQQPPS  143

Query  908   ------------ppppppqfPCISRDHSAEAASSSRTIDLPGLDFF---------GNAST  792
                                    S   + +  S  + + +  +D           G  + 
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSISKRREKAGDGFPTA  203

Query  791   FLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             F+DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  251



>gb|AIL00572.1| C-repeat binding factor 2 [Vitis vinifera]
Length=255

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 30/228 (13%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana------  909
              TPEMAARAHDVAALALRG +A+LNFP +A  LPR  S S  D++ AA+Q A A      
Sbjct  84    PTPEMAARAHDVAALALRGHSASLNFPDSAWRLPRPRSSSAGDVQFAAIQAAKAFQQPPS  143

Query  908   ------------ppppppqfPCISRDHSAEAASSSRTIDLPGLDFF---------GNAST  792
                                    S   + +  S  + + +  +D           G  + 
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSISKRREKAGDGFRTA  203

Query  791   FLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             F+DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  251



>gb|ABO48367.1| C-repeat binding facor 6 [Populus trichocarpa]
Length=197

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 127/207 (61%), Gaps = 40/207 (19%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
                K +AGRKKF+ETRHPVYRGVRRRN +KWVCEVREPNKKSRIW+GTF +PEMAARAHD
Sbjct  12    CFMKNKAGRKKFKETRHPVYRGVRRRNGNKWVCEVREPNKKSRIWVGTFKSPEMAARAHD  71

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             VAALAL+GE AALNF  +A  LPRA S S                         +RD   
Sbjct  72    VAALALKGELAALNFLDSALILPRAKSSS-------------------------ARDIQR  106

Query  857   EAASSSRTI-------------DLPGLDFFGNAS--TFLDEEAVFNLPALLDNMAEGMLI  723
              A +++  +             D   L    N S  TF DEEA+FN+P LLD+MAEG+++
Sbjct  107   AALAATEVLGRSASSCSSSSSPDHKKLSCVPNHSNATFFDEEALFNMPGLLDSMAEGLIL  166

Query  722   TPPAMKKGFSWDDEGDGIDLTLWKH*Y  642
             TPPAM +G  WDD     DLTLW+  Y
Sbjct  167   TPPAMARGVYWDDMACSTDLTLWEDDY  193



>gb|AIL00579.1| C-repeat binding factor 2 [Vitis vinifera]
Length=253

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 144/226 (64%), Gaps = 28/226 (12%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              TPEMAARAHD AALALRG  A+LNFP +A  LPR  S S  D++ AA+Q A A   PP 
Sbjct  84    PTPEMAARAHDXAALALRGHFASLNFPDSAWRLPRXRSSSAGDVQFAAIQAAKAFQQPPS  143

Query  890   qfPC---ISRDHSA---EAASSSRTIDLPGLDFF-------------------GNASTFL  786
                    +  + SA   +   +S  +D P L                      G  + F+
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSKRREKAGDGFXTAFV  203

Query  785   DEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   DEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>gb|AIL00589.1| C-repeat binding factor 2 [Vitis riparia]
 gb|AIL00590.1| C-repeat binding factor 2 [Vitis riparia]
Length=250

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 142/215 (66%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  32    IPHKLKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  91

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
             VAALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  92    VAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  151

Query  866   HSA---EAASSSRTIDLPGL----DFFGNAST---------------FLDEEAVFNLPAL  753
              SA   +   +S  +D P L       G +S                F+DEEAVFN+P L
Sbjct  152   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSVDSKSWEKAGDGFPTAFVDEEAVFNMPGL  211

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  212   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  246



>gb|AIL00571.1| C-repeat binding factor 2 [Vitis vinifera]
Length=255

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 140/228 (61%), Gaps = 30/228 (13%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana------  909
              TPEMAARAHD AALALRG  A+LNFP +A  LPR  S S  D++ AA+Q A A      
Sbjct  84    PTPEMAARAHDXAALALRGHFASLNFPDSAWRLPRXRSSSAGDVQFAAIQAAKAFQQPPS  143

Query  908   ------------ppppppqfPCISRDHSAEAASSSRTIDLPGLDFF---------GNAST  792
                                    S   + +  S  + + +  +D           G  + 
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSISKRREKAGDGFRTA  203

Query  791   FLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             F+DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  251



>ref|XP_010940400.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Elaeis guineensis]
Length=202

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 122/185 (66%), Gaps = 22/185 (12%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KRRAGRKKFRETRHPVY GVR R   KWVCEVREP+KKSRIWLGT+A PEMAARAHDVAA
Sbjct  38    KRRAGRKKFRETRHPVYHGVRERKGGKWVCEVREPHKKSRIWLGTYAKPEMAARAHDVAA  97

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG+AA LNFP +A SLPRA S S  D                     I R  S  A 
Sbjct  98    IALRGKAALLNFPDSAWSLPRAASSSAED---------------------IRRAASKAAE  136

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
                  +  P  +    A+ F+DEEA+FN+P LLD+MA G+++TPPAM++ F WD     +
Sbjct  137   MFRPAVSSPAPE-VRPAAVFVDEEALFNMPGLLDDMARGLMLTPPAMQEAFDWDSVECHM  195

Query  668   DLTLW  654
             DL+LW
Sbjct  196   DLSLW  200



>gb|AIL00576.1| C-repeat binding factor 2 [Vitis vinifera]
Length=255

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 140/228 (61%), Gaps = 30/228 (13%)
 Frame = -2

Query  1241  IAGDQAAP---VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             ++ D   P   +  KR+ GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF
Sbjct  24    VSSDSRCPSRCIPHKRKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTF  83

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana------  909
              TPEMAARAHD AALALRG  A+LNFP +A  LPR  S S  D++ AA+Q A A      
Sbjct  84    PTPEMAARAHDXAALALRGHXASLNFPDSAWRLPRXRSSSAGDVQFAAIQAAKAFQQPPS  143

Query  908   ------------ppppppqfPCISRDHSAEAASSSRTIDLPGLDFF---------GNAST  792
                                    S   + +  S  + + +  +D           G  + 
Sbjct  144   SSSSTPFVMDNMSAGSRKILETSSVVDTPQLKSQKKVVGVSSMDSISKRREKAGDGFRTA  203

Query  791   FLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             F+DEEA+FN+P L+D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  204   FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDALSDIDLSLWNH  251



>gb|AIL00651.1| C-repeat binding factor 2 [Vitis vinifera]
Length=253

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 139/215 (65%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+ G KKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  35    IXHKRKTGXKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  94

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
              AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  95    XAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  154

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEA FN+P L
Sbjct  155   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKXXEKAGDGFPTAFVDEEAXFNMPGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  215   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  249



>ref|XP_007132398.1| hypothetical protein PHAVU_011G091400g [Phaseolus vulgaris]
 gb|ESW04392.1| hypothetical protein PHAVU_011G091400g [Phaseolus vulgaris]
Length=222

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 124/196 (63%), Gaps = 11/196 (6%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHPVYRGVR+RN +KWVCE+REP KKSRIW+GT+ TPEMAARAHDVA
Sbjct  30    HKRKAGRKKFRETRHPVYRGVRQRNGNKWVCEIREPIKKSRIWVGTYPTPEMAARAHDVA  89

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR------  870
              LAL G +A  NFP +   LP A SCS  DIR AA          P      S       
Sbjct  90    VLALNGISANFNFPDSVSLLPLAKSCSAPDIREAAKAATLDQAFIPIPNTAFSSSSHGNS  149

Query  869   --DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF  696
               + +     S  +I +   +   + + F DEEA++N+P LLD+MAEG+LITPP+ K   
Sbjct  150   NFEENGNGEDSCLSISMQNDE---SETVFFDEEALYNMPGLLDSMAEGLLITPPSTKTAL  206

Query  695   SWDDEGDGIDLTLWKH  648
              WD  G  IDLTLW +
Sbjct  207   DWDHIGSEIDLTLWNN  222



>gb|AIL00730.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 139/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG  AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTPCSEELETSCSEDSPQLESRKKVVGVXLEDSESSZXAPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00731.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 139/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG  AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTPCSEELETSCSEDSPQLESRKKVVGXXLEDSESSZXAPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00729.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 139/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG  AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTPCSEELETSCSEDSPQLESRKKVVGVALEDSESSEGAPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>ref|XP_008807523.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Phoenix dactylifera]
Length=207

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 121/185 (65%), Gaps = 22/185 (12%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KRRAGRKKFRETRHPVY GVR RN  KWVCEVREP KKSRIWLGT+ATPEMAARAHD+AA
Sbjct  43    KRRAGRKKFRETRHPVYHGVRERNGGKWVCEVREPRKKSRIWLGTYATPEMAARAHDIAA  102

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG+AA LNFP +A +LP   S S  D                     I R  S  A 
Sbjct  103   MALRGKAALLNFPDSAWTLPPPASSSAED---------------------IRRAASKAAE  141

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
                 T+ LP       A+  +DEEA+FN P LLD+MA G+++TPPAM+KGF WD     +
Sbjct  142   MFRPTVSLPAPQ-AQPAAVVVDEEALFNKPGLLDDMARGLMLTPPAMQKGFDWDGVECQM  200

Query  668   DLTLW  654
             DL+LW
Sbjct  201   DLSLW  205



>gb|AIL00538.1| C-repeat binding factor 1 [Vitis rubra]
 gb|AIL00540.1| C-repeat binding factor 1 [Vitis palmata]
Length=251

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 142/214 (66%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR--DHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P    ++   D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLTSALDNMS  154

Query  857   EAASSSRTIDL------PGL-----------------DFFGNAST--FLDEEAVFNLPAL  753
               A S + ++       P L                 +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00633.1| C-repeat binding factor 2 [Vitis riparia]
Length=251

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 139/215 (65%), Gaps = 25/215 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  K + GRKKFR+TRHP+YRGVR+RNE+KWV EVREP+KKSRIWLGTF TPEMAARAHD
Sbjct  33    IPHKXKTGRKKFRKTRHPIYRGVRQRNENKWVSEVREPSKKSRIWLGTFPTPEMAARAHD  92

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC---ISRD  867
              AALALRG  A+LNFP +A  LPRA S S  D++ AA+Q A A   PP        +  +
Sbjct  93    XAALALRGHFASLNFPDSAWRLPRARSSSAGDVQFAAIQAAKAFQQPPSSSSSTPFVMDN  152

Query  866   HSA---EAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
              SA   +   +S  +D P L                      G  + F+DEEA FN+P L
Sbjct  153   MSAGSRKILETSSVVDTPQLKSQKKVVGVSSXDSKXXEKAGDGFXTAFVDEEAXFNMPGL  212

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +D+MAEG+L+TPPAM +GFSWDD    IDL+LW H
Sbjct  213   IDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWNH  247



>gb|KDO61045.1| hypothetical protein CISIN_1g038285mg, partial [Citrus sinensis]
Length=178

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 132/192 (69%), Gaps = 16/192 (8%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             Q +   QKR+AGRKKF+ETRHPVY+GVRRRN  KWVCE+REPNKKSRIWLGTFA+P+ AA
Sbjct  1     QKSSTAQKRKAGRKKFQETRHPVYKGVRRRN-GKWVCELREPNKKSRIWLGTFASPDKAA  59

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RA+D AALALRG +A+LNFP AA +L RA S    DI+ AA++ A     P    PC+  
Sbjct  60    RAYDAAALALRGNSASLNFPEAAGALRRAKSDDVRDIQCAAMEAAEKLSSPSSSKPCM--  117

Query  869   DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             + ++E    SR               F+DEE VFN+P ++D MAE +++TPPAMK GF W
Sbjct  118   ESNSENVQDSR-------------REFVDEEEVFNMPGIIDGMAEALILTPPAMKSGFKW  164

Query  689   DDEGDGIDLTLW  654
             DD  + ++ TLW
Sbjct  165   DDLDETVEFTLW  176



>gb|AIL00704.1| C-repeat binding factor 3 [Vitis aestivalis]
Length=239

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAKSSSARDIQXAALAAAMAFRPAAPSSSSSXISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00712.1| C-repeat binding factor 3 [Vitis rupestris]
 gb|AIL00716.1| C-repeat binding factor 3 [Vitis rupestris]
Length=239

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLEXRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00701.1| C-repeat binding factor 3 [Vitis cinerea]
Length=239

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00698.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQMAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00702.1| C-repeat binding factor 3 [Vitis labrusca]
 gb|AIL00703.1| C-repeat binding factor 3 [Vitis labrusca]
 gb|AIL00705.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|ABF61219.1| CBF/DREB3 transcription factor [Vitis amurensis]
Length=239

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVTLEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00711.1| C-repeat binding factor 3 [Vitis rupestris]
Length=239

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00706.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAKSSSARDIQXAALAAAMAFRPAAPSSSSSXISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPPLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>ref|XP_008777348.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Phoenix dactylifera]
Length=228

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 131/198 (66%), Gaps = 23/198 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRR-NEDKWVCEVREPNKKSRIWLGTFATPEMaarah  1041
              + KRRAGRKKF+ETRHPVYRGVRRR N  KWVCEVREP+ KSR+WLG+FATPEMAARAH
Sbjct  42    TMLKRRAGRKKFKETRHPVYRGVRRRSNGGKWVCEVREPHSKSRLWLGSFATPEMAARAH  101

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCS---------padiraaalqlanappppppq  888
             DVAA+AL GE+A LNFP +  +LPRA++ S          A  +        + PPP   
Sbjct  102   DVAAIALHGESAKLNFPDSTHALPRASTTSPDDIRCAAVVAAEKYRPDSSPMSLPPPKTN  161

Query  887   fPCISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAM  708
                ++     +AA ++  +             F+DEEA+FN+P L+D+MAEG+L+TPPAM
Sbjct  162   VTLLTEKKEEKAADAASEV-------------FVDEEALFNMPGLVDSMAEGLLLTPPAM  208

Query  707   KKGFSWDDEGDGIDLTLW  654
             +KGF WD     +DL+LW
Sbjct  209   QKGFDWDGAECHVDLSLW  226



>gb|AIL00737.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKXKSRIWLGTFXTPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYISHVTX  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVALEDSESSZXAPXGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00710.1| C-repeat binding factor 3 [Vitis rupestris]
 gb|AIL00713.1| C-repeat binding factor 3 [Vitis rupestris]
 gb|AIL00714.1| C-repeat binding factor 3 [Vitis rupestris]
 gb|AIL00715.1| C-repeat binding factor 3 [Vitis rupestris]
Length=239

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLENRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00697.1| C-repeat binding factor 3 [Vitis aestivalis]
Length=239

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-XKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQMAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00557.1| C-repeat binding factor 1 [Vitis aestivalis]
Length=251

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 140/216 (65%), Gaps = 28/216 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLWKH  648
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW +
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWNY  250



>gb|AIL00542.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00543.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00544.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00545.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00546.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00547.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00548.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00549.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00550.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00551.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00552.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00553.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00554.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00555.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00556.1| C-repeat binding factor 1 [Vitis labrusca]
Length=251

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 140/216 (65%), Gaps = 28/216 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLWKH  648
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW +
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLWNY  250



>gb|AIL00732.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG  AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                      +++ F+DEEA+FN+P L
Sbjct  144   HVTPCSEELETSCSEDSPQLESRKKVVGVXLEDSESSZXAPXXSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>ref|XP_006430282.1| hypothetical protein CICLE_v10013766mg [Citrus clementina]
 gb|ESR43522.1| hypothetical protein CICLE_v10013766mg [Citrus clementina]
Length=183

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 132/192 (69%), Gaps = 16/192 (8%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             Q +   QKR+AGRKKF+ETRHPVY+GVRRRN  KWVCE+REPNKKSRIWLGTFA+P+ AA
Sbjct  6     QKSSTAQKRKAGRKKFQETRHPVYKGVRRRN-GKWVCELREPNKKSRIWLGTFASPDKAA  64

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RA+D AALALRG +A+LNFP AA +L RA S    DI+ AA++ A     P    PC+  
Sbjct  65    RAYDAAALALRGNSASLNFPEAAGALRRAKSDDVRDIQCAAMEAAEKLSSPSSSKPCM--  122

Query  869   DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             + ++E    SR               F+DEE +FN+P ++D MAE +++TPPAMK GF W
Sbjct  123   ESNSENVQDSR-------------REFVDEEEMFNMPGIIDGMAEALILTPPAMKSGFKW  169

Query  689   DDEGDGIDLTLW  654
             DD  + ++ TLW
Sbjct  170   DDLDETVEFTLW  181



>ref|XP_006593271.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Glycine max]
Length=234

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 123/200 (62%), Gaps = 38/200 (19%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVREPNKKSRIWLGT+ TPEMAARAHD
Sbjct  59    ISHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVREPNKKSRIWLGTYPTPEMAARAHD  118

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             VA LAL+G +A  NFP +   LP A S S AD+R                          
Sbjct  119   VAVLALKGTSALFNFPDSVSLLPVAKSSSAADVRV-------------------------  153

Query  857   EAASSSRTIDLPGLDFFGNAST------------FLDEEAVFNLPALLDNMAEGMLITPP  714
              AAS   TI  P       +S+            F DEEA +N+P LLD+MAEG+LITPP
Sbjct  154   -AASKVSTIFCPSYSSVTLSSSSPSNSRVKAKPLFFDEEAFYNMPLLLDSMAEGLLITPP  212

Query  713   AMKKGFSWDDEGDGIDLTLW  654
             +MK+ F WD     IDLTLW
Sbjct  213   SMKRVFDWDQVDCEIDLTLW  232



>gb|AIL00523.1| C-repeat binding factor 1 [Vitis cinerea]
 gb|AIL00532.1| C-repeat binding factor 1 [Vitis cinerea]
Length=251

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 142/214 (66%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRTIDL-PGLDF----------------------FGNAST--FLDEEAVFNLPAL  753
               A S + ++  P +++                       G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVEWPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|KHN27668.1| Dehydration-responsive element-binding protein 1F [Glycine soja]
Length=252

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 132/197 (67%), Gaps = 14/197 (7%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVREPNKKSRIWLGT+ TPEMAARAHD
Sbjct  59    ISHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVREPNKKSRIWLGTYPTPEMAARAHD  118

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             VA LAL+G +A  NFP +   LP A S S AD+R AA +++    P        S   S+
Sbjct  119   VAVLALKGTSALFNFPDSVSLLPVAKSSSAADVRVAASKVSTIFCPSYS-----SVTLSS  173

Query  857   EAASSSRTIDLPGL--DFFGN-------ASTFLDEEAVFNLPALLDNMAEGMLITPPAMK  705
              + S+SR    P L  DF           S F DEEA +N+P LLD+MAEG+LITPP+MK
Sbjct  174   SSPSNSRVKTKPCLVDDFVKTENNVDEAKSVFFDEEAFYNMPLLLDSMAEGLLITPPSMK  233

Query  704   KGFSWDDEGDGIDLTLW  654
             + F WD      DLTLW
Sbjct  234   RAFDWDQVDCETDLTLW  250



>gb|AIL00536.1| C-repeat binding factor 1 [Vitis cinerea]
Length=251

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 142/214 (66%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRTIDL-PGLDF----------------------FGNAST--FLDEEAVFNLPAL  753
               A S + ++  P +++                       G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVEWPKLRSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>ref|XP_006481833.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Citrus sinensis]
Length=183

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 16/192 (8%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             Q +   QKR+AGRKKF+ETRHPVY+GVRRRN  KWVCE+REPNKKSRIWLGTFA+P+ AA
Sbjct  6     QKSSTAQKRKAGRKKFQETRHPVYKGVRRRN-GKWVCELREPNKKSRIWLGTFASPDKAA  64

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RA+D AALALRG +A+LNFP  A +L RA S    DI+ AA++ A     P    PC+  
Sbjct  65    RAYDAAALALRGNSASLNFPEVAGALRRAKSDDVRDIQCAAMEAAEKLSSPSSSKPCM--  122

Query  869   DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             + ++E    SR               F+DEE VFN+P ++D MAE +++TPPAMK GF W
Sbjct  123   ESNSENVQDSR-------------REFVDEEEVFNMPGIIDGMAEALILTPPAMKSGFKW  169

Query  689   DDEGDGIDLTLW  654
             DD  + ++ TLW
Sbjct  170   DDLDETVEFTLW  181



>gb|ABU55656.1| CBF1-like protein [Vitis amurensis]
Length=247

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  31    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  90

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  91    ALALRGHFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  150

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  151   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  210

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  211   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  244



>gb|AIL00558.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>ref|XP_010243826.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Nelumbo nucifera]
Length=229

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 136/194 (70%), Gaps = 8/194 (4%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             A  V  KR+AGRKKFRETRHP+YRGVR R   KWVCEVREPNKKSRIWLGTF  PEMAAR
Sbjct  38    AVVVGHKRKAGRKKFRETRHPIYRGVRERKGGKWVCEVREPNKKSRIWLGTFPCPEMAAR  97

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALALRG++A LNF  +A  LPRA S S  DI+ AAL+ A A  P      C +  
Sbjct  98    AHDVAALALRGKSAPLNFLDSAWLLPRAKSSSATDIQIAALEAAEAFRPVKSASACTTSS  157

Query  866   HSAEAASS---SRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF  696
              S+        +RT  +P       ++TFLDEEA+FN+P L+D+MAEGML+TPPAM+ G 
Sbjct  158   TSSAYLPQMVINRTKKVP-----EPSTTFLDEEALFNMPGLIDSMAEGMLLTPPAMQNGL  212

Query  695   SWDDEGDGIDLTLW  654
             ++DD    +DLTLW
Sbjct  213   NFDDVDCHVDLTLW  226



>gb|AIL00537.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|ABU55657.1| CBF1-like protein [Vitis aestivalis]
Length=247

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 141/214 (66%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  31    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  90

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  91    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  150

Query  857   EAASSSRTIDL------PGL-----------------DFFGNAST--FLDEEAVFNLPAL  753
               A S + ++       P L                 +  G+ ST  F+DEEA+FN+  L
Sbjct  151   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  210

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  211   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  244



>gb|AIL00539.1| C-repeat binding factor 1 [Vitis palmata]
Length=251

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 141/214 (66%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLXSALDNMS  154

Query  857   EAASSSRTIDL------PGL-----------------DFFGNAST--FLDEEAVFNLPAL  753
               A S + ++       P L                 +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00521.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00522.1| C-repeat binding factor 1 [Vitis aestivalis]
 gb|AIL00541.1| C-repeat binding factor 1 [Vitis aestivalis]
Length=251

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|ABU55659.1| CBF1-like protein [Ampelopsis glandulosa var. brevipedunculata]
Length=247

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 141/214 (66%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  31    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  90

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  91    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  150

Query  857   EAASSSRTIDL------PGL-----------------DFFGNAST--FLDEEAVFNLPAL  753
               A S + ++       P L                 +  G+ ST  F+DEEA+FN+  L
Sbjct  151   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  210

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  211   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  244



>gb|AIL00533.1| C-repeat binding factor 1 [Vitis cinerea]
 gb|AIL00535.1| C-repeat binding factor 1 [Vitis cinerea]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00480.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALKATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00514.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00516.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00517.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00518.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTXVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00534.1| C-repeat binding factor 1 [Vitis cinerea]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 140/216 (65%), Gaps = 28/216 (13%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHD
Sbjct  33    IGHKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHD  92

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDH  864
             VAALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+
Sbjct  93    VAALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDN  152

Query  863   SAEAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLP  759
              +  A S +                        +D    +  G+ ST  F+DEEA+FN+ 
Sbjct  153   MSGVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQ  212

Query  758   ALLDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
              L+++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  213   GLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00526.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00527.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00528.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00529.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00530.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00531.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00500.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVAXSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00699.1| C-repeat binding factor 3 [Vitis palmata]
Length=239

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQMAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWD+     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDETTSYTDLSLW  236



>gb|AIL00495.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL    A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALXATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AAR28671.1| CBF-like transcription factor [Vitis riparia]
 gb|AIL00472.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00473.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00474.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00476.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00477.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00478.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00481.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00482.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00483.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00484.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00485.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00486.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00489.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00490.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00494.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00496.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00497.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00498.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00499.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00487.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00488.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00493.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00682.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE+R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEMRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DIR A L  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAXLAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00501.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00511.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00512.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPXFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00491.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00492.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL    A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALXATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00479.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 139/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|ABF61217.1| CBF/DREB1 transcription factor [Vitis amurensis]
Length=251

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 140/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR--DHSA  858
             ALALRG  A LNFP +A  LPR  S S  DI+ AAL+   A  P  P    ++   D+ +
Sbjct  95    ALALRGRFATLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPPSSSLASALDNMS  154

Query  857   EAASSSRTIDL------PGL-----------------DFFGNAST--FLDEEAVFNLPAL  753
               A S + ++       P L                 +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MA G+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAVGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>ref|XP_010242642.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Nelumbo nucifera]
Length=220

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 127/186 (68%), Gaps = 7/186 (4%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR RN  KWVC+VREPNKKSRIWLGTF TPEMAARA+DVA
Sbjct  40    HKRKAGRKKFRETRHPIYRGVRERNGGKWVCKVREPNKKSRIWLGTFPTPEMAARAYDVA  99

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEA  852
             ALALRG++  LNFP ++  LPRA S    DI+AAAL+ A A  P        S  H    
Sbjct  100   ALALRGKSTPLNFPDSSCLLPRAKSSLAVDIQAAALEAAEAFRPATASCTSSSSSHQGTK  159

Query  851   ASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDG  672
               S   +         +++ FLDEE +FN+P L+ +MAEG+L+TPP M+KG  WDD    
Sbjct  160   VESEEKV-------AEDSTMFLDEEELFNMPGLIHSMAEGLLLTPPPMQKGPDWDDMDCH  212

Query  671   IDLTLW  654
             +D TLW
Sbjct  213   MDFTLW  218



>gb|AAR28675.1| CBF-like transcription factor [Vitis riparia]
 gb|AIL00652.1| C-repeat binding factor 3 [Vitis labrusca]
 gb|AIL00653.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00654.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00655.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00656.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00657.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00658.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00659.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00660.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00661.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00662.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00663.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00664.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00665.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00666.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00667.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00668.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00669.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00670.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00671.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00672.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00673.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00674.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00675.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00676.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00677.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00680.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00684.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00685.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00686.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00687.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00688.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE+R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEMRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DIR AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00679.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 136/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE+R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEMRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             A DVAALA RG+ AALNFP +   LPRA S S  DIR A L  A A  P  P        
Sbjct  84    AXDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAXLAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>ref|XP_007150096.1| hypothetical protein PHAVU_005G126300g [Phaseolus vulgaris]
 gb|ESW22090.1| hypothetical protein PHAVU_005G126300g [Phaseolus vulgaris]
Length=246

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 132/194 (68%), Gaps = 8/194 (4%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+ GRKKFRETRHPVYRGVR+RN D+WVCEVREPNKKSRIWLGT++TPEMAARAHDVA
Sbjct  55    HKRKTGRKKFRETRHPVYRGVRQRNGDRWVCEVREPNKKSRIWLGTYSTPEMAARAHDVA  114

Query  1031  alalrgeaaaLNFPG--AAESLPRATSCSpadiraaalqlan----appppppqfPCISR  870
              LAL+G +A LNFP   +   LP A S S ADIR AA +L+     +          I  
Sbjct  115   VLALKGTSAVLNFPDSHSVSLLPVAKSSSAADIRLAAAKLSEVFPPSSSSTNDSRVKIET  174

Query  869   DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             +  +  A +     L   D F N S F DEEA++N+P LLD+MAEG+LITPP+M++ F W
Sbjct  175   NPCSLEAVADFANTLNNDDGF-NKSMFFDEEAIYNMPGLLDSMAEGLLITPPSMRR-FDW  232

Query  689   DDEGDGIDLTLWKH  648
             D+     DLTLW +
Sbjct  233   DEVDCETDLTLWTY  246



>gb|AIL00700.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQMAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDFF-------------------GNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSQSAPDGSSTVFXDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00683.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE+R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEMRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DIR AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H     E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACXEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00515.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 135/214 (63%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  L  P+++S     + A     A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLXRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00709.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 136/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             A DVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AXDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                      +++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVXLEDSESSZXXPHXSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00506.1| C-repeat binding factor 1 [Vitis rupestris]
Length=251

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 135/214 (63%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  L  P+++S     + A     A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLXRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPLFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00510.1| C-repeat binding factor 1 [Vitis rupestris]
 gb|AIL00560.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 135/214 (63%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  L  P+++S     + A     A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLXRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPXFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00502.1| C-repeat binding factor 1 [Vitis rupestris]
 gb|AIL00503.1| C-repeat binding factor 1 [Vitis rupestris]
 gb|AIL00504.1| C-repeat binding factor 1 [Vitis rupestris]
 gb|AIL00505.1| C-repeat binding factor 1 [Vitis rupestris]
 gb|AIL00507.1| C-repeat binding factor 1 [Vitis rupestris]
Length=251

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 135/214 (63%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  L  P+++S     + A     A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLRRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPLFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00736.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKXKSRIWLGTFXTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGBFAALNFPDSXSRLPRAKSSSAXDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLD----FFGNA---------------STFLDEEAVFNLPAL  753
             H    +E   +S + D P L+      G A               + F+DEEA+FN+P L
Sbjct  144   HVTXCSEELETSCSEDSPQLESRKKVVGVALEDSESSEGXPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00738.1| C-repeat binding factor 3 [Vitis vinifera]
Length=239

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 136/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKXKSRIWLGTFXTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             A DVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AXDVAALAFRGBFAALNFPDSXSRLPRAKSSSAXDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLD----FFGNA---------------STFLDEEAVFNLPAL  753
             H    +E   +S + D P L+      G A               + F+DEEA+FN+P L
Sbjct  144   HVTXCSEELETSCSEDSPQLESRKKVVGVALEDSESSEGXPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00509.1| C-repeat binding factor 1 [Vitis rupestris]
Length=251

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 135/214 (63%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  L  P+++S     + A     A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLRRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPLFMDEEAMFNMQXL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|ADY17818.1| CBF1 transcription factor [Vitis amurensis]
 gb|AER27641.1| AP2/ERF protein [Vitis amurensis]
Length=251

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRE RHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFREIRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00734.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKXKSRIWLGTFXTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGBFAALNFPDSXSRLPRAKSSSAGDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLD----FFGNA---------------STFLDEEAVFNLPAL  753
             H    +E   +S + D P L+      G A               + F+DEEA+FN+P L
Sbjct  144   HVTXCSEELETSCSEDSPQLESRKKVVGVALEDSESSEGXPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00719.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKXKSRIWLGTFXTPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSHISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPXLESRKKVVGVALEDSESSZXAPXGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00559.1| C-repeat binding factor 1 [Vitis labrusca]
Length=251

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGV +RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVXQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AHG97393.1| C-repeat-binding transcription factor 3 [Vitis vinifera]
Length=239

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF  PEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPAPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSASRLPRAMSSSARDIQVAALAAAMAFRPAAPSSSSSHISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVTLEDSESSQSAPHGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00707.1| C-repeat binding factor 3 [Vitis palmata]
 gb|AIL00708.1| C-repeat binding factor 3 [Vitis rubra]
Length=239

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSYSARDIQVAALAAAMAFRPAAPSSSSSHIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00513.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP  KSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLXKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPXFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00520.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 140/214 (65%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+L FP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLXFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRTIDL------PGL-----------------DFFGNAST--FLDEEAVFNLPAL  753
               A S + ++       P L                 +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00475.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+L FP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLXFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00678.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00681.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE+R+P  KSRIW GTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEMRDPKNKSRIWXGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DIR AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00696.1| C-repeat binding factor 3 [Vitis aestivalis]
Length=239

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 139/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALALRG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALALRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSHIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVTLEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWD+     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDETTSYTDLSLW  236



>gb|AIL00508.1| C-repeat binding factor 1 [Vitis rupestris]
Length=251

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 134/214 (63%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  L  P+++S     + A     A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLXRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPLFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLXTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00519.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+L FP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLIFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AAR28672.1| CBF-like transcription factor [Vitis riparia]
Length=251

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNF  +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFSDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00525.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  I L+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIYLSLW  248



>gb|AIL00691.1| C-repeat binding factor 3 [Vitis cinerea]
 gb|AIL00692.1| C-repeat binding factor 3 [Vitis cinerea]
 gb|AIL00693.1| C-repeat binding factor 3 [Vitis cinerea]
 gb|AIL00694.1| C-repeat binding factor 3 [Vitis cinerea]
Length=239

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSHIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVTLEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWD+     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDETTSYTDLSLW  236



>gb|ACD45468.1| CBF/DREB3 transcription factor [Vitis amurensis]
 gb|ADY17813.1| CBF3 transcription factor [Vitis amurensis]
Length=239

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 134/209 (64%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF  PEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPAPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSHISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVTLEDSGSSQSAPHGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00735.1| C-repeat binding factor 3 [Vitis labrusca]
Length=239

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 134/209 (64%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF TPEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKNKSRIWLGTFPTPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSTSRLPRAQSSSARDIQVAALAAAMAFRPAAPSSSSSHISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVALEDSESSZXAPXGSSTVFXDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00717.1| C-repeat binding factor 3 [Vitis rupestris]
Length=239

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 136/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEXRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLD----FFGNA---------------STFLDEEAVFNLPAL  753
             H    +E   +S + D P L+      G A               + F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AAR28673.1| CBF-like transcription factor [Vitis vinifera]
Length=251

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 138/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TP+MAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPKMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNASTF--LDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST   +DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVSMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  248



>gb|AIL00690.1| C-repeat binding factor 3 [Vitis riparia]
 gb|AIL00720.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 136/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCE R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEXRDPKXKSRIWLGTFXTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DIR AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLD----FFGNA---------------STFLDEEAVFNLPAL  753
             H    +E   +S + D P L+      G A               + F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGXPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|ACT97164.1| CBF3 [Vitis labrusca x Vitis vinifera]
Length=239

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 134/209 (64%), Gaps = 22/209 (11%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKFRETRHPVYRGVR+RN ++WVCEV +P  KSRIWLGTF  PEMAARAHDV
Sbjct  28    VHKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVLDPKNKSRIWLGTFPAPEMAARAHDV  87

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH---  864
             AALA RG+ AALNFP +A  LPRA S S  DI+ AAL  A A  P  P        H   
Sbjct  88    AALAFRGDFAALNFPDSASRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSHISHVTA  147

Query  863   SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPALLDNM  741
              +E   +S + D P L+                     G+++ F+DEEA+FN+P L+++M
Sbjct  148   CSEELETSCSEDSPQLESRKKVVGVTLEDSESSQSAPHGSSTVFMDEEALFNMPGLINSM  207

Query  740   AEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             AEG+L+ PP M  GFSWDD     DL+LW
Sbjct  208   AEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|AIL00524.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 137/214 (64%), Gaps = 28/214 (13%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
              KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  35    HKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  94

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDHSA  858
             ALALRG  A+L FP +A  LPR  S S  DI+ AAL+   A  P  P       + D+ +
Sbjct  95    ALALRGRFASLIFPDSAWRLPRPKSSSAEDIQVAALEAXKAFNPTAPSSSSLASALDNMS  154

Query  857   EAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEAVFNLPAL  753
               A S +                        +D    +  G+ ST  F+DEEA+FN+  L
Sbjct  155   GVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTTVFMDEEAMFNMQGL  214

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
             +++MAEG+L+TPPAM KGF WDD  D  IDL+LW
Sbjct  215   INSMAEGLLLTPPAMCKGFXWDDATDSHIDLSLW  248



>gb|KHN21448.1| Dehydration-responsive element-binding protein 1F [Glycine soja]
Length=243

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 127/193 (66%), Gaps = 15/193 (8%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+AGRKKFRETRHPVYRGVR+RN +KWVCEVREPNKKSRIWLGT+ +PEMAARAHD
Sbjct  59    IPHKRKAGRKKFRETRHPVYRGVRQRNGNKWVCEVREPNKKSRIWLGTYPSPEMAARAHD  118

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             VA LAL+G +A  NFP +   LP A S S ADIR AA ++++                S+
Sbjct  119   VAVLALKGTSAVFNFPDSVSLLPVANSSSAADIRLAASKVSSVF----------GPSSSS  168

Query  857   EAASSSRTIDLPGLDFFGN-----ASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFS  693
              +   ++   + G     N      + F DEEA +N+P  LD+MAE +LITPP+MK+ F 
Sbjct  169   SSRVETKPCLVDGFVKTENNVDEVKTVFFDEEAFYNMPVFLDSMAEALLITPPSMKRAFD  228

Query  692   WDDEGDGIDLTLW  654
             WD+     DLTLW
Sbjct  229   WDEVDCETDLTLW  241



>ref|XP_003541976.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Glycine max]
Length=243

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 127/193 (66%), Gaps = 15/193 (8%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+AGRKKFRETRHPVYRGVR+RN +KWVCEVREPNKKSRIWLGT+ +PEMAARAHD
Sbjct  59    IPHKRKAGRKKFRETRHPVYRGVRQRNGNKWVCEVREPNKKSRIWLGTYPSPEMAARAHD  118

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             VA LAL+G +A  NFP +   LP A S S ADIR AA ++++                S+
Sbjct  119   VAVLALKGTSAVFNFPDSVSLLPVANSSSAADIRLAASKVSSVF----------GPSSSS  168

Query  857   EAASSSRTIDLPGLDFFGN-----ASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFS  693
              +   ++   + G     N      + F DEEA +N+P  LD+MAE +LITPP+MK+ F 
Sbjct  169   SSRVETKPCLVDGFVKTENNVDEVKTVFFDEEAFYNMPVFLDSMAEALLITPPSMKRAFD  228

Query  692   WDDEGDGIDLTLW  654
             WD+     DLTLW
Sbjct  229   WDEVDCETDLTLW  241



>ref|XP_006384650.1| hypothetical protein POPTR_0004s19820g [Populus trichocarpa]
 gb|ERP62447.1| hypothetical protein POPTR_0004s19820g [Populus trichocarpa]
Length=219

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 134/196 (68%), Gaps = 13/196 (7%)
 Frame = -2

Query  1238  AGDQAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPE  1059
             A ++   VL+K++AGRKKF+ETRHPVYRGVR+RN +KWVCEVREPNKKSRIWLGTF +PE
Sbjct  35    AQERPVTVLKKKKAGRKKFKETRHPVYRGVRKRNGNKWVCEVREPNKKSRIWLGTFTSPE  94

Query  1058  MaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC  879
             MAARAHDVAALAL+GE A LNFP +A  LPRA S S  DIR AA   A    P       
Sbjct  95    MAARAHDVAALALKGETATLNFPDSALILPRAKSSSAGDIRRAARDAALNDDPFSMVMMS  154

Query  878   ISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKG  699
                + S + +     +             F DEEA+FN+P LLD+MAEG+++TPP M++G
Sbjct  155   CPNNCSEKVSHQPNAL-------------FFDEEALFNMPGLLDSMAEGLILTPPVMQRG  201

Query  698   FSWDDEGDGIDLTLWK  651
             F+WDD     DLTLW+
Sbjct  202   FNWDDMACSTDLTLWE  217



>gb|AIL00695.1| C-repeat binding factor 3 [Vitis cinerea]
Length=239

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 137/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+ N ++WVCEVR+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQXNGNRWVCEVRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSHIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVTLEDSESSQSAPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWD+     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDETTSYTDLSLW  236



>ref|XP_009379780.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 130/198 (66%), Gaps = 14/198 (7%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KR+AGRKKFRETRHPVY GVR RN  +WVCEVREP KKSRIWLGTF TPE+AARAHDVAA
Sbjct  52    KRKAGRKKFRETRHPVYHGVRERNGGRWVCEVREPRKKSRIWLGTFRTPEVAARAHDVAA  111

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRGE+A LNFP +A  LPRATS +  D+R AA + A        +    S   +   A
Sbjct  112   IALRGESAHLNFPDSAWVLPRATSSAAEDVRRAAAEAAEMFGASETRSQQFSSSSTMPPA  171

Query  848   SSSRTIDLPGLD-----------FFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKK  702
             +       P  D            +  ++ F+DEEA+FN+P LLD+MA GML+TP AM+ 
Sbjct  172   APGEAGRTPATDGREAVAAPEAAAWMPSALFVDEEALFNMPGLLDDMARGMLLTPLAMQT  231

Query  701   GFSWD--DEGDGIDLTLW  654
             GF WD  DE   +DL+LW
Sbjct  232   GFDWDRVDE-HHMDLSLW  248



>gb|AIL00689.1| C-repeat binding factor 3 [Vitis riparia]
Length=239

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 136/213 (64%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRET  PVYRGVR+RN ++WVCE+R+P  KSRIWLGTF TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETXXPVYRGVRQRNGNRWVCEMRDPKNKSRIWLGTFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DIR AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSAGDIRVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLDF-------------------FGNASTFLDEEAVFNLPAL  753
             H    +E   +S + D P L+                     G+++ F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLESRKKVVGVALEDSESSEGSPHGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>ref|XP_004497619.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Cicer arietinum]
Length=192

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 126/194 (65%), Gaps = 9/194 (5%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             ++KRR GRKKF ETRHP+Y+GVR+RN  KWVCE+R+PN K+RIWLGTF+ P+MAA A+DV
Sbjct  1     MEKRRGGRKKFHETRHPIYKGVRQRN-GKWVCELRQPNNKTRIWLGTFSHPDMAAIAYDV  59

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPC------IS  873
             AALA +GE+A+LNFP AA SLPR  S + +        +  A                I 
Sbjct  60    AALAFKGESASLNFPHAATSLPRLNSRTSSIRSIQFAAMKAAKNHFFTCQDSEPFLTEIV  119

Query  872   RDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFS  693
             R+ S           +  L+   + S F DE+ +FN+P L+++MAEG++ITPPA+++GF+
Sbjct  120   RNDSESVDCQLNVCLVKSLE--DSRSFFWDEDEIFNMPGLINSMAEGLIITPPALQRGFN  177

Query  692   WDDEGDGIDLTLWK  651
             W D    +DLTLW+
Sbjct  178   WVDGESTMDLTLWE  191



>emb|CBI17074.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 127/184 (69%), Gaps = 21/184 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETRHPVYRGVR+RN ++WVCEVR+P  KSRIWLGTF+TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRHPVYRGVRQRNGNRWVCEVRDPKTKSRIWLGTFSTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG  AALNFP +A  LPRA S S  DI+ AAL  A A              
Sbjct  84    AHDVAALAFRGNFAALNFPDSASRLPRAKSSSAGDIQVAALAAAMAF-------------  130

Query  866   HSAEAASSSRTIDLPGLDF-------FGNASTFLDEEAVFNLPALLDNMAEGMLITPPAM  708
             HS +  S  + + +   D        +G+++ F+DEEA+FN+P L+++MAEG+L+ PP M
Sbjct  131   HSPQLESRKKVVGVALEDSESSEGAPYGSSTVFMDEEALFNMPGLINSMAEGLLLAPPTM  190

Query  707   KKGF  696
               GF
Sbjct  191   LGGF  194



>gb|KDP42691.1| hypothetical protein JCGZ_23631 [Jatropha curcas]
Length=218

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 122/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             +QKR+A RKKFRETRHPVY+GVRR+N  KWV E+RE   KSRIWLGTF  PEMAARA+DV
Sbjct  32    VQKRKAERKKFRETRHPVYKGVRRKN-GKWVSELRELQTKSRIWLGTFPNPEMAARAYDV  90

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
             A  ALRG  A+LNFP  A  LP+  S S       A   A           C S   S +
Sbjct  91    AVKALRGNTASLNFPETAHLLPQVGSTS-IKDIQCAALEAAGVHGGGGDVQCASSSSSLK  149

Query  854   AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD--E  681
             A+      +    +   +   FLDEE +FN+PALLD+MAEG+++TPPAMK+GFSW+D  E
Sbjct  150   ASVEEGYNNN--NNNNNDNKMFLDEEELFNMPALLDSMAEGLILTPPAMKRGFSWNDTKE  207

Query  680   GDGIDLTLW  654
              D +DLTLW
Sbjct  208   EDTVDLTLW  216



>ref|XP_002528599.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
 gb|EEF33807.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
Length=227

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 136/195 (70%), Gaps = 10/195 (5%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREP-NKKSRIWLGTFATPEMaarahdv  1035
             +KR+AGRKKF+ETRHPVY GVRRRN  KWV E+R+P N KSRIWLGTF +P+MAARA+DV
Sbjct  32    KKRKAGRKKFQETRHPVYNGVRRRN-GKWVSELRQPYNNKSRIWLGTFPSPDMAARAYDV  90

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD----  867
             AA ALRG++A+LNFP +   LP+A S S  DI+ AAL+ A+                   
Sbjct  91    AAFALRGDSASLNFPESVHLLPQARSTSIKDIQYAALEAADQSVSGGGGGGSDVDHLFQC  150

Query  866   HSAEAASSSRTI---DLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF  696
              S+  +  S TI   D  G D+  N + FLDEE +FN+PALLD+MAEG+++TPPAMKKGF
Sbjct  151   SSSSLSFCSSTIEGSDNVGKDWNKNMNMFLDEEELFNMPALLDSMAEGLILTPPAMKKGF  210

Query  695   SWDD-EGDGIDLTLW  654
             +W++ E D +DL  W
Sbjct  211   NWNNVEDDPVDLFFW  225



>gb|AIL00718.1| C-repeat binding factor 3 [Vitis rupestris]
Length=239

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 135/213 (63%), Gaps = 23/213 (11%)
 Frame = -2

Query  1226  AAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaar  1047
             ++PV  KR+AGRKKFRETR PVYRGVR+RN ++WVCE+R+P  KSRIWLG F TPEMAAR
Sbjct  25    SSPV-HKRKAGRKKFRETRPPVYRGVRQRNGNRWVCEMRDPKNKSRIWLGXFPTPEMAAR  83

Query  1046  ahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRD  867
             AHDVAALA RG+ AALNFP +   LPRA S S  DI+ AAL  A A  P  P        
Sbjct  84    AHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQVAALAAAMAFRPAAPSSSSSYIS  143

Query  866   H---SAEAASSSRTIDLPGLD----FFGNA---------------STFLDEEAVFNLPAL  753
             H    +E   +S + D P L+      G A               + F+DEEA+FN+P L
Sbjct  144   HVTACSEELETSCSEDSPQLEXRKKVVGVALEDSESSEGSPXGSSTVFMDEEALFNMPGL  203

Query  752   LDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLW  654
             +++MAEG+L+ PP M  GFSWDD     DL+LW
Sbjct  204   INSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLW  236



>gb|KDP34696.1| hypothetical protein JCGZ_10901 [Jatropha curcas]
Length=220

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 130/206 (63%), Gaps = 24/206 (12%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNK-KSRIWLGTFATPEMaarah  1041
             V++KR+AGR KF+ETRHP YRGVRRRN +KWVCEVREPNK KSRIWLGTF TPEMAARAH
Sbjct  21    VMKKRKAGRTKFKETRHPFYRGVRRRNGNKWVCEVREPNKNKSRIWLGTFPTPEMAARAH  80

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCI-----  876
             D+AALALRG+ A LNFP +A  LPR  S S  DI+       +  P   P          
Sbjct  81    DIAALALRGDLAILNFPDSASVLPRPKSSSAKDIKRVVRAFVSTTPSVSPSSSSCSYMST  140

Query  875   ----------SRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGML  726
                       S D      + +R +         + + F+DEEA+FN+P LLD++AEG++
Sbjct  141   TSQPYLVDHRSNDEFESCYNETREVS-------ESNALFMDEEALFNMPVLLDSLAEGLI  193

Query  725   ITPPAMKKGFSWDDEG-DGIDLTLWK  651
             +TPP ++ G  W++   D ++LTLW+
Sbjct  194   LTPPGIQSGIHWNEMAFDDMELTLWE  219



>gb|AFV15809.1| CBF/DREB1 transcription factor 1 [Carica papaya]
Length=212

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 128/195 (66%), Gaps = 25/195 (13%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             +QKR+AGRKKF+ETRHPVY+GVRRRN  KWVCE REPNK+SRIW+GTF++PEMAARAHDV
Sbjct  37    MQKRKAGRKKFQETRHPVYKGVRRRN-GKWVCETREPNKQSRIWVGTFSSPEMAARAHDV  95

Query  1034  aalalr-geaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             AALALR   +A+LNFP    +LPRA S +                       C + + + 
Sbjct  96    AALALRGESSASLNFPDEIRALPRAKSSA------------------IRDIQCAAMEAAE  137

Query  857   ---EAASSSRTIDLPGLDFFGNAS-TFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
                    SS  I++ G D   +    FLDE+ VFN+PA+L +MAEG+++ PP++++  +W
Sbjct  138   VFRNTGDSSSAINVHGDDDQEDEGMVFLDEDEVFNMPAILHSMAEGLILAPPSVQRECTW  197

Query  689   DDE-GDGIDLTLWKH  648
             DD+  D ++L LW +
Sbjct  198   DDDMEDEVELALWSY  212



>ref|XP_006594198.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Glycine max]
Length=195

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 127/194 (65%), Gaps = 8/194 (4%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKK-SRIWLGTFATPEMaarahd  1038
             +QKRRAGRKKF ETRHPVY+GVR+RN  KWVCE+R+PN K +R+WLGTF  P+MAA A+D
Sbjct  1     MQKRRAGRKKFHETRHPVYKGVRQRN-GKWVCELRQPNNKNARVWLGTFTHPDMAAIAYD  59

Query  1037  vaalalrgeaaaLNFPGAAESLPRATS--CSpadiraaalqlanappppppqfPCISRDH  864
             VAALA +G+ A+LNFP AA SLPR  S  CS   I+ AA Q A                 
Sbjct  60    VAALAFKGDNASLNFPHAATSLPRLNSRTCSVRAIQFAATQAAEKHFSCAESQQLQREGS  119

Query  863   SAEAASSSRTIDLPGLDFF----GNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF  696
                + S S ++D    +F     G+   F DEE VFN+P LL++MAE ++ITPPA+++GF
Sbjct  120   LEGSGSGSFSLDEDSSEFSSKEGGSERFFWDEEEVFNMPELLNSMAEALIITPPALERGF  179

Query  695   SWDDEGDGIDLTLW  654
             +W      +DLTLW
Sbjct  180   NWVGGETTVDLTLW  193



>gb|AEW22951.1| putative AP2 domain protein [Rosa chinensis]
Length=198

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 126/191 (66%), Gaps = 36/191 (19%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarah  1041
             V++KR+AGRKKF+ETRHPVY+GVR+RN  KWVCE+R+P  KKSR+WLGTF  PEMAARA+
Sbjct  41    VIKKRKAGRKKFKETRHPVYKGVRQRN-GKWVCEMRQPGLKKSRVWLGTFTCPEMAARAY  99

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHS  861
             DVAALAL+GE+A LNFP  A++ P  TS                               S
Sbjct  100   DVAALALKGESAQLNFPDEAKASPSWTS-------------------------------S  128

Query  860   AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDE  681
                   +  ++L  ++  G++  ++DEE +FN+P +LD+MAEG+++TPPA+KKGF+WDD 
Sbjct  129   MSLPELTSMVNLEKVE-VGSSKGYVDEEELFNMPEILDSMAEGLILTPPALKKGFNWDDY  187

Query  680   G--DGIDLTLW  654
                + ++ +LW
Sbjct  188   DLENAVEFSLW  198



>ref|XP_007027640.1| Dehydration-responsive element-binding protein 1B, putative [Theobroma 
cacao]
 gb|EOY08142.1| Dehydration-responsive element-binding protein 1B, putative [Theobroma 
cacao]
Length=226

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 135/197 (69%), Gaps = 6/197 (3%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             Q     QKR+AGRKKF+ETRHPVY+GVRRRN  KWV E+REP KKSRIWLGTF++P MAA
Sbjct  29    QVEAKTQKRKAGRKKFQETRHPVYKGVRRRN-GKWVSELREPIKKSRIWLGTFSSPGMAA  87

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RA+D AALAL+G++A+LNFP +A +LPRA S S  DI+ AA++ A A             
Sbjct  88    RAYDAAALALKGDSASLNFPESANALPRARSSSIRDIQYAAMEAAEAFGDIAKTPSPSPS  147

Query  869   DHSAEAASSSRTIDLPGLDFFGNAST---FLDEEAVFNLPALLDNMAEGMLITPPAMKKG  699
               S+ +  S     L         S+   FLDEE VFN+P +LD+MAEG+++TPPAM+KG
Sbjct  148   LSSSSSLPSPPLPSLENSSENVQGSSEKLFLDEEEVFNMPGILDSMAEGLILTPPAMQKG  207

Query  698   -FSWDDE-GDGIDLTLW  654
              ++WDD+  D ++ TLW
Sbjct  208   YYNWDDDVDDYMEFTLW  224



>ref|XP_003537045.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Glycine max]
Length=185

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 126/190 (66%), Gaps = 8/190 (4%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREP-NKKSRIWLGTFATPEMaarahd  1038
             +QKRRAGRKKF ETRHPVY+GVR+RN  KWV E+R+P NK +R+WLGTF  P+MAA A+D
Sbjct  1     MQKRRAGRKKFHETRHPVYKGVRQRN-GKWVSELRQPNNKNARVWLGTFPHPDMAAIAYD  59

Query  1037  vaalalrgeaaaLNFPGAAESLPRATS--CSpadiraaalqlanappppppqfPCISRDH  864
             VAALA +G++A+LNFP AA S PR  S  CS   I+ AA Q A            + R+ 
Sbjct  60    VAALAFKGDSASLNFPNAATSFPRLNSRTCSVRAIQFAATQAAEKHFSCVESQQ-LQREG  118

Query  863   SAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
             S    S S ++D    +F      F DEE VFN+P LL+ MAE ++ITPPA+++GF+W  
Sbjct  119   S---GSGSFSLDDDSSEFSSQGRFFWDEEEVFNMPELLNCMAEALIITPPALERGFNWVG  175

Query  683   EGDGIDLTLW  654
                 +DLTLW
Sbjct  176   GETTVDLTLW  185



>gb|ABQ53132.1| putative CBF/DREB transcription factor [Rosa chinensis]
Length=200

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 125/191 (65%), Gaps = 36/191 (19%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarah  1041
             V +KR+AGRKKFRETRHPVY+GVR+RN  KWVCE+R+P  KKSR+WLGTF  PEMAARA+
Sbjct  41    VTKKRKAGRKKFRETRHPVYKGVRQRN-GKWVCEMRQPGLKKSRVWLGTFTCPEMAARAY  99

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHS  861
             DVAALAL+GE+A LNFP  A++ P  TS                               S
Sbjct  100   DVAALALKGESAQLNFPDEAKASPSWTS-------------------------------S  128

Query  860   AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDE  681
                   +  ++L  ++  G++  ++DEE +FN+P +LD+MAEG+++TPPA+KKGF+WDD 
Sbjct  129   MSLPELTSMVNLEKVE-VGSSKGYVDEEELFNMPEILDSMAEGLILTPPALKKGFNWDDY  187

Query  680   G--DGIDLTLW  654
                + ++ +LW
Sbjct  188   DLENAVEFSLW  198



>ref|XP_009405193.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Musa acuminata subsp. malaccensis]
Length=212

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 126/186 (68%), Gaps = 7/186 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KR+AGRKKFRETRHPVY GVR RN  KWV EVREP KKSRIWLGTF TPEMAARAHDVA 
Sbjct  31    KRKAGRKKFRETRHPVYHGVRERNGGKWVSEVREPRKKSRIWLGTFRTPEMAARAHDVAV  90

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG +A+LNFP +A +LPRA S +  D+R AA++ A    P  P+ P           
Sbjct  91    IALRGASASLNFPDSAWALPRAESAAAEDVRRAAVEAAEMFGPWEPKSPPKPEALFNMPE  150

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGD-G  672
               +R + +         + F+DEEA+FN+P LL++MA G+L+TPPAM+K F WD   D  
Sbjct  151   DMARGLPV------TPPAVFVDEEALFNMPELLEDMARGLLVTPPAMQKEFDWDRVADCH  204

Query  671   IDLTLW  654
              DL LW
Sbjct  205   TDLRLW  210



>ref|XP_010278524.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nelumbo nucifera]
Length=228

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 126/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN +KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  52    KKRAGRKKFRETRHPVYRGVRRRNSNKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  111

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S  P DI+ AA + A A  P        + D   E A
Sbjct  112   LALRGRSACLNFADSAWRLPVPVSADPKDIQKAAAEAAEAFRPQESDAMSSADDVKPENA  171

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
             +++ + ++           ++DEEA+F +P LL NMAEG+L++PP   +G  WDD     
Sbjct  172   TATSSENV----------LYMDEEAIFGMPGLLTNMAEGLLLSPPHCLQG--WDDVESDA  219

Query  668   DLTLWKH  648
             D++LW +
Sbjct  220   DVSLWSY  226



>ref|XP_010654049.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Vitis vinifera]
Length=212

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 129/192 (67%), Gaps = 18/192 (9%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             +A    QKR+AGRKKF+ETRHP+Y+GVR+RN  KWVCE+R+P K++RIWLGTF  P+MAA
Sbjct  37    EAGSSSQKRKAGRKKFKETRHPLYKGVRQRN-GKWVCELRQPRKRNRIWLGTFPCPDMAA  95

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RA+DVAALA++G++A+LNFP +   LPRA S S  DIR+AAL+ A        +      
Sbjct  96    RAYDVAALAIKGDSASLNFPESVSQLPRAASSSIEDIRSAALKAAQTFEATEKEKEKERE  155

Query  869   DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             D  ++                     F+DEEA+FN+P LLD+MAEG+++TP A+KKGF+W
Sbjct  156   DEDSDP-----------------CQLFVDEEALFNMPTLLDSMAEGLILTPLALKKGFNW  198

Query  689   DDEGDGIDLTLW  654
             +   +  D TLW
Sbjct  199   NSIKEAEDFTLW  210



>ref|XP_006851570.1| hypothetical protein AMTR_s00040p00195730 [Amborella trichopoda]
 gb|ERN13151.1| hypothetical protein AMTR_s00040p00195730 [Amborella trichopoda]
Length=333

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKF+ETRHPV+RGVR+R   KWVCE+REP+KK+RIWLGT+  PEMAARAHDV
Sbjct  153   VPKRKAGRKKFKETRHPVFRGVRQRKGGKWVCEIREPHKKTRIWLGTYTCPEMAARAHDV  212

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
             A +ALRG+ AALNF  +A  LP A + S  DIR AA         P P    +  + S +
Sbjct  213   AVIALRGKDAALNFADSAWRLPVARTSSREDIREAAKTAVKHLTAPIPASSPV--NDSCD  270

Query  854   AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGD  675
              A   R +           + +LDEEA+F++P L+ ++AEG+LITPP+ K GFSWDD   
Sbjct  271   PACQCREVT------SSREALYLDEEALFDMPGLITDLAEGLLITPPSFKGGFSWDDLDT  324

Query  674   GIDLTLWK  651
              +D  LWK
Sbjct  325   HVDFELWK  332



>gb|ABU55658.1| CBF1-like protein [Vitis aestivalis]
Length=270

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 140/239 (59%), Gaps = 51/239 (21%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
             +  KR+AGRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHD
Sbjct  29    IGHKRKAGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHD  88

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana--ppppppqfPCISRDH  864
             VAALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A  P  P       + D+
Sbjct  89    VAALALRGRFASLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFNPTAPSSSSLASALDN  148

Query  863   SAEAASSSRT-----------------------IDLPGLDFFGNAST--FLDEEA-----  774
              +  A S +                        +D    +  G+ ST  F+DEEA     
Sbjct  149   MSGVADSKKVLETSPNVESPKLKSQRMVLEVSPVDTKRSEKVGDGSTPVFMDEEAMFNMQ  208

Query  773   ------------------VFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDG-IDLTLW  654
                               +FN+  L+++MAEG+L+TPPAM KGFSWDD  D  IDL+LW
Sbjct  209   GSEKVGDGSTPVFMDEEAMFNMQGLINSMAEGLLLTPPAMCKGFSWDDATDSHIDLSLW  267



>ref|XP_007145241.1| hypothetical protein PHAVU_007G222500g [Phaseolus vulgaris]
 gb|ESW17235.1| hypothetical protein PHAVU_007G222500g [Phaseolus vulgaris]
Length=191

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 123/192 (64%), Gaps = 6/192 (3%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKK-SRIWLGTFATPEMaarahd  1038
             +QKR+AGRKKF+ETRHPVYRGVR+R + KWVCE R+PNKK +R+WLGTF+ P+MAA A D
Sbjct  1     MQKRKAGRKKFQETRHPVYRGVRQR-KGKWVCEFRQPNKKNARLWLGTFSRPDMAAVAFD  59

Query  1037  vaalalrgeaaaLNFPGAAESLPRATS-CSpadiraaalqlanappppppqfPCISRDHS  861
             VAALA +G+ A+LNFP A   LPR  S  S       A            +F  +  D S
Sbjct  60    VAALAFKGDRASLNFPEAISFLPRLNSGTSSVRTIQFAATQTAEKLLSCTEFQKLRDDVS  119

Query  860   AEAASSSRTIDLPGLDFFGNAST---FLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             +   S +   +   L    + S+   F DEE VFN+P LL++MAE ++I PPA++KGF+W
Sbjct  120   SRGGSGNFFWNEDCLKLASDESSRRFFWDEEEVFNMPELLNSMAEALIIAPPALQKGFNW  179

Query  689   DDEGDGIDLTLW  654
              D    +DLTLW
Sbjct  180   VDGETTVDLTLW  191



>ref|XP_009390140.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Musa acuminata subsp. malaccensis]
Length=228

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KR+AGRKKFRETRHPVY GVR RN  +WVCEVREP KKSRIWLGTF  PEMAA AHD AA
Sbjct  36    KRKAGRKKFRETRHPVYHGVRERNGGRWVCEVREPRKKSRIWLGTFGEPEMAALAHDAAA  95

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             + LRGE+A LNFP  A +LPRA S +P D+R AA +      P  P    +     AE +
Sbjct  96    ITLRGESALLNFPDLAGTLPRARSPAPEDVRRAATEAVEMFRPSKPAPAQLPAVSDAEGS  155

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAM-KKGFSWD---DE  681
                +           +A+ F+DE+ +FN+P L+++MA GML+TPPA+ ++GF WD   +E
Sbjct  156   QGRKENTATEDAAAPSAAVFVDEDELFNMPELIEDMARGMLLTPPALQRRGFDWDIAVEE  215

Query  680   GDGIDLT-LW  654
                IDL+ LW
Sbjct  216   EQEIDLSPLW  225



>ref|XP_008241428.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Prunus mume]
Length=200

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 126/193 (65%), Gaps = 26/193 (13%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarahd  1038
              +KR+AGRKKF ETRHP+Y+GVR+R   KWVCE+R+P+ KKSRIWLGTF  P+MAARA+D
Sbjct  26    FKKRKAGRKKFNETRHPIYKGVRQRC-GKWVCELRQPDQKKSRIWLGTFTCPDMAARAYD  84

Query  1037  vaalalrgeaaaLNFPGAAESLPRATS-CSpadiraaalqlanappppppqfPCISRDHS  861
             VAALAL+GE+AALNFP  A +LPR TS CS  D++ AA   A        +   +     
Sbjct  85    VAALALKGESAALNFPHEASTLPRITSTCSVKDLQCAAAAAAEGFFEVEVKASGLEEKQE  144

Query  860   AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW---  690
              E                     +LDEE +FN+P L+D++AEG+++TPPAM+KGF+W   
Sbjct  145   EEV-------------------VYLDEEELFNMPGLIDSLAEGLILTPPAMQKGFNWNDF  185

Query  689   -DDEGDGIDLTLW  654
              DD  + +D +LW
Sbjct  186   DDDMENAVDFSLW  198



>ref|XP_004971403.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Setaria italica]
Length=219

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 123/187 (66%), Gaps = 9/187 (5%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVR-RRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
             KRRAGRKKFRETRHPVYRGVR R    +WVCEVREP  ++RIWLGT+ TPEMAARAHDVA
Sbjct  37    KRRAGRKKFRETRHPVYRGVRARAGGSRWVCEVREPQAQARIWLGTYPTPEMAARAHDVA  96

Query  1031  alalr-geaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
             A+ALR   AA LNFP +A +LPR  + +P DIR AA Q A    P        S      
Sbjct  97    AIALRGALAADLNFPDSAHTLPRPRTAAPDDIRCAAAQAAELYRPAAHHLIATS------  150

Query  854   AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGD  675
              +S++       L     ++ FLDE+A+F++P L+D+MA GML+TPPAM +G  W    D
Sbjct  151   -SSTAAPPRPLALPPPEPSACFLDEDAIFDMPGLIDDMARGMLLTPPAMGRGLDWGAVDD  209

Query  674   GIDLTLW  654
              +D TLW
Sbjct  210   DVDCTLW  216



>ref|XP_010255545.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Nelumbo nucifera]
Length=229

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 122/187 (65%), Gaps = 6/187 (3%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN ++WVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  47    KKRAGRKKFRETRHPVYRGVRRRNSNRWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  106

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A A  PP       + D  A+  
Sbjct  107   LALRGRSACLNFADSAWRLPVPVSTDAKDIQKAAAEAAEAFRPPQDSDTMSNEDVKADNT  166

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
             +       P      N   ++DEEA+F +P LL NMAEG+L++PP   +   WDD     
Sbjct  167   APMSMSPEP-----DNEEMYVDEEAIFGMPGLLANMAEGLLLSPPHCSQQ-QWDDVESDA  220

Query  668   DLTLWKH  648
             D++LW +
Sbjct  221   DVSLWSY  227



>ref|XP_011030036.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Populus euphratica]
Length=251

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 120/186 (65%), Gaps = 7/186 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  68    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  127

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  128   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELMRTVD-EGE  186

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD-EGDG  672
              ++ T    G + F     ++DEEA+F +P LL NMAEGML+ PP    G  WD+ E   
Sbjct  187   KAADTAAEAGEEVF-----YMDEEAIFGMPGLLANMAEGMLLPPPHCGGGDGWDNVENID  241

Query  671   IDLTLW  654
              D++LW
Sbjct  242   ADMSLW  247



>ref|XP_008442807.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Cucumis melo]
Length=202

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 121/190 (64%), Gaps = 6/190 (3%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahd  1038
              + KR+AGRKKF+ETRHP+Y+GVR+RN  KWVCE+R+PNKKS  W+GTF +P+ AA A+D
Sbjct  18    TVAKRKAGRKKFQETRHPIYKGVRQRN-GKWVCELRQPNKKSSFWVGTFCSPKTAAIAYD  76

Query  1037  vaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSA  858
             V ALA++GE+ +LNFP  A S PR  S S +     A+ +  A               S+
Sbjct  77    VVALAIKGESVSLNFPNFAHSFPRVMSSSSSINDIRAMAIKTAETFTSSDIMMPLSSPSS  136

Query  857   EAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEG  678
              ++  S   +   +  +     F DEE VFN+PA++  +AEG++ITPP MK+ F W+D  
Sbjct  137   PSSLCSLMSEEKVVPNY-----FWDEEEVFNMPAIIAGIAEGLIITPPGMKREFDWEDSE  191

Query  677   DGIDLTLWKH  648
             + ++L+LW H
Sbjct  192   NTMELSLWSH  201



>gb|ABU55661.1| CBF1-like protein [Parthenocissus tricuspidata]
Length=205

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 124/195 (64%), Gaps = 27/195 (14%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
               R++GRKKFRETRHP+YRGVR+RN +KWVCEVREP KKSRIWLGTF TPEMAARAHDVA
Sbjct  10    HNRKSGRKKFRETRHPIYRGVRQRNGNKWVCEVREPLKKSRIWLGTFPTPEMAARAHDVA  69

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlana-----------------pp  903
             ALALRG  A+LNFP +A  LPR  S S  DI+ AAL+   A                   
Sbjct  70    ALALRGHFASLNFPDSAWRLPRPKSSSAEDIQIAALEATKAFDPTAPSSSSLASALDSMS  129

Query  902   ppppqfPCISRDHSAEA---ASSSRTIDLPGLDFF-------GNASTFLDEEAVFNLPAL  753
               P     +    S E+    S  R +D+  +D         G+ + F+DEEAVFN+P L
Sbjct  130   GVPGSKKVLETSPSVESPKLKSQRRVLDISSVDTKSSEKVADGSMTVFMDEEAVFNMPGL  189

Query  752   LDNMAEGMLITPPAM  708
             +++MAEG+L+TPPAM
Sbjct  190   INSMAEGLLLTPPAM  204



>ref|XP_006413301.1| hypothetical protein EUTSA_v10027405mg [Eutrema salsugineum]
 gb|AAS00621.1| DREB1 [Eutrema salsugineum]
 gb|ESQ54754.1| hypothetical protein EUTSA_v10027405mg [Eutrema salsugineum]
Length=216

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 141/236 (60%), Gaps = 26/236 (11%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  ++E+                 + GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFAEMFGSEYESPVT--------------VGGDYCPTLATSCPKKPAGRKKFRETR  47

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA+ALRG +A LNF 
Sbjct  48    HPIYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAAIALRGRSACLNFA  107

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T C+    +AAA                ++ DH  +   +  T+++   
Sbjct  108   DSAWRLRIPEST-CAKDIQKAAAEAAVAFQAEMSDT---MTSDHGLDMEET--TVEVIVT  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             +   +   ++DEEA+F +P LL NMAEGML+ PP+++ G ++D +GD  D++LW +
Sbjct  162   EEEQSEGFYMDEEAMFGMPRLLANMAEGMLLPPPSVQWGHNYDCDGDA-DVSLWSY  216



>ref|XP_006832878.1| hypothetical protein AMTR_s00095p00096190 [Amborella trichopoda]
 gb|ERM98156.1| hypothetical protein AMTR_s00095p00096190 [Amborella trichopoda]
Length=266

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKF+ETRHPV+RGVR RN  KWVCE+REP KKSRIWLGT+  PEMAARAHDV
Sbjct  86    VPKRKAGRKKFKETRHPVFRGVRHRNGGKWVCEIREPQKKSRIWLGTYTCPEMAARAHDV  145

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
             A +ALRG+ A LNF  +A  LP A + SP DIR AA                     +A 
Sbjct  146   AVIALRGKGATLNFADSAWRLPAARTTSPEDIREAAQTAIEHLTVAVA---------AAT  196

Query  854   AASSSRTIDLPGLDFFGNAS-TFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEG  678
               + SR    P  +   +    F+D EA+F++P L+ ++AEG+LITPP+ K   SWDD  
Sbjct  197   PGTQSRKPARPSRELTSSVEPLFIDVEALFDMPGLITDLAEGLLITPPSFKVVSSWDDVD  256

Query  677   DGIDLTLW  654
               +DL LW
Sbjct  257   CHVDLDLW  264



>ref|XP_009413459.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Musa acuminata subsp. malaccensis]
Length=225

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 130/203 (64%), Gaps = 21/203 (10%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             Q AP   KR+AGRKKFRETRHPVY  V      +W CEVREP +KSRI LGTF+TPEMA+
Sbjct  29    QPAPS-PKRKAGRKKFRETRHPVYHSVPESRGGRWACEVREPRRKSRICLGTFSTPEMAS  87

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RAHDV A+ALRGE+A LNFP +A ++PRA S  P DIR AA Q+A    P  P       
Sbjct  88    RAHDVTAMALRGESAQLNFPDSAWTVPRARSAVPEDIRRAATQVAEGSAPSEPSP-----  142

Query  869   DHSAEAASSSRTIDLPGLDFFGN---------ASTFLDEEAVFNLPALLDNMAEGMLITP  717
                 EA ++SR    PG D             A  F+DEEAVFN+P L+++MA GML+TP
Sbjct  143   --PVEAPTTSRRT--PGRDARAAESEAAAPRPAPVFVDEEAVFNMPGLMEDMARGMLVTP  198

Query  716   PAMKKGFSWDDEGDGI--DLTLW  654
             P+M++G  WD  GD    DL+LW
Sbjct  199   PSMQRGVDWDGAGDECVWDLSLW  221



>ref|XP_007204774.1| hypothetical protein PRUPE_ppa015643mg [Prunus persica]
 gb|EMJ05973.1| hypothetical protein PRUPE_ppa015643mg [Prunus persica]
Length=201

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 28/194 (14%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarahd  1038
              +KR+AGRKKF ETRHP+Y+GVR+R   KWVCE+R+P+ KKSRIWLGTF  P+MAARA+D
Sbjct  27    FKKRKAGRKKFNETRHPIYKGVRQRC-GKWVCELRQPDQKKSRIWLGTFTCPDMAARAYD  85

Query  1037  vaalalrgeaaaLNFPGAAESLPR-ATSCSpadiraaalqlanappppppqfPCISRDHS  861
             VAALAL+G++AALNFP  A +LPR A++CS  D++ AA + A                  
Sbjct  86    VAALALKGKSAALNFPHEASTLPRIASTCSVKDLQCAAAEAAEGF-------------FE  132

Query  860   AEAASSSRTIDLPGLDFFGNAS-TFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW--  690
              E  SS       GL+        +LDEE +FN+P L+D++AEG+++TPPAM+KGF+W  
Sbjct  133   VEVKSS-------GLEEKEEEEVVYLDEEELFNMPGLIDSLAEGLILTPPAMQKGFNWND  185

Query  689   --DDEGDGIDLTLW  654
               DD  + +D +LW
Sbjct  186   FDDDMENAVDFSLW  199



>ref|XP_010686195.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Beta vulgaris subsp. vulgaris]
Length=257

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 125/212 (59%), Gaps = 31/212 (15%)
 Frame = -2

Query  1211  QKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdva  1032
             QKR+AGRKKF+ETRHP +RGVR R   KWVCE+REP KKSRIWLGT+ T E+AARAHDVA
Sbjct  52    QKRKAGRKKFKETRHPTFRGVRERERGKWVCELREPKKKSRIWLGTYPTAELAARAHDVA  111

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaa-----------------lqlanapp  903
             ALALRG+ AALNFP +A  +PRA S S  DIR AA                  +      
Sbjct  112   ALALRGDKAALNFPNSAWLVPRAKSTSARDIRLAAFQATRFDLRPNCSPCEGNKNIQENK  171

Query  902   ppppqfPCISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLI  723
                    C   D   ++   +   D   +        F+DEEA+FN+   +D+MA GML+
Sbjct  172   EEIKSSTCYDNDDDVKSLKKNVVDDESKV-------LFMDEEAIFNVHTFIDSMAAGMLL  224

Query  722   TPPAMKKGFSWD----DEGDG---IDLTLWKH  648
             TPP+ K+G +WD    D GD    IDL LW++
Sbjct  225   TPPSFKRGINWDEVEEDNGDDDCFIDLDLWRY  256



>gb|AFQ59977.1| CRT/DRE binding factor 1 [Morus alba var. multicaulis]
Length=230

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 121/198 (61%), Gaps = 33/198 (17%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKF+ETRHPVYRGVRRRN  KWVCEVREPNKK+RIWLGTF T EMAARAHDVAA
Sbjct  53    KKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAA  112

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG +  LNF  +A  LP   S  P DI                      +  ++EAA
Sbjct  113   IALRGRSTCLNFADSAWRLPVPASPDPKDI----------------------QKAASEAA  150

Query  848   SSSRTIDL-------PGLDFFGNAST---FLDEEAVFNLPALLDNMAEGMLITPP-AMKK  702
              + R +D+       P  D     S    F+DEEAVF +P LL NMAEGML+ PP  M+ 
Sbjct  151   EAFRPVDMAEDTGEKPAADAAVAESEDVFFMDEEAVFGMPGLLTNMAEGMLLPPPHCMEH  210

Query  701   GFSWDDEGDGIDLTLWKH  648
              +S DD     +++LW +
Sbjct  211   DYSSDDAEAYANVSLWSY  228



>gb|ABO48363.1| C-repeat binding facor 1 [Populus trichocarpa]
Length=192

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 119/187 (64%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  8     KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  67

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  68    LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELMRTGD-EGE  126

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              ++ T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  127   KAAETTAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  181

Query  674   GIDLTLW  654
               D+ LW
Sbjct  182   DADMPLW  188



>ref|XP_010686196.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Beta vulgaris subsp. vulgaris]
Length=231

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 126/197 (64%), Gaps = 15/197 (8%)
 Frame = -2

Query  1229  QAAPVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaa  1050
             + A + QKR+ GRKKF+ETRHP Y GVR R+  KWV E+REPNKKSRIWLGT+  PE+AA
Sbjct  45    EVAGLPQKRKTGRKKFKETRHPFYHGVRERDGGKWVSEIREPNKKSRIWLGTYPAPELAA  104

Query  1049  rahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISR  870
             RAHDVAALAL+G+ AALNFP +A  + RA S S    R   L    A           ++
Sbjct  105   RAHDVAALALKGDKAALNFPDSAWLVSRAKSTS---ARDIRLAAFQATRSELHSSLITTQ  161

Query  869   DHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW  690
             D+ +EAA + + I+  G +       F+DEE +FN+P+ +D MA+GML+TPP++K+  +W
Sbjct  162   DNESEAA-NVKYIENSGEEL------FVDEEVIFNMPSFIDGMAQGMLLTPPSLKREINW  214

Query  689   DDEGDG-----IDLTLW  654
             D   D      I L LW
Sbjct  215   DGIDDCGNISYIHLDLW  231



>ref|NP_001267604.1| uncharacterized protein LOC101209920 [Cucumis sativus]
 gb|AFL03400.1| CBF3 protein [Cucumis sativus]
 gb|KGN59069.1| hypothetical protein Csa_3G751440 [Cucumis sativus]
Length=204

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 119/189 (63%), Gaps = 4/189 (2%)
 Frame = -2

Query  1214  LQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdv  1035
             + KR+AGRKKF+ETRHP+Y+GVR+RN  KWVCE+R PNKKS  W+GTF +P+ AA A+DV
Sbjct  19    VAKRKAGRKKFQETRHPIYKGVRQRN-GKWVCELRRPNKKSSFWVGTFCSPKRAAIAYDV  77

Query  1034  aalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
              ALA++GE+  LNFP  A S PR  S S +     A+ +  A          I    S  
Sbjct  78    VALAIKGESVPLNFPNFAHSFPRVMSSSSSISDIRAMAIKTAETFTSGD---ILTPLSLS  134

Query  854   AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGD  675
             + SS     L   +     + F DEE VFN+PA++  MAEG++ITPP MKK F W+D  +
Sbjct  135   SPSSLSLCSLMSEEKVVGPNYFWDEEEVFNMPAIIAGMAEGLIITPPGMKKEFDWEDSEN  194

Query  674   GIDLTLWKH  648
              I+L+LW H
Sbjct  195   TIELSLWSH  203



>ref|XP_009611618.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611619.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X2 [Nicotiana tomentosiformis]
Length=232

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 123/203 (61%), Gaps = 40/203 (20%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRG+RRRN +KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  54    KKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  113

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             ++LRG +A LNF  +A  LP  TS +  DI                      +  + EAA
Sbjct  114   ISLRGRSACLNFADSAWRLPIPTSAAAKDI----------------------QKAAVEAA  151

Query  848   SSSRTIDLPGLDF---------------FGNASTFLDEEAVFNLPALLDNMAEGMLITPP  714
              + R ++  G +F                 +   F+DEEA+F +P LL NMAEG+++ PP
Sbjct  152   EAFRPVESHGENFKEIIVDQVIQELVAELPDNVLFMDEEALFCMPRLLVNMAEGLMLPPP  211

Query  713   -AMKKGFSWDDEGDGIDLTLWKH  648
               +  G+  + E D  D++LW +
Sbjct  212   QCIIDGY--EMEADHADMSLWSY  232



>gb|ABV82985.1| cold responsive transcription factor [Thlaspi arvense]
Length=214

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 138/237 (58%), Gaps = 30/237 (13%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQAAPVLQ----KRRAGRKKFRET  1173
             N+FSA    F  ++E+                +  G    P L     K+ AGRKKFRET
Sbjct  2     NSFSAFAEMFGSEYES---------------PDTIGADYCPTLATSCPKKPAGRKKFRET  46

Query  1172  RHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNF  993
             RHP+YRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA+ALRG +A LNF
Sbjct  47    RHPIYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAAIALRGRSACLNF  106

Query  992   PGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPG  819
               +A  L  P +T C+    +AAA                 + DH  +      TI    
Sbjct  107   ADSAWRLRIPEST-CAKDIQKAAAEAAVAFQAEMSD----TTTDHGLDM---EETIVEAI  158

Query  818   LDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
             ++   +   ++DEEA+F +P LL NMAEGML+ PP+++ G ++D +GD  D++LW +
Sbjct  159   VNEEQSGGFYMDEEAMFGMPRLLANMAEGMLLPPPSVQWGQNYDCDGDA-DVSLWSY  214



>gb|AHY04213.1| putative CBFx1 [Chorispora bungeana]
Length=217

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 127/201 (63%), Gaps = 8/201 (4%)
 Frame = -2

Query  1238  AGDQAAPVLQ----KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             +G    P L     K+ AGRKKFRETRHP+YRGVRRRN  KWVCEVREPNKK+RIWLGTF
Sbjct  21    SGSDYCPTLASSCPKKPAGRKKFRETRHPIYRGVRRRNSGKWVCEVREPNKKTRIWLGTF  80

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanapppppp  891
              T EMAARAHDVAA+ALRG +A LNF  +A  L    S  P DI+ AA + A A      
Sbjct  81    PTVEMAARAHDVAAIALRGRSACLNFADSAWRLRIPESTCPKDIQKAAAEAALAFQDEMC  140

Query  890   qfPCISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPA  711
                    DH  +   +     + G +  G    F+D+EA+F +P LL NMAEGML+ PP+
Sbjct  141   DTTTTREDHGLDMEETIVEAIVTGEESNG---FFMDDEAMFGMPRLLANMAEGMLLPPPS  197

Query  710   MKKGFSWDDEGDGIDLTLWKH  648
             ++   S+D +GD  D++LW +
Sbjct  198   VQWNHSYDGDGDD-DVSLWSY  217



>ref|XP_009611054.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana tomentosiformis]
Length=232

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 122/203 (60%), Gaps = 40/203 (20%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRG+RRRN +KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  54    KKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  113

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG +A LNF  +A  LP  TS +  DI                      +  + EAA
Sbjct  114   IALRGRSACLNFADSAWRLPIPTSAAAKDI----------------------QKAAVEAA  151

Query  848   SSSRTIDLPGLDF---------------FGNASTFLDEEAVFNLPALLDNMAEGMLITPP  714
              + R +   G +F                 +   F+DEEA+F +P LL NMAEG+++ PP
Sbjct  152   EAFRPVKSHGENFKEIIVDQVIQELVAELPDNVLFMDEEALFCMPRLLMNMAEGLMLPPP  211

Query  713   -AMKKGFSWDDEGDGIDLTLWKH  648
               +  G+  + E D  D++LW +
Sbjct  212   QCIIDGY--EMEADHADMSLWSY  232



>ref|XP_002318846.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
 gb|EEE97066.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
Length=255

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 119/187 (64%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              ++ T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAAETTAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>gb|KDP22330.1| hypothetical protein JCGZ_26161 [Jatropha curcas]
Length=225

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  45    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  104

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  ++  LP   S S       A   A     P      +  +   E  
Sbjct  105   LALRGRSACLNFADSSWRLPVPAS-SDPKDIQKAAAEAARAFRPVEADGLLGDEFRQENK  163

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              ++ T +  G+        ++DEEAVF +P LL NMAEGML+ PP        D E D  
Sbjct  164   RATETAEAEGM-------FYMDEEAVFGMPGLLANMAEGMLLPPPQCVAENGDDIEADSA  216

Query  668   DLTLW  654
             D+ LW
Sbjct  217   DVPLW  221



>ref|XP_009791610.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana sylvestris]
Length=235

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 123/188 (65%), Gaps = 10/188 (5%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRG+RRRN +KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  57    KKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  116

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +AL+G +A LNF  +A  LP   S +  DI+ AA + A A  P        SR+   +  
Sbjct  117   IALKGRSACLNFADSAWRLPIPASAAAKDIQKAAAEAAEAFRPLESDIEN-SREIIIDLV  175

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPP-AMKKGFSWDDEGDG  672
                   +LP      +   FLDEEA+F +P LL NMAEG+++ PP  +  G+    E D 
Sbjct  176   IQEVVAELP------DNVLFLDEEALFYMPGLLANMAEGLMLPPPQCIIDGYGM--EADH  227

Query  671   IDLTLWKH  648
              D++LW +
Sbjct  228   ADMSLWSY  235



>gb|AGY31291.1| C-repeat binding factor 4b [Populus euphratica]
Length=252

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 119/187 (64%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  68    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  127

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  128   LALRGRSACLNFADSAWRLPVPASSEAKDIQRAAAEAAGGFRPEGCVGGELMRTVD-EGE  186

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              ++ T    G + F     ++DEEAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  187   KAADTAAEAGEEVF-----YMDEEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNVENI  241

Query  674   GIDLTLW  654
               D+ LW
Sbjct  242   DADMPLW  248



>gb|ABK95675.1| unknown [Populus trichocarpa]
Length=255

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 119/187 (64%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              ++ T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAAGTTAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>gb|AET87124.1| DREB1C [Lepidium latifolium]
Length=213

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 137/237 (58%), Gaps = 31/237 (13%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQAAPVLQ----KRRAGRKKFRET  1173
             N+FSA    F  D+E+  +               +GD  +P L     K+ AGRKKFRET
Sbjct  2     NSFSAFAEMFGSDYESSVS---------------SGDNYSPTLAASCPKKPAGRKKFRET  46

Query  1172  RHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNF  993
             RHP+YRGVR RN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAALALRG +A LNF
Sbjct  47    RHPIYRGVRLRNSGKWVCEVREPNKKSRIWLGTFLTAEMAARAHDVAALALRGRSACLNF  106

Query  992   PGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPG  819
               +A  L  P +T        AA   L             ++ DH  +   +     +  
Sbjct  107   ADSAWRLRIPNSTFAKDIQKAAAEAALEFQDD--------MTNDHDLDMEETIVEAIVKA  158

Query  818   LDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
              +  G+ + ++DEEA+F +P +L NMAEGML+ PP+++    ++ +GD  D++LW +
Sbjct  159   EEASGD-TFYIDEEAMFGMPNMLANMAEGMLLPPPSVQWNHDYEGDGDD-DVSLWSY  213



>ref|XP_010438876.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Camelina sativa]
Length=212

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 123/189 (65%), Gaps = 11/189 (6%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+ AGRKKFRETRHP+YRGVR+RN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  33    KKPAGRKKFRETRHPIYRGVRQRNSGKWVCEVREPNKKSRIWLGTFQTAEMAARAHDVAA  92

Query  1028  lalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
             +ALRG +A LNF  +A  L  P +T C+    +AA+                 + DH  +
Sbjct  93    IALRGRSACLNFADSAWRLRIPEST-CAKEIQKAASEAALAFQNESDT----TTTDHGLD  147

Query  854   AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGD  675
                   T+    +    + + ++DEEA+F +P+ L NMAEGML+ PP+++   ++D EGD
Sbjct  148   M---EETLVEAVVTAEQSEAFYMDEEAMFGMPSFLANMAEGMLLPPPSVQWNNNYDGEGD  204

Query  674   GIDLTLWKH  648
               D++LW +
Sbjct  205   A-DMSLWSY  212



>ref|XP_007218312.1| hypothetical protein PRUPE_ppa010935mg [Prunus persica]
 gb|EMJ19511.1| hypothetical protein PRUPE_ppa010935mg [Prunus persica]
 gb|AGL07695.1| CBF/DREB 6 [Prunus persica]
 gb|AGS13699.1| C-repeat binding factor [Prunus persica]
Length=229

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 122/192 (64%), Gaps = 11/192 (6%)
 Frame = -2

Query  1223  APVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaara  1044
             A    K+RAGRKKF+ETRHPVYRGVRRRN  KWVCEVREPNKK+RIWLGTF T EMAARA
Sbjct  47    ASTYPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARA  106

Query  1043  hdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH  864
             HDVAA+ LRG +A LNF  +A  LP   S +  DI+  A + A A  PP      +S   
Sbjct  107   HDVAAIKLRGRSACLNFADSAWRLPVPASANAKDIQTTASEAAEAFRPPAEGSVEVS-GA  165

Query  863   SAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
             SA AAS S++              ++DEEAVF +P LL NMAEGML++PP   +    DD
Sbjct  166   SAVAASESKSA--------SEQVFYMDEEAVFGMPGLLANMAEGMLLSPPLYTEDD--DD  215

Query  683   EGDGIDLTLWKH  648
                  D+ LW +
Sbjct  216   VEFYADVPLWSY  227



>ref|XP_009759325.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana sylvestris]
Length=233

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 122/187 (65%), Gaps = 9/187 (5%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRK FRETRHPVYRG+RRRN +KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  56    KKRAGRKTFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  115

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG +A LNF  +A  LP   S +  DI+ AA + A A  P        SR+   + A
Sbjct  116   IALRGRSACLNFADSAWRLPIPASSAAKDIQKAAAEAAEAFRPLESDGEN-SREIIVDQA  174

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
                   +LP      +   F+DEEA+F +P LL NMAEG+++ PP    G+    E D  
Sbjct  175   IQEVVAELP------DNVLFMDEEALFCMPRLLANMAEGLMLPPPQCIDGYVM--ESDHA  226

Query  668   DLTLWKH  648
             D++LW +
Sbjct  227   DMSLWSY  233



>gb|AIU92947.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92951.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92959.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92960.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92961.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92969.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92970.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>gb|AIU92958.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHRGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>gb|AIU92963.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>ref|NP_567721.1| dehydration-responsive element-binding protein 1B [Arabidopsis 
thaliana]
 sp|P93835.2|DRE1B_ARATH RecName: Full=Dehydration-responsive element-binding protein 
1B; Short=Protein DREB1B; AltName: Full=C-repeat/dehydration-responsive 
element-binding factor 1; Short=C-repeat-binding 
factor 1; Short=CRT/DRE-binding factor 1 [Arabidopsis thaliana]
 emb|CAA18177.1| transcriptional activator CBF1/ CRT/CRE binding factor 1 [Arabidopsis 
thaliana]
 dbj|BAA33435.1| DREB1B [Arabidopsis thaliana]
 dbj|BAA33792.1| DREB1B [Arabidopsis thaliana]
 emb|CAB81359.1| transcriptional activator CBF1/ CRT/CRE binding factor 1 [Arabidopsis 
thaliana]
 gb|ABG38530.1| C-repeat/DRE binding factor 1 [Cucumis sativus]
 gb|ACI15570.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACJ70134.1| CBF1 [Olimarabidopsis pumila]
 gb|AEE85066.1| dehydration-responsive element-binding protein 1B [Arabidopsis 
thaliana]
Length=213

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 138/243 (57%), Gaps = 43/243 (18%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T C+    +AAA                  +D + +  +++  +D+   
Sbjct  105   DSAWRLRIPEST-CAKDIQKAAAEAALAF------------QDETCDTTTTNHGLDMEET  151

Query  815   DFFG-------NASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTL  657
                          + ++DEE +F +P LLDNMAEGML+ PP+++   ++D EGDG D++L
Sbjct  152   MVEAIYTPEQSEGAFYMDEETMFGMPTLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSL  210

Query  656   WKH  648
             W +
Sbjct  211   WSY  213



>gb|AFZ94947.1| C-repeat binding factor, partial [Lachnoloma sp. ZY-2012]
Length=215

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 124/203 (61%), Gaps = 18/203 (9%)
 Frame = -2

Query  1238  AGDQAAPVLQ----KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
              GD   P L     K+ AGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWL TF
Sbjct  25    GGDYCPPTLASSCPKKPAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLETF  84

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanapppp  897
              T EMAARAHDVAA+ LRG +A LNF  +A  L  P +T C+    +AAA          
Sbjct  85    PTAEMAARAHDVAAITLRGRSACLNFADSAWRLRIPEST-CAKDIQKAAAEAAVAFQDDT  143

Query  896   ppqfPCISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITP  717
               +      +   EA  ++   ++           ++DEEA+F +P LL NMAEGML+ P
Sbjct  144   TTEHGLDMEETMVEAIVTAEQSNV----------FYMDEEAMFGMPRLLANMAEGMLLPP  193

Query  716   PAMKKGFSWDDEGDGIDLTLWKH  648
             P+++   ++D EGD  D++LW +
Sbjct  194   PSVQWNHNYDGEGDD-DVSLWSY  215



>gb|ABV27072.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27083.1| C-repeat binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 130/236 (55%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + +LDEE +F +P LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYLDEETMFGMPTLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>gb|AIU92948.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELLRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>gb|ADE41100.1| AP2 domain class transcription factor [Malus domestica]
Length=236

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 123/187 (66%), Gaps = 3/187 (2%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarahdva  1032
             K+RAGR+ F+ETRHPVYRGVRRRN +KWVCE+REPN KKSRIWLGT+ T EMAARAHDVA
Sbjct  47    KKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLGTYPTAEMAARAHDVA  106

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEA  852
             ALA RG+ A LNF  +A  LP   S    DIR AA + A    P        S D   E+
Sbjct  107   ALAFRGKLACLNFADSAWRLPVPASIDSVDIRRAAAEAAETFRPAEFGGVLESGDDEKES  166

Query  851   ASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDDEGD  675
                    D  G++  G    +LDEE +F++P LLD+MAEG+L++PP    G+ +WDD G 
Sbjct  167   KKMEEEKDCGGVEGSG-ILFYLDEEEMFDMPRLLDSMAEGLLLSPPHSSGGYMNWDDMGS  225

Query  674   GIDLTLW  654
               D++LW
Sbjct  226   NDDVSLW  232



>ref|XP_008364557.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Malus domestica]
 gb|AGL07698.1| CBF/DREB 2 [Malus domestica]
 gb|AGM16327.1| C-repeat binding factor 2 [Malus domestica]
Length=236

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 123/187 (66%), Gaps = 3/187 (2%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarahdva  1032
             K+RAGR+ F+ETRHPVYRGVRRRN +KWVCE+REPN KKSRIWLGT+ T EMAARAHDVA
Sbjct  47    KKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLGTYPTAEMAARAHDVA  106

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEA  852
             ALA RG+ A LNF  +A  LP   S    DIR AA + A    P        S D   E+
Sbjct  107   ALAFRGKLACLNFADSAWRLPVPASIDSVDIRRAAAEAAETFRPAEFGGVLESGDDEXES  166

Query  851   ASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDDEGD  675
                    D  G++  G    +LDEE +F++P LLD+MAEG+L++PP    G+ +WDD G 
Sbjct  167   KKMEEEKDCGGVEGSG-ILFYLDEEEMFDMPRLLDSMAEGLLLSPPHSSGGYMNWDDMGS  225

Query  674   GIDLTLW  654
               D++LW
Sbjct  226   NDDVSLW  232



>gb|ABV27062.1| C-repeat binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 133/237 (56%), Gaps = 31/237 (13%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQAAPVLQ----KRRAGRKKFRET  1173
             N+FSA    F  D+E  G                 GD   P+L     K+ AGRKKFRET
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYC-PMLATSCPKKPAGRKKFRET  43

Query  1172  RHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNF  993
             RHP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF
Sbjct  44    RHPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNF  103

Query  992   PGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPG  819
               +A  L  P +T        AA   LA               D       +  T +   
Sbjct  104   ADSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ--  161

Query  818   LDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                    + ++DEE +F +P+LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ----SEGAFYMDEETMFGMPSLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>gb|ACI15564.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 129/236 (55%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALR  +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRSRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYMDEETMFGMPTLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>gb|ABV27064.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27079.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27089.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ACI15559.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15560.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15561.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15562.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 131/236 (56%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P+LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYMDEETMFGMPSLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>gb|ABV27057.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ACI15574.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 131/236 (56%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P+LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYIDEETMFGMPSLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>ref|XP_011089199.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Sesamum indicum]
Length=216

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 127/203 (63%), Gaps = 32/203 (16%)
 Frame = -2

Query  1220  PVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarah  1041
             P   K+RAGRK F+ETRHPVY+GVRR+       EVREPNKKSRIWLGTF  PE AA AH
Sbjct  31    PFKHKKRAGRKIFKETRHPVYKGVRRK------SEVREPNKKSRIWLGTFPDPETAAIAH  84

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanap---------pppppq  888
             DVAALALRGE A LNFP +A  LPRA S S  DI+ AAL+ A +               Q
Sbjct  85    DVAALALRGENAPLNFPDSARLLPRAPSSSHQDIQRAALEAAMSSGGKPLLGTHRQAFDQ  144

Query  887   fPCISRDHSAEAASSSRTIDLPGLDFFGNAS---TFLDEEAVFNLPALLDNMAEGMLITP  717
                +S ++  E AS             GN S    F+DEEA+FN+P LLD++AEG+L+TP
Sbjct  145   TRTVSVENGTERASE------------GNESGRVGFVDEEAMFNMPVLLDSLAEGLLLTP  192

Query  716   PAMKKGFSW--DDEGDGIDLTLW  654
              AM +GFSW  D+  D ++L LW
Sbjct  193   LAMSEGFSWSRDEVDDDVELHLW  215



>ref|XP_002867607.1| hypothetical protein ARALYDRAFT_492279 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43866.1| hypothetical protein ARALYDRAFT_492279 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 128/205 (62%), Gaps = 19/205 (9%)
 Frame = -2

Query  1238  AGDQAAPVLQ----KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             +G   +P L     K+ AGRKKFRETRHP+YRGVRRRN  KWVCE+REPNKK+RIWLGTF
Sbjct  12    SGGDYSPTLATSCPKKPAGRKKFRETRHPIYRGVRRRNSGKWVCELREPNKKTRIWLGTF  71

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanapppp  897
              T EMAARAHDVAA+ALRG +A LNF  +A  L  P +T C+    +AAA          
Sbjct  72    QTAEMAARAHDVAAIALRGRSACLNFADSAWRLRIPEST-CAKEIQKAAAEAALAFQDEM  130

Query  896   ppqfPCISRDHS--AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLI  723
                   ++ DH    E       +     D F     +LD+EA+F + +LLDNMAEGML+
Sbjct  131   CD----MTTDHGLDMEETMVEAIVTAEQSDAF-----YLDDEAIFGMSSLLDNMAEGMLL  181

Query  722   TPPAMKKGFSWDDEGDGIDLTLWKH  648
               P+++  +++D EGD  DL+LW +
Sbjct  182   PSPSVQWNYNFDVEGDD-DLSLWSY  205



>gb|ACE73696.1| DREB4 [Nicotiana tabacum]
Length=232

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 123/188 (65%), Gaps = 10/188 (5%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRG+RRRN +KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  54    KKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  113

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG +A LNF  +A  LP  TS +  DI+ A ++ A    P         ++   +  
Sbjct  114   IALRGRSACLNFADSAWRLPIPTSAAAKDIQKATVEAAETFRPVESHRENF-KEIIVDQV  172

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPP-AMKKGFSWDDEGDG  672
                   +LP      +   F+DEEA+F +P LL NMAEG+++ PP  +  G+  + E D 
Sbjct  173   IQELVAELP------DNVLFMDEEALFCMPRLLVNMAEGLMLPPPQCIIDGY--EMEADH  224

Query  671   IDLTLWKH  648
              D++LW +
Sbjct  225   ADMSLWSY  232



>gb|AAC49662.1| transcriptional activator CBF1 [Arabidopsis thaliana]
 gb|AAC99369.1| CRT/CRE binding factor 1 [Arabidopsis thaliana]
 gb|ABV27059.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27060.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27061.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27065.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27066.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27068.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27071.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27073.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27076.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27077.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27078.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27080.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27081.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27082.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27084.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27085.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27086.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27087.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27088.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ACI15558.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15563.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15565.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15566.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15567.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15568.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15569.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15571.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15572.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15573.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15575.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15576.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 130/236 (55%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYMDEETMFGMPTLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>ref|XP_004305358.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Fragaria vesca subsp. vesca]
Length=207

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 125/191 (65%), Gaps = 33/191 (17%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarah  1041
             V++KR+AGRKKF ETRHPVYRGVR+R+  KWVCE+R+P+ KKSR+WLGTF  PEMAARA+
Sbjct  44    VIKKRKAGRKKFTETRHPVYRGVRQRS-GKWVCEMRQPDLKKSRVWLGTFTCPEMAARAY  102

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHS  861
             DVAAL+LRGE+A LNFP  A++ P +TS        + + L                  +
Sbjct  103   DVAALSLRGESAELNFPEEAKASPSSTSSMSLLELTSMVNL-----------------EN  145

Query  860   AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDE  681
              E  S S  I             ++DEE +FN+P LLD++AEG+++TPPAM+KGF+WDD 
Sbjct  146   VEVESRSSRIG------------YVDEEELFNMPELLDSLAEGLILTPPAMQKGFNWDDY  193

Query  680   G--DGIDLTLW  654
                + ++ +LW
Sbjct  194   DLENAVEFSLW  204



>gb|AHH86061.1| CRT/DRE-binding factor 3 [Avicennia marina]
 gb|AHJ08667.1| CRT/DRE-binding factor 3 [Kandelia candel]
Length=242

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 118/187 (63%), Gaps = 6/187 (3%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRR+  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  62    KKRAGRKKFRETRHPVYRGVRRRDSGKWVCEVREPNKKSRIWLGTFLTAEMAARAHDVAA  121

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DIR AAL+ A A  P   +             
Sbjct  122   LALRGRSACLNFADSAWRLPLPASAEAKDIRRAALEAAEAFRPAGLETVSADESRQENNN  181

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              S     +   + F     F+DEEAVF LP LL NMAEGML+TPP      S D+     
Sbjct  182   ESKELATVSSEEMF-----FVDEEAVFGLPGLLANMAEGMLLTPPPC-LAESKDEMESEA  235

Query  668   DLTLWKH  648
             D++LW +
Sbjct  236   DVSLWSY  242



>gb|AAV80413.1| putative transcription factor CBF1 [Arabidopsis thaliana]
 gb|ABV27074.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27075.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ACI15554.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15555.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
 gb|ACI15556.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 131/236 (56%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAKAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P+LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYMDEETMFGMPSLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>gb|AIU92967.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQEAAAEAAGGFRPEGRVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+EAVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGEEVF-----YMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>gb|ABP98989.1| CBF/DREB1 transcription factor 3, partial [Betula pendula]
Length=207

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 126/192 (66%), Gaps = 10/192 (5%)
 Frame = -2

Query  1223  APVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaara  1044
             A  + KRRAGRKKF+ETRHPVYRGVRRRN++KWVCE+R+PN+K+RIWLGT+ + EMAARA
Sbjct  20    ASSMPKRRAGRKKFKETRHPVYRGVRRRNKNKWVCEMRKPNEKTRIWLGTYPSAEMAARA  79

Query  1043  hdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCIS-RD  867
             HDVAALALRG +A LNF  +A SLP   S    +I+ AA   A    P      C    +
Sbjct  80    HDVAALALRGSSACLNFADSAWSLPVPASTDAGEIQRAAAAAAEGFQPSEFGEDCEEVLE  139

Query  866   HSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWD  687
                E     +  ++ G++  G    ++DEEAVF++P LL NMAEG+L++PP       WD
Sbjct  140   RCTERVDDHQEAEVRGVEESG--VLYMDEEAVFDMPGLLANMAEGLLLSPP------QWD  191

Query  686   DEGDGI-DLTLW  654
             D    I +++LW
Sbjct  192   DMESIISEVSLW  203



>gb|ACI42860.1| dehydration-responsive element-binding protein 1B [Rosa hybrid 
cultivar]
Length=231

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 118/192 (61%), Gaps = 14/192 (7%)
 Frame = -2

Query  1223  APVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaara  1044
             A    K+RAGRKKF+ETRHPVYRGVRRRN  KWVCEVREPNKK+RIWLGTF T EMAARA
Sbjct  52    AATYPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARA  111

Query  1043  hdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH  864
             HDVAA++LRG +A LNF  +A  LP   S S  DI+ AA Q A A  P   +   +S   
Sbjct  112   HDVAAISLRGRSACLNFADSAWRLPVPASTSAKDIQTAAAQAAEAFRPTGEESEVVSGSV  171

Query  863   SAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
             +A  A                    +DEE VF +P LL NMAEGML++PP     +  DD
Sbjct  172   TATEAELEPVF-------------CMDEEDVFGMPGLLANMAEGMLLSPPHYNS-YGGDD  217

Query  683   EGDGIDLTLWKH  648
                  D++LW +
Sbjct  218   MEGYADVSLWSY  229



>gb|ABV27067.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ABV27069.1| C-repeat binding factor 1 [Arabidopsis thaliana]
 gb|ACI15557.1| DRE/CRT-binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 131/236 (56%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  + +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYSPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P+LLDNMAEGML+ PP+++   ++D EGDG D++LW +
Sbjct  162   ---SEGAFYMDEETMFGMPSLLDNMAEGMLLPPPSVQWNHNYDGEGDG-DVSLWSY  213



>gb|AGH33881.1| DREB70 [Populus hopeiensis]
Length=254

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 116/192 (60%), Gaps = 18/192 (9%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  70    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  129

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A              R       
Sbjct  130   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGF-----------RPEGCVGG  178

Query  848   SSSRTIDLPGLDFFGNAST-----FLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWD  687
                RT+D         A       ++D+EAVF +P LL NMAEGML+ PP    G   WD
Sbjct  179   ELMRTVDEGEKAAETAAEAGEEVFYMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWD  238

Query  686   D-EGDGIDLTLW  654
             + E    D++LW
Sbjct  239   NMENIDADMSLW  250



>gb|ABV27070.1| C-repeat binding factor 1 [Arabidopsis thaliana]
Length=213

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 130/236 (55%), Gaps = 29/236 (12%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQA---APVLQKRRAGRKKFRETR  1170
             N+FSA    F  D+E  G                 GD     A    K+ AGRKKFRETR
Sbjct  2     NSFSAFSEMFGSDYEPQG-----------------GDYCPTLATSCPKKPAGRKKFRETR  44

Query  1169  HPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNFP  990
             HP+YRGVR+RN  KWV EVREPNKK+RIWLGTF T EMAARAHDVAALALRG +A LNF 
Sbjct  45    HPIYRGVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFA  104

Query  989   GAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGL  816
              +A  L  P +T        AA   LA               D       +  T +    
Sbjct  105   DSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTDHGLDMEETMVEAIYTPEQ---  161

Query  815   DFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                   + ++DEE +F +P LLDNMAEGML+ PP+++   ++D +GDG D++LW +
Sbjct  162   ---SEGAFYMDEETMFGMPTLLDNMAEGMLLPPPSVQWNHNYDGKGDG-DVSLWSY  213



>gb|AFA50331.1| dehydration-responsive element-binding protein 1 [Manihot esculenta]
Length=219

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 116/185 (63%), Gaps = 10/185 (5%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVR+RN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  41    KKRAGRKKFRETRHPVYRGVRQRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  100

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  ++  LP   S    DI+ AA + A A  P   +  C       +  
Sbjct  101   LALRGRSACLNFADSSWRLPVPASSEAKDIQKAAAEAAMAFQPVGTEGFCEEVKLENKTT  160

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
             + + T ++           ++DEEAVF +P LL  MAEGML+ PP        D E D  
Sbjct  161   TEAATEEV----------FYMDEEAVFGMPGLLAYMAEGMLLPPPQCVAQSGEDIETDAA  210

Query  668   DLTLW  654
             D+ LW
Sbjct  211   DVPLW  215



>gb|AIU92956.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 117/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+EAVF +P LL NMAEG L+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGEEVF-----YMDDEAVFEMPGLLANMAEGTLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>ref|XP_006284509.1| hypothetical protein CARUB_v10005709mg [Capsella rubella]
 gb|EOA17407.1| hypothetical protein CARUB_v10005709mg [Capsella rubella]
Length=217

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 139/235 (59%), Gaps = 23/235 (10%)
 Frame = -2

Query  1340  NTFSAIFIFFQMDFENDGNsssspssspssSQEIAGDQAAPVLQ----KRRAGRKKFRET  1173
             N+FSA    F  D+E+  +               +G    P+L     K+ AGRKKFRET
Sbjct  2     NSFSAFSEMFGSDYESPVS---------------SGGDYCPMLAASCPKKPAGRKKFRET  46

Query  1172  RHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaalalrgeaaaLNF  993
             RHP+YRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA+ALRG +A LNF
Sbjct  47    RHPIYRGVRRRNSGKWVCEVREPNKKSRIWLGTFQTAEMAARAHDVAAIALRGRSACLNF  106

Query  992   PGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAASSSRTIDLPGLD  813
               +A  L    S    +I+ AA + A A           + DH  +      T+    + 
Sbjct  107   ADSAWRLRIPESTCAKEIQKAAAEAALAFQNEMMSDTTTTSDHGLDM---EETLVEAVVT  163

Query  812   FFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGIDLTLWKH  648
                + + ++DEEA+F +P+ LD++AEGML+  P+++   +++ EGD  D++LW +
Sbjct  164   PEQSDTLYIDEEAMFGMPSFLDSLAEGMLLPLPSVQWNNNYEFEGDA-DMSLWSY  217



>gb|AFJ14631.1| dehydration-responsive element-binding protein, partial [Malus 
domestica]
Length=335

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 123/187 (66%), Gaps = 3/187 (2%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarahdva  1032
             K+RAGR+ F+ETRHPVYRGVRRRN +KWVCE+REPN KKSRIWLGT+ T EMAARAHDVA
Sbjct  146   KKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLGTYPTAEMAARAHDVA  205

Query  1031  alalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEA  852
             ALA RG+ A LNF  +A  LP   S   ADIR AA + A             S D   E+
Sbjct  206   ALAFRGKLACLNFADSAWRLPVPASIDSADIRRAAAEAAETFRSAEFGGVLESGDDEKES  265

Query  851   ASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDDEGD  675
                    D  G++  G    +LDEE +F++P LLD+MAEG+L++PP    G+ +WDD G 
Sbjct  266   KKMEEEKDCGGVEGSG-ILFYLDEEEMFDMPRLLDSMAEGLLLSPPHSSGGYMNWDDMGS  324

Query  674   GIDLTLW  654
               D++LW
Sbjct  325   NDDVSLW  331



>gb|ABC79626.1| CBF1 [Populus tomentosa]
Length=231

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 120/191 (63%), Gaps = 14/191 (7%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGR+ F+ETRHP++RGVR+RN DKWVCE+REPNKKSRIWLGT+ TPEMAARAHDVAA
Sbjct  47    KKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAA  106

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAE--  855
             LA RG++A LNF  +A  LP   S + A     A   A            +  DH+ E  
Sbjct  107   LAFRGKSACLNFADSAWRLPAPIS-NEAKDIRRAASEAAELFRTSDLGGQVMEDHTTENR  165

Query  854   ----AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWD  687
                 ++++    DLP  +      +++DEEA FNLP LL NMAEG+L++PP       W+
Sbjct  166   GEVCSSTNDDIRDLPSENV-----SYIDEEAEFNLPGLLANMAEGLLLSPPHYTG--DWN  218

Query  686   DEGDGIDLTLW  654
             D     D +LW
Sbjct  219   DGEIDADWSLW  229



>gb|AIU92964.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 117/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  71    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  130

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S    DI+ AA + A    P       + R    E  
Sbjct  131   LALRGRSACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGD-EGE  189

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGF-SWDD-EGD  675
              +  T    G + F     ++D+ AVF +P LL NMAEGML+ PP    G   WD+ E  
Sbjct  190   KAVETAAEAGDEVF-----YMDDVAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENI  244

Query  674   GIDLTLW  654
               D+ LW
Sbjct  245   DADMPLW  251



>ref|NP_001234123.1| CBF1 protein [Solanum lycopersicum]
 gb|AAK57551.1| putative transcriptional activator CBF1 [Solanum lycopersicum]
 gb|AAS77820.1| CBF1 [Solanum lycopersicum]
Length=210

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 117/187 (63%), Gaps = 17/187 (9%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+ AGRKKFRETRHP+YRG+R+RN  KWVCEVREPNKK+RIWLGTF T EMAARAHDVAA
Sbjct  39    KKPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAA  98

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S +  DI+ AA Q               S + S E+ 
Sbjct  99    LALRGRSACLNFSDSAWRLPIPASSNSKDIQKAAAQAVEIFR---------SEEVSGESP  149

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              +S  +          +S F+DEEA+F +P LL NMAEG+++ PP   +      E D  
Sbjct  150   ETSENVQ--------ESSDFVDEEAIFFMPGLLANMAEGLMLPPPQCAEMGDHCVETDAY  201

Query  668   DLTLWKH  648
              +TLW +
Sbjct  202   MITLWNY  208



>gb|ACB45087.1| CRT binding factor 1 [Solanum habrochaites]
Length=219

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 117/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KR AGRKKFRETRHP+YRG+R+RN  KWVCEVREPNKK+RIWLGTF T EMAARAHDVAA
Sbjct  39    KRPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAA  98

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S +  DI+ AA + A    P            ++ + 
Sbjct  99    LALRGRSACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESEQVSGESDNSTSP  158

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              +S  +          +S F+DEEA+F +P LL NMAEG+++ PP   +      E D  
Sbjct  159   ETSENVQ--------ESSDFVDEEAIFFMPGLLANMAEGLMLPPPQCAEMGDHYVETDAY  210

Query  668   DLTLWKH  648
              +TLW +
Sbjct  211   MITLWNY  217



>ref|XP_010317563.1| PREDICTED: CBF1 protein isoform X1 [Solanum lycopersicum]
Length=206

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 116/187 (62%), Gaps = 17/187 (9%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+ AGRKKFRETRHPVYRGVR+RN  KWVCEVREPNKK+RIWLGTF T EMAARAHDVAA
Sbjct  35    KKPAGRKKFRETRHPVYRGVRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAA  94

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             +ALRG +A LNF  +A  LP   S    DI+ AA Q               S + S E+ 
Sbjct  95    IALRGRSACLNFADSAWRLPTPDSSDTKDIQKAAAQAVEIFR---------SEEVSGESP  145

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              +S  +          +S F+DEEA+F +P LL NMAEG+++ PP   +      E D  
Sbjct  146   ETSENVQ--------ESSDFVDEEAIFFMPGLLANMAEGLMLPPPQCAEMGDHCVETDAY  197

Query  668   DLTLWKH  648
              +TLW +
Sbjct  198   MITLWNY  204



>ref|XP_008391758.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Malus domestica]
Length=193

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 123/195 (63%), Gaps = 17/195 (9%)
 Frame = -2

Query  1217  VLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPN-KKSRIWLGTFATPEMaarah  1041
             V++KR+AGRKKF ETRHPV +GVR+R   KWVCE+R+P+ KKSRIWLGTF +P+MAARA+
Sbjct  7     VVKKRKAGRKKFTETRHPVXKGVRQRC-GKWVCELRQPDHKKSRIWLGTFTSPDMAARAY  65

Query  1040  dvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHS  861
             DVAALAL+GE+A+LNFP  A +LPR  S +          L  A      +    S    
Sbjct  66    DVAALALKGESASLNFPNEASALPRFESNAYTVKXIQCAALEAAEAFLEVKVKASSSSSL  125

Query  860   AEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSW---  690
                      +             +LDEE +FN+P L+D+MAEG+++TPP+++KGF+W   
Sbjct  126   KLEKVEEEEM---------GKVVYLDEEELFNMPGLIDSMAEGLILTPPSLQKGFNWNEY  176

Query  689   --DDEGDGI-DLTLW  654
               DD G+   D++LW
Sbjct  177   DDDDWGNNTGDISLW  191



>ref|XP_010448427.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Camelina sativa]
Length=211

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 126/203 (62%), Gaps = 15/203 (7%)
 Frame = -2

Query  1238  AGDQAAPVLQ----KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTF  1071
             +G    P L     K+ AGRKKFRETRHP+YRGVRRRN  KWVCEVREPNKKSRIWLGTF
Sbjct  18    SGGDYCPTLAASCPKKPAGRKKFRETRHPIYRGVRRRNSGKWVCEVREPNKKSRIWLGTF  77

Query  1070  ATPEMaarahdvaalalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanapppp  897
              T EMAARAHDVAA+ALRG +A LNF  +A  L  P +T C+    +      A A    
Sbjct  78    QTAEMAARAHDVAAIALRGRSACLNFADSAWRLRIPEST-CA----KEIQKAAAEAALAF  132

Query  896   ppqfPCISRDHSAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITP  717
               +    + DH  +      T     +    + + ++DEEA+F +P+ L NMAEGML+ P
Sbjct  133   QNESDITTTDHGLDM---EETFVEAVVTEEQSEAFYMDEEAMFGMPSFLANMAEGMLLPP  189

Query  716   PAMKKGFSWDDEGDGIDLTLWKH  648
             P+++   ++D EGD  +++LW +
Sbjct  190   PSVQWNNNYDGEGDA-EMSLWSY  211



>gb|AFA50332.1| dehydration-responsive element-binding protein 2 [Manihot esculenta]
Length=231

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 113/187 (60%), Gaps = 14/187 (7%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGRKKFRETRHPVYRGVRRRN  KWVCEVREPNKKSRIWLGTF T EMAARAHDVAA
Sbjct  53    KKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAA  112

Query  1028  lalrgeaaaLNFPGAAESL--PRATSCSpadiraaalqlanappppppqfPCISRDHSAE  855
             LALRG +A LNF  ++  L  P +T        AA   +A  P         I R++   
Sbjct  113   LALRGRSACLNFADSSWRLPVPASTDAKDIQKAAAEAAMAFQPVGTEGFSEEIKRENKKT  172

Query  854   AASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGD  675
                 S        D F     ++DEEA+F +P LL  MAEGML+ PP   +    D E  
Sbjct  173   TGEESE-------DVF-----YMDEEAIFGMPGLLAYMAEGMLLPPPQCVEESGEDKEMT  220

Query  674   GIDLTLW  654
               D++LW
Sbjct  221   AADMSLW  227



>dbj|BAE17131.1| LhCBF1 [Lycopersicon hirsutum]
Length=222

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 117/187 (63%), Gaps = 8/187 (4%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             KR AGRKKFRETRHP+YRG+R+RN  KWVCEVREPNKK+RIWLGTF T EMAARAHDVAA
Sbjct  42    KRPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAA  101

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG +A LNF  +A  LP   S +  DI+ AA + A    P            ++ + 
Sbjct  102   LALRGRSACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESEEVSGESDNSTSP  161

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDDEGDGI  669
              +S  +          +S F+DEEA+F +P LL NMAEG+++ PP   +      E D  
Sbjct  162   ETSENVQ--------ESSDFVDEEAIFFMPGLLANMAEGLMLPPPQCAEMGDHYVETDAY  213

Query  668   DLTLWKH  648
              +TLW +
Sbjct  214   MITLWNY  220



>gb|KDP25514.1| hypothetical protein JCGZ_20670 [Jatropha curcas]
Length=227

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 129/189 (68%), Gaps = 13/189 (7%)
 Frame = -2

Query  1208  KRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaarahdvaa  1029
             K+RAGR+ F+ETRHP++RGVR+RN +KWVCE+REPNKK+RIWLGT+ TPEMAARAHDVAA
Sbjct  44    KKRAGRRIFKETRHPIFRGVRKRNNEKWVCELREPNKKTRIWLGTYPTPEMAARAHDVAA  103

Query  1028  lalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDHSAEAA  849
             LALRG++A LNF  ++  LP   S    DIR AA + A        +   +  ++S E  
Sbjct  104   LALRGKSACLNFADSSWRLPVPVSKEAQDIRRAAHEAAEMFRSGETEKCGV--EYSGEV-  160

Query  848   SSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAM---KKGFSWDD-E  681
              SSR  +L       N  +++DEEAVF++P LL NMAEG L++PP       G +WD+ E
Sbjct  161   -SSRNSELKQ----ENDVSYIDEEAVFDMPGLLANMAEGPLLSPPHYAGGDDGVNWDELE  215

Query  680   GDGIDLTLW  654
              DG +++LW
Sbjct  216   ADG-EVSLW  223



>ref|XP_004308117.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Fragaria vesca subsp. vesca]
Length=229

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 122/192 (64%), Gaps = 12/192 (6%)
 Frame = -2

Query  1223  APVLQKRRAGRKKFRETRHPVYRGVRRRNEDKWVCEVREPNKKSRIWLGTFATPEMaara  1044
             A    K+RAGRKKF+ETRHPVYRGVRRRN  KWVCEVREPNKK+RIWLGTF T EMAARA
Sbjct  48    AGTYPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARA  107

Query  1043  hdvaalalrgeaaaLNFPGAAESLPRATSCSpadiraaalqlanappppppqfPCISRDH  864
             HDVAA+ALRG +A LNF  +A  LP   S S  DI+ AA + A A  P   +   +S+  
Sbjct  108   HDVAAIALRGRSACLNFADSAWRLPVPASNSAKDIQTAAAEAAEAFRPNGEESEVVSKAA  167

Query  863   SAEAASSSRTIDLPGLDFFGNASTFLDEEAVFNLPALLDNMAEGMLITPPAMKKGFSWDD  684
              A  A S + +      F+ +      EE VF +P LL NMAEGML+ PP    G+  DD
Sbjct  168   EAVEAESEQPV------FYMDV-----EEDVFGMPGLLANMAEGMLLPPPQY-SGYGGDD  215

Query  683   EGDGIDLTLWKH  648
                  D++LW +
Sbjct  216   MEGYADVSLWSY  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3524261125780