BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31939_g1_i1 len=1551 path=[1529:0-1550]

Length=1551
                                                                      Score     E

ref|XP_009761551.1|  PREDICTED: la-related protein 6C-like isofor...    440   5e-147   
ref|XP_009625721.1|  PREDICTED: la-related protein 6C-like              437   5e-146   
ref|XP_006346524.1|  PREDICTED: uncharacterized protein LOC102603710    426   9e-142   
ref|XP_004292453.1|  PREDICTED: uncharacterized protein LOC101311941    424   7e-141   
gb|KDP38238.1|  hypothetical protein JCGZ_04881                         426   1e-140   
ref|XP_010315496.1|  PREDICTED: la-related protein 6C                   421   1e-139   
ref|XP_010107985.1|  La-related protein 7                               420   2e-139   
ref|XP_008392294.1|  PREDICTED: la-related protein 6C                   417   3e-138   
ref|XP_002521842.1|  lupus la ribonucleoprotein, putative               417   8e-138   Ricinus communis
ref|XP_007042354.1|  RNA-binding protein, putative isoform 1            415   1e-136   
ref|XP_002281817.1|  PREDICTED: la-related protein 6C isoform X1        411   9e-136   Vitis vinifera
ref|XP_007042355.1|  RNA-binding protein, putative isoform 2            410   5e-135   
gb|AES90236.2|  LA-related protein 6 LA RNA-binding domain protein      409   8e-135   
ref|XP_009609348.1|  PREDICTED: la-related protein 6C-like              409   2e-134   
ref|XP_009772752.1|  PREDICTED: la-related protein 6C-like              405   5e-133   
ref|XP_006423072.1|  hypothetical protein CICLE_v10028506mg             402   7e-132   
ref|XP_007200048.1|  hypothetical protein PRUPE_ppa024894mg             400   2e-131   
ref|XP_008236634.1|  PREDICTED: la-related protein 6C isoform X1        400   2e-131   
ref|XP_010647782.1|  PREDICTED: la-related protein 6C isoform X2        395   2e-129   
ref|XP_006356602.1|  PREDICTED: la-related protein 6-like               394   3e-129   
ref|XP_007156532.1|  hypothetical protein PHAVU_003G293900g             392   2e-128   
ref|XP_006480245.1|  PREDICTED: la-related protein 7-like               390   3e-127   
ref|XP_003608039.1|  La-related protein                                 390   4e-127   
ref|XP_010248222.1|  PREDICTED: la-related protein 6C-like              387   2e-126   
gb|KHN31051.1|  La-related protein 7                                    384   3e-125   
ref|XP_004248744.1|  PREDICTED: la-related protein 6C-like              384   3e-125   
ref|XP_008236635.1|  PREDICTED: la-related protein 6C isoform X2        384   4e-125   
ref|XP_009761614.1|  PREDICTED: la-related protein 6C-like isofor...    383   4e-125   
ref|XP_003528499.1|  PREDICTED: la-related protein 6-like               382   1e-124   
ref|XP_003520171.1|  PREDICTED: la-related protein 6-like               382   2e-124   
ref|XP_011001196.1|  PREDICTED: la-related protein 6C                   378   1e-122   
ref|XP_006384451.1|  hypothetical protein POPTR_0004s15210g             376   7e-122   
ref|XP_010255219.1|  PREDICTED: la-related protein 6C-like              374   3e-121   
ref|XP_008236636.1|  PREDICTED: la-related protein 6C isoform X3        372   4e-121   
gb|KDO49150.1|  hypothetical protein CISIN_1g046325mg                   374   1e-120   
ref|XP_010999935.1|  PREDICTED: la-related protein 6C-like              372   2e-120   
ref|XP_002313090.2|  hypothetical protein POPTR_0009s10970g             367   2e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011092741.1|  PREDICTED: la-related protein 6C-like isofor...    365   8e-118   
ref|XP_004153773.1|  PREDICTED: uncharacterized protein LOC101217948    361   2e-116   
ref|XP_004145408.1|  PREDICTED: uncharacterized protein LOC101207999    361   5e-116   
ref|XP_011092740.1|  PREDICTED: la-related protein 6C-like isofor...    359   2e-115   
emb|CDO97143.1|  unnamed protein product                                359   3e-115   
gb|KGN61738.1|  hypothetical protein Csa_2G235610                       357   3e-114   
ref|XP_010066055.1|  PREDICTED: la-related protein 6C isoform X1        351   2e-112   
ref|XP_010540322.1|  PREDICTED: la-related protein 6C                   352   2e-112   
ref|XP_008459218.1|  PREDICTED: la-related protein 6C                   349   2e-111   
ref|XP_008803782.1|  PREDICTED: la-related protein 6C                   348   5e-111   
ref|XP_010930389.1|  PREDICTED: la-related protein 6C                   348   5e-111   
emb|CAN81423.1|  hypothetical protein VITISV_035943                     358   2e-109   Vitis vinifera
gb|EYU42655.1|  hypothetical protein MIMGU_mgv1a007130mg                337   1e-106   
gb|KFK39252.1|  hypothetical protein AALP_AA3G220100                    336   7e-106   
ref|XP_002883162.1|  predicted protein                                  335   1e-105   
ref|XP_004171643.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    332   7e-105   
ref|XP_010691018.1|  PREDICTED: la-related protein 6C                   333   2e-104   
ref|NP_188540.1|  RNA-binding protein                                   330   9e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99268.1|  BnaC05g33830D                                          330   1e-103   
ref|XP_009145827.1|  PREDICTED: la-related protein 6C-like              328   6e-103   
ref|XP_006406537.1|  hypothetical protein EUTSA_v10020682mg             325   2e-101   
ref|XP_006299563.1|  hypothetical protein CARUB_v10015738mg             321   5e-100   
ref|XP_010466043.1|  PREDICTED: la-related protein 6C-like              313   4e-97    
ref|XP_009398953.1|  PREDICTED: la-related protein 6C                   311   5e-97    
ref|XP_010507427.1|  PREDICTED: la-related protein 6C                   311   2e-96    
ref|XP_009408806.1|  PREDICTED: la-related protein 6C-like              310   3e-96    
ref|XP_010066056.1|  PREDICTED: la-related protein 6C isoform X2        301   1e-93    
ref|XP_011088295.1|  PREDICTED: la-related protein 6C                   300   6e-93    
ref|XP_010487835.1|  PREDICTED: la-related protein 6C                   302   8e-93    
dbj|BAK04171.1|  predicted protein                                      300   5e-92    
gb|AAF00075.2|AF094825_1  RNA-binding protein homolog                   293   1e-90    Brassica napus [oilseed rape]
ref|XP_009135612.1|  PREDICTED: la-related protein 6C-like              294   1e-89    
gb|EMS67153.1|  La-related protein 7                                    294   1e-89    
gb|EPS58875.1|  hypothetical protein M569_15937                         286   7e-89    
ref|XP_010228482.1|  PREDICTED: la-related protein 6C                   278   7e-84    
ref|NP_001058684.1|  Os07g0102500                                       277   2e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004987293.1|  PREDICTED: la-related protein 7-like               277   5e-83    
gb|AAK50577.1|AC084404_2  putative RNA-binding protein                  272   8e-83    Oryza sativa [red rice]
gb|EEC75591.1|  hypothetical protein OsI_12289                          273   4e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001050504.1|  Os03g0566500                                       273   5e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004986415.1|  PREDICTED: la-related protein 6-like               271   2e-81    
ref|XP_006651554.1|  PREDICTED: uncharacterized protein LOC102719286    270   5e-81    
emb|CDX82312.1|  BnaA03g35090D                                          268   6e-80    
emb|CDY22991.1|  BnaC03g40780D                                          264   1e-78    
ref|XP_006658195.1|  PREDICTED: la-related protein 6-like               263   2e-78    
ref|XP_006848537.1|  hypothetical protein AMTR_s00169p00025570          261   8e-78    
gb|EPS74002.1|  hypothetical protein M569_00755                         255   8e-76    
ref|XP_008651912.1|  PREDICTED: la-related protein 6C-like              257   4e-75    
ref|XP_008666613.1|  PREDICTED: la-related protein 6C-like              248   2e-72    
ref|XP_002461300.1|  hypothetical protein SORBIDRAFT_02g000420          250   3e-72    Sorghum bicolor [broomcorn]
ref|XP_010251419.1|  PREDICTED: la-related protein 6B isoform X2        248   4e-72    
gb|EMT10567.1|  26S proteasome non-ATPase regulatory subunit 11         250   5e-70    
ref|XP_010251418.1|  PREDICTED: la-related protein 6B isoform X1        241   5e-69    
ref|XP_002275950.2|  PREDICTED: LOW QUALITY PROTEIN: la-related p...    237   4e-68    Vitis vinifera
ref|XP_004139806.1|  PREDICTED: uncharacterized protein LOC101207485    229   8e-65    
ref|XP_008447184.1|  PREDICTED: la-related protein 6B isoform X1        229   1e-64    
ref|XP_009592278.1|  PREDICTED: la-related protein 6B-like              225   2e-63    
ref|XP_007026488.1|  RNA-binding protein, putative isoform 2            223   5e-63    
ref|XP_010908488.1|  PREDICTED: la-related protein 6B-like              222   3e-62    
ref|XP_007026487.1|  RNA-binding protein, putative isoform 1            223   3e-62    
ref|XP_008360671.1|  PREDICTED: la-related protein 6C-like              216   5e-62    
emb|CBI24756.3|  unnamed protein product                                217   8e-62    
ref|XP_006858735.1|  hypothetical protein AMTR_s00066p00125170          220   9e-62    
ref|XP_010672517.1|  PREDICTED: la-related protein 6B                   221   2e-61    
gb|KDP29552.1|  hypothetical protein JCGZ_19265                         221   2e-61    
ref|XP_007026489.1|  RNA-binding protein, putative isoform 3            218   2e-60    
ref|XP_008801106.1|  PREDICTED: la-related protein 6B-like              217   3e-60    
gb|EMS62383.1|  La-related protein 7                                    209   2e-59    
ref|XP_004287183.1|  PREDICTED: uncharacterized protein LOC101304608    214   2e-59    
ref|XP_011005266.1|  PREDICTED: la-related protein 6B-like              216   2e-59    
tpg|DAA49246.1|  TPA: hypothetical protein ZEAMMB73_519082              212   4e-59    
ref|XP_009393796.1|  PREDICTED: la-related protein 6B-like isofor...    213   4e-59    
ref|XP_009761351.1|  PREDICTED: la-related protein 6B-like              214   5e-59    
ref|XP_009393795.1|  PREDICTED: la-related protein 6B-like isofor...    213   6e-59    
ref|XP_011085064.1|  PREDICTED: la-related protein 6B-like isofor...    213   7e-59    
gb|EEE51926.1|  hypothetical protein OsJ_33536                          213   9e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139081.1|  hypothetical protein PHAVU_009G2633000g            209   1e-58    
gb|EEC67957.1|  hypothetical protein OsI_35696                          213   1e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_009343678.1|  PREDICTED: la-related protein 6B                   211   6e-58    
ref|XP_008788265.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...    211   1e-57    
gb|AGT16157.1|  hypothetical protein SHCRBa_167_G07_R_10                205   1e-57    
ref|XP_010912744.1|  PREDICTED: la-related protein 6B-like              209   2e-57    
ref|XP_010930308.1|  PREDICTED: la-related protein 6B-like              209   3e-57    
gb|EMT07023.1|  La-related protein 7                                    207   3e-57    
ref|XP_003577639.1|  PREDICTED: la-related protein 6B                   209   4e-57    
tpg|DAA41895.1|  TPA: hypothetical protein ZEAMMB73_789693              205   6e-57    
ref|XP_004159060.1|  PREDICTED: la-related protein 7-like               204   9e-57    
dbj|BAK05864.1|  predicted protein                                      207   1e-56    
ref|XP_009389160.1|  PREDICTED: la-related protein 6B-like              205   4e-56    
ref|XP_009404917.1|  PREDICTED: la-related protein 6B-like              205   5e-56    
ref|XP_008447187.1|  PREDICTED: la-related protein 6B isoform X4        203   6e-56    
ref|XP_008667401.1|  PREDICTED: uncharacterized protein LOC100217...    205   8e-56    
ref|XP_008667400.1|  PREDICTED: uncharacterized protein LOC100217...    205   9e-56    
ref|XP_008447186.1|  PREDICTED: la-related protein 6B isoform X3        204   9e-56    
ref|XP_004251985.1|  PREDICTED: la-related protein 6B                   204   1e-55    
ref|XP_008447185.1|  PREDICTED: la-related protein 6B isoform X2        204   1e-55    
ref|XP_006577368.1|  PREDICTED: la-related protein 6-like isoform X2    201   2e-55    
ref|XP_011074010.1|  PREDICTED: la-related protein 6B-like              203   2e-55    
ref|XP_004978967.1|  PREDICTED: la-related protein 6-like               203   4e-55    
ref|XP_002449258.1|  hypothetical protein SORBIDRAFT_05g006890          202   7e-55    Sorghum bicolor [broomcorn]
gb|AAX96755.1|  At2g43970/F6E13.10                                      203   7e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006353141.1|  PREDICTED: uncharacterized protein LOC102593695    203   8e-55    
gb|AFW56663.1|  hypothetical protein ZEAMMB73_374856                    200   8e-55    
ref|XP_007202011.1|  hypothetical protein PRUPE_ppa005181mg             202   9e-55    
ref|XP_010101330.1|  La-related protein 7                               202   9e-55    
ref|XP_002443059.1|  hypothetical protein SORBIDRAFT_08g007220          202   9e-55    Sorghum bicolor [broomcorn]
ref|XP_002878301.1|  hypothetical protein ARALYDRAFT_907506             200   9e-55    
gb|KDO51617.1|  hypothetical protein CISIN_1g009251mg                   200   1e-54    
ref|XP_008243073.1|  PREDICTED: la-related protein 6B                   201   2e-54    
ref|XP_010238604.1|  PREDICTED: la-related protein 6B-like              201   2e-54    
gb|KDO51616.1|  hypothetical protein CISIN_1g009251mg                   199   2e-54    
ref|XP_003521844.1|  PREDICTED: la-related protein 6-like isoformX1     201   3e-54    
ref|XP_004244780.1|  PREDICTED: la-related protein 6B                   200   3e-54    
gb|KHG02211.1|  La-related 7                                            199   3e-54    
ref|XP_003554803.1|  PREDICTED: la-related protein 6-like isoform 1     200   3e-54    
ref|NP_001148460.1|  LOC100282075                                       201   4e-54    Zea mays [maize]
ref|XP_004960758.1|  PREDICTED: la-related protein 6-like               200   6e-54    
gb|KDO51615.1|  hypothetical protein CISIN_1g009251mg                   199   1e-53    
gb|ACR36891.1|  unknown                                                 199   1e-53    Zea mays [maize]
gb|EPS72682.1|  hypothetical protein M569_02071                         194   2e-53    
gb|ABA96798.2|  transposon protein, putative, Mutator sub-class, ...    194   3e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011011378.1|  PREDICTED: la-related protein 6B-like isofor...    196   3e-53    
ref|XP_011001840.1|  PREDICTED: la-related protein 6B-like isofor...    196   3e-53    
dbj|BAJ88869.1|  predicted protein                                      194   3e-53    
ref|XP_006493132.1|  PREDICTED: lateral signaling target protein ...    198   7e-53    
ref|XP_006442037.1|  hypothetical protein CICLE_v10019649mg             198   7e-53    
gb|KDO51612.1|  hypothetical protein CISIN_1g009251mg                   198   7e-53    
gb|KDO51613.1|  hypothetical protein CISIN_1g009251mg                   198   8e-53    
gb|KDO51614.1|  hypothetical protein CISIN_1g009251mg                   198   8e-53    
ref|XP_002323712.2|  hypothetical protein POPTR_0017s04020g             197   1e-52    Populus trichocarpa [western balsam poplar]
ref|XP_008394254.1|  PREDICTED: la-related protein 6B                   197   1e-52    
ref|XP_011011377.1|  PREDICTED: la-related protein 6B-like isofor...    196   1e-52    
ref|XP_011001839.1|  PREDICTED: la-related protein 6B-like isofor...    196   1e-52    
ref|XP_009366258.1|  PREDICTED: la-related protein 6B-like              196   1e-52    
ref|XP_006342440.1|  PREDICTED: la-related protein 6-like               197   1e-52    
ref|XP_002529112.1|  lupus la ribonucleoprotein, putative               197   1e-52    Ricinus communis
ref|XP_006380252.1|  hypothetical protein POPTR_0007s00450g             196   2e-52    
ref|XP_006664435.1|  PREDICTED: la-related protein 7-like               194   2e-52    
ref|XP_004253040.1|  PREDICTED: la-related protein 6B-like              196   2e-52    
ref|XP_002310383.2|  hypothetical protein POPTR_0007s00450g             196   3e-52    Populus trichocarpa [western balsam poplar]
ref|NP_001067617.1|  Os11g0248200                                       192   3e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006380251.1|  hypothetical protein POPTR_0007s00450g             196   4e-52    
ref|XP_009598306.1|  PREDICTED: la-related protein 6B                   194   8e-52    
gb|EAY82629.1|  hypothetical protein OsI_37849                          194   1e-51    Oryza sativa Indica Group [Indian rice]
gb|EAZ20013.1|  hypothetical protein OsJ_35608                          192   3e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008447188.1|  PREDICTED: la-related protein 6B isoform X5        188   3e-51    
gb|ABA96797.2|  transposon protein, putative, Mutator sub-class, ...    192   3e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006351072.1|  PREDICTED: la-related protein 6-like isoform X2    189   4e-51    
emb|CDX79791.1|  BnaA05g03650D                                          192   5e-51    
ref|XP_009798623.1|  PREDICTED: la-related protein 6B-like              192   6e-51    
ref|XP_009800734.1|  PREDICTED: la-related protein 6B-like              193   7e-51    
emb|CDY17896.1|  BnaC04g03230D                                          191   7e-51    
emb|CDP19151.1|  unnamed protein product                                187   1e-50    
gb|KEH24676.1|  LA-related protein 6 LA RNA-binding domain protei...    188   2e-50    
gb|KFK37220.1|  hypothetical protein AALP_AA4G229300                    191   2e-50    
gb|KDO51618.1|  hypothetical protein CISIN_1g009251mg                   188   2e-50    
ref|XP_009142983.1|  PREDICTED: la-related protein 6B                   191   2e-50    
ref|XP_006351071.1|  PREDICTED: la-related protein 6-like isoform X1    189   4e-50    
ref|XP_010524198.1|  PREDICTED: la-related protein 6B-like              190   7e-50    
gb|KEH24675.1|  LA-related protein 6 LA RNA-binding domain protei...    187   1e-49    
ref|XP_009603304.1|  PREDICTED: la-related protein 6B-like              189   2e-49    
ref|XP_004494976.1|  PREDICTED: uncharacterized protein LOC101512171    190   3e-49    
ref|XP_010506300.1|  PREDICTED: la-related protein 6B                   188   3e-49    
ref|XP_010508353.1|  PREDICTED: la-related protein 6B-like              188   3e-49    
ref|XP_006397570.1|  hypothetical protein EUTSA_v10001395mg             188   3e-49    
ref|XP_011085065.1|  PREDICTED: la-related protein 6B-like isofor...    186   5e-49    
gb|AAX95155.1|  At2g43970/F6E13.10                                      182   7e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010469262.1|  PREDICTED: la-related protein 6B-like              184   7e-49    
gb|ABG22428.1|  La domain-containing protein, putative, expressed       182   7e-49    
gb|ADE76238.1|  unknown                                                 186   8e-49    
ref|XP_010517979.1|  PREDICTED: la-related protein 6B-like isofor...    187   9e-49    
ref|XP_006296119.1|  hypothetical protein CARUB_v10025271mg             187   1e-48    
ref|XP_010512276.1|  PREDICTED: la-related protein 6B-like              183   1e-48    
ref|XP_003574867.1|  PREDICTED: la-related protein 6B-like              183   2e-48    
ref|XP_010069204.1|  PREDICTED: la-related protein 6B                   179   3e-48    
ref|XP_010526876.1|  PREDICTED: la-related protein 6B                   182   2e-47    
ref|XP_002881943.1|  hypothetical protein ARALYDRAFT_322062             182   4e-47    
ref|XP_006662857.1|  PREDICTED: la-related protein 6-like               178   4e-47    
dbj|BAH57224.1|  AT2G43970                                              181   7e-47    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566004.1|  RNA-binding protein                                   182   7e-47    Arabidopsis thaliana [mouse-ear cress]
gb|EMT12290.1|  La-related protein 7                                    179   1e-46    
ref|XP_006660346.1|  PREDICTED: la-related protein 6-like               179   1e-46    
ref|XP_010517978.1|  PREDICTED: la-related protein 6B-like isofor...    181   1e-46    
gb|EMS51819.1|  La-related protein 7                                    176   2e-46    
ref|XP_002963146.1|  hypothetical protein SELMODRAFT_35606              174   2e-46    
ref|XP_002980176.1|  hypothetical protein SELMODRAFT_35604              174   2e-46    
gb|KCW57477.1|  hypothetical protein EUGRSUZ_H00248                     173   8e-46    
gb|ADE76297.1|  unknown                                                 173   2e-44    
ref|XP_006845325.1|  hypothetical protein AMTR_s00141p00064150          173   2e-44    
ref|NP_001062396.1|  Os08g0542900                                       171   8e-44    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97952.1|  predicted protein                                      169   1e-43    
ref|XP_002445763.1|  hypothetical protein SORBIDRAFT_07g025380          170   2e-43    Sorghum bicolor [broomcorn]
gb|KGN44212.1|  Lupus la ribonucleoprotein                              168   3e-43    
ref|XP_001766501.1|  predicted protein                                  172   2e-42    
gb|EMT23549.1|  La-related protein 7                                    163   4e-42    
ref|XP_008664459.1|  PREDICTED: la-related protein 6B-like              165   1e-41    
ref|XP_001766431.1|  predicted protein                                  166   2e-41    
ref|XP_009101528.1|  PREDICTED: la-related protein 6A isoform X1        164   2e-41    
ref|XP_010413626.1|  PREDICTED: la-related protein 6B-like              162   1e-40    
ref|XP_002276730.2|  PREDICTED: la-related protein 6A isoform X2        159   2e-40    Vitis vinifera
gb|EMS68293.1|  La-related protein 7                                    156   3e-40    
gb|KEH24677.1|  LA-related protein 6 LA RNA-binding domain protei...    159   9e-40    
ref|XP_009402690.1|  PREDICTED: la-related protein 6A                   157   4e-39    
gb|AAL06505.1|AF412052_1  At2g43970/F6E13.10                            155   5e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134576.1|  PREDICTED: la protein homolog                      156   6e-39    
ref|XP_003542932.1|  PREDICTED: stress response protein NST1-like...    155   2e-38    
ref|NP_850406.1|  RNA-binding protein                                   157   3e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008439642.1|  PREDICTED: la-related protein 6A                   154   4e-38    
ref|XP_001774093.1|  predicted protein                                  150   9e-38    
ref|XP_008225473.1|  PREDICTED: la-related protein 6A                   152   1e-37    
ref|XP_010232344.1|  PREDICTED: la-related protein 6A                   154   1e-37    
ref|XP_007211445.1|  hypothetical protein PRUPE_ppa007255mg             152   2e-37    
ref|XP_009360880.1|  PREDICTED: la-related protein 6A                   152   2e-37    
ref|XP_004974099.1|  PREDICTED: uncharacterized protein LOC101768999    152   4e-37    
ref|NP_001241310.1|  uncharacterized protein LOC100807619               151   7e-37    
ref|XP_008383487.1|  PREDICTED: la-related protein 6A-like              149   2e-36    
ref|XP_007025096.1|  Translation initiation factor eIF-2B subunit...    149   2e-36    
gb|KHN33140.1|  La-related protein 7                                    151   1e-35    
dbj|BAB11080.1|  unnamed protein product                                147   1e-35    Arabidopsis thaliana [mouse-ear cress]
gb|AFW56664.1|  hypothetical protein ZEAMMB73_374856                    143   2e-35    
ref|XP_007025099.1|  Translation initiation factor eIF-2B subunit...    143   2e-35    
ref|XP_006467479.1|  PREDICTED: la-related protein 6-like               146   2e-35    
ref|XP_010559249.1|  PREDICTED: la-related protein 6A isoform X1        146   3e-35    
ref|XP_010559250.1|  PREDICTED: la-related protein 6A isoform X2        146   3e-35    
ref|XP_010655648.1|  PREDICTED: la-related protein 6A isoform X1        145   3e-35    
ref|XP_011096548.1|  PREDICTED: la-related protein 6A                   145   4e-35    
ref|XP_010257772.1|  PREDICTED: la-related protein 6A isoform X3        144   5e-35    
emb|CDP16095.1|  unnamed protein product                                145   7e-35    
ref|XP_007025097.1|  Translation initiation factor eIF-2B subunit...    143   9e-35    
emb|CDY33465.1|  BnaA06g36080D                                          144   1e-34    
ref|XP_008371602.1|  PREDICTED: la-related protein 6A-like isofor...    143   1e-34    
ref|XP_009788466.1|  PREDICTED: la-related protein 6A isoform X2        143   1e-34    
ref|XP_008371601.1|  PREDICTED: la-related protein 6A-like isofor...    143   2e-34    
ref|XP_006279625.1|  hypothetical protein CARUB_v10026475mg             144   2e-34    
ref|XP_007025098.1|  Translation initiation factor eIF-2B subunit...    143   2e-34    
ref|XP_006449682.1|  hypothetical protein CICLE_v10015602mg             143   2e-34    
ref|XP_006352962.1|  PREDICTED: la-related protein 7-like               143   3e-34    
ref|XP_007147895.1|  hypothetical protein PHAVU_006G164000g             143   3e-34    
ref|XP_009788465.1|  PREDICTED: la-related protein 6A isoform X1        143   4e-34    
ref|XP_004233116.1|  PREDICTED: la-related protein 6A                   142   4e-34    
ref|XP_004293535.1|  PREDICTED: la-related protein 6-like               142   4e-34    
ref|XP_007025095.1|  Translation initiation factor eIF-2B subunit...    142   5e-34    
ref|XP_009101529.1|  PREDICTED: la-related protein 6A isoform X2        142   7e-34    
gb|KFK43639.1|  hypothetical protein AALP_AA1G152700                    140   2e-33    
ref|XP_010496013.1|  PREDICTED: la-related protein 6A-like isofor...    141   2e-33    
ref|XP_010496012.1|  PREDICTED: la-related protein 6A-like isofor...    140   2e-33    
ref|XP_010496015.1|  PREDICTED: la-related protein 6A-like isofor...    140   2e-33    
gb|KHG28356.1|  La-related 7                                            140   2e-33    
ref|XP_006594501.1|  PREDICTED: stress response protein NST1-like...    140   3e-33    
ref|XP_010665825.1|  PREDICTED: la-related protein 6A                   139   3e-33    
ref|XP_006398321.1|  hypothetical protein EUTSA_v10000879mg             140   4e-33    
ref|XP_004486031.1|  PREDICTED: la-related protein 7-like               140   5e-33    
ref|XP_006398322.1|  hypothetical protein EUTSA_v10000879mg             140   7e-33    
ref|XP_003593945.1|  La-related protein                                 139   8e-33    
ref|NP_001078721.1|  RNA-binding protein                                137   9e-33    
ref|XP_010441604.1|  PREDICTED: la-related protein 6A-like isofor...    139   1e-32    
ref|XP_010441607.1|  PREDICTED: la-related protein 6A-like isofor...    139   1e-32    
ref|XP_009601091.1|  PREDICTED: la-related protein 6A isoform X1        139   1e-32    
ref|XP_010441605.1|  PREDICTED: la-related protein 6A-like isofor...    139   1e-32    
ref|XP_006405325.1|  hypothetical protein EUTSA_v10028122mg             134   1e-32    
ref|XP_006646336.1|  PREDICTED: la-related protein 7-like               137   2e-32    
ref|NP_568660.3|  RNA-binding protein                                   136   3e-32    
ref|XP_008790044.1|  PREDICTED: la-related protein 6A                   137   3e-32    
gb|KDP37969.1|  hypothetical protein JCGZ_04612                         137   3e-32    
ref|XP_002865201.1|  predicted protein                                  137   6e-32    
ref|XP_010481476.1|  PREDICTED: la-related protein 6A-like isofor...    137   6e-32    
ref|XP_010481474.1|  PREDICTED: la-related protein 6A-like isofor...    137   6e-32    
ref|XP_010257771.1|  PREDICTED: la-related protein 6A isoform X2        135   6e-32    
ref|XP_010481477.1|  PREDICTED: la-related protein 6A-like isofor...    136   6e-32    
ref|XP_010257770.1|  PREDICTED: la-related protein 6A isoform X1        135   7e-32    
ref|NP_851141.1|  RNA-binding protein                                   136   7e-32    
ref|XP_009114366.1|  PREDICTED: la-related protein 6A-like isofor...    135   2e-31    
ref|XP_009114365.1|  PREDICTED: la-related protein 6A-like isofor...    135   2e-31    
ref|XP_010919805.1|  PREDICTED: la-related protein 6A                   133   8e-31    
ref|XP_011010419.1|  PREDICTED: la-related protein 6A                   132   1e-30    
ref|XP_010052065.1|  PREDICTED: la-related protein 6A                   132   1e-30    
ref|XP_004969999.1|  PREDICTED: la-related protein 7-like isoform X1    132   2e-30    
ref|XP_004970000.1|  PREDICTED: la-related protein 7-like isoform X2    132   2e-30    
gb|KCW75923.1|  hypothetical protein EUGRSUZ_D00299                     132   2e-30    
ref|XP_002532535.1|  lupus la ribonucleoprotein, putative               128   4e-30    
ref|XP_002453408.1|  hypothetical protein SORBIDRAFT_04g005500          130   1e-29    
gb|EYU33354.1|  hypothetical protein MIMGU_mgv1a008413mg                129   2e-29    
ref|XP_006290446.1|  hypothetical protein CARUB_v10019416mg             129   3e-29    
ref|NP_001136552.1|  uncharacterized protein LOC100216671               128   4e-29    
emb|CDY68074.1|  BnaCnng57490D                                          127   5e-29    
ref|XP_002316726.2|  hypothetical protein POPTR_0011s02640g             126   1e-28    
emb|CDY03229.1|  BnaC09g19270D                                          126   1e-28    
ref|XP_009601092.1|  PREDICTED: la-related protein 6A isoform X2        125   1e-28    
gb|KHG30828.1|  La-related 7                                            124   7e-28    
ref|XP_002501696.1|  predicted protein                                  123   1e-27    
gb|EPS65505.1|  hypothetical protein M569_09271                         122   2e-27    
ref|XP_004162617.1|  PREDICTED: la protein homolog                      119   7e-27    
emb|CDY35155.1|  BnaA09g17920D                                          121   9e-27    
gb|EMS61680.1|  La-related protein 6                                    124   1e-26    
ref|XP_010041983.1|  PREDICTED: la-related protein 6B-like              112   2e-26    
ref|XP_004293591.1|  PREDICTED: uncharacterized protein LOC101309803    117   3e-26    
gb|EMT03507.1|  La-related protein 6                                    119   1e-25    
dbj|BAK05029.1|  predicted protein                                      116   1e-24    
ref|XP_010257773.1|  PREDICTED: la-related protein 6A isoform X4        112   3e-24    
gb|EEC71506.1|  hypothetical protein OsI_03788                          113   6e-24    
dbj|BAD87502.1|  putative RNA-binding protein homolog                   113   7e-24    
dbj|BAJ96883.1|  predicted protein                                      113   2e-23    
gb|KDO78160.1|  hypothetical protein CISIN_1g041714mg                   105   2e-22    
ref|XP_003726871.1|  PREDICTED: la-related protein 6-like               108   7e-22    
ref|XP_002952554.1|  hypothetical protein VOLCADRAFT_105531             107   4e-21    
ref|XP_010110987.1|  La-related protein 7                               104   8e-21    
gb|EEE66426.1|  hypothetical protein OsJ_22779                          100   2e-20    
gb|EAZ13585.1|  hypothetical protein OsJ_03502                          102   2e-20    
gb|AET03461.2|  hydrolase of sodium-potassium ATPase alpha subuni...  97.4    8e-20    
gb|KEH28006.1|  hypothetical protein MTR_5g057940                     95.5    2e-19    
gb|AES97661.2|  hypothetical protein MTR_5g057940                     95.9    2e-19    
gb|AEF33405.1|  La autoantigen-like protein                           98.6    2e-19    
ref|XP_003062627.1|  predicted protein                                99.0    6e-19    
gb|ABG21923.1|  transposon protein, putative, Mutator sub-class, ...  96.7    7e-19    
ref|XP_003628985.1|  Plasma membrane H+-ATPase                        95.5    9e-19    
ref|XP_009048762.1|  hypothetical protein LOTGIDRAFT_112382           98.2    1e-18    
gb|ELU18651.1|  hypothetical protein CAPTEDRAFT_73288                 98.6    1e-18    
ref|XP_003614703.1|  Plasma membrane H+-ATPase                        95.1    2e-18    
gb|KFM24804.1|  La-related protein 7                                  92.8    2e-17    
ref|XP_001699972.1|  predicted protein                                94.0    5e-17    
gb|EGW10688.1|  La-related protein 7                                  90.1    5e-17    
dbj|BAB28459.1|  unnamed protein product                              89.7    8e-17    
gb|AAI14862.1|  LARP7 protein                                         89.7    8e-17    
gb|AAI51801.1|  LARP7 protein                                         89.4    1e-16    
gb|ACJ65686.1|  archeron-like protein                                 89.7    1e-16    
ref|XP_002741728.1|  PREDICTED: la-related protein 6-like             92.4    2e-16    
ref|XP_002406445.1|  lupus La ribonucleoprotein, putative             88.2    2e-16    
gb|ACO10111.1|  La protein homolog                                    87.8    4e-16    
dbj|BAE36753.1|  unnamed protein product                              88.6    5e-16    
ref|XP_003773044.1|  PREDICTED: la-related protein 7                  91.3    5e-16    
emb|CAG32359.1|  hypothetical protein RCJMB04_23k13                   87.4    5e-16    
ref|XP_005095717.1|  PREDICTED: la-related protein 6-like             90.9    6e-16    
ref|XP_007668342.1|  PREDICTED: la-related protein 7 isoform X1       90.5    8e-16    
ref|XP_975429.1|  PREDICTED: la-related protein 6                     89.7    9e-16    
ref|XP_007668343.1|  PREDICTED: la-related protein 7 isoform X2       90.1    9e-16    
gb|EPY88581.1|  hypothetical protein CB1_000165008                    87.8    1e-15    
dbj|BAB29687.1|  unnamed protein product                              88.2    1e-15    
ref|XP_007496077.1|  PREDICTED: la-related protein 7 isoform X1       89.7    1e-15    
ref|XP_007430783.1|  PREDICTED: la-related protein 7 isoform X1       89.7    1e-15    
ref|XP_007430784.1|  PREDICTED: la-related protein 7 isoform X2       89.7    1e-15    
ref|XP_005082895.1|  PREDICTED: la-related protein 7                  89.4    1e-15    
gb|ADV40103.1|  acheron                                               86.3    1e-15    
gb|AAH23165.1|  Larp7 protein                                         87.8    2e-15    
gb|KFV75913.1|  La-related protein 7                                  89.4    2e-15    
ref|XP_006119321.1|  PREDICTED: la-related protein 7 isoform X1       89.4    2e-15    
ref|XP_006119322.1|  PREDICTED: la-related protein 7 isoform X2       89.4    2e-15    
ref|XP_009663715.1|  PREDICTED: la-related protein 7                  89.4    2e-15    
ref|XP_006119323.1|  PREDICTED: la-related protein 7 isoform X3       89.4    2e-15    
gb|KFQ36734.1|  La-related protein 7                                  89.0    2e-15    
ref|XP_006119324.1|  PREDICTED: la-related protein 7 isoform X4       89.0    2e-15    
ref|XP_010183821.1|  PREDICTED: la-related protein 7 isoform X1       89.0    2e-15    
ref|XP_002590819.1|  hypothetical protein BRAFLDRAFT_125729           89.7    3e-15    
ref|XP_010183822.1|  PREDICTED: la-related protein 7 isoform X2       89.0    3e-15    
gb|AFE61891.1|  Larp7                                                 88.6    3e-15    
ref|XP_007651376.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  88.6    3e-15    
ref|XP_005287996.1|  PREDICTED: la-related protein 7                  88.6    3e-15    
ref|XP_005151564.1|  PREDICTED: la-related protein 7                  88.6    3e-15    
ref|XP_006970462.1|  PREDICTED: la-related protein 7                  88.2    4e-15    
ref|XP_004554444.1|  PREDICTED: la-related protein 7-like isoform X2  87.4    4e-15    
ref|XP_005985814.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  87.8    4e-15    
gb|KFV95529.1|  La-related protein 7                                  88.2    4e-15    
ref|XP_004554443.1|  PREDICTED: la-related protein 7-like isoform X1  87.4    5e-15    
ref|XP_009914280.1|  PREDICTED: la-related protein 7                  86.7    5e-15    
gb|AAI57142.1|  Unknown (protein for IMAGE:7537566)                   84.7    5e-15    
gb|AAN76709.1|AF443827_1  acheron                                     87.0    5e-15    
gb|EHJ74998.1|  acheron                                               87.0    5e-15    
ref|XP_009583190.1|  PREDICTED: la-related protein 7                  87.8    5e-15    
gb|KFQ01634.1|  La-related protein 7                                  86.7    5e-15    
ref|NP_001037755.2|  la-related protein 7                             87.8    5e-15    
ref|XP_007054489.1|  PREDICTED: la-related protein 7                  87.8    5e-15    
ref|XP_009708036.1|  PREDICTED: la-related protein 7                  87.8    5e-15    
ref|XP_010020913.1|  PREDICTED: la-related protein 7                  87.0    6e-15    
ref|NP_613059.2|  la-related protein 7                                87.8    6e-15    
gb|KFW64600.1|  La-related protein 7                                  87.8    6e-15    
ref|XP_005435267.1|  PREDICTED: la-related protein 7                  87.8    6e-15    
ref|XP_007634175.1|  PREDICTED: la-related protein 7 isoform X3       87.8    6e-15    
gb|KDR13509.1|  La-related protein 6                                  87.0    6e-15    
gb|KFQ41328.1|  La-related protein 7                                  87.0    6e-15    
ref|XP_005243175.1|  PREDICTED: la-related protein 7                  87.8    6e-15    
gb|KFP55005.1|  La-related protein 7                                  87.4    6e-15    
ref|XP_006025607.1|  PREDICTED: la-related protein 7 isoform X1       87.4    6e-15    
ref|XP_005357313.1|  PREDICTED: la-related protein 7                  87.4    7e-15    
gb|KFW89107.1|  La-related protein 7                                  87.4    7e-15    
gb|KFM09765.1|  La-related protein 7                                  87.4    7e-15    
ref|XP_010222349.1|  PREDICTED: la-related protein 7                  87.4    7e-15    
gb|KFV51707.1|  La-related protein 7                                  87.4    7e-15    
ref|NP_001068652.2|  la-related protein 7                             87.4    7e-15    
ref|XP_005532232.1|  PREDICTED: la-related protein 7 isoform X2       87.4    7e-15    
ref|XP_006271592.1|  PREDICTED: la-related protein 7                  87.4    7e-15    
ref|XP_009499425.1|  PREDICTED: la-related protein 7                  87.4    7e-15    
gb|KFO61967.1|  La-related protein 7                                  87.4    7e-15    
gb|KGL83721.1|  La-related protein 7                                  87.4    7e-15    
ref|XP_009318690.1|  PREDICTED: la-related protein 7                  87.4    8e-15    
gb|KFR17002.1|  La-related protein 7                                  87.4    8e-15    
ref|XP_009807664.1|  PREDICTED: la-related protein 7                  87.4    8e-15    
ref|XP_008565137.1|  PREDICTED: la-related protein 7 isoform X2       87.0    8e-15    
ref|XP_005532231.1|  PREDICTED: la-related protein 7 isoform X1       87.4    8e-15    
ref|XP_008635613.1|  PREDICTED: la-related protein 7 isoform X1       87.4    8e-15    
ref|XP_004798056.1|  PREDICTED: la-related protein 7 isoform X1       87.4    8e-15    
ref|XP_009280894.1|  PREDICTED: la-related protein 7                  87.4    8e-15    
gb|KFV63897.1|  La-related protein 7                                  87.0    8e-15    
ref|XP_009940873.1|  PREDICTED: la-related protein 7                  87.4    8e-15    
ref|XP_008635614.1|  PREDICTED: la-related protein 7 isoform X2       87.4    8e-15    
ref|XP_004554449.1|  PREDICTED: la-related protein 7-like isoform X2  87.0    8e-15    
gb|KFP11605.1|  La-related protein 7                                  87.0    9e-15    
ref|XP_005468210.1|  PREDICTED: la-related protein 7-like isoform X2  87.0    9e-15    
gb|KFQ59017.1|  La-related protein 7                                  87.0    9e-15    
gb|KFP76807.1|  La-related protein 7                                  87.0    9e-15    
ref|XP_009476563.1|  PREDICTED: la-related protein 7                  87.0    9e-15    
ref|XP_005044618.1|  PREDICTED: la-related protein 7                  87.0    9e-15    
gb|KFP39667.1|  La-related protein 7                                  87.0    9e-15    
gb|KFR03040.1|  La-related protein 7                                  87.0    9e-15    
gb|KFO80064.1|  La-related protein 7                                  87.0    9e-15    
ref|XP_004748106.1|  PREDICTED: la-related protein 7 isoform X1       87.0    9e-15    
ref|XP_005468209.1|  PREDICTED: la-related protein 7-like isoform X1  87.0    9e-15    
ref|XP_010113816.1|  PREDICTED: la-related protein 7                  87.0    9e-15    
ref|XP_005207653.1|  PREDICTED: la-related protein 7 isoform X1       87.0    9e-15    
ref|XP_008565064.1|  PREDICTED: la-related protein 7 isoform X1       87.0    1e-14    
ref|XP_010804190.1|  PREDICTED: la-related protein 7 isoform X2       87.0    1e-14    
ref|XP_010856812.1|  PREDICTED: la-related protein 7 isoform X3       87.0    1e-14    
ref|XP_010856811.1|  PREDICTED: la-related protein 7 isoform X2       87.0    1e-14    
ref|XP_005207655.1|  PREDICTED: la-related protein 7 isoform X3       87.0    1e-14    
ref|XP_004896394.1|  PREDICTED: la-related protein 7 isoform X3       87.0    1e-14    
ref|XP_010856810.1|  PREDICTED: la-related protein 7 isoform X1       87.0    1e-14    
ref|XP_006802544.1|  PREDICTED: la-related protein 7-like isoform X2  87.0    1e-14    
ref|XP_004554448.1|  PREDICTED: la-related protein 7-like isoform X1  87.0    1e-14    
ref|XP_009962839.1|  PREDICTED: la-related protein 7                  87.0    1e-14    
ref|XP_009564450.1|  PREDICTED: la-related protein 7                  87.0    1e-14    
ref|XP_004896393.1|  PREDICTED: la-related protein 7 isoform X2       87.0    1e-14    
ref|XP_005515268.1|  PREDICTED: la-related protein 7                  87.0    1e-14    
ref|XP_009468820.1|  PREDICTED: la-related protein 7                  87.0    1e-14    
gb|KFV48072.1|  La-related protein 7                                  87.0    1e-14    
ref|XP_009647691.1|  PREDICTED: la-related protein 7                  87.0    1e-14    
gb|AFK10709.1|  La protein-like protein                               83.2    1e-14    
ref|XP_009834459.1|  hypothetical protein H257_09795                  86.7    1e-14    
ref|XP_005904840.1|  PREDICTED: LOW QUALITY PROTEIN: la-related p...  87.0    1e-14    
ref|XP_006775426.1|  PREDICTED: la-related protein 7                  86.7    1e-14    
ref|XP_004896392.1|  PREDICTED: la-related protein 7 isoform X1       87.0    1e-14    
ref|XP_006802543.1|  PREDICTED: la-related protein 7-like isoform X1  86.7    1e-14    
gb|EMC76974.1|  La-related protein 7                                  86.7    1e-14    
ref|XP_003468051.2|  PREDICTED: la-related protein 7                  86.7    1e-14    
ref|XP_005752155.1|  PREDICTED: la-related protein 7-like             86.7    1e-14    
ref|XP_010573840.1|  PREDICTED: la-related protein 7                  86.7    1e-14    
gb|KFO90436.1|  La-related protein 7                                  86.7    1e-14    
ref|XP_008561663.1|  PREDICTED: la-related protein 7                  86.7    1e-14    
ref|XP_004340216.1|  La domain containing protein                     84.7    1e-14    
ref|XP_001730491.1|  hypothetical protein MGL_2287                    84.0    1e-14    
ref|XP_005709608.1|  PREDICTED: LOW QUALITY PROTEIN: La ribonucle...  86.7    1e-14    
ref|XP_010135603.1|  PREDICTED: la-related protein 7                  86.7    1e-14    
ref|XP_004626806.1|  PREDICTED: la-related protein 7-like             86.7    1e-14    
gb|KFQ72909.1|  La-related protein 7                                  86.7    1e-14    
ref|XP_004009660.1|  PREDICTED: la-related protein 7                  86.7    1e-14    
ref|XP_008292474.1|  PREDICTED: la-related protein 7                  86.7    1e-14    
gb|KFW83030.1|  La-related protein 7                                  86.3    1e-14    
gb|KFV01125.1|  La-related protein 7                                  86.3    1e-14    
ref|XP_009869179.1|  PREDICTED: la-related protein 7                  86.3    2e-14    
ref|XP_002425573.1|  lupus la ribonucleoprotein, putative             86.7    2e-14    
ref|XP_010080836.1|  PREDICTED: la-related protein 7                  86.3    2e-14    
ref|XP_009894290.1|  PREDICTED: la-related protein 7                  86.3    2e-14    
gb|KGL95878.1|  La-related protein 7                                  86.3    2e-14    
ref|XP_008924653.1|  PREDICTED: la-related protein 7 isoform X2       86.3    2e-14    
ref|XP_010303513.1|  PREDICTED: la-related protein 7 isoform X2       86.3    2e-14    
ref|XP_004867656.1|  PREDICTED: la-related protein 7 isoform X4       86.3    2e-14    



>ref|XP_009761551.1| PREDICTED: la-related protein 6C-like isoform X1 [Nicotiana sylvestris]
Length=411

 Score =   440 bits (1132),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 256/386 (66%), Positives = 296/386 (77%), Gaps = 32/386 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS-ITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLS  387
             FK NVQAPEFVPRS  T  P+S YFYPYFQY        DW+YVGDQD T  Y  NQ+ S
Sbjct  41    FKFNVQAPEFVPRSHTTTTPISSYFYPYFQYLSGGTATSDWLYVGDQD-TISYVPNQSFS  99

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
                  QK+ LP+EVK KIIKQVEYQLSDMSLLANENL KQM+KDPEG+VPIS+V++TKKI
Sbjct  100   AMGQSQKDVLPEEVKNKIIKQVEYQLSDMSLLANENLLKQMNKDPEGFVPISSVSTTKKI  159

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+++   Q LA AL SSTKLIVS+DGKKVKR+ PF +KDKE+LQ RTVVAENLPDDHS
Sbjct  160   KSLITNQ--QTLAHALLSSTKLIVSNDGKKVKRRTPFNDKDKEDLQLRTVVAENLPDDHS  217

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             HHNIEKIF V GSVKTIR+CHPQDPNSSR++G+  ISNKLHALIEFE+PE A++AVEKLN
Sbjct  218   HHNIEKIFKVAGSVKTIRVCHPQDPNSSRARGDIGISNKLHALIEFENPEAAERAVEKLN  277

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             DERNWRKGLRV+LLLRRSP+SVLK+RKS+F+GC +D+D              S L + +S
Sbjct  278   DERNWRKGLRVRLLLRRSPKSVLKSRKSDFDGCFDDED--------------SELTE-DS  322

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
                NVEES      KK W KGRGK R RTQI+GGRGLL          +S+   SE P++
Sbjct  323   DGNNVEES--MATNKKAWNKGRGKLRSRTQIYGGRGLL----AALPQCNSSPSLSEGPVR  376

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTT  1365
             Q +KGPRMPDGTRGFTMGRGKP  +T
Sbjct  377   QVTKGPRMPDGTRGFTMGRGKPFTST  402



>ref|XP_009625721.1| PREDICTED: la-related protein 6C-like [Nicotiana tomentosiformis]
Length=410

 Score =   437 bits (1125),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 258/386 (67%), Positives = 298/386 (77%), Gaps = 32/386 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS-ITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLS  387
             FK NVQAPEFVPRS  T  P+S YFYPYFQY        DW+YVGDQD T  Y +NQ+ S
Sbjct  40    FKFNVQAPEFVPRSHTTTTPISSYFYPYFQYLSGGTAASDWLYVGDQD-TISYVSNQSFS  98

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
                  QK+ LP+EVK KIIKQVEYQLSDMSLLANENL KQM+KDPEG+VPIS+V++TKKI
Sbjct  99    AVGQSQKDVLPEEVKNKIIKQVEYQLSDMSLLANENLLKQMNKDPEGFVPISSVSTTKKI  158

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+++   Q LA AL SSTKLIVS+D KKVKR+ PFT+KDKE+LQ RTVVAENLPDDHS
Sbjct  159   KSLITNQ--QTLAHALLSSTKLIVSNDDKKVKRRIPFTDKDKEDLQLRTVVAENLPDDHS  216

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             HHNIEKIF V GSVKTIR+CHPQDPNSSR++G+  ISNKLHALIEFE+ E A++AVEKLN
Sbjct  217   HHNIEKIFKVAGSVKTIRVCHPQDPNSSRARGDIGISNKLHALIEFENSEAAERAVEKLN  276

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             DERNWRKGLRV+LLLRRSP+SVLK+RKS+F+GC +D+D              S L + +S
Sbjct  277   DERNWRKGLRVRLLLRRSPKSVLKSRKSDFDGCFDDED--------------SELTE-DS  321

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
                NVEES      KKGW KGRGK R RTQI+GGRGLL          SS+   SE P++
Sbjct  322   DGNNVEES--MATNKKGWNKGRGKLRSRTQIYGGRGLL----AALPQCSSSPSLSEGPVR  375

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTT  1365
             Q +KGPRMPDGTRGFTMGRGKPL +T
Sbjct  376   QVTKGPRMPDGTRGFTMGRGKPLAST  401



>ref|XP_006346524.1| PREDICTED: uncharacterized protein LOC102603710 [Solanum tuberosum]
Length=396

 Score =   426 bits (1095),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 297/387 (77%), Gaps = 34/387 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSI-TQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLS  387
             FK NVQAPEFVPRS  T  P+S YFYPYFQY        DW+YV DQD T  Y  NQN S
Sbjct  29    FKFNVQAPEFVPRSHNTTTPISSYFYPYFQYVSGGNTTSDWLYVADQD-TLSYVPNQNFS  87

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
                  QK+ LP++VK KIIKQVEYQLSDMSLLANE+L +QM+KD EG+VPIS+V++TKKI
Sbjct  88    A--LLQKDVLPEDVKNKIIKQVEYQLSDMSLLANESLLRQMNKDLEGFVPISSVSATKKI  145

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+++   Q LA AL SSTKLIVS+DGKKVKR+ PFT+KDKE+LQ RTVVAENLPDDHS
Sbjct  146   KSLITNQ--QTLAHALLSSTKLIVSNDGKKVKRRIPFTDKDKEDLQLRTVVAENLPDDHS  203

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             HHNIEKIF V GSVKTIR+CHPQDPN SR++G+  ISNKLHALIEFE+PE A++AVEKLN
Sbjct  204   HHNIEKIFKVAGSVKTIRVCHPQDPNLSRARGDIGISNKLHALIEFENPEAAERAVEKLN  263

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             DERNWRKGLRV+LLLRRSP+S+LK RK EFEGC +D+D  P      EDS S+       
Sbjct  264   DERNWRKGLRVRLLLRRSPKSILKIRKCEFEGCFDDEDGLP-----SEDSDSN-------  311

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
                NVE+    G+AKK W KGRGK R+R QIHGGRGLL         SSS+SG  E P++
Sbjct  312   ---NVEDG--VGSAKKAWNKGRGKLRMRPQIHGGRGLL----AALPQSSSSSGLGEGPVR  362

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTTA  1368
             Q +KGPRMPDGTRGFTMGRGKPL  T 
Sbjct  363   QVTKGPRMPDGTRGFTMGRGKPLTATV  389



>ref|XP_004292453.1| PREDICTED: uncharacterized protein LOC101311941 [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   424 bits (1090),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 246/389 (63%), Positives = 299/389 (77%), Gaps = 22/389 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQYQ------DWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS TQ+P+SGYFYP F +       DW Y+GDQ+  P+  +N N+ P 
Sbjct  27    FKFNAQAPEFVPRSHTQVPISGYFYPCFHFLGDTASPDWFYIGDQELPPYLISNPNI-PT  85

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
               + KN LPDE++ KIIKQVEYQ SDMSLLANE+LAK +SKDPEGYVP+S V+STKK+KS
Sbjct  86    TNRSKNVLPDELQHKIIKQVEYQFSDMSLLANESLAKHISKDPEGYVPVSVVSSTKKMKS  145

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+S+N   +LAQAL+SS+KL+VS DGKKVKRK PFTEKDKE+LQ+RTVVAENLP+DHSH 
Sbjct  146   LISNN--HMLAQALRSSSKLVVSDDGKKVKRKHPFTEKDKEDLQARTVVAENLPEDHSHQ  203

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N+EKIFNVVGSVKTIRICHP + NSSRSKG++ ISNKLHAL+E+ES EIA+KAV+KL+DE
Sbjct  204   NLEKIFNVVGSVKTIRICHPHESNSSRSKGDFIISNKLHALVEYESTEIAEKAVDKLSDE  263

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST-  1110
             RNWRKGLRV+ LLRR+P+SVLK RKSEF+  LEDDD  P  ESA EDS S P+  ++   
Sbjct  264   RNWRKGLRVRTLLRRTPKSVLKNRKSEFD-ILEDDD-TPHYESA-EDS-SQPISHIDIVI  319

Query  1111  -ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
                N EE+S        WG+G+ + R  +Q   GRGL+A SPQ S +    +       K
Sbjct  320   DSMNAEENSMASKKGWAWGRGKARGRCASQ--SGRGLIAPSPQSSCAIQCEASA-----K  372

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTTAAP  1374
               +KGPRMPDGTRGFTMGRGKPL T+++P
Sbjct  373   PNTKGPRMPDGTRGFTMGRGKPLRTSSSP  401



>gb|KDP38238.1| hypothetical protein JCGZ_04881 [Jatropha curcas]
Length=457

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 251/403 (62%), Positives = 301/403 (75%), Gaps = 37/403 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSI----------------TQMPVSGYFYPYFQY------QDWIYVGD  345
             FK N QAPEFVPRS                 TQMP+SGYFYP F Y       DW ++G+
Sbjct  61    FKFNAQAPEFVPRSHSPSPAASPAAAAAAAQTQMPISGYFYPCFHYLGATTGSDWFFLGE  120

Query  346   QDPTPFYSNNQNLSPPQTQQKNSL-PDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDP  522
             QDP  +  +N NL+ P +  K +L  D+++QKI+KQVEYQ SDMSLLANE+++K +SKDP
Sbjct  121   QDPHAYLISNPNLALPNSSNKTTLLTDDLRQKILKQVEYQFSDMSLLANESMSKHISKDP  180

Query  523   EGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEEL  702
             EGYVPIS +ASTKK+KSL+++N   +LAQALQSS KL+VS DGKKVKRK PFTEKD+E+L
Sbjct  181   EGYVPISVIASTKKMKSLVNNN--HLLAQALQSSLKLVVSEDGKKVKRKIPFTEKDREDL  238

Query  703   QSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIE  882
             QSRTVV ENLP+DHSH N+EKIF+VVGSV+TIRICHPQ+ NSSR+K ++F+SNKLHAL+E
Sbjct  239   QSRTVVVENLPEDHSHQNLEKIFSVVGSVRTIRICHPQESNSSRTKSDFFMSNKLHALVE  298

Query  883   FESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVES  1062
             FESPE A+KAVEKLNDERNWRKGLRV++LLR SP+SVLK RKSEF+G L  DD+  PV  
Sbjct  299   FESPETAEKAVEKLNDERNWRKGLRVRVLLRCSPKSVLKNRKSEFDGLL--DDEELPVPE  356

Query  1063  APEDSVSSPLHQLEST-ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqc  1239
             + ED  SSP +  +S  E+NVEE+S  GA KKGW + RGK R R Q HGGRGLLA   Q 
Sbjct  357   SNED--SSPTNNADSVNESNVEENS--GALKKGWARTRGKVRGRGQSHGGRGLLAPPSQS  412

Query  1240  ssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTA  1368
               S    +       K  S+GPRMPDGTRGFTMGRGKPL T A
Sbjct  413   VCSLQCEASA-----KHTSRGPRMPDGTRGFTMGRGKPLGTPA  450



>ref|XP_010315496.1| PREDICTED: la-related protein 6C [Solanum lycopersicum]
Length=415

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 257/396 (65%), Positives = 296/396 (75%), Gaps = 34/396 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS--------ITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFY  366
             FK NVQAPEFVPRS         T  P+S YFYPYFQY        DW+YV DQD T  Y
Sbjct  28    FKFNVQAPEFVPRSHTTTTNTTTTTTPISSYFYPYFQYLSGGNTTSDWLYVADQD-TLSY  86

Query  367   SNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISA  546
               NQN S     QK+ LP++VK KIIKQVEYQLSDMSLLANENL +QM+KD EG+VPIS+
Sbjct  87    LPNQNFSA--LLQKDVLPEDVKNKIIKQVEYQLSDMSLLANENLLRQMNKDLEGFVPISS  144

Query  547   VASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAE  726
             V++TKKIKSL+++   Q LA AL SSTKLIVS+DGKKVKR+ PFT+KDKEELQ RTVVAE
Sbjct  145   VSATKKIKSLITNQ--QTLAHALLSSTKLIVSNDGKKVKRRIPFTDKDKEELQLRTVVAE  202

Query  727   NLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIAD  906
             NLPDDHSHHNIEKIF V GSVKTIR+CHPQDPN SR++G+  ISNKLHALIEFE+PE A+
Sbjct  203   NLPDDHSHHNIEKIFKVAGSVKTIRVCHPQDPNLSRARGDIGISNKLHALIEFENPEAAE  262

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSS  1086
             +AVEKLNDERNWRKGLRV+LLLRRSP+S+LK RK EFEGC +D+D  P  E +  ++VS 
Sbjct  263   RAVEKLNDERNWRKGLRVRLLLRRSPKSILKIRKCEFEGCFDDEDGVPS-EDSDNNNVSD  321

Query  1087  P---LHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssss  1257
                 ++ L      V  +       K W KGRGK R+R QIHGGRGLLAA PQ SSSS  
Sbjct  322   VIVIINDLTYIHYGVGSAK------KAWNKGRGKLRMRPQIHGGRGLLAALPQSSSSSGV  375

Query  1258  asgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTT  1365
               G     ++Q +KGPRMPDGTRGFTMGRGKPL  T
Sbjct  376   GEGA----VRQVTKGPRMPDGTRGFTMGRGKPLTAT  407



>ref|XP_010107985.1| La-related protein 7 [Morus notabilis]
 gb|EXC17385.1| La-related protein 7 [Morus notabilis]
Length=397

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 244/385 (63%), Positives = 291/385 (76%), Gaps = 21/385 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             F+ N QAPEFVPR+ TQMPVSGYF+P F          DW++V D DP  ++ +N N+S 
Sbjct  26    FRFNAQAPEFVPRTKTQMPVSGYFHPCFHILGGSADSPDWLFVEDHDPPSYWISNLNISL  85

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P    KN+LPD+++ KIIKQVEYQ SD SLLANE LAK  SKDP+GYVPIS +ASTKKIK
Sbjct  86    PNNSSKNALPDDLQHKIIKQVEYQFSDTSLLANETLAKHTSKDPQGYVPISVIASTKKIK  145

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL ++N   VLAQAL+SS+KL VS+DGKKVKRK PFTEKD+E LQSRTVVAENLP+DHSH
Sbjct  146   SLTTNNN--VLAQALRSSSKLAVSNDGKKVKRKHPFTEKDREGLQSRTVVAENLPEDHSH  203

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N+EKIF V GSVKT+R+CHPQ+ NSSRSKG++ +SNKLHAL+E+++ E+A+ AVEKLND
Sbjct  204   QNLEKIFRVAGSVKTVRVCHPQESNSSRSKGDFLVSNKLHALVEYDTTEMAETAVEKLND  263

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES-  1107
             ERNWRKGLRV+LLLR SP+SVLK R+SEF+G L+ DD AP  ESA ED+  S   Q ES 
Sbjct  264   ERNWRKGLRVRLLLRCSPKSVLKNRRSEFDGILDADD-APLTESA-EDAFHS--SQRESI  319

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
             TETN EESS G     G  +G+ + R    I  GRGLLA SPQ S+ +           K
Sbjct  320   TETNGEESSTGQKKGWGRVRGKAQGRASNHI--GRGLLAPSPQSSNGNQGEVSP-----K  372

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNT  1362
             Q+ KGPRMPDGTRGFTMGRGKPL T
Sbjct  373   QSPKGPRMPDGTRGFTMGRGKPLRT  397



>ref|XP_008392294.1| PREDICTED: la-related protein 6C [Malus domestica]
Length=404

 Score =   417 bits (1073),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 240/390 (62%), Positives = 301/390 (77%), Gaps = 22/390 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFY-SNNQNLS  387
             F  N QAPEFVPRS  QMP+SGYFYP F +        DW Y+GDQ+  P+  SNN N++
Sbjct  28    FTFNAQAPEFVPRSHAQMPISGYFYPCFHFLGDSTASPDWFYIGDQELPPYLISNNPNIN  87

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
             P   + KN+LPD+++QK IKQVEYQ SDMSLLANE+LAK +SKDPEG+VPIS +ASTKK+
Sbjct  88    PLSNRSKNALPDDLQQKXIKQVEYQFSDMSLLANESLAKHISKDPEGFVPISVIASTKKM  147

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+S+N   +L+QAL+SS KL+VS DGKKV+RK PFTEKDKEELQSRTVVAENLP+DHS
Sbjct  148   KSLISNN--HMLSQALRSSLKLVVSEDGKKVRRKHPFTEKDKEELQSRTVVAENLPEDHS  205

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             H N+EKIF+VVGSVKTIRICHP + NSSRSKG++ +SNKLHAL+E+E+ EIA++AV+KL+
Sbjct  206   HQNLEKIFSVVGSVKTIRICHPHESNSSRSKGDFIVSNKLHALLEYETMEIAERAVDKLS  265

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS-VSSPLHQLE  1104
             DERNWRKGLRV++L+R SP+SVLK+RKS+F+G LED++  PP + A E S  SSP  +L 
Sbjct  266   DERNWRKGLRVRMLIRCSPKSVLKSRKSDFDGILEDEE--PPYDCAVETSHPSSP--ELV  321

Query  1105  STETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
                 NVEE+S        WG+G+G+ R ++Q   GRGL+A SP  SS+    +       
Sbjct  322   IDSPNVEENSALSKKGLAWGRGKGRGRGQSQ--SGRGLIALSPLSSSTIQCEASA-----  374

Query  1285  KQASKGPRMPDGTRGFTMGRGKPLNTTAAP  1374
             K  SKGPRMPDGTRGFTMGRGKP++   +P
Sbjct  375   KLNSKGPRMPDGTRGFTMGRGKPVSAMNSP  404



>ref|XP_002521842.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF40478.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=440

 Score =   417 bits (1073),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 248/403 (62%), Positives = 299/403 (74%), Gaps = 31/403 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSI------TQMPVSGYFYPYFQY------QDWIYVGDQDP----TPF  363
             FK N QAPEFVPRS       TQ+P+SGYFYP F Y       DW +VGDQDP      +
Sbjct  50    FKFNAQAPEFVPRSHSFNQNQTQIPISGYFYPCFHYLGAASGSDWFFVGDQDPHNAAATY  109

Query  364   YSNNQNLSPPQTQQKNSL-PDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPI  540
               +N NL+ P +  K +L  D+++QKI+KQVEYQ  DMSLLANE+++K +SKDPEGYVPI
Sbjct  110   LISNPNLAFPNSSNKTTLLTDDLRQKILKQVEYQFGDMSLLANESMSKHISKDPEGYVPI  169

Query  541   SAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVV  720
             S +ASTKK+KSL+++N   +LAQALQSS+KL+VS D KKVKRK PFTEKD+EELQSRTVV
Sbjct  170   SVIASTKKMKSLVNNN--HLLAQALQSSSKLVVSEDNKKVKRKLPFTEKDREELQSRTVV  227

Query  721   AENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEI  900
              ENLP+DHSH N+EKIF+VVGSVKTIRICHPQ+ NSSR+K ++F+SNKLHAL+EFE  E 
Sbjct  228   VENLPEDHSHQNLEKIFSVVGSVKTIRICHPQESNSSRTKSDFFMSNKLHALVEFEGSEA  287

Query  901   ADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSV  1080
             A+KAVE LNDERNWRKGLRV++LLR SP+SVL+ RKSEFEG L+D+D A P   + ED  
Sbjct  288   AEKAVENLNDERNWRKGLRVRVLLRCSPKSVLRNRKSEFEGLLDDEDLALP--ESNED--  343

Query  1081  SSPLHQLES-TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssss  1257
             SS ++ +ES TE+N EE+SG        G+G+G+   R Q HGGRGLLA SPQ  SS   
Sbjct  344   SSQVNNVESVTESNTEENSGSSKKGWAKGRGKGRG--RGQSHGGRGLLAPSPQSVSSPQC  401

Query  1258  asgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAAPPSSV  1386
              +       K  SKGPRMPDGTRGFTMGRGKPL T     S V
Sbjct  402   EASA-----KHTSKGPRMPDGTRGFTMGRGKPLGTPTLASSMV  439



>ref|XP_007042354.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOX98185.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
Length=440

 Score =   415 bits (1066),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 291/384 (76%), Gaps = 18/384 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS TQ+P+SGY+YP F Y       DW +VGDQ+P  +  +N NL  P
Sbjct  48    FKFNAQAPEFVPRSHTQVPLSGYYYPCFHYLGGAGGSDWFFVGDQEPADYLISNPNLPIP  107

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L D+++QKII+QVEYQ +DMSLLANE+L+KQ+SKDPEGYV IS +AS KKIKS
Sbjct  108   NCSSKNLLTDDLRQKIIRQVEYQFNDMSLLANESLSKQISKDPEGYVSISFIASMKKIKS  167

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+++N  Q+LAQAL+SS+KL+VS DGKKVKRK PFTEK +EE+ SRTVV ENLP+DHSH 
Sbjct  168   LITNN--QLLAQALRSSSKLVVSDDGKKVKRKHPFTEKKREEVASRTVVIENLPEDHSHQ  225

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N++KIFNVVGSV+ IRICHPQ+ NSSRSK ++F+ NKLHAL+E+ES EIA+KAV+KLNDE
Sbjct  226   NLDKIFNVVGSVQNIRICHPQESNSSRSKSDFFMCNKLHALVEYESTEIAEKAVDKLNDE  285

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTE  1113
             RNWRKGLRV+LLLR SP+SVLK+RKSEF+G L D+D++P  E + + S+S   +  E+ E
Sbjct  286   RNWRKGLRVRLLLRLSPKSVLKSRKSEFDGIL-DEDESPVAEYSEDSSLS---NIAEAIE  341

Query  1114  TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQA  1293
              N ++ +  G+ K            R Q H GRGL+AA PQ  S+    +      +KQ 
Sbjct  342   NNADQDNAVGSKKGWGKGRGKGRG-RVQNHSGRGLIAACPQPGSAVQCEAS-----VKQT  395

Query  1294  SKGPRMPDGTRGFTMGRGKPLNTT  1365
             SKGPRMPDGTRGFTMGRGKP+++ 
Sbjct  396   SKGPRMPDGTRGFTMGRGKPISSA  419



>ref|XP_002281817.1| PREDICTED: la-related protein 6C isoform X1 [Vitis vinifera]
 emb|CBI32464.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   411 bits (1057),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 244/386 (63%), Positives = 302/386 (78%), Gaps = 21/386 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             FK N QAPEFVPRS TQ+P+SGYFYP F          DW+YV DQDP  F SN+    P
Sbjct  34    FKFNAQAPEFVPRSHTQVPISGYFYPCFHLLGGGAGSADWLYVADQDPVHFISNSNGSLP  93

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                  KN L  +++QKIIKQVEYQ +DMSLLA+++LAK ++KDPEGYVPIS +AS+KK+K
Sbjct  94    --NSSKNLLTHDIQQKIIKQVEYQFNDMSLLASDSLAKHINKDPEGYVPISVIASSKKVK  151

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             +L+S+N  Q+LAQAL+SS++L+VSSDGKKV+RK  FTE+DKEELQ+ TVVAENLP+DHSH
Sbjct  152   ALVSNN--QLLAQALRSSSQLVVSSDGKKVRRKHLFTERDKEELQAHTVVAENLPEDHSH  209

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N++KIF+VVGSVK IRICHPQ+ N+SRSKG++FISNKLHAL+E+ES EIA+KAVE LND
Sbjct  210   QNLQKIFSVVGSVKNIRICHPQESNNSRSKGDFFISNKLHALVEYESVEIAEKAVEMLND  269

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV++LLRRSP+SVLK R+SEF+G + D+++ P  E + EDS S P +     
Sbjct  270   ERNWRKGLRVRMLLRRSPKSVLKNRRSEFDGIM-DEEEGPHPEFS-EDS-SHPNNTELVI  326

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             E+N EE+S    +KKGW +GRGK R RTQI  GRGLLA SPQ S S+   +       KQ
Sbjct  327   ESNAEENS--SGSKKGWARGRGKPRGRTQITSGRGLLAPSPQSSGSNQFEASA-----KQ  379

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNTTA  1368
              +KGPRMPDGTRGFTMGRGKP++T A
Sbjct  380   ITKGPRMPDGTRGFTMGRGKPISTPA  405



>ref|XP_007042355.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOX98186.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
Length=422

 Score =   410 bits (1053),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 291/385 (76%), Gaps = 19/385 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS TQ+P+SGY+YP F Y       DW +VGDQ+P  +  +N NL  P
Sbjct  48    FKFNAQAPEFVPRSHTQVPLSGYYYPCFHYLGGAGGSDWFFVGDQEPADYLISNPNLPIP  107

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L D+++QKII+QVEYQ +DMSLLANE+L+KQ+SKDPEGYV IS +AS KKIKS
Sbjct  108   NCSSKNLLTDDLRQKIIRQVEYQFNDMSLLANESLSKQISKDPEGYVSISFIASMKKIKS  167

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+++N  Q+LAQAL+SS+KL+VS DGKKVKRK PFTEK +EE+ SRTVV ENLP+DHSH 
Sbjct  168   LITNN--QLLAQALRSSSKLVVSDDGKKVKRKHPFTEKKREEVASRTVVIENLPEDHSHQ  225

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISN-KLHALIEFESPEIADKAVEKLND  930
             N++KIFNVVGSV+ IRICHPQ+ NSSRSK ++F+ N KLHAL+E+ES EIA+KAV+KLND
Sbjct  226   NLDKIFNVVGSVQNIRICHPQESNSSRSKSDFFMCNKKLHALVEYESTEIAEKAVDKLND  285

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV+LLLR SP+SVLK+RKSEF+G L D+D++P  E + + S+S   +  E+ 
Sbjct  286   ERNWRKGLRVRLLLRLSPKSVLKSRKSEFDGIL-DEDESPVAEYSEDSSLS---NIAEAI  341

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             E N ++ +  G+ K            R Q H GRGL+AA PQ  S+    +      +KQ
Sbjct  342   ENNADQDNAVGSKKGWGKGRGKGRG-RVQNHSGRGLIAACPQPGSAVQCEAS-----VKQ  395

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNTT  1365
              SKGPRMPDGTRGFTMGRGKP+++ 
Sbjct  396   TSKGPRMPDGTRGFTMGRGKPISSA  420



>gb|AES90236.2| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=404

 Score =   409 bits (1050),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 232/387 (60%), Positives = 285/387 (74%), Gaps = 19/387 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK NVQAPEFVPRS +QMP+SGYFYP FQ        DW YVGDQDP+     N N+S P
Sbjct  29    FKFNVQAPEFVPRSHSQMPISGYFYPCFQILGGSGESDWFYVGDQDPSACLIPNANVSQP  88

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L  +++QKI+KQVEYQ SD+SLLANE+  KQM+KDPEGYVPI+ +ASTKKIKS
Sbjct  89    NCS-KNVLNPDLQQKIVKQVEYQFSDLSLLANESFQKQMNKDPEGYVPITVIASTKKIKS  147

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+  N   +L QA++ S+KL++S+DGKKVKRK PF EK+KEEL SRTVVAENLPDDHSH 
Sbjct  148   LV--NNIHLLTQAIRHSSKLVLSADGKKVKRKHPFAEKEKEELMSRTVVAENLPDDHSHQ  205

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N++KIF VVGS+KTIRICHPQ+PNSSR KG++ ISNKLHAL+E+ES ++ADKAVEKLNDE
Sbjct  206   NLQKIFGVVGSIKTIRICHPQEPNSSRPKGDFLISNKLHALVEYESSDVADKAVEKLNDE  265

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTE  1113
             RNWRKG+RV+LLLR SP+SVLK RKSEF+G L+DD+    + S   +  S P +     E
Sbjct  266   RNWRKGMRVRLLLRCSPKSVLKNRKSEFDGYLDDDEN---LHSETAEDSSHPNNTELCVE  322

Query  1114  TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQA  1293
             +N +E+S G       G+G+G+   RTQ H GRGLLA     SS             K  
Sbjct  323   SNGDETSVGSKKGWTRGRGKGRG--RTQNHTGRGLLAPPSPSSSVVLGEVS-----TKPN  375

Query  1294  SKGPRMPDGTRGFTMGRGKPLNTTAAP  1374
             +KGPRMPDGTRGF +GRGKP+++  +P
Sbjct  376   AKGPRMPDGTRGFAIGRGKPISSPTSP  402



>ref|XP_009609348.1| PREDICTED: la-related protein 6C-like [Nicotiana tomentosiformis]
Length=428

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 245/383 (64%), Positives = 291/383 (76%), Gaps = 23/383 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             FK NVQAPEFVP+S   +P+S Y YPYFQY        DWIY GDQ+   F      +S 
Sbjct  52    FKFNVQAPEFVPKSHATIPISRYIYPYFQYVNTTTTTNDWIYGGDQETISFVQEPSFVS-  110

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                 QK+ LP+E++ K+IKQVEYQLSDMSLLANE+L KQM+KDP+G+VPIS+V++TKKIK
Sbjct  111   -TLSQKDILPEELRLKVIKQVEYQLSDMSLLANESLLKQMNKDPKGFVPISSVSATKKIK  169

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL+++N    L+ AL SS+KLIVS DGKKVKRK PFT+KDKEEL  RTVVAENLPDDHSH
Sbjct  170   SLITNNQL-TLSHALLSSSKLIVSDDGKKVKRKIPFTDKDKEELMLRTVVAENLPDDHSH  228

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
             HNIEKIFNV GSVKTIR+CHPQDPN +R++G+  IS+KLHALIEFE PE A+KA EKLND
Sbjct  229   HNIEKIFNVAGSVKTIRVCHPQDPN-TRTRGDLGISSKLHALIEFEHPEAAEKAAEKLND  287

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRVKLLLRRSP+SVLK+RKS F+GC +D+D    + S   D  +   H  E  
Sbjct  288   ERNWRKGLRVKLLLRRSPKSVLKSRKSAFDGCFDDEDW---LASELTDDSNHTNHS-EIV  343

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             + NVEE+    A KK WGKGR + R R Q+  GRGLL      SS  SS+S   E+P+KQ
Sbjct  344   DNNVEET---LATKKTWGKGRVRARQRNQMFNGRGLL-----VSSPQSSSSSPFEAPLKQ  395

Query  1291  ASKGPRMPDGTRGFTMGRGKPLN  1359
             A+KGPRMPDGT+GFTMGRGKPLN
Sbjct  396   ATKGPRMPDGTKGFTMGRGKPLN  418



>ref|XP_009772752.1| PREDICTED: la-related protein 6C-like [Nicotiana sylvestris]
Length=431

 Score =   405 bits (1041),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 248/391 (63%), Positives = 296/391 (76%), Gaps = 38/391 (10%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY---------QDWIYVGD------QDPTPFY  366
             FK NVQAPEFVP+S   +P+SGY YPYFQY          DWI  GD      Q+P+ F 
Sbjct  54    FKFNVQAPEFVPKSHATIPISGYIYPYFQYVNTTITTTTNDWISGGDLTISFVQEPS-FV  112

Query  367   SNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISA  546
             S           QK+ LP+E++ K+IKQVEYQLSDMSLLANE+L KQM+KDP+G+VPIS+
Sbjct  113   ST--------LSQKDILPEELRLKVIKQVEYQLSDMSLLANESLLKQMNKDPKGFVPISS  164

Query  547   VASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAE  726
             V++TKKIKSL+++N    L+ AL SSTKLIVS DGKKVKRK PFT+KDKEEL  RTVVAE
Sbjct  165   VSATKKIKSLITNNQL-TLSHALLSSTKLIVSDDGKKVKRKIPFTDKDKEELMLRTVVAE  223

Query  727   NLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIAD  906
             NLPDDHSHHNIEKIFNV GSVKTIR+CHPQDPN +R++G+  IS+KLHALIEFE PE A+
Sbjct  224   NLPDDHSHHNIEKIFNVAGSVKTIRVCHPQDPN-TRTRGDLGISSKLHALIEFEHPEAAE  282

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSS  1086
             KAVEKLNDERNWRKGL+VKLLLRRSP+SVLK+RKS F+GC +D+D    + S   D  S+
Sbjct  283   KAVEKLNDERNWRKGLQVKLLLRRSPKSVLKSRKSAFDGCFDDEDW---LASELTDD-SN  338

Query  1087  PLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasg  1266
               +Q E  ++NVEE+    A +K WGKGR + R R Q+  GRGLL      SS  SS SG
Sbjct  339   HTNQSEIADSNVEET---LATRKTWGKGRVRARQRNQMFNGRGLL-----ASSPQSSNSG  390

Query  1267  qsesPMKQASKGPRMPDGTRGFTMGRGKPLN  1359
               E+P+KQA+KGPRMPDGT+GFTMGRGKPLN
Sbjct  391   PFEAPIKQATKGPRMPDGTKGFTMGRGKPLN  421



>ref|XP_006423072.1| hypothetical protein CICLE_v10028506mg [Citrus clementina]
 gb|ESR36312.1| hypothetical protein CICLE_v10028506mg [Citrus clementina]
Length=424

 Score =   402 bits (1032),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 235/382 (62%), Positives = 290/382 (76%), Gaps = 25/382 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY--------QDWIYVGDQDPTPFYSNNQNLS  387
             FK NVQAPEFVPRS TQMP+SGY+YP FQY         DWI+VGDQ+P  +  ++ +++
Sbjct  48    FKFNVQAPEFVPRSHTQMPISGYYYPCFQYIGGTATGSADWIFVGDQEPV-YVISSPSVA  106

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
              P    KN L D+++ KIIKQVEYQ SDMSLLANE L+K M+KDPEG+VP+S + S KKI
Sbjct  107   MPSNTSKNVLTDDLRAKIIKQVEYQFSDMSLLANETLSKHMNKDPEGFVPLSVIGSMKKI  166

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+ SN   +LAQAL+SS+KLIVS+DGKKV+RK PFT+K++EELQS TVVAENLP+DHS
Sbjct  167   KSLVGSN--HLLAQALRSSSKLIVSNDGKKVRRKHPFTDKEREELQSCTVVAENLPEDHS  224

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             H N+EKIF VVGSVKTIRICHP + NSSR+K ++F+SNKLHAL+E+ES +IA+KAVEKLN
Sbjct  225   HQNLEKIFGVVGSVKTIRICHPPESNSSRAKSDFFVSNKLHALVEYESTDIAEKAVEKLN  284

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             DERNWRKGLRV++LLR SP+SVLKT+KSEFEG L+D++       A EDS S P +Q   
Sbjct  285   DERNWRKGLRVRVLLRCSPKSVLKTKKSEFEGILDDEEA-----DASEDS-SHPNNQESV  338

Query  1108  TE-TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
              E  NVEE+SGG       G+G+G+   R Q H  R LL   PQ S+++ + +       
Sbjct  339   AENNNVEENSGGSKKGWARGRGKGRG--RAQSHNSRSLLTPPPQSSNATQNEASA-----  391

Query  1285  KQASKGPRMPDGTRGFTMGRGK  1350
             KQ  KGPRMPDGTRGFTMGRGK
Sbjct  392   KQTFKGPRMPDGTRGFTMGRGK  413



>ref|XP_007200048.1| hypothetical protein PRUPE_ppa024894mg [Prunus persica]
 gb|EMJ01247.1| hypothetical protein PRUPE_ppa024894mg [Prunus persica]
Length=401

 Score =   400 bits (1027),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 287/392 (73%), Gaps = 37/392 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFY-SNNQNLSP  390
             FK N QAPEFVPRS TQMP+SGYFYP F +       DW Y+GDQ+  P+  SNN N+ P
Sbjct  28    FKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNI-P  86

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                + KN+LPD+++QKIIKQVEYQ SDMSLLANE+L K +SKDPEGYVPIS VASTKK+K
Sbjct  87    LANRSKNALPDDLQQKIIKQVEYQFSDMSLLANESLVKHISKDPEGYVPISVVASTKKMK  146

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL+S+N   +LAQAL+SS+KL+V+ DGKKV+RK PFTEKDKEELQSRTVVAENLP+DHSH
Sbjct  147   SLISNN--HMLAQALRSSSKLVVNEDGKKVRRKYPFTEKDKEELQSRTVVAENLPEDHSH  204

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N+EKIF+VVGSVKTIRICHP + NSSRSKG++ ISNKLHAL+E+E+ +IA++AV+KL+D
Sbjct  205   QNLEKIFSVVGSVKTIRICHPHESNSSRSKGDFIISNKLHALVEYETTDIAERAVDKLSD  264

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV+LLLRRSP+SVLK RKS+F+G LED++  P  + A E   S P +    T
Sbjct  265   ERNWRKGLRVRLLLRRSPKSVLKNRKSDFDGILEDEE--PQYDCAEE--TSQPSNPELVT  320

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRG--------LLaaspqcssssssasg  1266
             ++  EE+                   +     GRG                 S  SS + 
Sbjct  321   DSPNEENLAAS---------------KKGWAWGRGKARGRGQGQSGRGLIAPSPQSSNTI  365

Query  1267  qsesPMKQASKGPRMPDGTRGFTMGRGKPLNT  1362
             Q E+P KQ +KGPRMPDGTRGFTMGRGKP++ 
Sbjct  366   QCEAPAKQNAKGPRMPDGTRGFTMGRGKPVSA  397



>ref|XP_008236634.1| PREDICTED: la-related protein 6C isoform X1 [Prunus mume]
Length=401

 Score =   400 bits (1027),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 286/392 (73%), Gaps = 37/392 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFY-SNNQNLSP  390
             FK N QAPEFVPRS TQMP+SGYFYP F +       DW Y+GDQ+  P+  SNN N+ P
Sbjct  28    FKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNI-P  86

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                + KN+LPD+++QKIIKQVEYQ SDMSLLANE+L K +SKDPEGYVPIS VASTKK+K
Sbjct  87    LANRSKNALPDDLQQKIIKQVEYQFSDMSLLANESLVKHISKDPEGYVPISVVASTKKMK  146

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL+S+N   +LAQAL+SS+KL+V+ DGKKV+RK PFTEKDKEELQSRTVVAENLP+DHSH
Sbjct  147   SLISNN--HMLAQALRSSSKLVVNEDGKKVRRKYPFTEKDKEELQSRTVVAENLPEDHSH  204

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N+EKIF+VVGSVKTIRICHP + NSSRSKG++ ISNKLHAL+E+E+ +IA++AV KL+D
Sbjct  205   QNLEKIFSVVGSVKTIRICHPHESNSSRSKGDFIISNKLHALVEYETTDIAERAVAKLSD  264

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             E NWRKGLRV+LLLRRSP+SVLK RKS+F+G LEDD+  P  + A E   S P +    T
Sbjct  265   EGNWRKGLRVRLLLRRSPKSVLKNRKSDFDGILEDDE--PQYDCAEE--TSQPSNPELVT  320

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRG--------LLaaspqcssssssasg  1266
             ++  EE+                   +     GRG                 S  SS + 
Sbjct  321   DSPNEENLAAS---------------KKGWAWGRGKARGRGQGQSGRGLIAPSPQSSNTI  365

Query  1267  qsesPMKQASKGPRMPDGTRGFTMGRGKPLNT  1362
             Q E+P KQ +KGPRMPDGTRGFTMGRGKP++T
Sbjct  366   QCEAPAKQNAKGPRMPDGTRGFTMGRGKPVST  397



>ref|XP_010647782.1| PREDICTED: la-related protein 6C isoform X2 [Vitis vinifera]
Length=406

 Score =   395 bits (1014),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 299/386 (77%), Gaps = 27/386 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             FK N QAPEFVPRS TQ+P+SGYFYP F          DW+YV DQDP  F SN+ N S 
Sbjct  34    FKFNAQAPEFVPRSHTQVPISGYFYPCFHLLGGGAGSADWLYVADQDPVHFISNS-NGSL  92

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P +  KN L  +++QKIIKQVEYQ +DMSLLA+++LAK ++KDPEGYVPIS +AS+KK+K
Sbjct  93    PNSS-KNLLTHDIQQKIIKQVEYQFNDMSLLASDSLAKHINKDPEGYVPISVIASSKKVK  151

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             +L+S+N  Q+LAQAL+SS++L+VSSDGKKV+RK  FTE+DKEELQ+ TVVAENLP+DHSH
Sbjct  152   ALVSNN--QLLAQALRSSSQLVVSSDGKKVRRKHLFTERDKEELQAHTVVAENLPEDHSH  209

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N++KIF+VVGSVK IRICHPQ+ N+SRSKG++FISNKLHAL+E+ES EIA+KAVE LND
Sbjct  210   QNLQKIFSVVGSVKNIRICHPQESNNSRSKGDFFISNKLHALVEYESVEIAEKAVEMLND  269

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV++LLRRS       R+SEF+G + D+++ P  E + EDS S P +     
Sbjct  270   ERNWRKGLRVRMLLRRS------NRRSEFDGIM-DEEEGPHPEFS-EDS-SHPNNTELVI  320

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             E+N EE+S    +KKGW +GRGK R RTQI  GRGLLA SPQ S S+   +       KQ
Sbjct  321   ESNAEENS--SGSKKGWARGRGKPRGRTQITSGRGLLAPSPQSSGSNQFEASA-----KQ  373

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNTTA  1368
              +KGPRMPDGTRGFTMGRGKP++T A
Sbjct  374   ITKGPRMPDGTRGFTMGRGKPISTPA  399



>ref|XP_006356602.1| PREDICTED: la-related protein 6-like [Solanum tuberosum]
Length=411

 Score =   394 bits (1013),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 282/387 (73%), Gaps = 25/387 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS--ITQMPVSG-YFYPY-FQY-----QDWIYVGDQDPTPFYSNNQNL  384
             FK NVQAP FVPR    T +P+SG Y YP  FQY        IY GDQD T        +
Sbjct  30    FKFNVQAPAFVPRKSHATTIPISGGYLYPCNFQYVSTNNNSKIYGGDQDATSLLQEPMFV  89

Query  385   SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKK  564
             S     QK+ LP++++ K+IKQVEYQLSDMSLLANE+L KQM+KDPE +VPIS+V++TKK
Sbjct  90    S--SLSQKDKLPEDLRLKVIKQVEYQLSDMSLLANESLLKQMNKDPEAFVPISSVSATKK  147

Query  565   IKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDH  744
             IKSL+++N    L+ AL SSTKLIVS DGK+VKRK PFT+KDKEEL  RTVVAENLPDDH
Sbjct  148   IKSLITNNQL-TLSHALLSSTKLIVSDDGKRVKRKIPFTDKDKEELMLRTVVAENLPDDH  206

Query  745   SHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKL  924
             SHHNIEKIFNV GSVKTIR+CHPQDPN +R++G+  IS+KLHALIEFE PE A+KA EKL
Sbjct  207   SHHNIEKIFNVAGSVKTIRVCHPQDPN-TRTRGDLGISSKLHALIEFEHPEAAEKAAEKL  265

Query  925   NDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLE  1104
             NDERNWRKGLRV+LLLRRSP+SVLK+RKS FEGCL+D+D    + S   D      +Q E
Sbjct  266   NDERNWRKGLRVRLLLRRSPKSVLKSRKSAFEGCLDDEDW---LSSELADDSHHVSNQSE  322

Query  1105  STE-TNVEES-SgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqses  1278
               + TNVEE+       K         TR R Q++ GRGLL       SSS  +S   E+
Sbjct  323   VVDHTNVEETLDAATTKKTWGKGRVKSTRQRNQMYSGRGLL-------SSSPQSSNTYEA  375

Query  1279  PMKQASKGPRMPDGTRGFTMGRGKPLN  1359
             P+KQA+KGPRMPDGTRGFTMGRGKPL+
Sbjct  376   PVKQATKGPRMPDGTRGFTMGRGKPLS  402



>ref|XP_007156532.1| hypothetical protein PHAVU_003G293900g [Phaseolus vulgaris]
 gb|ESW28526.1| hypothetical protein PHAVU_003G293900g [Phaseolus vulgaris]
Length=399

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 234/391 (60%), Positives = 288/391 (74%), Gaps = 28/391 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS +QMP+SGYFYP FQ        DW +VGDQDP+          P 
Sbjct  26    FKFNAQAPEFVPRSQSQMPISGYFYPCFQILGGCGDSDWFFVGDQDPSCLIPTASVALP-  84

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L  +++QKI+KQVEYQ SDMSLLANE+  KQM+KDPEGYVPI+ +ASTKK+KS
Sbjct  85    -NSSKNILTPDLQQKIVKQVEYQFSDMSLLANESFQKQMNKDPEGYVPITVIASTKKVKS  143

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+  N   VL QA++SS+KL++S+DGKKVKRK PFTEK+KE+LQSRTVVAENLPDDHSH 
Sbjct  144   LV--NNVHVLTQAIRSSSKLVLSTDGKKVKRKHPFTEKEKEDLQSRTVVAENLPDDHSHQ  201

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N++KIF+ VGSVKTIRICHPQ+PN+SR K ++F+SNKLHAL+E+E+ +IADKAVEKLNDE
Sbjct  202   NLQKIFSTVGSVKTIRICHPQEPNTSRPKSDFFVSNKLHALVEYETSDIADKAVEKLNDE  261

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTE  1113
             RNWRKG+RV+LLLR SP+SVLK RKSEF+G L DDD+A   E A EDS  S  +  E  +
Sbjct  262   RNWRKGMRVRLLLRCSPKSVLKCRKSEFDGYL-DDDEALNSEIA-EDSSHS--NNAEFFD  317

Query  1114  TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQA  1293
             TNV+E++ G       G+G+G+ R + +     GLLA   Q SS+            K  
Sbjct  318   TNVDENTVGSKKGWARGRGKGRGRTQGR-----GLLAPPSQSSSTVLCDVHT-----KPN  367

Query  1294  SKGPRMPDGTRGFTMGRGKPLNTTAAPPSSV  1386
             +KGPRMPDGTRGFTMGRGKP+    +PP+ V
Sbjct  368   AKGPRMPDGTRGFTMGRGKPI----SPPALV  394



>ref|XP_006480245.1| PREDICTED: la-related protein 7-like [Citrus sinensis]
Length=424

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 231/382 (60%), Positives = 288/382 (75%), Gaps = 25/382 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY--------QDWIYVGDQDPTPFYSNNQNLS  387
             FK NVQAPEFVPRS TQMP+SGY+YP FQY         DWI+VGDQ+P  +  ++ +++
Sbjct  48    FKFNVQAPEFVPRSHTQMPISGYYYPCFQYIGGTATGSADWIFVGDQEPV-YVISSPSVA  106

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
              P    KN L D+++ KIIKQVEYQ SDMSLLANE L+K ++KDPEG+VP+S + S KKI
Sbjct  107   MPSNTSKNVLTDDLRAKIIKQVEYQFSDMSLLANETLSKHVNKDPEGFVPLSVIGSMKKI  166

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+ +N   +LAQAL+SS+KLIVS+DGKKV+RK PFT+K++EELQS TVVAENLP+DHS
Sbjct  167   KSLVGNN--HLLAQALRSSSKLIVSNDGKKVRRKHPFTDKEREELQSCTVVAENLPEDHS  224

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             H N+EKIF VVGSVKTIRICHP + NSSR+K ++F+SNKLHAL+E+ES +IA+KAVEKLN
Sbjct  225   HQNLEKIFGVVGSVKTIRICHPPETNSSRAKSDFFVSNKLHALVEYESTDIAEKAVEKLN  284

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             DERNWRKGLRV++LLR SP+SVLKT+KSEFEG L+D++     +S      S P +Q   
Sbjct  285   DERNWRKGLRVRVLLRCSPKSVLKTKKSEFEGILDDEEADAAEDS------SHPNNQESV  338

Query  1108  TE-TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
              E  NVEE+SGG       G+G+G+   R Q H  R LL   PQ S++S + +       
Sbjct  339   AENNNVEENSGGSKKGWARGRGKGRG--RAQSHNSRSLLTPPPQSSNASQNEASA-----  391

Query  1285  KQASKGPRMPDGTRGFTMGRGK  1350
             KQ  KGPRMPDGTRGFTMGRGK
Sbjct  392   KQTFKGPRMPDGTRGFTMGRGK  413



>ref|XP_003608039.1| La-related protein [Medicago truncatula]
Length=442

 Score =   390 bits (1002),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 232/425 (55%), Positives = 285/425 (67%), Gaps = 57/425 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK NVQAPEFVPRS +QMP+SGYFYP FQ        DW YVGDQDP+     N N+S P
Sbjct  29    FKFNVQAPEFVPRSHSQMPISGYFYPCFQILGGSGESDWFYVGDQDPSACLIPNANVSQP  88

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L  +++QKI+KQVEYQ SD+SLLANE+  KQM+KDPEGYVPI+ +ASTKKIKS
Sbjct  89    NCS-KNVLNPDLQQKIVKQVEYQFSDLSLLANESFQKQMNKDPEGYVPITVIASTKKIKS  147

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+  N   +L QA++ S+KL++S+DGKKVKRK PF EK+KEEL SRTVVAENLPDDHSH 
Sbjct  148   LV--NNIHLLTQAIRHSSKLVLSADGKKVKRKHPFAEKEKEELMSRTVVAENLPDDHSHQ  205

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISN------------------------  861
             N++KIF VVGS+KTIRICHPQ+PNSSR KG++ ISN                        
Sbjct  206   NLQKIFGVVGSIKTIRICHPQEPNSSRPKGDFLISNKVTKNMAYTILLCVSWYLRKRNDT  265

Query  862   --------------KLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLK  999
                           KLHAL+E+ES ++ADKAVEKLNDERNWRKG+RV+LLLR SP+SVLK
Sbjct  266   CIGRISYHLLLAIMKLHALVEYESSDVADKAVEKLNDERNWRKGMRVRLLLRCSPKSVLK  325

Query  1000  TRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgk  1179
              RKSEF+G L+DD+    + S   +  S P +     E+N +E+S G       G+G+G+
Sbjct  326   NRKSEFDGYLDDDEN---LHSETAEDSSHPNNTELCVESNGDETSVGSKKGWTRGRGKGR  382

Query  1180  TRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLN  1359
                RTQ H GRGLLA     SS             K  +KGPRMPDGTRGF +GRGKP++
Sbjct  383   G--RTQNHTGRGLLAPPSPSSSVVLGEVST-----KPNAKGPRMPDGTRGFAIGRGKPIS  435

Query  1360  TTAAP  1374
             +  +P
Sbjct  436   SPTSP  440



>ref|XP_010248222.1| PREDICTED: la-related protein 6C-like [Nelumbo nucifera]
Length=410

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 229/384 (60%), Positives = 296/384 (77%), Gaps = 20/384 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS TQMP++GYFYP+F +       DW Y+ +Q+P  + +N+ N++ P
Sbjct  25    FKFNAQAPEFVPRSQTQMPITGYFYPFFPFLGGSSGSDWFYIAEQEPVQYVANS-NVTVP  83

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
              +  KN L D+++QKIIKQVEYQ SDMSL+A++ LAK ++KDPEGYVPIS +AS+KKIKS
Sbjct  84    NSS-KNFLSDDLRQKIIKQVEYQFSDMSLIASDMLAKHINKDPEGYVPISIIASSKKIKS  142

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+S+N   +L QAL+ S+KL+VS DGK+++RK  FTE++KEELQ RTV  ENLP+D+SH 
Sbjct  143   LVSNN--HLLVQALRGSSKLVVSDDGKRIRRKHLFTEREKEELQCRTVAVENLPEDYSHQ  200

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N+EKIF VVGSVKTIR+CHPQ+ N+SRSKG+  ISNKLHAL+E+E+ + A+KAVEKLNDE
Sbjct  201   NLEKIFGVVGSVKTIRVCHPQESNTSRSKGDVLISNKLHALVEYETVDQAEKAVEKLNDE  260

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLE--DDDQAPPVESAPEDSVSSPLHQLES  1107
             RNWRKGLRV+LL RR+PRS++K+RK +++      ++D+APP ES  EDS S P      
Sbjct  261   RNWRKGLRVRLLHRRTPRSIIKSRKPDYDHSDRNSEEDEAPPSESL-EDS-SQPNSIEHP  318

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
              E+N E+SS    +KKGW +GRGK+R R Q H GRGLLA SPQ +SS  S +      +K
Sbjct  319   MESNAEDSS--SGSKKGWARGRGKSRGRCQSHNGRGLLAPSPQSTSSVLSEATT----IK  372

Query  1288  QASKGPRMPDGTRGFTMGRGKPLN  1359
             Q  +GPRMPDGTRGFTMGRGKPL+
Sbjct  373   QTPRGPRMPDGTRGFTMGRGKPLS  396



>gb|KHN31051.1| La-related protein 7 [Glycine soja]
Length=399

 Score =   384 bits (986),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 230/387 (59%), Positives = 288/387 (74%), Gaps = 28/387 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS  QMPVSGYFYPYFQ        DW +VGDQDP+          P 
Sbjct  26    FKFNAQAPEFVPRSQIQMPVSGYFYPYFQILGGSGESDWFFVGDQDPSCLIPTANAALP-  84

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L  +++QKI+KQVEYQ SDMSLLANE+  KQ++KDPEGYVPI+ +ASTKK+KS
Sbjct  85    -NSSKNILTPDLQQKIVKQVEYQFSDMSLLANESFHKQINKDPEGYVPITVIASTKKVKS  143

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+S+    +L QA++SS+KL++S DGKKVKRK P+TE++KE+LQSRTVVAENLPDDHSH 
Sbjct  144   LVSN--INMLTQAIRSSSKLVLSVDGKKVKRKHPYTEREKEDLQSRTVVAENLPDDHSHQ  201

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N++KIF +VGSVKTIRICHPQ+PNSSR K ++F+SNKLHAL+E+E+ +IA+KA EKLNDE
Sbjct  202   NLQKIFGMVGSVKTIRICHPQEPNSSRPKSDFFVSNKLHALVEYETSDIAEKAAEKLNDE  261

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLH--QLES  1107
             RNWRKG+RV++ +R SP+SVLK+RKSEF+G L DDD+    ES  ED  SSP H    E 
Sbjct  262   RNWRKGMRVRMFVRCSPKSVLKSRKSEFDGYL-DDDEMLNSESV-ED--SSPYHSNNAEL  317

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
              +TNV+E+S  G A +G GKGRG+T+ R        LLA   Q SS+    +       K
Sbjct  318   FDTNVDENSKKGWASRGRGKGRGRTQGRG-------LLAPPSQSSSTILCDAHT-----K  365

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTTA  1368
               +KGP+MPDGTRGFTMGRGKP++ ++
Sbjct  366   PNTKGPKMPDGTRGFTMGRGKPISPSS  392



>ref|XP_004248744.1| PREDICTED: la-related protein 6C-like [Solanum lycopersicum]
Length=412

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 278/389 (71%), Gaps = 26/389 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS--ITQMPVSG-YFYPY-FQY--------QDWIYVGDQDPTPFYSNN  375
             FK NVQAP FVPR    T +P+SG Y YP  FQY           IY GDQD        
Sbjct  27    FKFNVQAPAFVPRKSHATTIPISGGYLYPCNFQYVNTNNNNHNSKIYGGDQDVASLLQEP  86

Query  376   QNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAS  555
               +S     QK+ LP++++ K+IKQVEYQLSDMSLLANE+L KQM+KDPE +VPIS+V++
Sbjct  87    SFVS--SLSQKDKLPEDLRLKVIKQVEYQLSDMSLLANESLLKQMNKDPEAFVPISSVSA  144

Query  556   TKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLP  735
             TKKIKSL+++N    L+ AL SSTKLIVS DGK+VKRK PFT+KDKEEL  RTVVAENLP
Sbjct  145   TKKIKSLITNNQL-TLSHALLSSTKLIVSDDGKRVKRKIPFTDKDKEELMLRTVVAENLP  203

Query  736   DDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             DDHSHHNIEKIFNV GSVKTIR+CHPQDPN +R++G+  IS+KLHALIEFE PE A+KA 
Sbjct  204   DDHSHHNIEKIFNVAGSVKTIRVCHPQDPN-TRTRGDLGISSKLHALIEFEHPEAAEKAA  262

Query  916   EKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLH  1095
              KLNDERNWRKGLRV+LLLRRSP+SVLK+RK+ FEGCL+D+D      +     VS+   
Sbjct  263   MKLNDERNWRKGLRVRLLLRRSPKSVLKSRKTAFEGCLDDEDWMSSGLAEDSHHVSNQSE  322

Query  1096  QLESTETNVEES-SgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqs  1272
              ++   TNVEE+ +     K         TR R Q++ GRGLL       SSS  +S   
Sbjct  323   VVD--HTNVEETLAAATTKKTWGKGRVKSTRQRNQMYNGRGLL-------SSSPQSSKTY  373

Query  1273  esPMKQASKGPRMPDGTRGFTMGRGKPLN  1359
             E+P+ Q +KGPRMPDGTRGFTMGRGKPL+
Sbjct  374   EAPVNQVTKGPRMPDGTRGFTMGRGKPLS  402



>ref|XP_008236635.1| PREDICTED: la-related protein 6C isoform X2 [Prunus mume]
Length=395

 Score =   384 bits (985),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 280/392 (71%), Gaps = 43/392 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFY-SNNQNLSP  390
             FK N QAPEFVPRS TQMP+SGYFYP F +       DW Y+GDQ+  P+  SNN N+ P
Sbjct  28    FKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNI-P  86

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                + KN+LPD+++QKIIKQVEYQ SDMSLLANE+L K +SKDPEGYVPIS VASTKK+K
Sbjct  87    LANRSKNALPDDLQQKIIKQVEYQFSDMSLLANESLVKHISKDPEGYVPISVVASTKKMK  146

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL+S+N   +LAQAL+SS+KL+V+ DGKKV+RK PFTEKDKEELQSRTVVAENLP+DHSH
Sbjct  147   SLISNN--HMLAQALRSSSKLVVNEDGKKVRRKYPFTEKDKEELQSRTVVAENLPEDHSH  204

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N+EKIF+VVGSVKTIRICHP + NSSRSKG++ ISNKLHAL+E+E+ +IA++AV KL+D
Sbjct  205   QNLEKIFSVVGSVKTIRICHPHESNSSRSKGDFIISNKLHALVEYETTDIAERAVAKLSD  264

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             E NWRKGLRV+LLLRRS       RKS+F+G LEDD+  P  + A E   S P +    T
Sbjct  265   EGNWRKGLRVRLLLRRS------NRKSDFDGILEDDE--PQYDCAEE--TSQPSNPELVT  314

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRG--------LLaaspqcssssssasg  1266
             ++  EE+                   +     GRG                 S  SS + 
Sbjct  315   DSPNEENLAAS---------------KKGWAWGRGKARGRGQGQSGRGLIAPSPQSSNTI  359

Query  1267  qsesPMKQASKGPRMPDGTRGFTMGRGKPLNT  1362
             Q E+P KQ +KGPRMPDGTRGFTMGRGKP++T
Sbjct  360   QCEAPAKQNAKGPRMPDGTRGFTMGRGKPVST  391



>ref|XP_009761614.1| PREDICTED: la-related protein 6C-like isoform X2 [Nicotiana sylvestris]
Length=383

 Score =   383 bits (983),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 271/358 (76%), Gaps = 28/358 (8%)
 Frame = +1

Query  292   SGYFYPYFQYQDWIYVGDQDPTPFYSNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSD  471
             S YF P        + GDQD T  Y  NQ+ S     QK+ LP+EVK KIIKQVEYQLSD
Sbjct  45    SNYFGPPLNK----FKGDQD-TISYVPNQSFSAMGQSQKDVLPEEVKNKIIKQVEYQLSD  99

Query  472   MSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDG  651
             MSLLANENL KQM+KDPEG+VPIS+V++TKKIKSL+++   Q LA AL SSTKLIVS+DG
Sbjct  100   MSLLANENLLKQMNKDPEGFVPISSVSTTKKIKSLITNQ--QTLAHALLSSTKLIVSNDG  157

Query  652   KKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS  831
             KKVKR+ PF +KDKE+LQ RTVVAENLPDDHSHHNIEKIF V GSVKTIR+CHPQDPNSS
Sbjct  158   KKVKRRTPFNDKDKEDLQLRTVVAENLPDDHSHHNIEKIFKVAGSVKTIRVCHPQDPNSS  217

Query  832   RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKS  1011
             R++G+  ISNKLHALIEFE+PE A++AVEKLNDERNWRKGLRV+LLLRRSP+SVLK+RKS
Sbjct  218   RARGDIGISNKLHALIEFENPEAAERAVEKLNDERNWRKGLRVRLLLRRSPKSVLKSRKS  277

Query  1012  EFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLR  1191
             +F+GC +D+D              S L + +S   NVEES      KK W KGRGK R R
Sbjct  278   DFDGCFDDED--------------SELTE-DSDGNNVEES--MATNKKAWNKGRGKLRSR  320

Query  1192  TQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTT  1365
             TQI+GGRGLL          +S+   SE P++Q +KGPRMPDGTRGFTMGRGKP  +T
Sbjct  321   TQIYGGRGLL----AALPQCNSSPSLSEGPVRQVTKGPRMPDGTRGFTMGRGKPFTST  374



>ref|XP_003528499.1| PREDICTED: la-related protein 6-like [Glycine max]
Length=399

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 287/387 (74%), Gaps = 28/387 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK N QAPEFVPRS  QMPVSGYFYPYFQ        DW +VGDQDP+          P 
Sbjct  26    FKFNAQAPEFVPRSQIQMPVSGYFYPYFQILGGSGESDWFFVGDQDPSCLIPTANAALP-  84

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                 KN L  +++QKI+KQVEYQ SDMSLLANE+  KQ++KDPEGYVPI+ +ASTKK+KS
Sbjct  85    -NSSKNILTPDLQQKIVKQVEYQFSDMSLLANESFHKQINKDPEGYVPITVIASTKKVKS  143

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+S+    +L QA++SS+KL++S DGKKVKRK P+TE++KE+LQSRTVVAENLPDDHSH 
Sbjct  144   LVSN--INMLTQAIRSSSKLVLSVDGKKVKRKHPYTEREKEDLQSRTVVAENLPDDHSHQ  201

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N++KIF +VGSVKTIRICHPQ+PNSSR K ++F+SNKLHAL+E+E+ +IA+KA EKLNDE
Sbjct  202   NLQKIFGMVGSVKTIRICHPQEPNSSRPKSDFFVSNKLHALVEYETSDIAEKAAEKLNDE  261

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLH--QLES  1107
             RNWRKG+RV++ +R SP+SVLK+RKSEF+G L DDD+    ES  ED  SSP H    E 
Sbjct  262   RNWRKGMRVRMFVRCSPKSVLKSRKSEFDGYL-DDDEMLNSESV-ED--SSPYHSNNAEL  317

Query  1108  TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
              +TNV+E+   G A +G GKGRG+T+ R        LLA   Q SS+    +       K
Sbjct  318   FDTNVDENCKKGWASRGRGKGRGRTQGRG-------LLAPPSQSSSTILCDAHT-----K  365

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTTA  1368
               +KGP+MPDGTRGFTMGRGKP++ ++
Sbjct  366   PNTKGPKMPDGTRGFTMGRGKPISPSS  392



>ref|XP_003520171.1| PREDICTED: la-related protein 6-like [Glycine max]
 gb|KHN37485.1| La-related protein 7 [Glycine soja]
Length=404

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 223/386 (58%), Positives = 278/386 (72%), Gaps = 22/386 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             FK N QAPEFVPRS TQMPVSGY+YP FQ         DW +VGDQDP+       N++ 
Sbjct  27    FKFNAQAPEFVPRSHTQMPVSGYYYPCFQIFGGSSESADWFFVGDQDPSCLIPT-PNVAQ  85

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P +  KN L  +++QKI+KQVEYQ SDMSLLANE+  KQM+KDPEGYVPI+ +ASTKK+K
Sbjct  86    PNSS-KNILTPDLQQKIVKQVEYQFSDMSLLANESFHKQMNKDPEGYVPITVIASTKKVK  144

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL+S+    +L QA++SS+KL++S DGKKVKRK P+TEK+KE+L +RTVVAENLPDDHSH
Sbjct  145   SLVSN--INMLTQAIRSSSKLVLSVDGKKVKRKHPYTEKEKEDLLARTVVAENLPDDHSH  202

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N++KIF +VGSVKTIRICHPQ+PNSSR K ++ +SNKLHAL+E+E+ +IA+KA EKLND
Sbjct  203   QNLQKIFGIVGSVKTIRICHPQEPNSSRPKSDFIVSNKLHALVEYETSDIAEKAAEKLND  262

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKG+RV+L LR SP+SVLK+RKSEF+G L DDD+    ES  EDS  S  +  E  
Sbjct  263   ERNWRKGMRVRLFLRCSPKSVLKSRKSEFDGYL-DDDEIINFESV-EDSSPSHSNNAELF  320

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             ETNV+E+  G                       RGLLA   Q SS+    +       K 
Sbjct  321   ETNVDENWVGCKKGWAGRGRGKGRGRTQG----RGLLAPPSQSSSTILCDAHT-----KH  371

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNTTA  1368
              +KGPRMPDGTRGFTMGRGKP++ ++
Sbjct  372   NTKGPRMPDGTRGFTMGRGKPMSPSS  397



>ref|XP_011001196.1| PREDICTED: la-related protein 6C [Populus euphratica]
Length=428

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 294/405 (73%), Gaps = 36/405 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQ---MPVSGYFYPYFQY----------QDWIYVGDQDPTPFY--  366
             FK N QAPEFVPRS T    +P+SGYFYP F Y           DWI+VGDQD    Y  
Sbjct  38    FKFNAQAPEFVPRSHTNTSPLPISGYFYPCFHYFGATDSAAGGSDWIFVGDQDHAAAYLI  97

Query  367   SNNQN--LSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPI  540
             SNN N  +S   ++ +  L D++++KIIKQVEYQLSDMSLLANE+++K +SKDPEGYVPI
Sbjct  98    SNNPNHAMSNCPSKNRGVLTDDLREKIIKQVEYQLSDMSLLANESMSKHVSKDPEGYVPI  157

Query  541   SAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVV  720
             + +ASTKK++SL+S N   +LAQAL+SS+KL+++ DGKKVKRK PFT+KD+EELQSR VV
Sbjct  158   AVIASTKKMRSLISDN--DLLAQALKSSSKLVLAEDGKKVKRKLPFTDKDREELQSRIVV  215

Query  721   AENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEI  900
              ENLPDDHSH N++KIF+V+GS KTIRICHPQ+ NSSR+K ++F++NKLHAL+E E+  I
Sbjct  216   VENLPDDHSHQNVQKIFSVIGSAKTIRICHPQESNSSRAKNDFFVTNKLHALVELETRVI  275

Query  901   ADKAVEKLNDERNWrkglrvklllrrSPRSVL-KTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             A+KAVEKLNDERNWRKGLRV+LLLR SP+SVL + RKSEF+  LE++D +  ++ + ED+
Sbjct  276   AEKAVEKLNDERNWRKGLRVRLLLRCSPKSVLTRGRKSEFDNILEEEDSS--LDESTEDT  333

Query  1078  VSSPLHQLESTETNVEESSggg--aakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssss  1251
                   Q  ++E+ +E  +     A+KK   KGRGK + R QI   RG+LA     S+  
Sbjct  334   F-----QPNNSESAIESCAEDNPGASKKARAKGRGKGKDRGQIICARGMLAPPKCGSTPH  388

Query  1252  ssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAAPPSSV  1386
               AS       K+   GPRMPDGT+GFT+GRGKPL  T+ P SS+
Sbjct  389   CEASP------KKTCNGPRMPDGTKGFTVGRGKPL-VTSGPTSSM  426



>ref|XP_006384451.1| hypothetical protein POPTR_0004s15210g [Populus trichocarpa]
 gb|ERP62248.1| hypothetical protein POPTR_0004s15210g [Populus trichocarpa]
Length=429

 Score =   376 bits (966),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 288/398 (72%), Gaps = 31/398 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS---ITQMPVSGYFYPYFQY----------QDWIYVGDQDPTPFY--  366
             FK N QAPEFVPRS    TQ+P+SGYFYP F Y           DWI+VGDQD    Y  
Sbjct  39    FKFNAQAPEFVPRSHTNTTQLPISGYFYPCFHYFGATASAAGGSDWIFVGDQDHAAAYLI  98

Query  367   SNNQN--LSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPI  540
             SNN N  +S   ++ +  L D++++KIIKQVEYQLSDMSLLANE+++K +SKDPEGYVPI
Sbjct  99    SNNPNHAMSNCPSKNRGVLTDDLREKIIKQVEYQLSDMSLLANESMSKHVSKDPEGYVPI  158

Query  541   SAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVV  720
             + +ASTKK++SL+S N   +LAQAL+SS+KL+++ DGKKVKRK PFT+K +EELQSR VV
Sbjct  159   AVIASTKKMRSLVSDN--DLLAQALKSSSKLVLAEDGKKVKRKLPFTDKHREELQSRIVV  216

Query  721   AENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEI  900
              ENLPDDHSH N++KIF+V+GS KTIRICHPQ+ NSSR+K  +F++NKLHAL+E ES  I
Sbjct  217   VENLPDDHSHQNVQKIFSVIGSAKTIRICHPQESNSSRAKNGFFVTNKLHALVELESRVI  276

Query  901   ADKAVEKLNDERNWrkglrvklllrrSPRSVL-KTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             A+KAVEKLNDERNWRKGL+V+LLLR SP+SVL + RKSEF+  L+ +D   P++ + ED+
Sbjct  277   AEKAVEKLNDERNWRKGLKVRLLLRCSPKSVLTRGRKSEFDNILDGEDS--PLDESTEDT  334

Query  1078  VSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssss  1257
              S P +   + E+  E++ G        G+G+GK   R QI   RG+LA     S+    
Sbjct  335   -SQPNNSESAIESCAEDNPGASKKAWAKGRGKGKG--RGQIICARGMLAPPKCGSTPHCE  391

Query  1258  asgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAA  1371
             AS       K+  KGPRMPDGT+GFT+GRGKPL T+ +
Sbjct  392   ASP------KKTCKGPRMPDGTKGFTVGRGKPLVTSVS  423



>ref|XP_010255219.1| PREDICTED: la-related protein 6C-like [Nelumbo nucifera]
Length=407

 Score =   374 bits (960),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 226/392 (58%), Positives = 285/392 (73%), Gaps = 20/392 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFYSNNQNLSPP  393
             FK NV APEFVPRS TQMP+SGYFYP+F +       DW Y  +Q+P    SN+ N++ P
Sbjct  25    FKFNVHAPEFVPRSQTQMPISGYFYPFFHFLGGSSGSDWYYFTEQEPIQIVSNS-NVTLP  83

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
              +  KN L D+++QKIIKQVEYQ SDMSL+A++ L K ++KDPEGYVPIS +AS+KKIKS
Sbjct  84    NSS-KNFLTDDLRQKIIKQVEYQFSDMSLVASDMLMKHINKDPEGYVPISVIASSKKIKS  142

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             L+S+N   ++ QAL++S KL+VS DGKKV+RK  FTE+DKEELQSRTV  ENLP+D+SH 
Sbjct  143   LVSNNN--LVIQALRTSPKLVVSDDGKKVRRKHLFTERDKEELQSRTVAVENLPEDYSHQ  200

Query  754   NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
             N+EKIF+VVGSVKTIR+CHPQ+ N+SR KG+  ISNKLHAL+E+E+ + A+KAVE LNDE
Sbjct  201   NLEKIFSVVGSVKTIRVCHPQESNASRPKGDVLISNKLHALVEYETVDQAEKAVETLNDE  260

Query  934   RNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTE  1113
             RNWRKGLRV+LLLRRSPRSV+K+R  +      DD++ PP ES  EDS      QL +TE
Sbjct  261   RNWRKGLRVRLLLRRSPRSVVKSRNYDHFDRNSDDEETPPYESL-EDS-----SQLNNTE  314

Query  1114  TNVEESSgggaakkgw--gkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMK  1287
               +E S+            +GRGK R RTQ   GRG          S+SS++ Q E+ ++
Sbjct  315   NPMENSAEDSTTGPKKGWARGRGKPRGRTQSQSGRG--GPFAPSPQSTSSSNNQPEAHIR  372

Query  1288  QASKGPRMPDGTRGFTMGRGKPLNTTAAPPSS  1383
             Q  +GPRMPDGTRGFTMGRGKPL+T     SS
Sbjct  373   QTPRGPRMPDGTRGFTMGRGKPLSTMPLATSS  404



>ref|XP_008236636.1| PREDICTED: la-related protein 6C isoform X3 [Prunus mume]
Length=352

 Score =   372 bits (954),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 196/277 (71%), Positives = 236/277 (85%), Gaps = 10/277 (4%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY------QDWIYVGDQDPTPFY-SNNQNLSP  390
             FK N QAPEFVPRS TQMP+SGYFYP F +       DW Y+GDQ+  P+  SNN N+ P
Sbjct  28    FKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNI-P  86

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                + KN+LPD+++QKIIKQVEYQ SDMSLLANE+L K +SKDPEGYVPIS VASTKK+K
Sbjct  87    LANRSKNALPDDLQQKIIKQVEYQFSDMSLLANESLVKHISKDPEGYVPISVVASTKKMK  146

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL+S+N   +LAQAL+SS+KL+V+ DGKKV+RK PFTEKDKEELQSRTVVAENLP+DHSH
Sbjct  147   SLISNN--HMLAQALRSSSKLVVNEDGKKVRRKYPFTEKDKEELQSRTVVAENLPEDHSH  204

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N+EKIF+VVGSVKTIRICHP + NSSRSKG++ ISNKLHAL+E+E+ +IA++AV KL+D
Sbjct  205   QNLEKIFSVVGSVKTIRICHPHESNSSRSKGDFIISNKLHALVEYETTDIAERAVAKLSD  264

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDD  1041
             E NWRKGLRV+LLLRRSP+SVLK RKS+F+G LEDD+
Sbjct  265   EGNWRKGLRVRLLLRRSPKSVLKNRKSDFDGILEDDE  301



>gb|KDO49150.1| hypothetical protein CISIN_1g046325mg, partial [Citrus sinensis]
Length=442

 Score =   374 bits (959),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 282/378 (75%), Gaps = 25/378 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY--------QDWIYVGDQDPTPFYSNNQNLS  387
             FK NVQAPEFVPRS TQMP+SGY+YP FQY         DWI+VGDQ+P  +  ++ +++
Sbjct  68    FKFNVQAPEFVPRSHTQMPISGYYYPCFQYIGGTATGSADWIFVGDQEPV-YVISSPSVA  126

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
              P    KN L D+++ KIIKQVEYQ SDMSLLANE L+K ++KDPEG+VP+S + S KKI
Sbjct  127   MPSNTSKNVLTDDLRAKIIKQVEYQFSDMSLLANETLSKHVNKDPEGFVPLSVIGSMKKI  186

Query  568   KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
             KSL+ +N   +LAQAL+SS+KLIVS+DGKKV+RK PFT+K++EELQS TVVAENLP+DHS
Sbjct  187   KSLVGNN--HLLAQALRSSSKLIVSNDGKKVRRKHPFTDKEREELQSCTVVAENLPEDHS  244

Query  748   HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
             H N+EKIF VVGSVKTIRICHP + NSSR+K ++F+SNKLHAL+E+ES +IA+KAVEKLN
Sbjct  245   HQNLEKIFGVVGSVKTIRICHPPESNSSRAKSDFFVSNKLHALVEYESTDIAEKAVEKLN  304

Query  928   DERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             DERNWRKGLRV++LLR SP+SVLKT+KSEFEG L+D++       A EDS S P +Q   
Sbjct  305   DERNWRKGLRVRVLLRCSPKSVLKTKKSEFEGILDDEEA-----DASEDS-SHPNNQESV  358

Query  1108  TE-TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
              E  NVEE+SGG       G+G+G+   R Q H  R LL   PQ S++S + +       
Sbjct  359   AENNNVEENSGGSKKGWARGRGKGRG--RAQSHNSRSLLTPPPQSSNASQNEASA-----  411

Query  1285  KQASKGPRMPDGTRGFTM  1338
             KQ  KGPRMPD T+   +
Sbjct  412   KQTFKGPRMPDVTQIMAL  429



>ref|XP_010999935.1| PREDICTED: la-related protein 6C-like [Populus euphratica]
Length=414

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 222/394 (56%), Positives = 280/394 (71%), Gaps = 32/394 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS---ITQMPVSGYFYPYFQY--------QDWIYVGDQDPTPFY-SNN  375
             FK N QAPEF+PRS    TQMP+SGYFYPYF Y         DW +VG+QD   +  SNN
Sbjct  31    FKFNAQAPEFLPRSHTTATQMPISGYFYPYFNYLGATAAGGSDWFFVGNQDHAAYLISNN  90

Query  376   QNLSPPQTQQKNS--LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAV  549
              NL+ P    KNS  L D++++KIIKQVEYQ SDMSLLANE+++K  +KDPEGYVPIS +
Sbjct  91    PNLAMPNCPTKNSDVLTDDLRKKIIKQVEYQFSDMSLLANESMSKHNNKDPEGYVPISVI  150

Query  550   ASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAEN  729
             ASTKK++SL+  N   +LAQAL+SS+KL ++ DGKKVKRK PFT+KD+EELQSR VV EN
Sbjct  151   ASTKKMRSLVIDN--DMLAQALKSSSKLSLTEDGKKVKRKIPFTDKDREELQSRIVVVEN  208

Query  730   LPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADK  909
             LP+DHSH N++KIF+V GSVKTIRICHPQ+ NSS +K ++ ++NKLHAL+E E+ +IA+K
Sbjct  209   LPEDHSHQNVQKIFSVAGSVKTIRICHPQESNSSVAKNDFIVTNKLHALVELETQKIAEK  268

Query  910   AVEKLNDERNWrkglrvklllrrSPRSVL-KTRKSEFEGCLEDDDQAPPVESAPEDSVSS  1086
             AVEKLNDERNWRKGLRV+LLLR SP+SVL + R+SEF+   E+D  +P  ES  +     
Sbjct  269   AVEKLNDERNWRKGLRVRLLLRCSPKSVLPRGRRSEFDIWEEED--SPHYESTVD-----  321

Query  1087  PLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasg  1266
                +  ++E++ E+SSG                 R QI+  RGLLA     S+    AS 
Sbjct  322   -TFKPNNSESHAEDSSGASKKAWAAKGHGKGKG-RGQINCSRGLLAPVKCASTPQREASA  379

Query  1267  qsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTA  1368
                   K ASKGPRMPDGT+GFT+GRGKPL T+A
Sbjct  380   ------KHASKGPRMPDGTKGFTVGRGKPLITSA  407



>ref|XP_002313090.2| hypothetical protein POPTR_0009s10970g [Populus trichocarpa]
 gb|EEE87045.2| hypothetical protein POPTR_0009s10970g [Populus trichocarpa]
Length=419

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 280/395 (71%), Gaps = 29/395 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS---ITQMPVSGYFYPYFQY--------QDWIYVGDQDPTPFY-SNN  375
             FK N QAPEF+PRS    TQMP+SGYFYPYF Y         DW +VG+QD   +  SN+
Sbjct  31    FKFNAQAPEFLPRSHTAATQMPISGYFYPYFNYLGATAAGGSDWFFVGNQDHAAYLISND  90

Query  376   QNLSP-PQTQQKNS--LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISA  546
              NL+  P    KNS  L D++++KIIKQVEYQ SDMSLLANE+++K ++KDPEGYVPIS 
Sbjct  91    PNLAAMPNGPTKNSDVLTDDLRKKIIKQVEYQFSDMSLLANESMSKHINKDPEGYVPISV  150

Query  547   VASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAE  726
             +ASTKK++SL+  N +  LAQAL+SS+KL ++ DGKK+KRK PFT+KD+EELQSR VV E
Sbjct  151   IASTKKMRSLVIDNDS--LAQALKSSSKLSLTEDGKKIKRKIPFTDKDREELQSRIVVVE  208

Query  727   NLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIAD  906
             NLP+DHSH N++KIF+VVGSVKTIRICHP + NSS +K ++F++NKLHAL+E E+ +IA+
Sbjct  209   NLPEDHSHQNVQKIFSVVGSVKTIRICHPHESNSSGAKNDFFVTNKLHALVELETRKIAE  268

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVL-KTRKSEFEGCLEDDDQAPPVESAPEDSVS  1083
             KA EKLNDERNWRKGLRV+LLLR SP+SVL + R+SEF+  + D++ +P  ES  +    
Sbjct  269   KAAEKLNDERNWRKGLRVRLLLRCSPKSVLPRGRRSEFD--IWDEEDSPHYESTVD--TF  324

Query  1084  SPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssas  1263
              P +    TE++ E+SSG                 R QI+  RGLLA     S+    AS
Sbjct  325   KPNNSESVTESHAEDSSGASKKAWAAKGHGKGKG-RGQINCSRGLLAPVKCASTPQREAS  383

Query  1264  gqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTA  1368
                    K ASK PRMPDGT+GF +GRGKPL T+A
Sbjct  384   A------KHASKSPRMPDGTKGFNVGRGKPLITSA  412



>ref|XP_011092741.1| PREDICTED: la-related protein 6C-like isoform X2 [Sesamum indicum]
Length=406

 Score =   365 bits (937),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 224/395 (57%), Positives = 283/395 (72%), Gaps = 38/395 (10%)
 Frame = +1

Query  232   FKLNVQAPEFVPR----SITQMPVSGYFYPYFQYQD-----WIYVGDQDPT-PF-YSNNQ  378
             FK NV APEFVP     + TQ+P++GYFYP FQY D     WIYV +QD T P  +S   
Sbjct  26    FKFNVAAPEFVPTLAHTTATQVPITGYFYPCFQYIDGTSGNWIYVAEQDITLPLVHSKPN  85

Query  379   NLSPPQTQQKN-------SLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVP  537
               +   T Q N       +L DE+KQKIIKQ EY  SDMS+LANE L K ++KDPEGYVP
Sbjct  86    GKAGADTDQTNHTQTKEIALSDELKQKIIKQAEYMFSDMSMLANETLVKHVNKDPEGYVP  145

Query  538   ISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTV  717
             I+ V++ KK+KSL  +N  Q++AQAL+SSTKL+VSSDGKKV+RK PFTEK+KE+LQ RTV
Sbjct  146   INFVSTLKKLKSLNVNN--QMVAQALRSSTKLVVSSDGKKVRRKNPFTEKEKEDLQMRTV  203

Query  718   VAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS--RSKGEYFISNKLHALIEFES  891
             +AENLPDDHSH  IEK+FNVVGS+++IRIC PQD NSS   SKG+  ISNKLHAL+E+E+
Sbjct  204   IAENLPDDHSHQKIEKMFNVVGSIRSIRICQPQDHNSSSRSSKGDVVISNKLHALVEYEN  263

Query  892   PEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPE  1071
              E A+KA EKLNDERNWRKG+RV+L+LRRSP+SVLK+RKSEF+ CL+DD  +     + E
Sbjct  264   AETAEKAAEKLNDERNWRKGMRVRLMLRRSPKSVLKSRKSEFDVCLDDDGLS--THQSHE  321

Query  1072  DSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssss  1251
             D+ S  L   E+T++  EE+S     K+ W + RGK++ R Q+ G R L          +
Sbjct  322   DA-SGRLSTSEATDS--EENS--AILKRSWSRNRGKSKHRPQLQGARSL---------PT  367

Query  1252  ssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPL  1356
              S++G    P  Q +KGPRMPDGT+GFTMGRGKP+
Sbjct  368   PSSNGGLSCPGLQPAKGPRMPDGTKGFTMGRGKPM  402



>ref|XP_004153773.1| PREDICTED: uncharacterized protein LOC101217948, partial [Cucumis 
sativus]
Length=393

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 282/384 (73%), Gaps = 18/384 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             F+ N QAPEF PR+ TQMPV+GYF+PYF +        DW ++GDQ+P  +   N N+  
Sbjct  12    FRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPA-YLIPNPNIQL  70

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P    K++  +E++QKI+KQVEYQLSDMSLLANE LAK +SKDP+GYVPIS ++STKK+K
Sbjct  71    PNFS-KHARSEEIQQKIVKQVEYQLSDMSLLANETLAKHISKDPDGYVPISILSSTKKVK  129

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL ++N    + QAL+SS++L+VSSDGK+V+RK PFT+KDKEEL +RTVVAENLP++HSH
Sbjct  130   SLSTNN--NFIVQALRSSSRLVVSSDGKRVRRKVPFTDKDKEELLARTVVAENLPENHSH  187

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
             HN+EKIF+VVGSVKTIRICHP + N   SKGE F+SNKLHAL+EFE+ E+A++A+E+LND
Sbjct  188   HNLEKIFSVVGSVKTIRICHPPESNPCCSKGELFVSNKLHALVEFETAELAERAIEQLND  247

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV+ L+RRSP+SVLK RKSEF+  L++DD   PV         SPL  +   
Sbjct  248   ERNWRKGLRVRPLVRRSPKSVLKNRKSEFDSVLDEDDSPSPVSVE-----ESPLQNI--N  300

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             + NV+ +S   +       GRG+ + R +IHG      + P  SS  +S    SE+  K 
Sbjct  301   DLNVDCNSEENSTSLKKSWGRGRGKGRGRIHGNLDRSYSLPVTSSLQTSGQVLSEASSKL  360

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNT  1362
              +K PRMPDGT+GFTMGRGKPL++
Sbjct  361   TTKSPRMPDGTKGFTMGRGKPLSS  384



>ref|XP_004145408.1| PREDICTED: uncharacterized protein LOC101207999 [Cucumis sativus]
Length=423

 Score =   361 bits (926),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 282/384 (73%), Gaps = 18/384 (5%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             F+ N QAPEF PR+ TQMPV+GYF+PYF +        DW ++GDQ+P  +   N N+  
Sbjct  42    FRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPA-YLIPNPNIQL  100

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P    K++  +E++QKI+KQVEYQLSDMSLLANE LAK +SKDP+GYVPIS ++STKK+K
Sbjct  101   PNFS-KHARSEEIQQKIVKQVEYQLSDMSLLANETLAKHISKDPDGYVPISILSSTKKVK  159

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL ++N    + QAL+SS++L+VSSDGK+V+RK PFT+KDKEEL +RTVVAENLP++HSH
Sbjct  160   SLSTNNN--FIVQALRSSSRLVVSSDGKRVRRKVPFTDKDKEELLARTVVAENLPENHSH  217

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
             HN+EKIF+VVGSVKTIRICHP + N   SKGE F+SNKLHAL+EFE+ E+A++A+E+LND
Sbjct  218   HNLEKIFSVVGSVKTIRICHPPESNPCCSKGELFVSNKLHALVEFETAELAERAIEQLND  277

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV+ L+RRSP+SVLK RKSEF+  L++DD   PV         SPL  +   
Sbjct  278   ERNWRKGLRVRPLVRRSPKSVLKNRKSEFDSVLDEDDSPSPVSVE-----ESPLQNI--N  330

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             + NV+ +S   +       GRG+ + R +IHG      + P  SS  +S    SE+  K 
Sbjct  331   DLNVDCNSEENSTSLKKSWGRGRGKGRGRIHGNLDRSYSLPVTSSLQTSGQVLSEASSKL  390

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNT  1362
              +K PRMPDGT+GFTMGRGKPL++
Sbjct  391   TTKSPRMPDGTKGFTMGRGKPLSS  414



>ref|XP_011092740.1| PREDICTED: la-related protein 6C-like isoform X1 [Sesamum indicum]
Length=410

 Score =   359 bits (922),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 283/399 (71%), Gaps = 42/399 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPR----SITQMPVSGYFYPYFQYQD-----WIYVGDQDPT-PF-YSNNQ  378
             FK NV APEFVP     + TQ+P++GYFYP FQY D     WIYV +QD T P  +S   
Sbjct  26    FKFNVAAPEFVPTLAHTTATQVPITGYFYPCFQYIDGTSGNWIYVAEQDITLPLVHSKPN  85

Query  379   NLSPPQTQQKN-------SLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVP  537
               +   T Q N       +L DE+KQKIIKQ EY  SDMS+LANE L K ++KDPEGYVP
Sbjct  86    GKAGADTDQTNHTQTKEIALSDELKQKIIKQAEYMFSDMSMLANETLVKHVNKDPEGYVP  145

Query  538   ISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTV  717
             I+ V++ KK+KSL  +N  Q++AQAL+SSTKL+VSSDGKKV+RK PFTEK+KE+LQ RTV
Sbjct  146   INFVSTLKKLKSLNVNN--QMVAQALRSSTKLVVSSDGKKVRRKNPFTEKEKEDLQMRTV  203

Query  718   VAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS--RSKGEYFISNKLHALIEFES  891
             +AENLPDDHSH  IEK+FNVVGS+++IRIC PQD NSS   SKG+  ISNKLHAL+E+E+
Sbjct  204   IAENLPDDHSHQKIEKMFNVVGSIRSIRICQPQDHNSSSRSSKGDVVISNKLHALVEYEN  263

Query  892   PEIADKAVEKLNDERNWrkglrvklllrrS----PRSVLKTRKSEFEGCLEDDDQAPPVE  1059
              E A+KA EKLNDERNWRKG+RV+L+LRRS    P+SVLK+RKSEF+ CL+DD  +    
Sbjct  264   AETAEKAAEKLNDERNWRKGMRVRLMLRRSVNLQPKSVLKSRKSEFDVCLDDDGLS--TH  321

Query  1060  SAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqc  1239
              + ED+ S  L   E+T++  EE+S     K+ W + RGK++ R Q+ G R L       
Sbjct  322   QSHEDA-SGRLSTSEATDS--EENS--AILKRSWSRNRGKSKHRPQLQGARSL-------  369

Query  1240  ssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPL  1356
                + S++G    P  Q +KGPRMPDGT+GFTMGRGKP+
Sbjct  370   --PTPSSNGGLSCPGLQPAKGPRMPDGTKGFTMGRGKPM  406



>emb|CDO97143.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   359 bits (922),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 225/394 (57%), Positives = 274/394 (70%), Gaps = 23/394 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS------GYFYPYF------QYQDWIYVGDQDPTPFYSNN  375
             FK N  AP FVPR+    P        GYF P F         DW+++GDQD     S +
Sbjct  38    FKFNADAPAFVPRAPVPAPPPASVPVSGYFLPCFPIFGGTNGTDWLFLGDQDTISLVSKS  97

Query  376   QNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAS  555
                SP Q Q K+ L +E+++KIIKQ+EYQ SDMSLLAN+NLAKQ+ KD EGYVPI+ VAS
Sbjct  98    NATSPTQ-QSKHVLTEELQKKIIKQMEYQFSDMSLLANDNLAKQIYKDHEGYVPIANVAS  156

Query  556   TKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLP  735
             TKKIKS + SN  Q+LAQAL++STKL VS+DGK+VKRK PFT+K KEELQ RT+VAENLP
Sbjct  157   TKKIKSFVGSNH-QLLAQALRASTKLDVSNDGKRVKRKVPFTDKVKEELQLRTIVAENLP  215

Query  736   DDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             DDHSH NIEKIFNV G VKTIRICHPQDPN +RSKG++ IS KLHAL+EFE+ E A++AV
Sbjct  216   DDHSHQNIEKIFNVAGCVKTIRICHPQDPN-TRSKGDFIISTKLHALVEFENSESAERAV  274

Query  916   EKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVES--APEDSVSSP  1089
             EKLND++NWRKGLRV+ LLRRSP+SVLK++KSEF+G L DDD+ PP  S  +PE S   P
Sbjct  275   EKLNDQKNWRKGLRVRCLLRRSPKSVLKSKKSEFDGLL-DDDETPPGSSIVSPELS-PRP  332

Query  1090  LHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgq  1269
             +      E N  ESSG    K             T  H GRGLL        S++     
Sbjct  333   IISDSPPENNGYESSGASKTKAWNKGRGKPRHRLTSSHSGRGLL---SLSPQSNNGIFIL  389

Query  1270  sesPM-KQASKGPRMPDGTRGFTMGRGKPLNTTA  1368
              E+P+ +Q +KGP+MPDGTRGFTMGRGKP++ + 
Sbjct  390   GEAPLTRQNAKGPKMPDGTRGFTMGRGKPISVSV  423



>gb|KGN61738.1| hypothetical protein Csa_2G235610 [Cucumis sativus]
Length=446

 Score =   357 bits (916),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 213/405 (53%), Positives = 275/405 (68%), Gaps = 37/405 (9%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             F+ N QAPEF PR+ TQMPV+GYF+PYF +        DW ++GDQ+P  +   N N+  
Sbjct  42    FRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPA-YLIPNPNIQL  100

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P    K++  +E++QKI+KQVEYQLSDMSLLANE LAK +SKDP+GYVPIS ++STKK+K
Sbjct  101   PNFS-KHARSEEIQQKIVKQVEYQLSDMSLLANETLAKHISKDPDGYVPISILSSTKKVK  159

Query  571   SLLSSNTTQVLAQAL---------------------QSSTKLIVSSDGKKVKRKQPFTEK  687
             SL ++N   V A                        Q     +VSSDGK+V+RK PFT+K
Sbjct  160   SLSTNNNFIVQALRSSSRLVSSVVEHSVLYSLLIIDQYLVPKVVSSDGKRVRRKVPFTDK  219

Query  688   DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKL  867
             DKEEL +RTVVAENLP++HSHHN+EKIF+VVGSVKTIRICHP + N   SKGE F+SNKL
Sbjct  220   DKEELLARTVVAENLPENHSHHNLEKIFSVVGSVKTIRICHPPESNPCCSKGELFVSNKL  279

Query  868   HALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQA  1047
             HAL+EFE+ E+A++A+E+LNDERNWRKGLRV+ L+RRSP+SVLK RKSEF+  L++DD  
Sbjct  280   HALVEFETAELAERAIEQLNDERNWRKGLRVRPLVRRSPKSVLKNRKSEFDSVLDEDDSP  339

Query  1048  PPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaa  1227
              PV         SPL  +   + NV+ +S   +       GRG+ + R +IHG      +
Sbjct  340   SPVSVE-----ESPLQNI--NDLNVDCNSEENSTSLKKSWGRGRGKGRGRIHGNLDRSYS  392

Query  1228  spqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNT  1362
              P  SS  +S    SE+  K  +K PRMPDGT+GFTMGRGKPL++
Sbjct  393   LPVTSSLQTSGQVLSEASSKLTTKSPRMPDGTKGFTMGRGKPLSS  437



>ref|XP_010066055.1| PREDICTED: la-related protein 6C isoform X1 [Eucalyptus grandis]
 gb|KCW63827.1| hypothetical protein EUGRSUZ_G01502 [Eucalyptus grandis]
Length=407

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 276/384 (72%), Gaps = 23/384 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP-VSGYFYPYFQYQD-------WIYVGDQ-DPTPFYSNNQNL  384
             FK N QA EFVPRS TQMP +SGY+YP FQ  D       W+Y GDQ +P+ +   + NL
Sbjct  28    FKFNAQAAEFVPRSRTQMPDLSGYYYPCFQLFDGSSAGSEWLYFGDQIEPSSYSIPDINL  87

Query  385   SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKK  564
              P     KN L  ++++K++KQ EY  S MSLL+N+ +AKQ+SKDPEGYVPIS +A+TKK
Sbjct  88    VPSHCP-KNGLSYDLQKKVVKQAEYLFSSMSLLSNDFIAKQVSKDPEGYVPISIIANTKK  146

Query  565   IKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDH  744
             IKSL+++N  Q+LAQAL+SS  L+VSSDGK+V+R+ PFTEK+KE+LQSRT+V ENLP+DH
Sbjct  147   IKSLVTNN--QLLAQALRSSPNLVVSSDGKRVRRRSPFTEKEKEDLQSRTIVVENLPEDH  204

Query  745   SHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKL  924
             S+HN+EKIF+ VGSV+ IRICHPQ+ NSSR  G+ FI NKLHALIE++S E A+ AVEKL
Sbjct  205   SYHNLEKIFSAVGSVRNIRICHPQESNSSRPIGDIFIRNKLHALIEYDSTETAEMAVEKL  264

Query  925   NDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLE  1104
             NDER+WRKGLRV+LLLRR+P+SVLK RK +F+  L++++    + S P D +     +L 
Sbjct  265   NDERDWRKGLRVRLLLRRTPKSVLKNRKFDFDTILDEEEG---LLSDPTDDLHPSNSEL-  320

Query  1105  STETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
               E N EE +    A    G  RG+ +LR +   G G+LA SPQ  ++    S       
Sbjct  321   CLEANAEEYA----AGLKKGWTRGRGKLRGRAQSGHGVLAPSPQAGNTIVVQSETMP---  373

Query  1285  KQASKGPRMPDGTRGFTMGRGKPL  1356
             KQ  KGPRMPDGTRGFTMGRGKP+
Sbjct  374   KQVLKGPRMPDGTRGFTMGRGKPM  397



>ref|XP_010540322.1| PREDICTED: la-related protein 6C [Tarenaya hassleriana]
Length=425

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 209/411 (51%), Positives = 270/411 (66%), Gaps = 60/411 (15%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS----ITQMPVSGYFYPYFQY--------QDWIYVGD------QDPT  357
             FK N QAPEFVPRS      Q+PVSGYF P+FQY         DW++VGD      QDP 
Sbjct  35    FKFNAQAPEFVPRSHMPAAAQVPVSGYFCPFFQYLGGGGAPDSDWVFVGDLSQHHLQDPA  94

Query  358   PFYSNNQNLSPPQTQQKNSLP---DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEG  528
              FY +N  ++P  +    + P   D+++ KI+KQVEYQ +D+S+LANE+++K +SKDPEG
Sbjct  95    AFYVSNPAVNPNPSSSSKNSPLLSDDLRLKIVKQVEYQFTDISVLANESISKHISKDPEG  154

Query  529   YVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQS  708
             YVPIS +ASTKKIK+L S++   +++ AL+SS+KLI+S DGKKVKR+ PFTEK++E+LQS
Sbjct  155   YVPISYIASTKKIKALTSNH--HMVSIALRSSSKLILSEDGKKVKRRSPFTEKNREDLQS  212

Query  709   RTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFE  888
             RTVVAENLPDDHS+ N+EKIF VVG+VK IRICHPQ+ NS RSKG++ +SNK+HALIE++
Sbjct  213   RTVVAENLPDDHSYQNLEKIFGVVGAVKAIRICHPQEFNSPRSKGDFLMSNKIHALIEYD  272

Query  889   SPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAP  1068
             + +IA+KAVEKLNDERNWRKGLRV+LLLR SP+SVLK+R+ +F   L+DDD  P  ES  
Sbjct  273   NTDIAEKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKSRRLDFNEILDDDDGTPTYESGE  332

Query  1069  EDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcsss  1248
             E S ++P   L  ++ N                       R +  G       +   S  
Sbjct  333   ESSQNNPSDSLLESDKN-----------------------RAKGRGRGRGRIQTSYGSGR  369

Query  1249  sssasgqsesPMKQASKG--------------PRMPDGTRGFTMGRGKPLN  1359
                      SP  Q+S G              PRMPDGTRGFTMGRGKP +
Sbjct  370   GIGLGLGLMSPTSQSSNGVFHHESSPKSASKGPRMPDGTRGFTMGRGKPFS  420



>ref|XP_008459218.1| PREDICTED: la-related protein 6C [Cucumis melo]
Length=424

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 283/391 (72%), Gaps = 24/391 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             F+ N QAPEF PR+  QMPV+GYF+PYF +        DW ++GDQ+P  +   N N+  
Sbjct  42    FRFNAQAPEFFPRTQPQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPA-YLIPNPNIQL  100

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
             P    K++  +E++QKI+KQVEYQLSDMSLLANE LAK +SKDP+GYVPIS ++STKK+K
Sbjct  101   PNFS-KHARSEEIQQKIVKQVEYQLSDMSLLANETLAKHISKDPDGYVPISILSSTKKVK  159

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             SL ++N    + QAL+SS++L+VSSDGK+V+RK PFT+KDKEEL +RTVVAENLP++HSH
Sbjct  160   SLSTNNN--FIVQALRSSSRLVVSSDGKRVRRKVPFTDKDKEELLARTVVAENLPENHSH  217

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
             HN+EKIF+VVGSVKTIRICHP + N   SKGE F+SNKLHAL+EFE+ ++A++A+E+LND
Sbjct  218   HNLEKIFSVVGSVKTIRICHPPESNPCCSKGELFVSNKLHALVEFETVDLAERAIEQLND  277

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES-  1107
             ERNWRKGLRV+ L+RRSP+SVLK RKSEF+  L++DD +P   S  E    +PL  +   
Sbjct  278   ERNWRKGLRVRPLVRRSPKSVLKNRKSEFDSVLDEDD-SPSSVSVEE----TPLQNINDL  332

Query  1108  -TETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
               + N EE+S           GRG+ + R +IHG      + P  SS  +S     E+  
Sbjct  333   IVDCNPEENS----TSSKKSWGRGRGKGRGRIHGHLDRSYSLPVTSSLQTSGQVLCEASS  388

Query  1285  KQASKGPRMPDGTRGFTMGRGKPLNTTAAPP  1377
             K  +K PRMPDGT+GFTMGRGKPL  ++ PP
Sbjct  389   KLTTKSPRMPDGTKGFTMGRGKPL--SSKPP  417



>ref|XP_008803782.1| PREDICTED: la-related protein 6C [Phoenix dactylifera]
Length=412

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 206/395 (52%), Positives = 267/395 (68%), Gaps = 46/395 (12%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP-VSGYFYPYFQY---------QDWIYVGDQDPTPFYSNNQN  381
             FK NV APEFVPRS +Q P +SGYFYPY Q+          DWIY  +Q+P  F      
Sbjct  25    FKFNVHAPEFVPRSHSQAPPISGYFYPYLQFFGNGGGGLGPDWIYFAEQEPAHFVPELHG  84

Query  382   LSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTK  561
                  ++  N    +V QKI+KQVEYQ SD +L+A++ L K M+KDPEGYVP+S +AS K
Sbjct  85    KVSGHSKNNN----DVIQKIVKQVEYQFSDTNLVASDFLMKIMNKDPEGYVPMSVIASWK  140

Query  562   KIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDD  741
             KIKSL ++N  Q+L +AL++STKL+VS DGKKV+RKQPFTE+DKEELQ+RTVV ENLP+D
Sbjct  141   KIKSLGTNN--QMLIKALRTSTKLVVSEDGKKVRRKQPFTERDKEELQTRTVVVENLPED  198

Query  742   HSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIADKAVE  918
             +S  N+EKIF+V GSVK IRICHPQ+PNS+R SK +  ISNKLHAL+E+E+ E A+KAVE
Sbjct  199   YSRQNLEKIFSVAGSVKNIRICHPQEPNSARSSKTDVLISNKLHALVEYETVEQAEKAVE  258

Query  919   KLNDERNWrkglrvklllrrSPRSVLKTRKSEFE--GCLEDDDQAPPVESAPEDSVSSPL  1092
             KLNDERNWRKGLRV+ +LRR+PRSV++TR+S+++      +D+Q+PP ++     +   L
Sbjct  259   KLNDERNWRKGLRVRTMLRRTPRSVIRTRRSDYDHFDIFSEDEQSPPSQTVGSPHIGQLL  318

Query  1093  -HQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG------GRGLLaaspqcssss  1251
              H +E  +   ++                  R R ++HG      GRGLL+ SPQ     
Sbjct  319   EHSIEDNQNTAKKG---------------WGRGRAKLHGMVQNHNGRGLLSQSPQPGCLG  363

Query  1252  ssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPL  1356
                +       KQ  +GPRMPDGTRGFTMGRGKPL
Sbjct  364   QPEATS-----KQILQGPRMPDGTRGFTMGRGKPL  393



>ref|XP_010930389.1| PREDICTED: la-related protein 6C [Elaeis guineensis]
Length=412

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 208/394 (53%), Positives = 270/394 (69%), Gaps = 44/394 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQM-PVSGYFYPYFQY---------QDWIYVGDQDPTPFYSNNQN  381
             FK NV APEFVPRS +Q  P+SGYFYPY Q+          DWIY  +Q+P+ F      
Sbjct  25    FKFNVHAPEFVPRSYSQASPISGYFYPYLQFFGNGGGGLGPDWIYFAEQEPSHFVPELHG  84

Query  382   LSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTK  561
                   +  N    +V QKI+KQVEYQ SD +L+A++ L K M+KDPEGYVP+S +AS K
Sbjct  85    KVSGHPKNNN----DVIQKIVKQVEYQFSDTNLVASDFLIKIMNKDPEGYVPMSVIASWK  140

Query  562   KIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDD  741
             KIKSL ++N  Q+L +AL++STKL+VS DGKKV+RKQPFTE+DKEELQSRTVV ENLP+D
Sbjct  141   KIKSLGANN--QMLIKALRTSTKLVVSEDGKKVRRKQPFTERDKEELQSRTVVVENLPED  198

Query  742   HSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIADKAVE  918
             +S  N+EKIF+V GSVK IRICHPQ+PNS++ SK +  ISNKLHAL+E+E+ E A+KAVE
Sbjct  199   YSRQNLEKIFSVAGSVKNIRICHPQEPNSAKSSKTDVLISNKLHALVEYETVEQAEKAVE  258

Query  919   KLNDERNWrkglrvklllrrSPRSVLKTRKSEFE--GCLEDDDQAPPVESAPEDSVSSPL  1092
             KLNDERNWRKGLRV+ + RRSPRSV++TR+S+++    + +D+Q+P  ++         L
Sbjct  259   KLNDERNWRKGLRVRTMSRRSPRSVIRTRRSDYDHFDIVSEDEQSPSSQTV------GSL  312

Query  1093  HQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG------GRGLLaaspqcsssss  1254
             H  +  E N+E++             +G  R R ++HG      GRGLL+ +PQ      
Sbjct  313   HIEQLLEHNIEDN--------QNTTKKGWGRGRAKLHGMVQNHNGRGLLSQTPQPGCLGQ  364

Query  1255  sasgqsesPMKQASKGPRMPDGTRGFTMGRGKPL  1356
             S +       KQ  +GPRMPDGTRGFTMGRGKPL
Sbjct  365   SEASS-----KQMLQGPRMPDGTRGFTMGRGKPL  393



>emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera]
Length=941

 Score =   358 bits (920),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 227/386 (59%), Positives = 283/386 (73%), Gaps = 37/386 (10%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             FK N QAPEFVPRS TQ+P+SGYFYP F          DW+YV DQDP  F SN+    P
Sbjct  34    FKFNAQAPEFVPRSHTQVPISGYFYPCFHLLGGGAGSADWLYVADQDPVHFISNSNGSLP  93

Query  391   PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
                  KN L  +++QKIIKQV   +++  ++                VPIS +AS+KK+K
Sbjct  94    --NSSKNLLTHDIQQKIIKQV-VSINECGIVT---------------VPISVIASSKKVK  135

Query  571   SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
             +L+S+N  Q+LAQAL+SS++L+VSSDGKKV+RK  FTE+DKEELQ+ TVVAENLPDDHSH
Sbjct  136   ALVSNN--QLLAQALRSSSQLVVSSDGKKVRRKHLFTERDKEELQAHTVVAENLPDDHSH  193

Query  751   HNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
              N++KIF+VVGSVK IRICHPQ+ N+SRSKG++FISNKLHAL+E+ES EIA+KAVE LND
Sbjct  194   QNLQKIFSVVGSVKNIRICHPQESNNSRSKGDFFISNKLHALVEYESVEIAEKAVEMLND  253

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLEST  1110
             ERNWRKGLRV++LLRRSP+SVLK R+SEF+G + D+++ P  E + EDS S P +     
Sbjct  254   ERNWRKGLRVRMLLRRSPKSVLKNRRSEFDGIM-DEEEGPHPEFS-EDS-SHPNNTELVI  310

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             E+N EE+S    +KKGW +GRGK R RTQI  GRGLLA SPQ S S+   +       KQ
Sbjct  311   ESNAEENS--SGSKKGWARGRGKPRGRTQITSGRGLLAPSPQSSGSNQFEASA-----KQ  363

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNTTA  1368
              +KGPRMPDGTRGFTMGRGKP++T A
Sbjct  364   ITKGPRMPDGTRGFTMGRGKPISTPA  389



>gb|EYU42655.1| hypothetical protein MIMGU_mgv1a007130mg [Erythranthe guttata]
Length=418

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 211/412 (51%), Positives = 265/412 (64%), Gaps = 60/412 (15%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP----------VSGYFYPYFQYQD-----WIYVGDQD-PTPF  363
             FK NV APEFVP +++Q            ++GYFYP FQ  D     WIYV DQ+   P 
Sbjct  23    FKFNVAAPEFVP-TVSQTAAPPPVPAQVPITGYFYPCFQSIDGGSGSWIYVADQEIAIPL  81

Query  364   YSN--NQNLSPPQTQQKN------------------SLPDEVKQKIIKQVEYQLSDMSLL  483
               +  N  + P Q                       +L DE+KQKIIKQ EY  SDMS+L
Sbjct  82    IQSKINAKVGPAQIAAAAAAATVHHHHNNNQPPKEIALADELKQKIIKQAEYMFSDMSML  141

Query  484   ANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVK  663
             ANE LAK +SKDPEGYVPI+ V++ KK+KSL  +N  Q++AQAL+SS+KL+VS+DGKKVK
Sbjct  142   ANETLAKHVSKDPEGYVPINFVSTLKKLKSLNVNN--QMVAQALRSSSKLVVSNDGKKVK  199

Query  664   RKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SK  840
             RK PFTEK+KEELQ RTV+AENLPDDHSH  IEK+FNVVGS+K+IRIC PQ+ NSSR SK
Sbjct  200   RKHPFTEKEKEELQLRTVIAENLPDDHSHQKIEKMFNVVGSIKSIRICQPQEHNSSRSSK  259

Query  841   GEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFE  1020
             G+  +SNKLHAL+E+E+ E A++A EKLNDERNWRKG+RV+L+L+RSP+SVLK RKSEFE
Sbjct  260   GDIVVSNKLHALVEYENHETAERAAEKLNDERNWRKGMRVRLMLKRSPKSVLKNRKSEFE  319

Query  1021  GCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQI  1200
              CL+DD      + +          +L S+E   +++           +G+     R Q+
Sbjct  320   VCLDDDHHHAHEDGS----------RLSSSENEGDDNPSALKRSWSRNRGKATKTQRPQL  369

Query  1201  HGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPL  1356
              G R L   S    SS +           Q  KGPRMPDGTRGFTMGRGKP+
Sbjct  370   QGTRSLPTPSSHAGSSFAG----------QPVKGPRMPDGTRGFTMGRGKPI  411



>gb|KFK39252.1| hypothetical protein AALP_AA3G220100 [Arabis alpina]
Length=455

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 286/419 (68%), Gaps = 53/419 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQM------PVSGYFYPYFQYQ--------------------DWI  333
             FK N QAPEFVPRS + +      P+SGYFYP FQY                     DWI
Sbjct  39    FKFNAQAPEFVPRSHSTVATPQVSPISGYFYPCFQYNGGCIGGCGGGGGTGVGSQSSDWI  98

Query  334   YVGDQDPT----------PFYSNNQNLSPPQTQQKNSLP-----DEVKQKIIKQVEYQLS  468
             +VG  DPT           ++ +N  +  P  Q  +S       D+++ KI+KQVEYQ +
Sbjct  99    FVGGGDPTQHQHLHDPAAAYFVSNPAVQFPVNQNSSSSSKNLLSDDLRLKIVKQVEYQFT  158

Query  469   DMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSD  648
             DMSLLANE+++K +SKDP+GYVPIS +ASTKKIK+L S++   +++ AL+SS+KL+VS D
Sbjct  159   DMSLLANESISKHISKDPQGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKLVVSED  216

Query  649   GKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNS  828
              KKVKR+ PFT++D+EELQ+RTVVAENLPDDHS+ N+EKIF VVG+VK IRICHP + NS
Sbjct  217   SKKVKRRSPFTDRDREELQARTVVAENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNS  276

Query  829   SRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRK  1008
             SR KG++ +SNK+HALIE+++  IADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R+
Sbjct  277   SRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKNRR  336

Query  1009  SEFEGCLEDDDQAPPVESAPEDSVSSPLHQLE-STETNVEESSgggaakkgwgkgrgkT-  1182
             + F+G L  DD+ P  ES  EDS    LH  E   + +V++++ GG   KG GKGRG++ 
Sbjct  337   N-FDGLLI-DDETPSYESG-EDSPR--LHLTEQQLDNDVDDNNVGGLWGKGRGKGRGRSP  391

Query  1183  RLRTQIHGGR--GLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKP  1353
             R      GGR  G+       S S S    +S SP K A+KGPRMPDGT+GFTMGRGKP
Sbjct  392   RSYAVAGGGRSFGIGLGLSLGSMSPSLGQHESSSP-KTATKGPRMPDGTKGFTMGRGKP  449



>ref|XP_002883162.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 217/421 (52%), Positives = 265/421 (63%), Gaps = 54/421 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYFQYQ-----------------------  324
             FK N QAPEFVPRS T  P      VSGYFYP F Y                        
Sbjct  33    FKFNAQAPEFVPRSHTTAPATQVSPVSGYFYPCFHYNGGCIGGCGGGVCGGGGTGVGTQS  92

Query  325   -DWIYVGDQDPTP-----------FYSNNQNLSPPQTQQKNSLP-----DEVKQKIIKQV  453
              DWIYVG  DPT            F+ +N  +  P  Q  +S       D+++ KI+KQV
Sbjct  93    SDWIYVGGGDPTAQHQHVHDPAAAFFISNPAVQFPANQNSSSSSKNLLSDDLRLKIVKQV  152

Query  454   EYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKL  633
             EYQ +DMSLLANE+++K +SKDPEGYVPIS +ASTKKIK+L S++   +++ AL+SS+KL
Sbjct  153   EYQFTDMSLLANESISKHISKDPEGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKL  210

Query  634   IVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHP  813
             +VS DGKKVKR  PFT++D+EELQ RTVVAENLPDDHS+ N+EKIF VVG+VK IRICHP
Sbjct  211   VVSEDGKKVKRTSPFTDRDREELQGRTVVAENLPDDHSYQNLEKIFGVVGNVKAIRICHP  270

Query  814   QDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSV  993
              + NSSR KG++ +SNK+HALIE+++  IADKAVEKLNDERNWRKGLRV+LLLR SP+SV
Sbjct  271   PESNSSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKSV  330

Query  994   LKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgr  1173
             LK R++ F+G L  DD+ P  ES  EDS    LH  ES   N  + +  G          
Sbjct  331   LKNRRN-FDGILI-DDELPSYESG-EDSPR--LHLTESQLDNDGDDNNVGGLWGKGRGKG  385

Query  1174  gkTRLRT-QIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGK  1350
                  R+  + GG          S    S      S  K A+KGPRMPDGTRGFTMGRGK
Sbjct  386   RGRSPRSYAVGGGGRSFGIGLGVSLGIPSLGSHESSSPKTATKGPRMPDGTRGFTMGRGK  445

Query  1351  P  1353
             P
Sbjct  446   P  446



>ref|XP_004171643.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101217948 
[Cucumis sativus]
Length=429

 Score =   332 bits (852),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 279/390 (72%), Gaps = 24/390 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYPYFQY-------QDWIYVGDQDPTPFYSNNQNLSP  390
             F+ N QAPEF PR+ TQMPV+GYF+PYF +        DW ++GDQ+P  +   N N+  
Sbjct  42    FRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPA-YLIPNPNIQL  100

Query  391   PQTQQKNSLPDEVKQKIIK------QVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVA  552
             P    K++  +E++QK I       QVEYQLSDMSLLANE LAK +SKDP+GYVPIS ++
Sbjct  101   PNFS-KHARSEEIQQKSILWMISILQVEYQLSDMSLLANETLAKHISKDPDGYVPISILS  159

Query  553   STKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENL  732
             STKK KSL ++N    + QAL+SS++L+VSSDGK+V+RK PFT+KDKEEL +RTVVAENL
Sbjct  160   STKKXKSLSTNNN--FIVQALRSSSRLVVSSDGKRVRRKVPFTDKDKEELLARTVVAENL  217

Query  733   PDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKA  912
             P++HSHHN+EKIF+VVGSVKTIRICHP + N   SKGE F+SNKLHAL+EFE+ E+A++A
Sbjct  218   PENHSHHNLEKIFSVVGSVKTIRICHPPESNPCCSKGELFVSNKLHALVEFETAELAERA  277

Query  913   VEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPL  1092
             +E+LNDERNWRKGLRV+ L+RRSP+SVLK RKSEF+  L++DD   PV         SPL
Sbjct  278   IEQLNDERNWRKGLRVRPLVRRSPKSVLKNRKSEFDSVLDEDDSPSPVSVE-----ESPL  332

Query  1093  HQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqs  1272
               +   + NV+ +S   +       GRG+ + R +IHG      + P  SS  +S    S
Sbjct  333   QNI--NDLNVDCNSEENSTSLKKSWGRGRGKGRGRIHGNLDRSYSLPVTSSLQTSGQVLS  390

Query  1273  esPMKQASKGPRMPDGTRGFTMGRGKPLNT  1362
             E+  K  +K PRMPDGT+GFTMGRGKPL++
Sbjct  391   EASSKLTTKSPRMPDGTKGFTMGRGKPLSS  420



>ref|XP_010691018.1| PREDICTED: la-related protein 6C [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 214/434 (49%), Positives = 281/434 (65%), Gaps = 70/434 (16%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSIT--------QMPVS-GYFYPYFQY------------QDWIYVGDQ  348
             FK N QA EFVPRS +        QMP+S GYFYP  Q+             DW YV   
Sbjct  51    FKFNAQAAEFVPRSYSCNSSYTNHQMPLSTGYFYPCVQFLQDGDHVLGSHSADWFYV---  107

Query  349   DPTPFYSNNQ-------------------NLSPPQTQQ---------------KNSLPDE  426
             +P+P  S +                    ++SP QT +               +NS+ D+
Sbjct  108   NPSPTTSTHNNNSNSNSNSSSNNNNVTNNDVSPIQTTRIIISNSPSQSHPNSPRNSVTDD  167

Query  427   VKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLA  606
             ++QKIIKQVEY  SD+SL+AN+ ++K +SKDPEGYVPI  +AS KKIK+L++ +   +L 
Sbjct  168   LQQKIIKQVEYLFSDLSLMANDTMSKHVSKDPEGYVPIPVIASMKKIKALVTDH--HLLV  225

Query  607   QALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGS  786
             QAL+SSTKL++S D KKVKR+ PFTE  ++ELQ RTV+ ENLPDDHS+ N+EKIF+VVGS
Sbjct  226   QALRSSTKLVISKDNKKVKRRSPFTESYRDELQCRTVMVENLPDDHSYQNLEKIFSVVGS  285

Query  787   VKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvkl  966
             VK IR+CHP + N SRSK +  ISNKLHAL+E+E+ E A++A EKLNDERNWRKG+RV++
Sbjct  286   VKAIRLCHPPEANPSRSKNDVIISNKLHALVEYENVETAERAAEKLNDERNWRKGMRVRV  345

Query  967   llrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLE-STETNV---EESS  1134
             +LRRSP+SVLKTRKS+F+  L DDD+ P    +P+++ SS L+  E  TE NV    E +
Sbjct  346   MLRRSPKSVLKTRKSDFD-MLTDDDE-PSYGDSPKET-SSQLNGAEFVTENNVAQQAEET  402

Query  1135  gggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMP  1314
              GG  + G G+ R KT+ R Q H  RGLL++      +    +       KQ +KGPRMP
Sbjct  403   SGGLKRLGSGRMRVKTKGRAQCHNDRGLLSSPTHSIGAVQCDTLLLT---KQITKGPRMP  459

Query  1315  DGTRGFTMGRGKPL  1356
             DGTRGFTMGRGKP+
Sbjct  460   DGTRGFTMGRGKPI  473



>ref|NP_188540.1| RNA-binding protein [Arabidopsis thaliana]
 sp|Q9LHL3.1|LRP6C_ARATH RecName: Full=La-related protein 6C; Short=AtLARP6c [Arabidopsis 
thaliana]
 dbj|BAB02607.1| RNA-binding protein-like [Arabidopsis thaliana]
 gb|AEE76193.1| RNA-binding protein [Arabidopsis thaliana]
Length=455

 Score =   330 bits (847),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 217/421 (52%), Positives = 265/421 (63%), Gaps = 54/421 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYFQYQ-----------------------  324
             FK N QAPEFVPRS T  P      VSGYFYP F Y                        
Sbjct  33    FKFNAQAPEFVPRSHTTAPAPQVSPVSGYFYPCFHYNGGCIGGCGGGVCGGGGTGVGTQS  92

Query  325   -DWIYVGDQDPTP-----------FYSNNQNLSPP-----QTQQKNSLPDEVKQKIIKQV  453
              DWIYVG  DPT            FY +N  +  P      +  KN L D+++ KI+KQV
Sbjct  93    SDWIYVGGGDPTAQHQHVHDPAAAFYISNPAVQFPASQNSSSSSKNLLSDDLRLKIVKQV  152

Query  454   EYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKL  633
             EYQ +DMSLLANE+++K +SKDPEGYVP+S +ASTKKIK+L S++   +++ AL+SS+KL
Sbjct  153   EYQFTDMSLLANESISKHISKDPEGYVPVSYIASTKKIKALTSNH--HLVSLALRSSSKL  210

Query  634   IVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHP  813
             +VS DGKKVKR   FT++D+EELQ RTVVAENLPDDHS+ N+EKIF VVG+VK IRICHP
Sbjct  211   VVSEDGKKVKRTSQFTDRDREELQGRTVVAENLPDDHSYQNLEKIFGVVGNVKAIRICHP  270

Query  814   QDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSV  993
              + NSSR KG++ +SNK+HALIE+++  IADKAVEKLNDERNWRKGLRV+LLLR SP+SV
Sbjct  271   PESNSSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKSV  330

Query  994   LKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgr  1173
             LK R++ F+G L  DD+ P  ES  EDS    LH  ES   N  + +  G          
Sbjct  331   LKNRRN-FDGILI-DDELPSYESG-EDSPR--LHLTESQLDNDGDDNNVGGLWGKGRGKG  385

Query  1174  gkTRLRT-QIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGK  1350
                  R+  + GG          S    S      S  K A+KGPRMPDGTRGFTMGRGK
Sbjct  386   RGRSPRSYAVGGGGRSFGIGLGVSLGIPSLGSHESSSPKTATKGPRMPDGTRGFTMGRGK  445

Query  1351  P  1353
             P
Sbjct  446   P  446



>emb|CDX99268.1| BnaC05g33830D [Brassica napus]
Length=444

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 264/414 (64%), Gaps = 45/414 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYFQYQD------------WIYVGDQDPT  357
             FK N +APEFVP+S   +P      +SGYFYP F Y D            W +VG+ DP 
Sbjct  38    FKFNAEAPEFVPQSRAAVPTPQVSPISGYFYPCFHYSDGGGTAVGSQASDWFFVGEGDPA  97

Query  358   ----------PFYSNNQNLSPPQTQQKNSLPDEVKQ----KIIKQVEYQLSDMSLLANEN  495
                        FY  +  +  P  Q  +     +      KI+KQVEYQ +DMSLLANE+
Sbjct  98    QHPHVHDPAAAFYVPSPAVQFPVNQNSSPSSSLLSDDLRLKIVKQVEYQFTDMSLLANES  157

Query  496   LAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQP  675
             ++K M+KDPEGYVPIS +ASTKKIK+L S++   +++ AL+SS+KL+VS D KKVKRK P
Sbjct  158   ISKHMNKDPEGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKLVVSEDNKKVKRKVP  215

Query  676   FTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFI  855
             FT++D+E+LQ RTVVAENLPDDHS+ N+EKIF VVG+VK IRICHP + NSSR KG++ +
Sbjct  216   FTDRDREDLQGRTVVAENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNSSRPKGDFLM  275

Query  856   SNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLED  1035
             SNK+HALIE++   +ADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R++ F+G L D
Sbjct  276   SNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKHRRN-FDGILID  334

Query  1036  DDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGR-  1212
             D+   P ES  EDS    LH  E    N  + +  G               R+ + GG  
Sbjct  335   DES--PYESG-EDSPR--LHLTEHQLDNEGDENTLGGLWGKGRGKGRGRSPRSYVVGGGE  389

Query  1213  ---GLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTT  1365
                G+         S S     S SP K A+KGPRMPDGTRGFTMGRGKP+N +
Sbjct  390   RSFGIGMGLSLGPMSPSLGLHGSSSP-KTATKGPRMPDGTRGFTMGRGKPVNLS  442



>ref|XP_009145827.1| PREDICTED: la-related protein 6C-like [Brassica rapa]
 emb|CDX92302.1| BnaA05g21050D [Brassica napus]
Length=443

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 208/414 (50%), Positives = 263/414 (64%), Gaps = 45/414 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQM------PVSGYFYPYFQYQD------------WIYVGDQDPT  357
             FK N +APEFVP+S   +      P+SGYFYP F Y D            W +VG  DP 
Sbjct  37    FKFNAEAPEFVPQSRAAVATPQVSPISGYFYPCFHYSDGGGTAVGTQASDWFFVGGGDPA  96

Query  358   ----------PFYSNNQNLSPPQTQQKNSLPDEVKQ----KIIKQVEYQLSDMSLLANEN  495
                        +Y  +  +  P  Q  +     +      KI+KQVEYQ +DMSLLANE+
Sbjct  97    QHPHVHDPAAAYYVPSPAVQFPVNQNSSPSSSLLSDDLRLKIVKQVEYQFTDMSLLANES  156

Query  496   LAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQP  675
             ++K M+KDPEGYVPIS +ASTKKIK+L S++   +++ AL+SS+KL+VS D KKVKRK P
Sbjct  157   ISKHMNKDPEGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKLVVSEDNKKVKRKVP  214

Query  676   FTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFI  855
             FT++D+E+LQ RTVVAENLPDDHS+ N+EKIF VVG+VK IRICHP + NSSR KG++ +
Sbjct  215   FTDRDREDLQGRTVVAENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNSSRPKGDFLM  274

Query  856   SNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLED  1035
             SNK+HALIE++   +ADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R++ F+G L D
Sbjct  275   SNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKHRRN-FDGILID  333

Query  1036  DDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGR-  1212
             D+   P ES  EDS    LH  E    N  + +  G               R+ + GG  
Sbjct  334   DES--PYESG-EDSPR--LHLTEHQLDNEGDENTLGGLWGKGRGKGRGRSPRSYVVGGGE  388

Query  1213  ---GLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTT  1365
                G+         S S     S SP K A+KGPRMPDGTRGFTMGRGKP+N +
Sbjct  389   RSFGIGMGLSLGPMSPSLGLHGSSSP-KTATKGPRMPDGTRGFTMGRGKPVNLS  441



>ref|XP_006406537.1| hypothetical protein EUTSA_v10020682mg [Eutrema salsugineum]
 gb|ESQ47990.1| hypothetical protein EUTSA_v10020682mg [Eutrema salsugineum]
Length=463

 Score =   325 bits (833),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 210/426 (49%), Positives = 263/426 (62%), Gaps = 59/426 (14%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQM-------PVSGYFYPYFQYQ----------------------  324
             FK N QAPEFVPRS T         P+SGYFYP F Y                       
Sbjct  36    FKFNAQAPEFVPRSHTTTAPTPQVSPISGYFYPCFHYNGGCIGGCGGGVCGGGGGTGVGS  95

Query  325   ---DWIYVGDQDPT----------PFYSNNQNLSPPQTQQKNSLP-----DEVKQKIIKQ  450
                DWI+VG  DP+           FY +N  +  P  Q  +S       D+++ KI+KQ
Sbjct  96    QSSDWIFVGGGDPSQHQHLHDPAAAFYISNPAVQFPANQNSSSSSKNLLSDDLRLKIVKQ  155

Query  451   VEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTK  630
             VEYQ +DMSLLANE+++K +SKDPEGYVPIS +ASTKKIK+L S++   ++  AL+SS+K
Sbjct  156   VEYQFTDMSLLANESISKHISKDPEGYVPISYIASTKKIKALTSNH--HLVTLALRSSSK  213

Query  631   LIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICH  810
             L+VS D KKVKRK PFT++D+EELQ+RTVVAENLPDDHS+ N+EKIF V+G+VK IRICH
Sbjct  214   LVVSEDSKKVKRKIPFTDRDREELQARTVVAENLPDDHSYQNLEKIFGVIGNVKAIRICH  273

Query  811   PQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRS  990
             P +  SSR KG++ +SNK+HALIE+++  IADKAVEKLNDERNWRKGLRV+LLLR SP+S
Sbjct  274   PPESTSSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKS  333

Query  991   VLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkg  1170
             VLK R++ F+G L  DD+ P  ES  EDS    LH  E    N  + +            
Sbjct  334   VLKNRRN-FDGILI-DDEIPSYESG-EDSPR--LHLTEQQLDNDGDDNTVSGLWGKGRGK  388

Query  1171  rgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQAS-----KGPRMPDGTRGFT  1335
                   R+   GG     +       S  +   S  P + +S     KGPRMPDGTRGFT
Sbjct  389   GRGRSPRSYAVGGGAGGRSFGIGLGLSLGSMSPSLGPHESSSPKTATKGPRMPDGTRGFT  448

Query  1336  MGRGKP  1353
             MGRGKP
Sbjct  449   MGRGKP  454



>ref|XP_006299563.1| hypothetical protein CARUB_v10015738mg [Capsella rubella]
 gb|EOA32461.1| hypothetical protein CARUB_v10015738mg [Capsella rubella]
Length=456

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 216/425 (51%), Positives = 268/425 (63%), Gaps = 51/425 (12%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYFQYQ-------------------DWIY  336
             FK N QAPEFVPRS T  P      +SGYFYP F Y                    DWIY
Sbjct  36    FKFNAQAPEFVPRSHTTAPAPQVSPISGYFYPCFHYNGGCIGGCGGGGTNVGTPSSDWIY  95

Query  337   VGDQDPT-----------PFYSNNQNLSPPQTQ-------QKNSLPDEVKQKIIKQVEYQ  462
             VG  DPT            FY  +  +  P  Q        KN L D+++ KI+KQVEYQ
Sbjct  96    VGGGDPTGQHQHVHDPAAAFYIPSPAVQFPANQTSSSSSSSKNLLSDDLRLKIVKQVEYQ  155

Query  463   LSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVS  642
              +DMSLLANE+++K +SKDPEGYVPIS +ASTKKIK+L S++   +++ +L+SS+KL+VS
Sbjct  156   FTDMSLLANESISKHISKDPEGYVPISYIASTKKIKALTSNH--HLVSLSLRSSSKLVVS  213

Query  643   SDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDP  822
              DGKKVKR   FT++D+EELQ RTVVAENLPDDHS+ N+EKIF V+G+VK IRICHP + 
Sbjct  214   EDGKKVKRTSQFTDRDREELQGRTVVAENLPDDHSYQNLEKIFGVIGNVKAIRICHPPES  273

Query  823   NSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKT  1002
             NSSR KG++ +SNK+HALIE+++  IADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK 
Sbjct  274   NSSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKN  333

Query  1003  RKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkT  1182
             R++ F+G L  DD+ P  ES  EDS    LH  ES   N  + +  G             
Sbjct  334   RRN-FDGILI-DDELPSYESG-EDSPR--LHLTESQLDNDGDDNNVGGLWGKGRGKGRGR  388

Query  1183  RLRT-QIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLN  1359
               R+  + GG          S    S      S  K A+KGPRMPDGTRGFTMGRGKP +
Sbjct  389   SPRSYAVGGGGRSFGIGLGVSLGIPSLGSHESSSPKTATKGPRMPDGTRGFTMGRGKPSS  448

Query  1360  TTAAP  1374
              + +P
Sbjct  449   ISLSP  453



>ref|XP_010466043.1| PREDICTED: la-related protein 6C-like [Camelina sativa]
Length=456

 Score =   313 bits (803),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 185/338 (55%), Positives = 234/338 (69%), Gaps = 50/338 (15%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYFQYQ--------------------DWI  333
             FK N QAPEFVPRS T +P      +SGYFYP F Y                     DWI
Sbjct  36    FKFNAQAPEFVPRSHTTVPAPQVSPISGYFYPCFHYNGGCIGGCGAAGGTGVGAQSSDWI  95

Query  334   YVGDQDPTP-----------FYSNNQNLSPPQTQQ-----KNSLPDEVKQKIIKQVEYQL  465
             YVG  DPT            FY  +  +  P  Q      KN L D+++ KI+KQVEYQ 
Sbjct  96    YVGGGDPTAQHQHVHDPAAAFYIPSPAVQFPVNQSSSSSSKNLLSDDLRLKIVKQVEYQF  155

Query  466   SDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSS  645
             +DMSLLANE+++K +SKD EGYVPIS +ASTKKIK+L S++   +++ AL+SS+KL+VS 
Sbjct  156   TDMSLLANESISKHISKDIEGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKLVVSE  213

Query  646   DGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPN  825
             DGKKVKR  PFTE+D+EELQ RTVVAENLPDDHS+ N+EKIF V+G+VK IRICHP + N
Sbjct  214   DGKKVKRTSPFTERDREELQGRTVVAENLPDDHSYQNLEKIFGVIGNVKAIRICHPPESN  273

Query  826   SSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTR  1005
             SSR KG++ +SNK+HALIE+++  IA++AVEKLNDERNWRKGLRV+LLLR SP+SVLK+R
Sbjct  274   SSRPKGDFLMSNKIHALIEYDNTVIAERAVEKLNDERNWRKGLRVRLLLRCSPKSVLKSR  333

Query  1006  KSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETN  1119
             ++ F+G L  DD+ P  ES  ED   SP H L  ++ +
Sbjct  334   RN-FDGILI-DDELPSYESG-ED---SPRHHLTESQLD  365


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1285  KQASKGPRMPDGTRGFTMGRGKPLNTTAAP  1374
             K A+KGPRMPDGTRGFTMGRGKP + + +P
Sbjct  424   KTATKGPRMPDGTRGFTMGRGKPSSISLSP  453



>ref|XP_009398953.1| PREDICTED: la-related protein 6C [Musa acuminata subsp. malaccensis]
Length=418

 Score =   311 bits (798),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 197/399 (49%), Positives = 255/399 (64%), Gaps = 50/399 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP---VSGYFYPYFQY-----------QDWIYVGDQDPTPFYS  369
             FK NV APEFVPRS  Q      +G F PY Q+            +W Y  +Q+P  F  
Sbjct  29    FKFNVHAPEFVPRSQLQAAPALSAGCFCPYLQFFGNGGGGAALGPEWFYFTEQEPVHFMP  88

Query  370   NNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAV  549
             +        ++  +    ++ QKI+KQVEYQ SD +L+AN+ L K M+KDPEGYVP+S V
Sbjct  89    DFHGKIAGHSKSNS----DMIQKIVKQVEYQFSDTNLVANDFLMKIMNKDPEGYVPMSVV  144

Query  550   ASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAEN  729
             AS KKIK L ++N   +LA+AL++STKL++S DGKK+KRKQ FTE+DKEELQSRTVV EN
Sbjct  145   ASWKKIKCLGANN--HMLAKALRTSTKLVLSEDGKKIKRKQVFTERDKEELQSRTVVVEN  202

Query  730   LPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS-KGEYFISNKLHALIEFESPEIAD  906
             LP+D+S  N+EK+F+VVGSVK IRICHPQ+PNS+RS K +  ISNKLHAL+E+E+ E A+
Sbjct  203   LPEDYSRQNLEKMFSVVGSVKNIRICHPQEPNSARSTKSDLLISNKLHALVEYETTEQAE  262

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSS  1086
             KAVEKLNDERNWRKGLRV+ +LR SP+SV+  R + FE    +DDQ+P  ++     +  
Sbjct  263   KAVEKLNDERNWRKGLRVRTMLRCSPKSVI--RGNHFE-LYSEDDQSPSSQTLGSPRIEQ  319

Query  1087  PL-HQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG-------GRGLLaaspqcs  1242
              L H  E  ++   ++                 R R + HG       GRGLL  +PQ  
Sbjct  320   LLDHNNEDNQSGPRKA---------------WGRGRVKPHGLLAPNLSGRGLLTQAPQIG  364

Query  1243  sssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLN  1359
              +       S    KQ  +GPRMPDGTRGFTMGRGKPL+
Sbjct  365   GALGHGGEASS---KQTPQGPRMPDGTRGFTMGRGKPLS  400



>ref|XP_010507427.1| PREDICTED: la-related protein 6C [Camelina sativa]
Length=455

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 232/338 (69%), Gaps = 50/338 (15%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYFQYQ--------------------DWI  333
             FK N QAPEFVPRS T  P      +SGYFYP F Y                     DWI
Sbjct  36    FKFNAQAPEFVPRSHTTAPAPQVSPISGYFYPCFHYNGGCIGGCGGGGGTGVGAQSSDWI  95

Query  334   YVGDQDPTP-----------FYSNNQNLSPPQTQQKNSLP-----DEVKQKIIKQVEYQL  465
             YVG  DPT            FY  N  +  P  Q  +S       D+++ KI+KQVEYQ 
Sbjct  96    YVGGGDPTAQHQHVHDPAAAFYIPNPAVQFPVNQNSSSSSKNLLSDDLRLKIVKQVEYQF  155

Query  466   SDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSS  645
             +DMSLLANE+++K +SKD EGYVPIS +ASTKKIK+L S++   +++ AL+SS+KL+VS 
Sbjct  156   TDMSLLANESISKHISKDIEGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKLVVSE  213

Query  646   DGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPN  825
             DGKKVKR  PFTE+D+EELQ RTVVAENLPDDHS+ N+EKIF V+G+VK IRICHP + N
Sbjct  214   DGKKVKRTSPFTERDREELQGRTVVAENLPDDHSYQNLEKIFGVIGNVKAIRICHPPESN  273

Query  826   SSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTR  1005
             SSR KG++ +SNK+HALIE+++  IADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK+R
Sbjct  274   SSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKSR  333

Query  1006  KSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETN  1119
             ++ F+G L  DD+ P  ES  ED   SP H L  ++ +
Sbjct  334   RN-FDGILI-DDELPSYESG-ED---SPRHHLTESQLD  365


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1285  KQASKGPRMPDGTRGFTMGRGKPLNTTAAP  1374
             K A+KGPRMPDGTRGFTMGRGKP + + +P
Sbjct  423   KTATKGPRMPDGTRGFTMGRGKPSSISLSP  452



>ref|XP_009408806.1| PREDICTED: la-related protein 6C-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 196/392 (50%), Positives = 258/392 (66%), Gaps = 33/392 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQM--PVSGYFYPYFQYQD-----------WIYVGDQDPTPFYSN  372
             FKLNV APEFVPRS  Q   P+SG FYPY  + +           W Y  +Q+P  F  +
Sbjct  33    FKLNVHAPEFVPRSQLQAVPPLSGCFYPYLPFFENGCGGSALGPGWFYFAEQEPIHFIPD  92

Query  373   NQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVA  552
                     ++  N    +V QKI+KQVEYQ SD +L+AN+ L K M+KDP+G+VP+S VA
Sbjct  93    FHGKVAGHSKDSN----DVIQKIVKQVEYQFSDTNLVANDFLMKIMNKDPQGFVPMSVVA  148

Query  553   STKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENL  732
             S KKIKSL +++   +L +AL +STKL +S DGKK++RKQ FTE+DKEELQSRTVV ENL
Sbjct  149   SWKKIKSLGANH--HMLIKALGTSTKLALSEDGKKIRRKQLFTERDKEELQSRTVVVENL  206

Query  733   PDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS-RSKGEYFISNKLHALIEFESPEIADK  909
             P+D+S  N+ K+F+VVGSVK IRICHPQ+PNS+  SK +  I+NKLHAL+E+ES E A+K
Sbjct  207   PEDYSRQNLGKLFSVVGSVKNIRICHPQEPNSATSSKSDVLINNKLHALVEYESTEQAEK  266

Query  910   AVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFE--GCLEDDDQAPPVESAPEDSVS  1083
             AVEKLNDERNWRKGLRV+ +LR SP+SV++++K +F+      +DDQ+P   S+P  ++ 
Sbjct  267   AVEKLNDERNWRKGLRVRTMLRCSPKSVIRSKKLDFDHFDLYAEDDQSP---SSP--TLG  321

Query  1084  SPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssas  1263
             SP  ++E    +  E +  G+ K           L  Q H   GLL  SP    +     
Sbjct  322   SP--RIEHLLDHSTEDNQSGSRKGRGRGRAKSHGLLLQSHSESGLLPHSPHSGGALGHGE  379

Query  1264  gqsesPMKQASKGPRMPDGTRGFTMGRGKPLN  1359
               S    KQ+ +GPRMPDGTRGF MGRGKPL+
Sbjct  380   ASS----KQSPQGPRMPDGTRGFAMGRGKPLS  407



>ref|XP_010066056.1| PREDICTED: la-related protein 6C isoform X2 [Eucalyptus grandis]
Length=365

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 193/246 (78%), Gaps = 12/246 (5%)
 Frame = +1

Query  232  FKLNVQAPEFVPRSITQMP-VSGYFYPYFQYQD-------WIYVGDQ-DPTPFYSNNQNL  384
            FK N QA EFVPRS TQMP +SGY+YP FQ  D       W+Y GDQ +P+ +   + NL
Sbjct  28   FKFNAQAAEFVPRSRTQMPDLSGYYYPCFQLFDGSSAGSEWLYFGDQIEPSSYSIPDINL  87

Query  385  SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKK  564
             P     KN L  ++++K++KQ EY  S MSLL+N+ +AKQ+SKDPEGYVPIS +A+TKK
Sbjct  88   VPSHCP-KNGLSYDLQKKVVKQAEYLFSSMSLLSNDFIAKQVSKDPEGYVPISIIANTKK  146

Query  565  IKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDH  744
            IKSL+++N  Q+LAQAL+SS  L+VSSDGK+V+R+ PFTEK+KE+LQSRT+V ENLP+DH
Sbjct  147  IKSLVTNN--QLLAQALRSSPNLVVSSDGKRVRRRSPFTEKEKEDLQSRTIVVENLPEDH  204

Query  745  SHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKL  924
            S+HN+EKIF+ VGSV+ IRICHPQ+ NSSR  G+ FI NKLHALIE++S E A+ AVEKL
Sbjct  205  SYHNLEKIFSAVGSVRNIRICHPQESNSSRPIGDIFIRNKLHALIEYDSTETAEMAVEKL  264

Query  925  NDERNW  942
            NDER+W
Sbjct  265  NDERDW  270


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  1285  KQASKGPRMPDGTRGFTMGRGKPL  1356
             KQ  KGPRMPDGTRGFTMGRGKP+
Sbjct  332   KQVLKGPRMPDGTRGFTMGRGKPM  355



>ref|XP_011088295.1| PREDICTED: la-related protein 6C [Sesamum indicum]
Length=365

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 189/387 (49%), Positives = 248/387 (64%), Gaps = 48/387 (12%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSI--TQMPVSGYFYPYFQYQD------WIYVGDQDPTPFYSNNQNLS  387
             FK N  APEFVPRS   TQ+PV+ Y YPY  Y D      WIYV DQ+ T F   + NL+
Sbjct  11    FKFNAGAPEFVPRSQAQTQLPVTSYLYPYVPYVDGISCGSWIYVADQETT-FPVVDPNLA  69

Query  388   PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
                        DE+ Q IIKQ EY  SDMS+LAN++ A+ ++K+ +G+VP+  V++  K+
Sbjct  70    SDDND------DELNQIIIKQAEYMFSDMSILANDSFAEYVNKEHQGFVPMDFVSTANKL  123

Query  568   KSLLSSNTTQVLAQALQSSTK---LIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPD  738
              SL  +  TQ +A+AL+SS     L+VS +GKKV+RKQ  T+K+KE++Q RTVV ENLPD
Sbjct  124   NSL--NVDTQTVARALRSSASSPGLVVSDNGKKVRRKQALTDKEKEDIQLRTVVVENLPD  181

Query  739   DHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIADKAV  915
             DHSH NIEK+F+VVGS+K+IRIC PQ+ N+ R SKG+  ISNKLHAL+E+E+ E A+KA 
Sbjct  182   DHSHENIEKLFSVVGSIKSIRICQPQESNTCRSSKGDLVISNKLHALVEYENSEAAEKAA  241

Query  916   EKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLH  1095
             EKLNDERNWRKG+RV+++L+RSP+SVL++RKS+F+    DDDQ P  E A   S ++ L 
Sbjct  242   EKLNDERNWRKGMRVRVMLKRSPKSVLRSRKSDFD-MYSDDDQGPSHEDA---SRANSLK  297

Query  1096  QLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqse  1275
               E+ E  V                     L+      RG    S     + SS    + 
Sbjct  298   PAEAGENPVG--------------------LKRSWSRNRGKPRHSVAIPCAVSSNCPAAG  337

Query  1276  sPMKQASKGPRMPDGTRGFTMGRGKPL  1356
              P    +KGPRMPDGTRGF+MGRGKPL
Sbjct  338   KP---TAKGPRMPDGTRGFSMGRGKPL  361



>ref|XP_010487835.1| PREDICTED: la-related protein 6C [Camelina sativa]
Length=449

 Score =   302 bits (773),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 229/332 (69%), Gaps = 44/332 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMP------VSGYFYPYF--------------QYQDWIYVGDQD  351
             FK N QAPEFVPRS T  P      +SGYFYP                Q  DWIYVG  D
Sbjct  36    FKFNAQAPEFVPRSHTTAPAPQVSPISGYFYPCCIGGCGGAGGTGVGAQSSDWIYVGGGD  95

Query  352   PTP-----------FYSNNQNLSPPQTQQKNSLP-----DEVKQKIIKQVEYQLSDMSLL  483
             PT            FY  N  +  P  Q  +S       D+++ KI+KQVEYQ +DMSLL
Sbjct  96    PTAQHQHVHDPAAAFYIPNPAVQFPVNQNSSSSSKNLLSDDLRLKIVKQVEYQFTDMSLL  155

Query  484   ANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVK  663
             ANE+++K +SKD EGYVPIS +ASTKKIK+L S++   +++ AL+SS+KL+VS DGKKVK
Sbjct  156   ANESISKHISKDIEGYVPISYIASTKKIKALTSNH--HLVSLALRSSSKLVVSEDGKKVK  213

Query  664   RKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKG  843
             R   FT++D+EELQ RTVVAENLPDDHS+ N+EKIF V+G+VK IRICHP + NSSR KG
Sbjct  214   RTSTFTDRDREELQGRTVVAENLPDDHSYQNLEKIFGVIGNVKAIRICHPPESNSSRPKG  273

Query  844   EYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEG  1023
             ++ +SNK+HALIE+++  IADKAVEKLNDER+WRKGLRV+LLLR SP+SVLK R++ F+G
Sbjct  274   DFLMSNKIHALIEYDNTVIADKAVEKLNDERDWRKGLRVRLLLRCSPKSVLKNRRN-FDG  332

Query  1024  CLEDDDQAPPVESAPEDSVSSPLHQLESTETN  1119
              L  DD+ P  ES  ED   SP H L  ++ +
Sbjct  333   ILI-DDELPSYESG-ED---SPRHHLTESQLD  359


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  1285  KQASKGPRMPDGTRGFTMGRGKPLNTTAAP  1374
             K A+KGPRMPDGTRGFTMGRGKP + + +P
Sbjct  417   KTATKGPRMPDGTRGFTMGRGKPSSISLSP  446



>dbj|BAK04171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 262/423 (62%), Gaps = 54/423 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS----GYFYPYFQYQ---DWIYVGDQDPTPFYSNNQNLSP  390
             FK NV APEFVP S T  P+S    GY+ P+ Q Q   DW ++ D +P  F  +  +   
Sbjct  38    FKFNVHAPEFVPMSPTATPMSAPAGGYYSPFLQMQPAPDWSFLHDHEPVFFMPDFAHAKF  97

Query  391   PQTQQKNSLPD---------EVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPIS  543
                   ++            +V QKI+KQVEYQ SD++L+ANE L K M+KD EGYVP+S
Sbjct  98    AAAAAASNSAQAKGGGGGSADVAQKIVKQVEYQFSDINLVANEFLLKIMNKDSEGYVPLS  157

Query  544   AVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVA  723
              ++S KKIKSL ++N  Q+L +AL++STKLIVS DGKKV+R+QPFTEK KEELQSR ++A
Sbjct  158   VISSWKKIKSLGATN--QMLVKALRTSTKLIVSDDGKKVRRRQPFTEKHKEELQSRMIIA  215

Query  724   ENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEI  900
             ENLP+D S +++EK+F+VVGSVK I+ICHPQ+P+S+R SK +  +SNK+HAL+E+E+ + 
Sbjct  216   ENLPEDSSRNSLEKVFSVVGSVKNIKICHPQEPSSARASKSDTLVSNKMHALVEYETSQQ  275

Query  901   ADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSV  1080
             A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV++ ++ +F+     DD++P  + + +   
Sbjct  276   AEKAVEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRPDFDHYAGSDDESPHSQVSSDSPT  335

Query  1081  SSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIH------------GGRGLLa  1224
             S  +H  E+   + +  +            +G  R R ++H            G  G   
Sbjct  336   SEAIHSPEAHPEDHQSGA-----------KKGWARGRGKLHVVAPHSPQSAPAGAVGHFD  384

Query  1225  aspqcssssssasgqsesPMK------QASKGPRMPDGTRGFTMGRGKP------LNTTA  1368
              S    +S        +   K      Q  +GPRMPDGTRGFTMGRGKP        T A
Sbjct  385   PSSPRQASQKCPLSPRQVSQKCPFSPRQPPQGPRMPDGTRGFTMGRGKPAASSVAARTVA  444

Query  1369  APP  1377
             APP
Sbjct  445   APP  447



>gb|AAF00075.2|AF094825_1 RNA-binding protein homolog [Brassica napus]
Length=367

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 218/320 (68%), Gaps = 47/320 (15%)
 Frame = +1

Query  241   NVQAPEFVPRSITQM------PVSGYFYPYFQYQ--------------------DWIYVG  342
             N QAPEFVPRS          P+SGYFYP F Y                     DWI+VG
Sbjct  44    NAQAPEFVPRSHATALTPQVSPISGYFYPCFHYNELSIGGCSGGGGVTGGSQSSDWIFVG  103

Query  343   DQDPT----------PFYSNNQNLSPPQTQQKNSLPDEV-----KQKIIKQVEYQLSDMS  477
               DP            FY +N  +  P  Q  +S    +     + KI+KQVEYQ +DMS
Sbjct  104   GGDPVHHQNIHDPTAAFYVSNPVVQFPANQNLSSSSKSLLSDDLRLKIVKQVEYQFTDMS  163

Query  478   LLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKK  657
             LLANE+++K ++KDPEGYVPIS +ASTKKIK+L S +   ++A AL+SS+KL+VS D KK
Sbjct  164   LLANESISKHINKDPEGYVPISYIASTKKIKALTSHH--HLVALALRSSSKLVVSEDNKK  221

Query  658   VKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS  837
             V+RK PFT++D+EELQ RTVV ENLPDDHS+ N+EKIF VVG+VK IRICHP + N+SR 
Sbjct  222   VRRKIPFTDRDREELQGRTVVVENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNTSRP  281

Query  838   KGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEF  1017
             KG++ +SNK+HALIE++   +ADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R++ F
Sbjct  282   KGDFLMSNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKHRRN-F  340

Query  1018  EGCLEDDDQAPPVESAPEDS  1077
             +G L DD+   P ES  EDS
Sbjct  341   DGILIDDES--PYESG-EDS  357



>ref|XP_009135612.1| PREDICTED: la-related protein 6C-like [Brassica rapa]
Length=458

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 218/320 (68%), Gaps = 47/320 (15%)
 Frame = +1

Query  241   NVQAPEFVPRSITQM------PVSGYFYPYFQYQ--------------------DWIYVG  342
             N QAPEFVPRS          P+SGYFYP F Y                     DWI+VG
Sbjct  44    NAQAPEFVPRSHATALTPQVSPISGYFYPCFHYNELSIGGCSGGGGVTGGSQSSDWIFVG  103

Query  343   DQDPT----------PFYSNNQNLSPPQTQQKNSLPDEV-----KQKIIKQVEYQLSDMS  477
               DP            FY +N  +  P  Q  +S    +     + KI+KQVEYQ +DMS
Sbjct  104   GGDPVHHQNIHDPTAAFYVSNPVVQFPANQNLSSSSKSLLSDDLRLKIVKQVEYQFTDMS  163

Query  478   LLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKK  657
             LLANE+++K ++KDPEGYVPIS +ASTKKIK+L S +   ++A AL+SS+KL+VS D KK
Sbjct  164   LLANESISKHINKDPEGYVPISYIASTKKIKALTSHH--HLVALALRSSSKLVVSEDNKK  221

Query  658   VKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS  837
             V+RK PFT++D+EELQ RTVV ENLPDDHS+ N+EKIF VVG+VK IRICHP + N+SR 
Sbjct  222   VRRKIPFTDRDREELQGRTVVVENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNTSRP  281

Query  838   KGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEF  1017
             KG++ +SNK+HALIE++   +ADKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R++ F
Sbjct  282   KGDFLMSNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKHRRN-F  340

Query  1018  EGCLEDDDQAPPVESAPEDS  1077
             +G L DD+   P ES  EDS
Sbjct  341   DGILIDDES--PYESG-EDS  357



>gb|EMS67153.1| La-related protein 7 [Triticum urartu]
Length=458

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 263/433 (61%), Gaps = 64/433 (15%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS----GYFYPYFQYQ---DWIYVGDQDPTPFYSN------  372
             FK NV APEFVP S T  P+S    GY+ P+ Q Q   DW ++ D +P  F  +      
Sbjct  33    FKFNVHAPEFVPMSPTATPMSAPAGGYYSPFLQMQPAPDWSFLHDHEPVFFMPDFAHAKF  92

Query  373   ----NQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPI  540
                     +  Q +       +V QKI+KQVEYQ SD++L+ANE L K M+KD EGYVP+
Sbjct  93    AGAAAAASNSAQAKGTGGGGADVAQKIVKQVEYQFSDINLVANEFLLKIMNKDSEGYVPL  152

Query  541   SAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQ-----  705
             S ++S KKIKSL ++N  Q+L +AL++STKLIVS DGKKV+R+QPFTEK KEELQ     
Sbjct  153   SVISSWKKIKSLGATN--QMLVKALRTSTKLIVSDDGKKVRRRQPFTEKHKEELQVYKDS  210

Query  706   ----SRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLH  870
                 SR ++AENLP+D S +++EK+F+VVGSVK I+ICHPQ+P+S+R SK +  +SNK+H
Sbjct  211   ISSLSRMIIAENLPEDSSRNSLEKVFSVVGSVKNIKICHPQEPSSARASKSDTLVSNKMH  270

Query  871   ALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAP  1050
             AL+E+E+ + A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV++ ++ +F+     DD++P
Sbjct  271   ALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRPDFDHYAGSDDESP  330

Query  1051  PVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIH---------  1203
               + + +   S  +H  E+ + + +  +            +G  R R ++H         
Sbjct  331   HSQVSSDSPTSEAIHSPEAHQEDHQSGA-----------KKGWARGRGKLHIVAPHSPQS  379

Query  1204  ---GGRGLLaaspqcssssssasgqsesPMK------QASKGPRMPDGTRGFTMGRGKP-  1353
                G  G    S    +S        +   K      Q  +GPRMPDGTRGFTMGRGKP 
Sbjct  380   APAGAVGHFDPSSPRQASQKCPLSPRQVSQKCPFSPRQPPQGPRMPDGTRGFTMGRGKPA  439

Query  1354  -----LNTTAAPP  1377
                    T AAPP
Sbjct  440   ASSVAARTVAAPP  452



>gb|EPS58875.1| hypothetical protein M569_15937, partial [Genlisea aurea]
Length=275

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 205/315 (65%), Gaps = 42/315 (13%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             + DE+K KIIKQ EY  SD+S+LANE L K  +KDPEGYVPI+ V++ KK++SL   N T
Sbjct  1     ISDEIKSKIIKQAEYMFSDVSMLANETLVKHANKDPEGYVPINFVSTLKKLRSLNIDNHT  60

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
               ++QAL+ STKL+VS D KKVKRK+PFTEK+KEELQ RTV+AENLPDDHSH  IEKIFN
Sbjct  61    --VSQALRFSTKLVVSDDCKKVKRKKPFTEKEKEELQLRTVIAENLPDDHSHQKIEKIFN  118

Query  775   VVGSVKTIRICHPQDPNSSRSKGEYFI-SNKLHALIEFESPEIADKAVEKLNDERNWrk-  948
              VG +++IRIC PQD N  RSKG+  + SNKLHAL+E+ESPE A KA EKLNDERNWRK 
Sbjct  119   SVGRIRSIRICQPQDHN-KRSKGDAVVMSNKLHALVEYESPESAKKAAEKLNDERNWRKG  177

Query  949   glrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEE  1128
                  +LLRRSP+SVLK +KSEFE CLED+                 LH+   T+ N   
Sbjct  178   MRVRVMLLRRSPKSVLKNKKSEFEACLEDEGLL--------------LHEDHPTKPNNNT  223

Query  1129  SSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPR  1308
             S   G         + + + + Q+HG                        P   +++GPR
Sbjct  224   SETEGDENSKKTWAKNRAKTKPQLHG-----------------------LPDSSSTRGPR  260

Query  1309  MPDGTRGFTMGRGKP  1353
             MPDGTRGFTMGRGKP
Sbjct  261   MPDGTRGFTMGRGKP  275



>ref|XP_010228482.1| PREDICTED: la-related protein 6C [Brachypodium distachyon]
Length=443

 Score =   278 bits (712),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 252/428 (59%), Gaps = 60/428 (14%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS-------GYFYPYFQYQDWIYVGDQDPTPFYSNNQNLSP  390
             FK NV APEFVP S T    S       GY  P+    DW ++ D     F+  +   + 
Sbjct  24    FKFNVHAPEFVPMSPTAAAASPMSAPASGYCSPFLA-PDWSFLHDHHEPVFFMPDFKFAA  82

Query  391   PQTQQKNSLPD--------------EVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEG  528
                   NS                 ++  KI+KQVEYQ SD++L+ANE L K M+KD EG
Sbjct  83    AAAAASNSAGQPKAGGGGGGAATAVDIAHKIVKQVEYQFSDINLVANEFLLKIMNKDSEG  142

Query  529   YVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQS  708
             YVP+S ++S KKIKSL ++N  Q+L +AL++STKLIVS DGKKV+R+QPFTEK KEELQS
Sbjct  143   YVPLSVISSWKKIKSLGATN--QMLVKALRTSTKLIVSDDGKKVRRRQPFTEKHKEELQS  200

Query  709   RTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEF  885
             R ++AENLP+D S +++EK+F VVGSVK I+ICHPQ+P+S+R SK +  +SNK+HAL+E+
Sbjct  201   RMIIAENLPEDSSRNSLEKVFGVVGSVKNIKICHPQEPSSARASKSDTLVSNKMHALVEY  260

Query  886   ESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESA  1065
             E+ + A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV++ ++ +F+     DD +P  + +
Sbjct  261   ETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRPDFDHFAGSDDDSPHSQMS  320

Query  1066  PEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIH------------GG  1209
              +   S  +H  E+   + +  +            +G  R R ++H            G 
Sbjct  321   SDSPTSEAVHSPEAHPEDHQSGA-----------KKGWARGRGKLHVTAPHSPQSAPAGI  369

Query  1210  RGLLaaspqcssssssasgqsesPMK------QASKGPRMPDGTRGFTMGRGKP------  1353
              G    S    +S  S     +   K      Q  +GPRMPDGTRGFTMGRGKP      
Sbjct  370   VGHFDPSSPRQASQKSPLSPRQVSQKCPFSPRQPPQGPRMPDGTRGFTMGRGKPPASSVT  429

Query  1354  LNTTAAPP  1377
               T   PP
Sbjct  430   ARTVGGPP  437



>ref|NP_001058684.1| Os07g0102500 [Oryza sativa Japonica Group]
 dbj|BAD31839.1| putative RNA-binding protein homolog [Oryza sativa Japonica Group]
 dbj|BAF20598.1| Os07g0102500 [Oryza sativa Japonica Group]
 dbj|BAG94768.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81373.1| hypothetical protein OsI_24577 [Oryza sativa Indica Group]
Length=438

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 250/403 (62%), Gaps = 32/403 (8%)
 Frame = +1

Query  232   FKLNVQAPEFVPR-SITQMPVSG------YFYPY---FQYQDWIYVGDQDPTPFYSNNQ-  378
             FK NV APEFVP  S T  P+S       ++ P+    Q   W +  D +P  F  + + 
Sbjct  38    FKFNVHAPEFVPAMSPTASPMSAPAGSSSFYSPFGLHVQPDHWSFFHDHEPVFFMPDFKF  97

Query  379   -NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAS  555
                +    Q K +   ++  KI+KQVEYQ SD++L+ANE L K M+KD EGYVP+S +AS
Sbjct  98    AAAAAASAQPKPTSAADMPHKIVKQVEYQFSDINLVANEFLLKIMNKDSEGYVPLSVIAS  157

Query  556   TKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLP  735
              KKIKSL ++N  Q+L +AL++STKLIVS DGKKV+R+QPFTEK KEELQSR ++AENLP
Sbjct  158   WKKIKSLGATN--QMLVKALRTSTKLIVSDDGKKVRRRQPFTEKHKEELQSRMIIAENLP  215

Query  736   DDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIADKA  912
             +D S +++EKIF VVGSVK I++CHPQ+P+++R SK +  +SNK+HAL+E+ES + A+KA
Sbjct  216   EDSSRNSLEKIFGVVGSVKNIKMCHPQEPSTARASKSDTLVSNKMHALVEYESSQQAEKA  275

Query  913   VEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPL  1092
             VEKLNDERNWRKGLRV+ +LRRSP+SV++ +++EF+  L  DD+  P+ S    + ++  
Sbjct  276   VEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRTEFD--LNSDDEQSPMSSDLSPTATATA  333

Query  1093  HQLESTETNVEESSgggaakkgwgkgrgkTRLRTQI-----HGGRGLLaaspqcssssss  1257
              +L +     ++             G      R ++     H  +   A S      +S 
Sbjct  334   AELSAEAAGHDQGGEQQMMNSSKKGGGWARGGRGKLQVAAPHSPQSAPAGSVGHFEPASP  393

Query  1258  asgqsesPMKQASKGPR----------MPDGTRGFTMGRGKPL  1356
                   SP  +    PR          MPDGTRGFTMGRGKPL
Sbjct  394   RHKLPASPRHKCPSSPRQPPPHAHGPRMPDGTRGFTMGRGKPL  436



>ref|XP_004987293.1| PREDICTED: la-related protein 7-like [Setaria italica]
Length=470

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 187/418 (45%), Positives = 253/418 (61%), Gaps = 51/418 (12%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSIT---------QMPVSGYFYPYFQYQ------DWIYVGDQDPTPFY  366
             FK NV APEFVP S             P  GY+ P+ Q Q      DW +  D +P  F 
Sbjct  36    FKFNVHAPEFVPMSPAAASPMASPMSAPAGGYYSPFMQMQAGLGPADWSFFHDHEPVFFM  95

Query  367   SNNQNL----------SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSK  516
              +  +           +  Q +       +V QKI+KQVEYQ SD++L+ANE L K M+K
Sbjct  96    PDFAHAKFGATAAAGGNSAQAKGTTGATADVTQKIVKQVEYQFSDINLVANEFLLKIMNK  155

Query  517   DPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKE  696
             D EGYVP+S VAS KKIKSL ++N  Q+L +AL++STKLIVS DGKKV+R+QP TEK KE
Sbjct  156   DTEGYVPLSVVASWKKIKSLGATN--QMLVKALRTSTKLIVSDDGKKVRRRQPLTEKHKE  213

Query  697   ELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHA  873
             ELQSR ++AENLP+D S +++EKIF VVGSVK I+ICHPQ+P+++R SK +  +SNK+HA
Sbjct  214   ELQSRMIIAENLPEDSSRNSLEKIFGVVGSVKNIKICHPQEPSTARASKSDTLVSNKMHA  273

Query  874   LIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPP  1053
             L+E+E+ + A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV++ ++ +F+  +  DD +P 
Sbjct  274   LVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRPDFDHFVGSDDDSPH  333

Query  1054  VESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIH-------GGR  1212
              + + E    +P H  E+   + ++            +GRGK  +    H       G  
Sbjct  334   SQMSSE----TPDHSPEAAAHHQQQDEQQHQKGGWGARGRGKLHVTAPPHSPQSAPAGMA  389

Query  1213  GLLaaspqcssssssasgqsesPMKQASK-----GPRMP-------DGTRGFTMGRGK  1350
             G     P  SSS  +    + SP +Q  +      PR P       DGTRGFTMGRGK
Sbjct  390   GHFDPPPASSSSPRAKCPAASSPRQQHKQQQCPFSPRQPPQGPRMPDGTRGFTMGRGK  447



>gb|AAK50577.1|AC084404_2 putative RNA-binding protein [Oryza sativa Japonica Group]
Length=343

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 155/297 (52%), Positives = 210/297 (71%), Gaps = 17/297 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS----GYFYPYFQY--------QDWIYVGDQDPTPFYSN-  372
             F+LNV APEFVPRS    P++    GY+ P+ Q          DW    D DPT F  + 
Sbjct  34    FRLNVHAPEFVPRSPAASPMAAAAAGYYSPFLQLPGSSIGLGADWSIFADPDPTFFLPDF  93

Query  373   -NQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAV  549
              +  +     Q K + P ++ QKIIKQVEYQ SD +L+AN+ L K M+KDPE YVP+S +
Sbjct  94    GHAKIGGGNGQPKGASPADIAQKIIKQVEYQFSDTNLVANDFLMKIMNKDPECYVPMSVI  153

Query  550   ASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAEN  729
             +S KKIK++  +N  Q+L  AL++S+KL+VS DGKKV+R QPFTE+ KEELQSR V+AEN
Sbjct  154   SSWKKIKAMGVTN--QLLVNALRTSSKLVVSDDGKKVRRAQPFTERHKEELQSRMVIAEN  211

Query  730   LPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIAD  906
             LP+D + +++EKIF ++GSVK IRICHPQ+P+S+R SK +  ISNKLHALIE+E+ + AD
Sbjct  212   LPEDSTRNSLEKIFGIIGSVKNIRICHPQEPSSARSSKSDALISNKLHALIEYETSQQAD  271

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             +AV+KLNDERNWRKGLRV+ +LRRSP+S ++ ++ +F+  +  DD   P   A  DS
Sbjct  272   RAVDKLNDERNWRKGLRVRPVLRRSPKSAMRLKRPDFDHLMISDDDHSPQSQASSDS  328



>gb|EEC75591.1| hypothetical protein OsI_12289 [Oryza sativa Indica Group]
Length=429

 Score =   273 bits (699),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 155/297 (52%), Positives = 210/297 (71%), Gaps = 17/297 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS----GYFYPYFQY--------QDWIYVGDQDPTPFYSN-  372
             F+LNV APEFVPRS    P++    GY+ P+ Q          DW    D DPT F  + 
Sbjct  34    FRLNVHAPEFVPRSPAASPMAAAAAGYYSPFLQLPGSSIGLGADWSIFADPDPTFFLPDF  93

Query  373   -NQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAV  549
              +  +     Q K + P ++ QKIIKQVEYQ SD +L+AN+ L K M+KDPE YVP+S +
Sbjct  94    GHAKIGGGNGQPKGASPADIAQKIIKQVEYQFSDTNLVANDFLMKIMNKDPECYVPMSVI  153

Query  550   ASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAEN  729
             +S KKIK++  +N  Q+L  AL++S+KL+VS DGKKV+R QPFTE+ KEELQSR V+AEN
Sbjct  154   SSWKKIKAMGVTN--QLLVNALRTSSKLVVSDDGKKVRRAQPFTERHKEELQSRMVIAEN  211

Query  730   LPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIAD  906
             LP+D + +++EKIF ++GSVK IRICHPQ+P+S+R SK +  ISNKLHALIE+E+ + AD
Sbjct  212   LPEDSTRNSLEKIFGIIGSVKNIRICHPQEPSSARSSKSDALISNKLHALIEYETSQQAD  271

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             +AV+KLNDERNWRKGLRV+ +LRRSP+S ++ ++ +F+  +  DD   P   A  DS
Sbjct  272   RAVDKLNDERNWRKGLRVRPVLRRSPKSAMRLKRPDFDHLMISDDDHSPQSQASSDS  328



>ref|NP_001050504.1| Os03g0566500 [Oryza sativa Japonica Group]
 gb|ABF97161.1| RNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12418.1| Os03g0566500 [Oryza sativa Japonica Group]
 dbj|BAG92039.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59367.1| hypothetical protein OsJ_11468 [Oryza sativa Japonica Group]
Length=429

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 155/297 (52%), Positives = 210/297 (71%), Gaps = 17/297 (6%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS----GYFYPYFQY--------QDWIYVGDQDPTPFYSN-  372
             F+LNV APEFVPRS    P++    GY+ P+ Q          DW    D DPT F  + 
Sbjct  34    FRLNVHAPEFVPRSPAASPMAAAAAGYYSPFLQLPGSSIGLGADWSIFADPDPTFFLPDF  93

Query  373   -NQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAV  549
              +  +     Q K + P ++ QKIIKQVEYQ SD +L+AN+ L K M+KDPE YVP+S +
Sbjct  94    GHAKIGGGNGQPKGASPADIAQKIIKQVEYQFSDTNLVANDFLMKIMNKDPECYVPMSVI  153

Query  550   ASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAEN  729
             +S KKIK++  +N  Q+L  AL++S+KL+VS DGKKV+R QPFTE+ KEELQSR V+AEN
Sbjct  154   SSWKKIKAMGVTN--QLLVNALRTSSKLVVSDDGKKVRRAQPFTERHKEELQSRMVIAEN  211

Query  730   LPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIAD  906
             LP+D + +++EKIF ++GSVK IRICHPQ+P+S+R SK +  ISNKLHALIE+E+ + AD
Sbjct  212   LPEDSTRNSLEKIFGIIGSVKNIRICHPQEPSSARSSKSDALISNKLHALIEYETSQQAD  271

Query  907   KAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             +AV+KLNDERNWRKGLRV+ +LRRSP+S ++ ++ +F+  +  DD   P   A  DS
Sbjct  272   RAVDKLNDERNWRKGLRVRPVLRRSPKSAMRLKRPDFDHLMISDDDHSPQSQASSDS  328



>ref|XP_004986415.1| PREDICTED: la-related protein 6-like [Setaria italica]
Length=421

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/402 (41%), Positives = 238/402 (59%), Gaps = 46/402 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVS-------GYFYPYFQYQ------------DWIYVGDQDP  354
             F+ NV A EFVP S    P+        GY+ P+ Q              DW +  + DP
Sbjct  24    FRFNVHAREFVPVSPAASPMGASALAAVGYYSPFLQLPSGSGGGGGLGAVDWNFFAEPDP  83

Query  355   TPF-----YSNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKD  519
             T F     ++     +      K + P ++  KIIKQVEYQ SD +L+AN+ L K M+KD
Sbjct  84    TFFLPDFGHAEIAGAAGITGHPKGASPADIAHKIIKQVEYQFSDTNLVANDFLTKIMNKD  143

Query  520   PEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEE  699
             PEGYVP+S ++S KKIK++  +N  Q+L +AL++S KL+VS DG++V+R QPFTE+ KEE
Sbjct  144   PEGYVPLSVISSWKKIKAMGVTN--QLLVRALRTSEKLVVSDDGRRVRRAQPFTERHKEE  201

Query  700   LQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS----KGEYFISNKL  867
             LQSR V+AEN PDD + +++EKIF V+GSVK IRICHPQ+P+S+RS         +SNKL
Sbjct  202   LQSRMVIAENFPDDSTRNSLEKIFGVIGSVKNIRICHPQEPSSARSSKSDANALLVSNKL  261

Query  868   HALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQA  1047
             HALIE+E+ + A++AV +LND RNWRKGLRV+ +LRRSP+SV + ++ + +     D++ 
Sbjct  262   HALIEYETSQQAERAVYRLNDGRNWRKGLRVRAVLRRSPKSVTRLKRLDLDHLAASDEER  321

Query  1048  PPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaa  1227
              P      DS ++  H  + ++ +   +        G          R + H G      
Sbjct  322   SP------DSPTAAAHLPDHSQEDQHAAGSKKPWGSG----------RGRQHAGANAAPQ  365

Query  1228  spqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKP  1353
             +   ++ ++       +  + A +GPRMPDGTRGF MGRG+P
Sbjct  366   TTHSTAGAAWHLDSFAASPRHAPQGPRMPDGTRGFNMGRGRP  407



>ref|XP_006651554.1| PREDICTED: uncharacterized protein LOC102719286 [Oryza brachyantha]
Length=396

 Score =   270 bits (689),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 230/374 (61%), Gaps = 41/374 (11%)
 Frame = +1

Query  298   YFYPYFQY--------QDWIYVGDQDPTPFY--------SNNQNLSPPQTQQKNSLPDEV  429
             ++ P+ Q          DW    + DP  F         +      PP    K + P ++
Sbjct  27    FYSPFLQLPGSGIGLCADWSIFAEPDPAFFLPDFGHGKIAAAAGNGPP----KGASPADI  82

Query  430   KQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQ  609
              QKIIKQVEYQ SD +L+AN+ L K M+KDPE YVP+S ++S KKIK++  +N  Q+L  
Sbjct  83    AQKIIKQVEYQFSDTNLVANDFLMKIMNKDPECYVPMSVISSWKKIKAMGVTN--QLLVN  140

Query  610   ALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSV  789
             AL++S+KL+VS DGKKV+R QPFTE+ KEELQSR V+AENLP+D + +++EKIF ++GSV
Sbjct  141   ALRTSSKLVVSDDGKKVRRAQPFTERHKEELQSRMVIAENLPEDSTRNSLEKIFGIIGSV  200

Query  790   KTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvkl  966
             K IRICHPQ+P+S+R SK +  +SNKLHALIE+E+ + AD+AV+KLNDERNWRKGLRV+ 
Sbjct  201   KNIRICHPQEPSSARSSKSDALVSNKLHALIEYETSQQADRAVDKLNDERNWRKGLRVRP  260

Query  967   llrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEESSggga  1146
             +LRRSP+SV++ ++ +F+  +  DD+             SPL Q+ S     + S     
Sbjct  261   VLRRSPKSVVRLKRPDFDHAMISDDE------------HSPLSQVSSDSPMADHSPDHHQ  308

Query  1147  akkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTR  1326
                   K   + R      GGR   A      ++S+          + A +GPRMPDGTR
Sbjct  309   EDHHGKKSWARGR------GGRTPHATGAPHPAASAGHFDALMRSPRYAPQGPRMPDGTR  362

Query  1327  GFTMGRGKPLNTTA  1368
             GFTMGRG+P    A
Sbjct  363   GFTMGRGRPSPAAA  376



>emb|CDX82312.1| BnaA03g35090D [Brassica napus]
Length=431

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 209/298 (70%), Gaps = 30/298 (10%)
 Frame = +1

Query  241   NVQAPEFVPRS-------------ITQMPVSGYFYPYFQYQDWIYVGDQDPTP-FYSNNQ  378
             N QAPEFVPRS               +  V G       +Q+       DPT  FY +N 
Sbjct  44    NAQAPEFVPRSHATALTPQRRRRSYRRFSVVGLDLHPVHHQNI-----HDPTAAFYVSNP  98

Query  379   NLSPPQTQQKNSLPDEV-----KQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPIS  543
              +  P  Q  +S    +     + KI+KQVEYQ +DMSLLANE+++K ++KDPEGYVPIS
Sbjct  99    VVQFPANQNLSSSSKSLLSDDLRLKIVKQVEYQFTDMSLLANESISKHINKDPEGYVPIS  158

Query  544   AVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVA  723
              +ASTKKIK+L S +   ++A AL+SS+KL+VS D KKV+RK PFT++D+EELQ RTVV 
Sbjct  159   YIASTKKIKALTSHH--HLVALALRSSSKLVVSEDNKKVRRKIPFTDRDREELQGRTVVV  216

Query  724   ENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIA  903
             ENLPDDHS+ N+EKIF VVG+VK IRICHP + N+SR KG++ +SNK+HALIE++   +A
Sbjct  217   ENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNTSRPKGDFLMSNKIHALIEYDHTVVA  276

Query  904   DKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             DKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R++ F+G L DD+   P ES  EDS
Sbjct  277   DKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKHRRN-FDGILIDDES--PYESG-EDS  330



>emb|CDY22991.1| BnaC03g40780D [Brassica napus]
Length=431

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 207/298 (69%), Gaps = 29/298 (10%)
 Frame = +1

Query  241   NVQAPEFVPRS-------------ITQMPVSGYFYPYFQYQDWIYVGDQDPTP-FYSNNQ  378
             N QAPEFVPRS               +  V G       +Q+       DPT  FY +N 
Sbjct  41    NAQAPEFVPRSHATALTPQRRRRSYRRFSVVGLDLHPVHHQNI-----HDPTAAFYVSNP  95

Query  379   NLSPPQTQQKNSLPDEV-----KQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPIS  543
              +  P  Q  +S    +     + KI+KQVEYQ +DMSLLAN++++K ++KDPEGYVPIS
Sbjct  96    VVQFPANQNLSSSSKSLLSDDLRLKIVKQVEYQFTDMSLLANKSISKHINKDPEGYVPIS  155

Query  544   AVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVA  723
              +ASTKKIK+L S +   ++A AL+SS+KL+VS D KKVKRK PFT++D+EELQ RTVV 
Sbjct  156   YIASTKKIKALTSHH--HLVALALRSSSKLVVSEDNKKVKRKIPFTDRDREELQGRTVVV  213

Query  724   ENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIA  903
             ENLPDDHS+ N+EKIF VVG+V  IRICHP + N+SR KG+Y +SNK+HALIE++   +A
Sbjct  214   ENLPDDHSYQNLEKIFGVVGNVTAIRICHPPESNTSRPKGDYLMSNKIHALIEYDHTVVA  273

Query  904   DKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS  1077
             DKAVEKLNDERNWRKGLRV+LLLR SP+SVLK R++  +G L  DD+ P  ES  EDS
Sbjct  274   DKAVEKLNDERNWRKGLRVRLLLRCSPKSVLKNRRN-LDGIL-IDDEYPSYESG-EDS  328



>ref|XP_006658195.1| PREDICTED: la-related protein 6-like [Oryza brachyantha]
Length=420

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 241/399 (60%), Gaps = 38/399 (10%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQM-PVS------GYFY-PYFQYQ-DWIYVGDQ-DPTPFYSNNQN  381
             FK NV APEFVP S T   P+S      G FY P+   Q DW +  +  +P  F  +  +
Sbjct  25    FKFNVHAPEFVPMSPTAASPMSAPAGSSGVFYSPFLHMQPDWSFFHEHAEPVFFMPDFAH  84

Query  382   LSPPQTQQKNSLPD------EVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPIS  543
              S   T    + P       ++  KI+KQVEYQ SD++L+ANE L K M+KD EGYVP+S
Sbjct  85    ASKFATATAGAQPTKPTSAADMPHKIVKQVEYQFSDINLVANEFLLKIMNKDSEGYVPLS  144

Query  544   AVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVA  723
              +AS KKIKSL ++N  Q+L +AL++STKLIVS DGKKV+R+QPF+EK KEELQSR ++A
Sbjct  145   VIASWKKIKSLGATN--QMLVKALRTSTKLIVSDDGKKVRRRQPFSEKHKEELQSRMIIA  202

Query  724   ENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEI  900
             ENLP+D S +++EKIF VVGSVK I++CHPQ+P + R SK +  +SNK+HAL+E+ES + 
Sbjct  203   ENLPEDSSRNSLEKIFGVVGSVKNIKMCHPQEPTTPRSSKSDTLVSNKMHALVEYESSQQ  262

Query  901   ADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSV  1080
             A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV++ ++++F+  +   D+           V
Sbjct  263   AEKAVEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRTDFDHLVLASDE----------DV  312

Query  1081  SSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQI------HGGRGLLaaspqcs  1242
              SP    +  E      +  G        G      + Q+       G       +    
Sbjct  313   HSPHSHADPQEQQTSNKNSKGGGGGWARGGPRGMNKQLQVLPQSAPAGSVAHFDPASPRH  372

Query  1243  sssssasgqsesPMKQASKGPRMP---DGTRGFTMGRGK  1350
             +   ++    + P   + + P  P   DGTRGFTMGRGK
Sbjct  373   NKLPASPRHKQCPCPSSPRHPHGPRMPDGTRGFTMGRGK  411



>ref|XP_006848537.1| hypothetical protein AMTR_s00169p00025570 [Amborella trichopoda]
 gb|ERN10118.1| hypothetical protein AMTR_s00169p00025570 [Amborella trichopoda]
Length=394

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 160/295 (54%), Positives = 197/295 (67%), Gaps = 22/295 (7%)
 Frame = +1

Query  235   KLNVQAPEFVPRSITQMPVSGYFYPYFQYQD--WIYVGDQDPTPFYSNNQNLSPPQTQQK  408
             KLN QAPEFVPR+  Q  VS Y YP FQ     WIY G+       S         +  K
Sbjct  25    KLNAQAPEFVPRAQAQAHVSAYMYPSFQVSGTGWIYGGESGQLQMVST--------SSSK  76

Query  409   NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
               L DE+KQKIIKQVEY LSD SL  N+ L KQM+KDPEGYV IS +AS KKIK+L+++N
Sbjct  77    EILTDELKQKIIKQVEYHLSDSSLATNDYLMKQMNKDPEGYVSISLIASFKKIKALVNNN  136

Query  589   TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
                +LA AL+SS+KL+VS DGKKV+R+Q  T+ D EE QSR VV ENLP DHSH N+EKI
Sbjct  137   --HMLATALRSSSKLVVSEDGKKVRRQQRLTDTDIEEFQSRAVVVENLPSDHSHQNLEKI  194

Query  769   FNVVGSVKTIRICHP------QDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
             F VVGSVKT+R+C+P         +S   K +  +SNKLHAL+EFE+ E A+KAV +LN+
Sbjct  195   FGVVGSVKTVRVCNPPASSTSGSLSSKSPKTDMLVSNKLHALVEFETVEQAEKAVAELNN  254

Query  931   ERNWrkglrvklllrrSPRSVLKTRKSEFEGC---LEDDDQAPPVESAPEDSVSS  1086
             E+NWR GLRV+ LLRRSP+SV + RK + +      EDD   P  ES  + S SS
Sbjct  255   EKNWRSGLRVRHLLRRSPKSV-RCRKLDCDNTDVNCEDDAALPSNESVEDGSQSS  308



>gb|EPS74002.1| hypothetical protein M569_00755 [Genlisea aurea]
Length=379

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 203/282 (72%), Gaps = 21/282 (7%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPVSGYFYP--YFQYQD-------WIYVGDQDPTPFYSNNQNL  384
             FKLN  APEFVPR+   M + GY +P  Y QY D       WIY  D++ TP Y +   L
Sbjct  25    FKLNAAAPEFVPRAHL-MRMQGYVHPPLYLQYPDRNAAANNWIYFPDRE-TPHYPSPATL  82

Query  385   SPPQTQQK-----NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAV  549
              P Q  Q       +L +E+K  II+Q EY  SD+SLLANE+  K MSKD EGYVP++ V
Sbjct  83    PPHQNLQHFKENTATLTEELKCSIIQQAEYMFSDLSLLANESFTKHMSKDHEGYVPVNFV  142

Query  550   ASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAEN  729
               TK++KSL  +N   ++A+AL SS+ L+VS+DGKKV+RKQPFTEKDKEELQ RTV+AEN
Sbjct  143   TMTKQLKSLNVTN--HMVAKALMSSSTLVVSNDGKKVRRKQPFTEKDKEELQMRTVIAEN  200

Query  730   LPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADK  909
             LPD+HS  +IEK+F+VVG+VK+IRIC PQ+PN+S+S  +   S KL  ++E+E+ E A+K
Sbjct  201   LPDNHSIESIEKLFHVVGNVKSIRICQPQEPNTSKS--DAVASYKLRVMVEYENAENAEK  258

Query  910   AVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLED  1035
             A EKLNDER+WRKG+RV+++L+RS +++ K R+S  +G +++
Sbjct  259   AAEKLNDERHWRKGMRVRVMLKRSAKAMTKGRRS-LDGVVDE  299



>ref|XP_008651912.1| PREDICTED: la-related protein 6C-like [Zea mays]
 tpg|DAA59328.1| TPA: hypothetical protein ZEAMMB73_430508 [Zea mays]
Length=505

 Score =   257 bits (657),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 149/293 (51%), Positives = 199/293 (68%), Gaps = 32/293 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSIT---------QMPVSGYFYPYFQYQ------DWIYVGDQDPTPFY  366
             FK NV APEFVP S             P  GY+ P+ Q Q      DW +  + +P  F 
Sbjct  52    FKFNVHAPEFVPMSPAAASPMASPMSAPAGGYYSPFMQMQPGLAPADWSFFHEHEPVFFM  111

Query  367   SN-------------NQNLSPPQTQQKNSLPD-EVKQKIIKQVEYQLSDMSLLANENLAK  504
              +                      Q K +    +V QKI+KQVEYQ SD++L+ANE L K
Sbjct  112   PDLAHAKFGAATATAAGAAGSNSAQAKGAATTTDVAQKIVKQVEYQFSDINLVANEFLLK  171

Query  505   QMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTE  684
              M+KD EGYVP+S +AS KKIKSL ++N  Q+L +AL++STKL VS DGKKV+R+Q FTE
Sbjct  172   IMNKDTEGYVPLSVIASWKKIKSLGATN--QMLVKALRTSTKLNVSDDGKKVRRRQAFTE  229

Query  685   KDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISN  861
             K KEELQSR ++AENLP+D S +++EKIF VVGSVK I+ICHPQ+PN++R SK +  +SN
Sbjct  230   KHKEELQSRMIIAENLPEDSSRNSLEKIFGVVGSVKNIKICHPQEPNTARASKSDTLVSN  289

Query  862   KLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFE  1020
             K+HAL+E+E+ + A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV + ++++ +
Sbjct  290   KMHALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVTRLKRADLD  342



>ref|XP_008666613.1| PREDICTED: la-related protein 6C-like [Zea mays]
Length=435

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 169/404 (42%), Positives = 242/404 (60%), Gaps = 41/404 (10%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS---ITQMPVSGYFYPYFQYQ-------DWI-YVGDQDPT------P  360
             F+LNV A EFVP +          GY+ P+ Q         DW+ +  + DPT      P
Sbjct  26    FRLNVHAREFVPVASPLAAAAAGGGYYSPFVQLSGDGGLGTDWMNFFAEPDPTSPSSFLP  85

Query  361   FYSNNQNLSPPQTQQKNSLPD--------EVKQKIIKQVEYQLSDMSLLANENLAKQMSK  516
              + +   L    T   N  P+        ++  KI+KQVEYQ SD +L+AN+ L K M+K
Sbjct  86    DFGHCDILR--ATGGINGYPNPKGGASVADIADKIVKQVEYQFSDTNLVANDFLTKIMNK  143

Query  517   DPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKE  696
             DPEGYVP+S ++S KKIK++    T+Q+L  AL++S KL+VS DG+KV+R QPFTE+ KE
Sbjct  144   DPEGYVPLSVISSWKKIKAM--GVTSQLLVMALRTSDKLVVSDDGRKVRRAQPFTERHKE  201

Query  697   ELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYF-----ISN  861
             ELQ R V+AENLP D + +++EKIF V+GSVK IRICHPQ+P S+RS           SN
Sbjct  202   ELQCRMVIAENLPQDSTRNSLEKIFGVIGSVKNIRICHPQEPGSARSSPRSSDTNTPASN  261

Query  862   KLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDD  1041
             KLHALIE+E+   AD+AV+KLNDERNWRKGLRV+ +LRRSP++V + ++ + +  +   D
Sbjct  262   KLHALIEYETSHQADRAVDKLNDERNWRKGLRVRPVLRRSPKTVARMKRPDLDHHVAASD  321

Query  1042  QAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrg-kTRLRTQIHGGRGL  1218
             +   V ++   + ++  H  ++T+   EE        +  G  +   +R R     GR  
Sbjct  322   EE-RVSTSDSPTATAAAHPPDNTQQQQEEEEEDQHQHQHGGAKKPWGSRGR-----GRPP  375

Query  1219  LaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGK  1350
               +S   + +   +     +  + A++GPRMPDGTRGFTMGRG+
Sbjct  376   PHSSAHSAGAPGHSVDSLAASPRHAAQGPRMPDGTRGFTMGRGR  419



>ref|XP_002461300.1| hypothetical protein SORBIDRAFT_02g000420 [Sorghum bicolor]
 gb|EER97821.1| hypothetical protein SORBIDRAFT_02g000420 [Sorghum bicolor]
Length=516

 Score =   250 bits (638),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 206/309 (67%), Gaps = 33/309 (11%)
 Frame = +1

Query  232   FKLNVQAPEFVPRSITQMPV-----SGYFYPYFQYQ------DWIYVGDQDPTPFYSNNQ  378
             FK NV APEFVP S            GY+ P+ Q Q      DW +  + +P  F  +  
Sbjct  49    FKFNVHAPEFVPMSPAAASPMSAPAGGYYSPFMQMQPGLAPADWSFFHEHEPVFFMPDFA  108

Query  379   NL---------------SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMS  513
             +                S     +  +   +V QKI+KQVEYQ SD++L+ANE L K M+
Sbjct  109   HAKFGAATATATAAAAGSNSAQAKGTAATTDVAQKIVKQVEYQFSDINLVANEFLLKIMN  168

Query  514   KDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDK  693
             KD EGYV    +AS KKIKSL ++N  Q+L +AL++STKL VS DGKKV+R+QPFTEK K
Sbjct  169   KDTEGYV----IASWKKIKSLGATN--QMLVKALRTSTKLNVSDDGKKVRRRQPFTEKHK  222

Query  694   EELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-SKGEYFISNKLH  870
             EELQSR ++AENLP+D S +++EKIF VVGSVK I+ICHPQ+P+++R SK +  +SNK+H
Sbjct  223   EELQSRMIIAENLPEDSSRNSLEKIFGVVGSVKNIKICHPQEPSTARASKSDTLVSNKMH  282

Query  871   ALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAP  1050
             AL+E+E+ + A+KAVEKLNDERNWRKGLRV+ +LRRSP+SV++ ++++F+  +  DD +P
Sbjct  283   ALVEYETSQQAEKAVEKLNDERNWRKGLRVRTVLRRSPKSVMRLKRADFDHFVGSDDDSP  342

Query  1051  PVESAPEDS  1077
                    DS
Sbjct  343   HSSQMSSDS  351



>ref|XP_010251419.1| PREDICTED: la-related protein 6B isoform X2 [Nelumbo nucifera]
Length=471

 Score =   248 bits (634),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 237/419 (57%), Gaps = 50/419 (12%)
 Frame = +1

Query  235   KLNVQAPEFVPRS------------ITQMPVSGYFYP------YFQYQDWIYVGDQDPTP  360
             +LN  APEFVPR             I Q P   + +P      +    + + V +  P  
Sbjct  44    RLNAGAPEFVPRMPNRADLHQPRLLIPQGPAPIHVFPSPNSPFHIPIHNHVGVPNHVPYQ  103

Query  361   FYSN---NQNLSP-------PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQM  510
             +YS    ++ + P       P    +N L +E   KI+ QVEY  SD +L   E+L + +
Sbjct  104   YYSGFGEHEVVQPQVPVDPDPAPVTRNGLSEEATHKILNQVEYYFSDANLATTEHLMRFI  163

Query  511   SKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKD  690
             SKDPEG+VPIS VAS KKIK+L+SS+    LA  L+ S+KL+VS DGKKV+R+ PFTE D
Sbjct  164   SKDPEGFVPISVVASFKKIKALISSH--HQLANVLRMSSKLVVSEDGKKVRRQHPFTESD  221

Query  691   KEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSK-------GEY  849
              EELQSRTVVAENLP+DHS  N+ K+F+ VGSVKTIR C PQ  N   S           
Sbjct  222   VEELQSRTVVAENLPEDHSFQNLMKVFSAVGSVKTIRTCQPQTSNGGSSASSRSAKLDNM  281

Query  850   FISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVL-KTRKS--EFE  1020
               SNKLHA +E+E+ E+A+KA+ +LNDERNWR GLRV+LLLRR+P+S   + RK+  E E
Sbjct  282   LFSNKLHAFVEYETVELAEKAITELNDERNWRSGLRVRLLLRRTPKSAQPRGRKAGHEGE  341

Query  1021  GCLEDDDQAP---PVESAPEDSV---SSPLHQLESTE-TNVEESSgggaakkgwgkgrgk  1179
             G  E+DD +    P E   EDS     S  H+L   E  N +ESSG    +         
Sbjct  342   GNYEEDDVSTSEQPNEKQCEDSYQPSDSAAHELMGEEVVNDKESSGPRRGRGRGRGKGRG  401

Query  1180  TRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPL  1356
                  Q HG R    A    +S +SS     + P  +   GPRMPDGTRGF MGRGKPL
Sbjct  402   R---GQYHGNRATNHAGGCGTSPTSSPVQNEQPPQTKQPPGPRMPDGTRGFAMGRGKPL  457



>gb|EMT10567.1| 26S proteasome non-ATPase regulatory subunit 11 [Aegilops tauschii]
Length=793

 Score =   250 bits (638),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 186/229 (81%), Gaps = 3/229 (1%)
 Frame = +1

Query  424   EVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVL  603
             +V QKI+KQVEYQ SD++L+ANE L K M+KD EGYVP+S ++S KKIKSL ++N  Q+L
Sbjct  458   DVAQKIVKQVEYQFSDINLVANEFLLKIMNKDSEGYVPLSVISSWKKIKSLGATN--QML  515

Query  604   AQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVG  783
              +AL++STKLIVS DGKKV+R+QPFTEK KEELQSR ++AENLP+D S +++EK+F+VVG
Sbjct  516   VKALRTSTKLIVSDDGKKVRRRQPFTEKHKEELQSRMIIAENLPEDSSRNSLEKVFSVVG  575

Query  784   SVKTIRICHPQDPNSSR-SKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrv  960
             SVK I+ICHPQ+P+S+R SK +  +SNK+HAL+E+E+ + A+KAVEKLNDERNWRKGLRV
Sbjct  576   SVKNIKICHPQEPSSARASKSDTLVSNKMHALVEYETSQQAEKAVEKLNDERNWRKGLRV  635

Query  961   klllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLES  1107
             + +LRRSP+SV++ ++ +F+     DD++P  + + +   S  +H  E+
Sbjct  636   RTVLRRSPKSVMRLKRPDFDHYAGSDDESPHSQVSSDSPTSEAIHSPEA  684


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 6/37 (16%)
 Frame = +1

Query  1285  KQASKGPRMPDGTRGFTMGRGKP------LNTTAAPP  1377
             +Q  +GPRMPDGTRGFTMGRGKP        T AAPP
Sbjct  751   RQPPQGPRMPDGTRGFTMGRGKPAASSVAARTVAAPP  787



>ref|XP_010251418.1| PREDICTED: la-related protein 6B isoform X1 [Nelumbo nucifera]
Length=481

 Score =   241 bits (614),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 192/429 (45%), Positives = 246/429 (57%), Gaps = 60/429 (14%)
 Frame = +1

Query  235   KLNVQAPEFVPRS------------ITQMPVSGYFYP------YFQYQDWIYVGDQDPTP  360
             +LN  APEFVPR             I Q P   + +P      +    + + V +  P  
Sbjct  44    RLNAGAPEFVPRMPNRADLHQPRLLIPQGPAPIHVFPSPNSPFHIPIHNHVGVPNHVPYQ  103

Query  361   FYSN---NQNLSP-------PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQM  510
             +YS    ++ + P       P    +N L +E   KI+ QVEY  SD +L   E+L + +
Sbjct  104   YYSGFGEHEVVQPQVPVDPDPAPVTRNGLSEEATHKILNQVEYYFSDANLATTEHLMRFI  163

Query  511   SKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKD  690
             SKDPEG+VPIS VAS KKIK+L+SS+    LA  L+ S+KL+VS DGKKV+R+ PFTE D
Sbjct  164   SKDPEGFVPISVVASFKKIKALISSH--HQLANVLRMSSKLVVSEDGKKVRRQHPFTESD  221

Query  691   KEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSK-------GEY  849
              EELQSRTVVAENLP+DHS  N+ K+F+ VGSVKTIR C PQ  N   S           
Sbjct  222   VEELQSRTVVAENLPEDHSFQNLMKVFSAVGSVKTIRTCQPQTSNGGSSASSRSAKLDNM  281

Query  850   FISN----------KLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVL-  996
               SN          KLHA +E+E+ E+A+KA+ +LNDERNWR GLRV+LLLRR+P+S   
Sbjct  282   LFSNKAIMATGHCQKLHAFVEYETVELAEKAITELNDERNWRSGLRVRLLLRRTPKSAQP  341

Query  997   KTRKS--EFEGCLEDDDQAP---PVESAPEDSV---SSPLHQLESTE-TNVEESSgggaa  1149
             + RK+  E EG  E+DD +    P E   EDS     S  H+L   E  N +ESS     
Sbjct  342   RGRKAGHEGEGNYEEDDVSTSEQPNEKQCEDSYQPSDSAAHELMGEEVVNDKESS---GP  398

Query  1150  kkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDGTRG  1329
             ++G G+GRGK R R Q HG R    A    +S +SS     + P  +   GPRMPDGTRG
Sbjct  399   RRGRGRGRGKGRGRGQYHGNRATNHAGGCGTSPTSSPVQNEQPPQTKQPPGPRMPDGTRG  458

Query  1330  FTMGRGKPL  1356
             F MGRGKPL
Sbjct  459   FAMGRGKPL  467



>ref|XP_002275950.2| PREDICTED: LOW QUALITY PROTEIN: la-related protein 6B [Vitis 
vinifera]
Length=453

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 210/336 (63%), Gaps = 24/336 (7%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             +N L +EV QKI+ QVEY  SD++L   E+L + ++KDPEGYVPIS VAS KKIK+L+SS
Sbjct  128   RNGLSEEVTQKILNQVEYYFSDVNLATTEHLMRFINKDPEGYVPISVVASFKKIKALVSS  187

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             ++   LA  L++STKL+VS DGKKV+R  P TE D EELQSR VVAENLP+DH H N+ K
Sbjct  188   HSQ--LATVLRNSTKLVVSEDGKKVRRLHPLTESDMEELQSRIVVAENLPEDHCHQNLMK  245

Query  766   IFNVVGSVKTIRICHPQDPNSSRSKG-------EYFISNKLHALIEFESPEIADKAVEKL  924
             IF+ VGSVKTIR C PQ  N   S             SNKLHA +E+ES E+A+KAV +L
Sbjct  246   IFSAVGSVKTIRTCQPQTSNGGASSAARSSKTDNMLFSNKLHAFVEYESIELAEKAVVEL  305

Query  925   NDERNWrkglrvklllrrSPRSV-LKTRKS-EFEGCLEDDDQAP----PVESAPED-SVS  1083
             NDE NWR GLRV+L+ RR  +S   ++RK  E E   E+DD       P +  PED  V 
Sbjct  306   NDEGNWRSGLRVRLMHRRVAKSAQARSRKGHEGEAICEEDDACTSEQLPNDKQPEDPDVH  365

Query  1084  SPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssas  1263
             S  H   + E ++ +  G     +  G+G+G+ R +   HG RG    +P  SS +    
Sbjct  366   SHEH---AGEEHINDKEGAQRKGRSRGRGKGRGRGQYHHHGNRGNHVGTPPNSSINHEQP  422

Query  1264  gqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAA  1371
               ++ P      GPRMPDGTRGF+MGRGKP+    A
Sbjct  423   AVAKPP-----PGPRMPDGTRGFSMGRGKPVAVNIA  453



>ref|XP_004139806.1| PREDICTED: uncharacterized protein LOC101207485 [Cucumis sativus]
Length=492

 Score =   229 bits (585),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 207/343 (60%), Gaps = 40/343 (12%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159   RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219   HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766   IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
             IF+ VGSVK IR C PQ           S+++ G ++ SNKLHA +E+ES E+A+KAV +
Sbjct  277   IFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKLHAFVEYESVELAEKAVAE  335

Query  922   LNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLE----DDDQAPPVESAPED-SVSS  1086
             LNDE NWR  LR++L+L  S +S     K    G +     D  + P +E   +D S   
Sbjct  336   LNDEGNWRNALRLRLMLSCSSKSAPVRGKKGHNGEMNYKDVDTSEQPAIEKHVDDLSDQV  395

Query  1087  PLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG-GRGLLaaspqcssssssas  1263
              +H  E  E +  E  GGG             R+R ++ G GRG        +++ S  +
Sbjct  396   DVHPPEQREEHGNEKDGGGQR-----------RVRNRVRGKGRGRSQYHHNHNNNHSHGN  444

Query  1264  gqsesP------------MKQASKGPRMPDGTRGFTMGRGKPL  1356
                  P            MKQ   GPRMPDGTRGF+MGRGKP+
Sbjct  445   HLGTPPPSSSTTIEQAGTMKQQPPGPRMPDGTRGFSMGRGKPV  487



>ref|XP_008447184.1| PREDICTED: la-related protein 6B isoform X1 [Cucumis melo]
Length=492

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 205/343 (60%), Gaps = 40/343 (12%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159   RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219   HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766   IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
             IF+ VGSVK IR C PQ           S+++ G ++ SNKLHA +E+ES E+A+KAV +
Sbjct  277   IFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKLHAFVEYESVELAEKAVAE  335

Query  922   LNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLE----DDDQAPPVESAPED-SVSS  1086
             LNDE NWR  LR++L+L  S +S     K    G +     D  + P +E   +D S   
Sbjct  336   LNDEGNWRNALRLRLMLSCSSKSAPVRGKKGHNGEMNYKDVDASEQPAIEKHVDDLSDQV  395

Query  1087  PLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG-GRGLLaaspqcssssssas  1263
              +H  E  E +  E  GGG             R+R ++ G GRG        ++  +  +
Sbjct  396   DVHPPEQREEHGNEKDGGGQR-----------RVRNRVRGKGRGRSQYHHNHNNIHNHGN  444

Query  1264  gqsesP------------MKQASKGPRMPDGTRGFTMGRGKPL  1356
                  P            MKQ   GPRMPDGTRGF MGRGKP+
Sbjct  445   HVGTPPPSSSTTIEQAGTMKQQPPGPRMPDGTRGFAMGRGKPV  487



>ref|XP_009592278.1| PREDICTED: la-related protein 6B-like [Nicotiana tomentosiformis]
Length=469

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 174/441 (39%), Positives = 228/441 (52%), Gaps = 81/441 (18%)
 Frame = +1

Query  235   KLNVQAPEFVPR----------SITQMPVSGYFYPYFQYQDWIYVGDQDP-TPFYSN---  372
             KLN QAP FVPR           + Q+ V+ +  P  Q Q +IY   Q P +P+Y     
Sbjct  38    KLNAQAPAFVPRISAPGRVYATRLHQINVT-HVVPVVQNQ-FIYAPQQSPPSPYYGGVAR  95

Query  373   ---NQNLSPP---QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYV  534
                +Q ++      + +   L +E  QKI+ QVE+  SD++L   +NL + M KDPE YV
Sbjct  96    GFVDQEVAAADSNNSAKNGGLTEEAAQKIVNQVEFYFSDLNLATTDNLIRHMIKDPEAYV  155

Query  535   PISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRT  714
             PIS VAS KKIK+L+ S+    LA+ L+SS  L+VS DGKKVKR+ P TE   EELQSR 
Sbjct  156   PISVVASFKKIKALIGSHAQ--LAEILRSSINLVVSEDGKKVKRQNPLTEAALEELQSRI  213

Query  715   VVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFI-------SNKLHA  873
             VVAENLP+DH H N+ KIF+ VG VK IR CHPQ  N   S     +       SNKLH 
Sbjct  214   VVAENLPEDHCHQNLMKIFSAVGRVKMIRTCHPQPSNGGASSASRSVKSDSTLYSNKLHV  273

Query  874   LIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSV-LKTRKSEFEGCL---EDDD  1041
              +E+ES E+A+KAV +LND  NWR GL+V+LLLRR+ +S   + +K   E  L   EDDD
Sbjct  274   FVEYESVELAEKAVLELNDVDNWRNGLKVRLLLRRTAKSGQAQEKKVGHESGLNFKEDDD  333

Query  1042  QAPPVESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG-----  1206
              A  +    E+   SP H         E+S+         GK +G  R R ++ G     
Sbjct  334   FASELNEKHEE--ESPCH--------FEQSNDVADKHGSNGKRKGHNRGRGKVQGPGPGQ  383

Query  1207  ----GRGLLaaspqcssssssasgqsesPMKQASKG------------------------  1302
                 GRG            + AS  + +     + G                        
Sbjct  384   TRVRGRGAAQFQQNNRGGRTGASTTNLNRGSNVASGPSNTNGVSVAGQPAVVCDQSAGKQ  443

Query  1303  ---PRMPDGTRGFTMGRGKPL  1356
                PRMPDGTRGF+MGRGKP+
Sbjct  444   SSVPRMPDGTRGFSMGRGKPV  464



>ref|XP_007026488.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY06990.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
Length=431

 Score =   223 bits (569),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 202/340 (59%), Gaps = 23/340 (7%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             KN L +E   KI+ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+L+++
Sbjct  97    KNGLSEEATLKILNQVEYYFSDLNLATTDHLMRFINKDPEGYVPISVVASFKKIKALITT  156

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             +    LA  L++S KL+VS DGKKV+R+ P TE D EELQSR +VAENLP+DH H N+ K
Sbjct  157   HAQ--LATVLRNSLKLVVSEDGKKVRRQHPLTESDMEELQSRIIVAENLPEDHCHQNLMK  214

Query  766   IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
             IF+ VGSVKTIR C PQ           +++S G +F SNKLHA +E+ES E+A+KAV +
Sbjct  215   IFSSVGSVKTIRTCQPQPSGGGVSSASRTAKSDGMHF-SNKLHAFVEYESVELAEKAVAE  273

Query  922   LNDERNWrk--glrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSP--  1089
             LNDE NWR    +R+ L     P      +  + EG  E+DD +   + + +     P  
Sbjct  274   LNDEGNWRSGLRVRLMLRRVSKPTHTRGKKGHDGEGHYEEDDASTSEQQSNDKQQEDPSQ  333

Query  1090  LHQLESTE------TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssss  1251
             L  + S E      +N +E        +G GKGRG+ +     H  RG         S++
Sbjct  334   LSDIHSHEYPGEEHSNEKEGGQKKGRNRGRGKGRGRAQYHNNQHNSRG--NHVGTPPSAT  391

Query  1252  ssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAA  1371
             S+     ++ + +   GPRMPDGTRGF MGRGKP+    A
Sbjct  392   SNLVSNEQATVAKQPPGPRMPDGTRGFAMGRGKPVAVNTA  431



>ref|XP_010908488.1| PREDICTED: la-related protein 6B-like [Elaeis guineensis]
Length=471

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 150/340 (44%), Positives = 193/340 (57%), Gaps = 34/340 (10%)
 Frame = +1

Query  412   SLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNT  591
              LP+EV QKI KQVEY  SD++L   E+L + +S+DPEG+VPIS +AS KKIK+L+ +N+
Sbjct  135   GLPEEVIQKITKQVEYYFSDLNLATTEHLMRFISRDPEGFVPISVIASFKKIKALVHNNS  194

Query  592   TQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIF  771
               +LA ALQ+S+KL+VS DGKKV+R  PFTE D EELQSR VVAENLP+DH + N+ K+F
Sbjct  195   --LLAAALQTSSKLVVSDDGKKVRRLHPFTEGDVEELQSRIVVAENLPEDHCYQNLMKVF  252

Query  772   NVVGSVKTIRICHPQDPNSS----------RSKGEYFISNKLHALIEFESPEIADKAVEK  921
             + VGSVKTIR C+PQ+PN +           SK E    NKLHA +E+E+ E A+KAV +
Sbjct  253   SAVGSVKTIRTCYPQNPNGNPHGTTAAVNRSSKLEMLFYNKLHAFVEYETVEDAEKAVTE  312

Query  922   LNDERNWrkg-lrvklllrrSPRSVLKTRKSEFEG-CLEDDDQAPPVESAPEDSVSSPLH  1095
             L DERNWR G     L    +     + RK   EG    D+D+        E  V  P  
Sbjct  313   LIDERNWRSGLRVRILSKCMTKHGPGRGRKIGHEGDGTGDEDEIATTNQPNEKQVDDPSQ  372

Query  1096  QLESTETNVEESS----gggaakkgwgkgrgkTRLRTQIH------GGRGLLaaspqcss  1245
               E +  +V E +     G A +        + R R Q H      GG  L         
Sbjct  373   SFEDSMEHVGEENFNDKDGMARRGKGRGPGARGRGRAQYHHNNNRNGGHALGTPPSSHLI  432

Query  1246  ssssasgqsesPMKQASKGP---RMPDGTRGFTMGRGKPL  1356
              +          +  ASK P   RMPDGTRGF+MGRG PL
Sbjct  433   HADQQ-------LAVASKQPPGPRMPDGTRGFSMGRGNPL  465



>ref|XP_007026487.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY06989.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
Length=500

 Score =   223 bits (568),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 202/340 (59%), Gaps = 23/340 (7%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             KN L +E   KI+ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+L+++
Sbjct  166   KNGLSEEATLKILNQVEYYFSDLNLATTDHLMRFINKDPEGYVPISVVASFKKIKALITT  225

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             +    LA  L++S KL+VS DGKKV+R+ P TE D EELQSR +VAENLP+DH H N+ K
Sbjct  226   HAQ--LATVLRNSLKLVVSEDGKKVRRQHPLTESDMEELQSRIIVAENLPEDHCHQNLMK  283

Query  766   IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
             IF+ VGSVKTIR C PQ           +++S G +F SNKLHA +E+ES E+A+KAV +
Sbjct  284   IFSSVGSVKTIRTCQPQPSGGGVSSASRTAKSDGMHF-SNKLHAFVEYESVELAEKAVAE  342

Query  922   LNDERNWrk--glrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSP--  1089
             LNDE NWR    +R+ L     P      +  + EG  E+DD +   + + +     P  
Sbjct  343   LNDEGNWRSGLRVRLMLRRVSKPTHTRGKKGHDGEGHYEEDDASTSEQQSNDKQQEDPSQ  402

Query  1090  LHQLESTE------TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssss  1251
             L  + S E      +N +E        +G GKGRG+ +     H  RG         S++
Sbjct  403   LSDIHSHEYPGEEHSNEKEGGQKKGRNRGRGKGRGRAQYHNNQHNSRG--NHVGTPPSAT  460

Query  1252  ssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAA  1371
             S+     ++ + +   GPRMPDGTRGF MGRGKP+    A
Sbjct  461   SNLVSNEQATVAKQPPGPRMPDGTRGFAMGRGKPVAVNTA  500



>ref|XP_008360671.1| PREDICTED: la-related protein 6C-like [Malus domestica]
Length=278

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 10/167 (6%)
 Frame = +1

Query  232  FKLNVQAPEFVPRSITQMPVSGYFYPYFQYQ-------DWIYVGDQDPTPFY-SNNQNLS  387
            F  N QAPEFVPRS  QMP+SGYFYP F +        DW Y+GDQ+  P+  SNN N++
Sbjct  28   FTFNAQAPEFVPRSHAQMPISGYFYPCFHFLGDSTASPDWFYIGDQELPPYLISNNPNIN  87

Query  388  PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
            P   + KN+LPD+++QK IKQVEYQ SDMSLLANE+LAK +SKDPEG+VPIS +ASTKK+
Sbjct  88   PLSNRSKNALPDDLQQKXIKQVEYQFSDMSLLANESLAKHISKDPEGFVPISVIASTKKM  147

Query  568  KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQS  708
            KSL+S+N   +L+QAL+SS KL+VS DGKKV+RK PFTEKDKEELQ 
Sbjct  148  KSLISNN--HMLSQALRSSLKLVVSEDGKKVRRKHPFTEKDKEELQG  192



>emb|CBI24756.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 202/327 (62%), Gaps = 26/327 (8%)
 Frame = +1

Query  433   QKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQA  612
             +K++++  + +SD++L   E+L + ++KDPEGYVPIS VAS KKIK+L+SS++   LA  
Sbjct  11    RKLLRR--FSISDVNLATTEHLMRFINKDPEGYVPISVVASFKKIKALVSSHSQ--LATV  66

Query  613   LQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVK  792
             L++STKL+VS DGKKV+R  P TE D EELQSR VVAENLP+DH H N+ KIF+ VGSVK
Sbjct  67    LRNSTKLVVSEDGKKVRRLHPLTESDMEELQSRIVVAENLPEDHCHQNLMKIFSAVGSVK  126

Query  793   TIRICHPQDPNSSRSKG-------EYFISNKLHALIEFESPEIADKAVEKLNDERNWrkg  951
             TIR C PQ  N   S             SNKLHA +E+ES E+A+KAV +LNDE NWR G
Sbjct  127   TIRTCQPQTSNGGASSAARSSKTDNMLFSNKLHAFVEYESIELAEKAVVELNDEGNWRSG  186

Query  952   lrvklllrrSPRSVLKTRKSEFEG---CLEDD---DQAPPVESAPED-SVSSPLHQLEST  1110
             LRV+L+ RR  +S     +   EG   C EDD    +  P +  PED  V S  H   + 
Sbjct  187   LRVRLMHRRVAKSAQARSRKGHEGEAICEEDDACTSEQLPNDKQPEDPDVHSHEH---AG  243

Query  1111  ETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQ  1290
             E ++ +  G     +  G+G+G+ R +   HG RG    +P  SS +      ++ P   
Sbjct  244   EEHINDKEGAQRKGRSRGRGKGRGRGQYHHHGNRGNHVGTPPNSSINHEQPAVAKPP---  300

Query  1291  ASKGPRMPDGTRGFTMGRGKPLNTTAA  1371
                GPRMPDGTRGF+MGRGKP+    A
Sbjct  301   --PGPRMPDGTRGFSMGRGKPVAVNIA  325



>ref|XP_006858735.1| hypothetical protein AMTR_s00066p00125170 [Amborella trichopoda]
 gb|ERN20202.1| hypothetical protein AMTR_s00066p00125170 [Amborella trichopoda]
Length=432

 Score =   220 bits (560),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 184/305 (60%), Gaps = 50/305 (16%)
 Frame = +1

Query  235   KLNVQAPEFVP-----------------------RSITQMPVSGYF--YPYFQYQDWIYV  339
             KLN +AP FVP                       + +   PV  +   +PYF Y D  + 
Sbjct  31    KLNAEAPAFVPSMNSSPFWHGSSSRHLMPQVHHRQVLPFHPVHAHHGHFPYFGYGDQEHA  90

Query  340   G---DQDPTPFYSNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQM  510
             G   D DP P               K  + +E+  K++KQVEY   D +L   ++L K +
Sbjct  91    GMATDPDPNP--------------SKEVISEELSNKVVKQVEYYFRDANLATGDHLMKFV  136

Query  511   SKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKD  690
             +KD  G+VPIS +AS KKIK+L+S++   +LA AL++S KL+VS DGKKVKR  P TE D
Sbjct  137   NKDSGGFVPISVIASFKKIKALISNHA--MLADALRTSKKLVVSEDGKKVKRLHPLTESD  194

Query  691   KEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS------KGEYF  852
              E+LQSRTVV ENLP+DHSH N+EKIF+VVGSVKTIRICHPQ  N + S      K +  
Sbjct  195   IEDLQSRTVVVENLPEDHSHPNLEKIFSVVGSVKTIRICHPQGANGTASSAARSPKMDML  254

Query  853   ISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLE  1032
             +SNKLHA +E+E+ E A+KAV +LNDERNWR GLRV+LLLR + +S    R    +G  E
Sbjct  255   VSNKLHAFVEYETVEQAEKAVAELNDERNWRSGLRVRLLLRHTAKSEKPGRAKRADGNGE  314

Query  1033  DDDQA  1047
             +D+ +
Sbjct  315   EDEAS  319



>ref|XP_010672517.1| PREDICTED: la-related protein 6B [Beta vulgaris subsp. vulgaris]
Length=517

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 208/342 (61%), Gaps = 23/342 (7%)
 Frame = +1

Query  397   TQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSL  576
             ++  N L DE  QK+I QVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L
Sbjct  181   SRSNNGLSDENTQKLINQVEYYFSDVNLATTDHLVRFINKDPEGFVPISVVASFKKIKAL  240

Query  577   LSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHN  756
             +SSN+   LA  L+SS+KL+VS DGKKVKR  P T  D EELQ+R +VAENLP+DH H N
Sbjct  241   ISSNSQ--LAAVLRSSSKLVVSEDGKKVKRLHPLTGPDMEELQARIIVAENLPEDHCHQN  298

Query  757   IEKIFNVVGSVKTIRICHPQDPNSSRSKGE-------YFISNKLHALIEFESPEIADKAV  915
             + K+F+ VGSVK+IR C PQ  N+  S              NKLHA +E+ES E+A+KA+
Sbjct  299   LMKVFSTVGSVKSIRTCQPQPSNTGASSASRPSKTDNMLYCNKLHAFVEYESIELAEKAI  358

Query  916   EKLNDERNWrkglrvklllrrSPRSV-LKTRKSEFEG---CLEDDDQAPPV---ESAPED  1074
              +LNDE NWR GLRV+ LL+   ++   + +KS  EG   C E+D         E   ED
Sbjct  359   AELNDEGNWRNGLRVRALLKHGSKTAQTRGKKSGNEGEVTCEEEDASTSEQNQNEKPSED  418

Query  1075  SVSSP-LHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIH-GGRGLLaaspqcsss  1248
               + P +H  E  E    E  GG    +  G+G+G+ R     H   RG+   SP  +++
Sbjct  419   LSTQPDVHSQEHVEEQTLEKEGGQKKTRNRGRGKGRGRGHHNHHQNNRGIHVGSPPINNA  478

Query  1249  sssasgqsesPMKQASKGPRMPDGTRGFTMGRGKP--LNTTA  1368
              +          KQ   GPRMPDGTRGF+MGRG+P  +NTTA
Sbjct  479   MNGEHPIV---AKQQPPGPRMPDGTRGFSMGRGRPVAVNTTA  517



>gb|KDP29552.1| hypothetical protein JCGZ_19265 [Jatropha curcas]
Length=526

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/344 (44%), Positives = 203/344 (59%), Gaps = 27/344 (8%)
 Frame = +1

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
             ++ + + L DE  QK++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+
Sbjct  192   KSDRNSGLSDEAVQKLLNQVEYYFSDLNLATTDHLMRFINKDPEGYVPISVVASFKKIKA  251

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
              +++N+   LA  L++S+KL+VS DGKKV+R  P TE D EELQSR VVAENLP+DH HH
Sbjct  252   AINNNSQ--LASILRNSSKLVVSEDGKKVRRLHPLTESDVEELQSRIVVAENLPEDHCHH  309

Query  754   NIEKIFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADK  909
             N+ KIF+ VGSVKTIR C PQ           S+++ G +F SNKLHA +E+ES EIA+K
Sbjct  310   NLMKIFSSVGSVKTIRTCPPQTSGGGASSASRSTKADGMHF-SNKLHAFVEYESVEIAEK  368

Query  910   AVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLE-DDDQAPPVESAP-EDSVS  1083
             AV +LNDE +WR GLRV+L+L+R+ +      K   +G    ++D+A   E  P E    
Sbjct  369   AVIELNDEESWRSGLRVRLMLKRTSKHTQARGKKGHDGSGHSEEDEASTSEQQPNEKQHE  428

Query  1084  SP--LHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssss  1257
             SP   H + S E + E+ +              K R +   + GRG          +   
Sbjct  429   SPPQHHDVHSHEQSGEDHA------NDKEGAHRKGRNKGHRNKGRGRGQHHHNNRGNHVG  482

Query  1258  asgqsesPMKQASK------GPRMPDGTRGFTMGRGKPLNTTAA  1371
                 +   M +         GPRMPDGTRGF MGRGKPL    A
Sbjct  483   TPPSNNPVMSELPTVAKQPPGPRMPDGTRGFAMGRGKPLAVNIA  526



>ref|XP_007026489.1| RNA-binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY06991.1| RNA-binding protein, putative isoform 3 [Theobroma cacao]
Length=501

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 202/341 (59%), Gaps = 24/341 (7%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             KN L +E   KI+ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+L+++
Sbjct  166   KNGLSEEATLKILNQVEYYFSDLNLATTDHLMRFINKDPEGYVPISVVASFKKIKALITT  225

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             +    LA  L++S KL+VS DGKKV+R+ P TE D EELQSR +VAENLP+DH H N+ K
Sbjct  226   HAQ--LATVLRNSLKLVVSEDGKKVRRQHPLTESDMEELQSRIIVAENLPEDHCHQNLMK  283

Query  766   IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKA-VE  918
             IF+ VGSVKTIR C PQ           +++S G +F SNKLHA +E+ES E+A+KA V 
Sbjct  284   IFSSVGSVKTIRTCQPQPSGGGVSSASRTAKSDGMHF-SNKLHAFVEYESVELAEKAVVA  342

Query  919   KLNDERNWrk--glrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSP-  1089
             +LNDE NWR    +R+ L     P      +  + EG  E+DD +   + + +     P 
Sbjct  343   ELNDEGNWRSGLRVRLMLRRVSKPTHTRGKKGHDGEGHYEEDDASTSEQQSNDKQQEDPS  402

Query  1090  -LHQLESTE------TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcsss  1248
              L  + S E      +N +E        +G GKGRG+ +     H  RG         S+
Sbjct  403   QLSDIHSHEYPGEEHSNEKEGGQKKGRNRGRGKGRGRAQYHNNQHNSRG--NHVGTPPSA  460

Query  1249  sssasgqsesPMKQASKGPRMPDGTRGFTMGRGKPLNTTAA  1371
             +S+     ++ + +   GPRMPDGTRGF MGRGKP+    A
Sbjct  461   TSNLVSNEQATVAKQPPGPRMPDGTRGFAMGRGKPVAVNTA  501



>ref|XP_008801106.1| PREDICTED: la-related protein 6B-like [Phoenix dactylifera]
Length=461

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 156/369 (42%), Positives = 214/369 (58%), Gaps = 22/369 (6%)
 Frame = +1

Query  304   YPYFQYQDWIYVGDQDPTPFYSNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLL  483
             + Y+        G+Q+  P  ++    S P    ++ L +EV QKI KQVEY  SD++L 
Sbjct  99    FEYYGGGGCAAFGEQEAVPALAD----SDPAPPARDGLSEEVIQKITKQVEYYFSDVNLA  154

Query  484   ANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVK  663
               E+L + +SKDPEG+VPIS +A+ KKIK+L+ +N+  +LA AL++S+KL+VS DGKKV+
Sbjct  155   TTEHLMRFISKDPEGFVPISVIAAFKKIKALVHNNS--LLAMALRTSSKLVVSDDGKKVR  212

Query  664   RKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR---  834
             R+QPF E D EELQSR VVAENLP+DH + N+ K+F+VVGSVKTIR C+PQ  N +    
Sbjct  213   RQQPFAESDMEELQSRIVVAENLPEDHCYQNLMKVFSVVGSVKTIRTCYPQTNNGTTTST  272

Query  835   ---SKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkg-lrvklllrrSPRSVLKT  1002
                +K +    N+LHA +E+E+ E A+KA+ +LNDERNWR G     LL   +     + 
Sbjct  273   NKSAKLDMLFGNRLHAFVEYETVEDAEKAIAELNDERNWRSGLRVRLLLKCMTKHGPARG  332

Query  1003  RKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEES----Sgggaakkgwgkg  1170
             RK   EG +  +      +   E  V  P    E++  NV E+      GG  +      
Sbjct  333   RKGGHEGDVNGEGDVSTSDQPNEKQVEDPSQLSEASHENVGEALYSEKDGGLRRGRGRGR  392

Query  1171  rgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMP---DGTRGFTMG  1341
              GK R R Q H    L       SSS  S    +E P+  A+K P  P   DGTRGFTMG
Sbjct  393   GGKGRGRGQYH-NNNLNGGHMIGSSSPLSHPVHTEQPVV-ANKQPPGPRMPDGTRGFTMG  450

Query  1342  RGKPLNTTA  1368
             RGK + TT+
Sbjct  451   RGKLVTTTS  459



>gb|EMS62383.1| La-related protein 7 [Triticum urartu]
Length=266

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 135/180 (75%), Gaps = 8/180 (4%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            D+V  KI KQVEY  SD++L   E+L + +SKDPEGYVP+S VAS KKIK+L+ S++  +
Sbjct  26   DDVLHKITKQVEYYFSDINLATTEHLMRFISKDPEGYVPMSVVASFKKIKALVQSSS--M  83

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL++S+KL+VS DG +VKR QPFTE D EELQ+R VVAENLPDDH + N+ KIF+ V
Sbjct  84   LASALRTSSKLVVSEDGNRVKRVQPFTESDLEELQARIVVAENLPDDHCYQNLMKIFSSV  143

Query  781  GSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSVKTIR C+PQ PN S       +K +   +NKLHA +E+E+ E A+KA+  LNDERNW
Sbjct  144  GSVKTIRTCYPQTPNGSGPVTNRSAKLDMLFANKLHAFVEYETIEDAEKAIVVLNDERNW  203



>ref|XP_004287183.1| PREDICTED: uncharacterized protein LOC101304608 [Fragaria vesca 
subsp. vesca]
Length=454

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 162/377 (43%), Positives = 220/377 (58%), Gaps = 35/377 (9%)
 Frame = +1

Query  307   PYFQYQDWIYVGDQD-PTPFYSNNQNLSPPQ---TQQKNSLPDEVKQKIIKQVEYQLSDM  474
             PY+      + GDQD PT   S+ Q   PP    + + + L DE   K++ QVEY  SD+
Sbjct  90    PYYASG---FSGDQDQPT---SDEQ--PPPDHATSSKSHKLSDEATSKVLNQVEYYFSDL  141

Query  475   SLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGK  654
             +L   ++L + +SKDPEG+VPIS VAS KKIK+L++S++   LA  L++S+KL+V  DGK
Sbjct  142   NLATTDHLMRFISKDPEGFVPISVVASFKKIKALVNSHSQ--LATVLRNSSKLVVHEDGK  199

Query  655   KVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR  834
             KV+R+ P T+ D EELQSR VVAENLP+DH H N+ KIF+  GSVKTIR C PQ  N++ 
Sbjct  200   KVRRQHPLTQSDMEELQSRIVVAENLPEDHCHQNLMKIFSAAGSVKTIRTCQPQTSNNNS  259

Query  835   SK--------GEYFISNKLHALIEFESPEIADKAVEKLNDERNWrk--glrvklllrrSP  984
             S         G +F SNKLHA +E+ESPE+A+KAV +LN+E NWR    +R+ L     P
Sbjct  260   SSASRSAKADGMHF-SNKLHAFVEYESPELAEKAVAELNEEGNWRSGLRVRLMLRRLSKP  318

Query  985   RSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVS--------SPLHQLESTETNVEESSgg  1140
               V   +  + E  LE++D + P ++   +  S        +  H+      N +ES   
Sbjct  319   GQVRGKKGQDGEVQLEEEDASAPEQNHANEKQSDDTSRQFDAHSHEQGEEHGNDKESGQR  378

Query  1141  gaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGPRMPDG  1320
              A  +  G+GRG+ R +   H  R  +  S   S  SS   G   S  KQ   GPRMPDG
Sbjct  379   KARNRQGGRGRGRGRGQYH-HNNRNHVGTSHNSSMGSSEQPGIGVSVAKQP-PGPRMPDG  436

Query  1321  TRGFTMGRGKPLNTTAA  1371
             TRGF MGRGKP+    A
Sbjct  437   TRGFAMGRGKPVTVNIA  453



>ref|XP_011005266.1| PREDICTED: la-related protein 6B-like [Populus euphratica]
Length=509

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 152/339 (45%), Positives = 206/339 (61%), Gaps = 26/339 (8%)
 Frame = +1

Query  394   QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                + +S  DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+
Sbjct  172   HASKSDSKSDEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKA  231

Query  574   LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
              ++SN+   LA  L++STKL+VS DGKKV+R+ P T+ D EELQSR VVAENLP+DH H 
Sbjct  232   AINSNSQ--LANILRNSTKLVVSDDGKKVRRQHPLTDSDVEELQSRIVVAENLPEDHCHQ  289

Query  754   NIEKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADK  909
             N+ KIF+ VGSVKTIR C PQ           S+++ G +F SNKLHA +E+E+ EIA+K
Sbjct  290   NLMKIFSAVGSVKTIRTCPPQTSGGGASSASRSAKADGMHF-SNKLHAFVEYETIEIAEK  348

Query  910   AVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEG-CLEDDDQAPPVESAPEDSVSS  1086
             AV +LNDE NWR GLRV+L+L+R  +S     K   +G    ++D+    E  P D  + 
Sbjct  349   AVAELNDEGNWRSGLRVRLMLKRGSKSTQARGKKGHDGQGHSEEDEISATEQMPNDKQTE  408

Query  1087  PL------HQLEST---ETNVEESSgggaakkgwgkgrgkTRL-RTQIHGGRGLLaaspq  1236
              L      H LE +     N +E +      +G GKGRG+ +      H  RG    +  
Sbjct  409   DLPQQHDAHSLEHSGEDHANDKEGAQRKGRNRGRGKGRGRGQYHHNSHHNNRG----NHL  464

Query  1237  cssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGKP  1353
              +S S++        M +   GPRMPDGTRGF MGRGKP
Sbjct  465   GTSPSNNPVIGEHPAMAKQPPGPRMPDGTRGFAMGRGKP  503



>tpg|DAA49246.1| TPA: hypothetical protein ZEAMMB73_519082 [Zea mays]
Length=413

 Score =   212 bits (540),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 153/399 (38%), Positives = 226/399 (57%), Gaps = 53/399 (13%)
 Frame = +1

Query  232   FKLNVQAPEFVPRS---ITQMPVSGYFYPYFQYQ-------DWI-YVGDQDPT------P  360
             F+LNV A EFVP +          GY+ P+ Q         DW+ +  + DPT      P
Sbjct  26    FRLNVHAREFVPVASPLAAAAAGGGYYSPFVQLSGDGGLGTDWMNFFAEPDPTSPSSFLP  85

Query  361   FYSNNQNLSPPQTQQKNSLPD--------EVKQKIIKQVEYQLSDMSLLANENLAKQMSK  516
              + +   L    T   N  P+        ++  KI+KQVEYQ SD +L+AN+ L K M+K
Sbjct  86    DFGHCDILR--ATGGINGYPNPKGGASVADIADKIVKQVEYQFSDTNLVANDFLTKIMNK  143

Query  517   DPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKE  696
             DPEGYVP+S ++S KKIK++    T+Q+L  AL++S KL+VS DG+KV+R QPFTE+ KE
Sbjct  144   DPEGYVPLSVISSWKKIKAM--GVTSQLLVMALRTSDKLVVSDDGRKVRRAQPFTERHKE  201

Query  697   ELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHAL  876
             ELQ R V+AENLP D + +++EKIF V+GS   +                     +LHAL
Sbjct  202   ELQCRMVIAENLPQDSTRNSLEKIFGVIGSCSLLSFL-----------------TQLHAL  244

Query  877   IEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPV  1056
             IE+E+   AD+AV+KLNDERNWRKGLRV+ +LRRSP++V + ++ + +  +   D+   V
Sbjct  245   IEYETSHQADRAVDKLNDERNWRKGLRVRPVLRRSPKTVARMKRPDLDHHVAASDEE-RV  303

Query  1057  ESAPEDSVSSPLHQLESTETNVEESSgggaakkgwgkgrg-kTRLRTQIHGGRGLLaasp  1233
              ++   + ++  H  ++T+   EE        +  G  +   +R R     GR    +S 
Sbjct  304   STSDSPTATAAAHPPDNTQQQQEEEEEDQHQHQHGGAKKPWGSRGR-----GRPPPHSSA  358

Query  1234  qcssssssasgqsesPMKQASKGPRMPDGTRGFTMGRGK  1350
               + +   +     +  + A++GPRMPDGTRGFTMGRG+
Sbjct  359   HSAGAPGHSVDSLAASPRHAAQGPRMPDGTRGFTMGRGR  397



>ref|XP_009393796.1| PREDICTED: la-related protein 6B-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 140/190 (74%), Gaps = 8/190 (4%)
 Frame = +1

Query  391  PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIK  570
            P    ++ L DEV QKIIKQVEY  SD +L   E+L + ++KDP+G+VPIS VA+ KKIK
Sbjct  118  PSYTARDGLSDEVVQKIIKQVEYYFSDANLATTEHLMRFITKDPDGFVPISVVAAFKKIK  177

Query  571  SLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSH  750
            +L+ +N    LA AL++STKL+VS DGKKV+R+QPFTE D EELQSR VVAENLP+DH +
Sbjct  178  ALVHNNFQ--LAVALRTSTKLVVSDDGKKVRRQQPFTESDLEELQSRIVVAENLPEDHCY  235

Query  751  HNIEKIFNVVGSVKTIRICHPQDPNSSRS------KGEYFISNKLHALIEFESPEIADKA  912
             N+ KIF+VVGSVKTIR C+PQ  N + +      K E    N+LHA +E+E+ E A+KA
Sbjct  236  QNLMKIFSVVGSVKTIRTCYPQPSNGTGAATNRPTKLEMLFGNRLHAFVEYETVEDAEKA  295

Query  913  VEKLNDERNW  942
            V +LNDE+NW
Sbjct  296  VAELNDEKNW  305



>ref|XP_009761351.1| PREDICTED: la-related protein 6B-like [Nicotiana sylvestris]
Length=478

 Score =   214 bits (544),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 158/263 (60%), Gaps = 31/263 (12%)
 Frame = +1

Query  235  KLNVQAPEFVPR----------SITQMPVSGYFYPYFQYQDWIYVGDQDP-TPFYSN---  372
            KLN QAP FVPR           + Q+ V+ +  P  Q Q +IY   Q P +P+Y     
Sbjct  46   KLNAQAPAFVPRISAPGRVYATRLHQINVT-HVVPVVQNQ-FIYAPQQSPPSPYYGGVAR  103

Query  373  ---NQNLSPP---QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYV  534
               +Q ++      + +   LP+E  QKI+ QVE+  SD++L   +NL + M KDPEGYV
Sbjct  104  GFVDQEVAAADSNNSAKNGGLPEEAAQKIVNQVEFYFSDLNLATTDNLIRHMIKDPEGYV  163

Query  535  PISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRT  714
            PIS VAS KKIK+L+ S+    LA+ L+SS  L+VS DGKKVKR+ P TE   EELQSR 
Sbjct  164  PISVVASFKKIKALIGSHAQ--LAEVLRSSINLVVSEDGKKVKRQNPLTEAALEELQSRI  221

Query  715  VVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEY-------FISNKLHA  873
            VVAENLP+DH H N+ KIF+ VG VK IR CHPQ  N   S             SNKLH 
Sbjct  222  VVAENLPEDHCHQNLMKIFSAVGRVKMIRTCHPQPSNGGASSASRSAKSDSTLYSNKLHV  281

Query  874  LIEFESPEIADKAVEKLNDERNW  942
             +E+ES E+A+KAV +LND  NW
Sbjct  282  FVEYESVELAEKAVLELNDVDNW  304



>ref|XP_009393795.1| PREDICTED: la-related protein 6B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   213 bits (542),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 151/228 (66%), Gaps = 11/228 (5%)
 Frame = +1

Query  286  PVSGYFYP---YFQYQDWIYVGDQDPTPFYSNNQNLSPPQTQQKNSLPDEVKQKIIKQVE  456
            P+S YF P    F+Y      G          +     P    ++ L DEV QKIIKQVE
Sbjct  80   PISAYFGPGPGSFEYYGGGAAGGFGEHEGGGQSSVDPDPSYTARDGLSDEVVQKIIKQVE  139

Query  457  YQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLI  636
            Y  SD +L   E+L + ++KDP+G+VPIS VA+ KKIK+L+ +N    LA AL++STKL+
Sbjct  140  YYFSDANLATTEHLMRFITKDPDGFVPISVVAAFKKIKALVHNNFQ--LAVALRTSTKLV  197

Query  637  VSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQ  816
            VS DGKKV+R+QPFTE D EELQSR VVAENLP+DH + N+ KIF+VVGSVKTIR C+PQ
Sbjct  198  VSDDGKKVRRQQPFTESDLEELQSRIVVAENLPEDHCYQNLMKIFSVVGSVKTIRTCYPQ  257

Query  817  DPNSSRS------KGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
              N + +      K E    N+LHA +E+E+ E A+KAV +LNDE+NW
Sbjct  258  PSNGTGAATNRPTKLEMLFGNRLHAFVEYETVEDAEKAVAELNDEKNW  305



>ref|XP_011085064.1| PREDICTED: la-related protein 6B-like isoform X1 [Sesamum indicum]
Length=451

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 162/271 (60%), Gaps = 41/271 (15%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMP----VSGYFYP------------YFQYQDWIYVGDQDPTPFY  366
            KLN +APEFVPRS    P    V    Y             Y+ Y+++     Q P  FY
Sbjct  21   KLNAEAPEFVPRSSATAPPLHSVLQNVYARPPPFVSPLPPAYYGYENFY---QQPPMQFY  77

Query  367  SNNQN-LSP-----------PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQM  510
              N N LSP           P    KN L D    KI+ QVE+  SD++L   + L + M
Sbjct  78   GYNSNPLSPAELAADRNNGSPAAVTKNGLSD-AHLKILNQVEFYFSDINLATTDQLFRFM  136

Query  511  SKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKD  690
            SKDPEGYVPIS VAS KKIKS +  N +  L+  LQSS KL+VS DGK VKR+QP TE D
Sbjct  137  SKDPEGYVPISVVASFKKIKSAI--NGSAELSSILQSSKKLLVSEDGKMVKRRQPLTESD  194

Query  691  KEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS------KGEYF  852
             EELQSR ++AENLP+DHSH N+ +IF+ VGSVK+IR C PQ+ N+S S      KG+  
Sbjct  195  MEELQSRIIIAENLPEDHSHQNLMRIFSSVGSVKSIRTCPPQNSNNSASSAFKTGKGDAM  254

Query  853  -ISNKLHALIEFESPEIADKAVEKLNDERNW  942
              + KLHA +EFES E+A+KAV +L DE NW
Sbjct  255  HFNGKLHAFVEFESVELAEKAVIELTDEGNW  285



>gb|EEE51926.1| hypothetical protein OsJ_33536 [Oryza sativa Japonica Group]
Length=470

 Score =   213 bits (542),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 143/193 (74%), Gaps = 10/193 (5%)
 Frame = +1

Query  388  PPQTQQ--KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTK  561
            PP  QQ  ++ + D+V  KI KQVEY  SD++L   E+L + ++KDPEGYVPIS VA  K
Sbjct  91   PPPGQQSGRDGISDDVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPISVVAGFK  150

Query  562  KIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDD  741
            KIK+L+ SN   +LA AL++S+KL+VS+DG +VKR+QPFTE D EELQ+R VVAENLPDD
Sbjct  151  KIKALIQSNA--MLASALRTSSKLVVSNDGTRVKREQPFTESDLEELQARIVVAENLPDD  208

Query  742  HSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIA  903
            H + N+ K+F+ VGSVKTIR C+PQ PN +       +K +   +NKLHA +E+++ E A
Sbjct  209  HCYQNLMKLFSTVGSVKTIRTCYPQTPNGTGPVTNRSAKLDMLFANKLHAFVEYDTVEDA  268

Query  904  DKAVEKLNDERNW  942
            +KA+ +LNDERNW
Sbjct  269  EKAIVELNDERNW  281



>ref|XP_007139081.1| hypothetical protein PHAVU_009G2633000g, partial [Phaseolus vulgaris]
 gb|ESW11075.1| hypothetical protein PHAVU_009G2633000g, partial [Phaseolus vulgaris]
Length=332

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 165/291 (57%), Gaps = 61/291 (21%)
 Frame = +1

Query  235  KLNVQAPEFVP-----RSITQMP-------------VSGYFYPYFQYQDWI---------  333
            +LN QAPEFVP     R+  Q P             V  Y  P+   Q  +         
Sbjct  35   RLNAQAPEFVPTRATPRTDLQQPRLVVSPPPPASSMVHVYSLPHIPIQGHVVPVQNHHHN  94

Query  334  ----------YVGDQDPTPFYSNNQNLSPPQTQQ-----------KNSLPDEVKQKIIKQ  450
                      Y     P  +Y +    S P  QQ           K+ L DE  QKI+ Q
Sbjct  95   LGHQHHVPVHYRSHHHPHQYYVS----SDPTVQQSQVDPDRISSSKSKLSDEASQKILNQ  150

Query  451  VEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTK  630
            VEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S++  +LA  L++S+K
Sbjct  151  VEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFKKIKALITSHS--LLATVLRNSSK  208

Query  631  LIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICH  810
            L+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+ K+F+ VGSVKTIR C 
Sbjct  209  LVVSEDGKKIKRQYPLTESDIEELQSRIVVAENLPEDHCHQNLMKVFSAVGSVKTIRTCP  268

Query  811  PQDPNSSRSKGEYF-------ISNKLHALIEFESPEIADKAVEKLNDERNW  942
            PQ  NS  S            +SNKLHA +E+ES E+A++AV +LNDE NW
Sbjct  269  PQTSNSGASSASRLGKVDGLPLSNKLHAFVEYESVELAERAVAELNDEGNW  319



>gb|EEC67957.1| hypothetical protein OsI_35696 [Oryza sativa Indica Group]
Length=489

 Score =   213 bits (542),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 143/193 (74%), Gaps = 10/193 (5%)
 Frame = +1

Query  388  PPQTQQ--KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTK  561
            PP  QQ  ++ + D+V  KI KQVEY  SD++L   E+L + ++KDPEGYVPIS VA  K
Sbjct  112  PPPGQQSGRDGISDDVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPISVVAGFK  171

Query  562  KIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDD  741
            KIK+L+ SN   +LA AL++S+KL+VS+DG +VKR+QPFTE D EELQ+R VVAENLPDD
Sbjct  172  KIKALIQSNA--MLASALRTSSKLVVSNDGTRVKREQPFTESDLEELQARIVVAENLPDD  229

Query  742  HSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIA  903
            H + N+ K+F+ VGSVKTIR C+PQ PN +       +K +   +NKLHA +E+++ E A
Sbjct  230  HCYQNLMKLFSTVGSVKTIRTCYPQTPNGTGPVTNRSAKLDMLFANKLHAFVEYDTVEDA  289

Query  904  DKAVEKLNDERNW  942
            +KA+ +LNDERNW
Sbjct  290  EKAIVELNDERNW  302



>ref|XP_009343678.1| PREDICTED: la-related protein 6B [Pyrus x bretschneideri]
Length=490

 Score =   211 bits (537),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 207/343 (60%), Gaps = 28/343 (8%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             L DE   KI+ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+L++SN+ 
Sbjct  152   LSDEATSKILNQVEYYFSDINLATTDHLMRFINKDPEGYVPISVVASFKKIKALVNSNSQ  211

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
               LA  L++S+KL+V  DGKKV+R+ P T+ D +ELQSR VVAENLP+DH H N+ K+F+
Sbjct  212   --LATILRNSSKLVVHEDGKKVRRQHPLTQLDMDELQSRIVVAENLPEDHCHQNLMKVFS  269

Query  775   VVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
               GSVKTIR C PQ           S+++ G  F SNKLHA +E+ESPEIA+KAV +LND
Sbjct  270   AAGSVKTIRTCQPQASNSGSSSASRSTKADGMLF-SNKLHAFVEYESPEIAEKAVAELND  328

Query  931   ERNWrkglrvklllrrS--PRSVLKTRKSEFEGCLEDDDQAPPVESAPE-----DSVSSP  1089
             E NWR GLRV+L+LRR+  P  V   +  + E  LE++D +   + A E      S  S 
Sbjct  329   EANWRSGLRVRLMLRRATKPAQVRGKKGQDGEVQLEEEDASTAEQQANEKQSVDSSQQSN  388

Query  1090  LHQLESTE-TNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasg  1266
             +H  E  E TN  +        K  G+ +G+ + R +   GRG    +    +  + A  
Sbjct  389   VHPHEHEERTNSLKYGEEHGNDKEVGQRKGRNKGRVKGR-GRGQYHQNHHNINRGNHAGH  447

Query  1267  ---qsesPMKQA--SKGP---RMPDGTRGFTMGRGKPLNTTAA  1371
                 S    +QA  +K P   RMPDGTRGF MGRGKP     A
Sbjct  448   PPNNSVGSTEQAVVTKQPPGPRMPDGTRGFAMGRGKPATVNIA  490



>ref|XP_008788265.1| PREDICTED: LOW QUALITY PROTEIN: la-related protein 6B-like [Phoenix 
dactylifera]
Length=499

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 139/189 (74%), Gaps = 12/189 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            +  LP+EV QKI KQVEY  SD++L   E+L + +S+DPEG+VPIS +AS KKIK+L+ +
Sbjct  162  REGLPEEVVQKITKQVEYYFSDVNLATTEHLMRFISRDPEGFVPISVIASFKKIKALVHN  221

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N   +LA ALQ+S+KL+VS+DGKKV+R QPFTE D EELQSR VVAENLP+DH + N+ K
Sbjct  222  NP--LLAAALQTSSKLVVSNDGKKVRRLQPFTEGDVEELQSRIVVAENLPEDHCYQNLMK  279

Query  766  IFNVVGSVKTIRICHPQDP----------NSSRSKGEYFISNKLHALIEFESPEIADKAV  915
            +F+ VGSVKTIR C+PQ+P           +  SK E    NKLHA +E+E+ E A+ AV
Sbjct  280  VFSAVGSVKTIRTCYPQNPIGNLNGTTAAANRSSKLEVLFYNKLHAFVEYETIEDAENAV  339

Query  916  EKLNDERNW  942
             +LNDERNW
Sbjct  340  TELNDERNW  348



>gb|AGT16157.1| hypothetical protein SHCRBa_167_G07_R_10 [Saccharum hybrid cultivar 
R570]
Length=305

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 140/195 (72%), Gaps = 9/195 (5%)
 Frame = +1

Query  376  QNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAS  555
            Q+    Q  +  S  D V+ KI KQVEY  SD++L   E+L + +SKDPEGYVPIS VA 
Sbjct  97   QDAEAEQPPRDGSFDDPVR-KIRKQVEYYFSDINLATTEHLMRFISKDPEGYVPISVVAG  155

Query  556  TKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLP  735
             KKIK+L+ SN+  +LA AL++S+KL+VS DG +VKR+QPFTE D EELQ+R VVAENLP
Sbjct  156  FKKIKALVQSNS--MLASALRTSSKLVVSDDGTRVKREQPFTESDLEELQARIVVAENLP  213

Query  736  DDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPE  897
            DDH + N+ ++F+ VGSVKTIR C+PQ PN +       +K +   +NKLHA +E+++ E
Sbjct  214  DDHCYQNLMRLFSAVGSVKTIRTCYPQTPNGTGPATNRSAKLDMLFANKLHAFVEYDTIE  273

Query  898  IADKAVEKLNDERNW  942
             A +A+ +LNDERNW
Sbjct  274  DAARAIVELNDERNW  288



>ref|XP_010912744.1| PREDICTED: la-related protein 6B-like [Elaeis guineensis]
Length=454

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 161/271 (59%), Gaps = 37/271 (14%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQ-----------------MPVSGYFYP------YFQYQDWIYVGD  345
            +LN +APEFVPRS                     PV   ++P      +F      +   
Sbjct  39   RLNAKAPEFVPRSAAADRIDARKPRVVPIHHGPTPVMQVYHPAPPSPTFFAPVPGSFEYY  98

Query  346  QDPTPFYSNNQNLSP------PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQ  507
                      Q   P      P    +  L +EV QKI KQVEY  SD++L   E+L + 
Sbjct  99   GGGGGAGFGEQETVPGPADLDPAPPAREGLSEEVIQKITKQVEYYFSDVNLATTEHLMRF  158

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            +SKDPEG+VPIS +A+ KKIK+L+ +N+  +LA AL++S+KL+VS DGKKV+R+QPFTE 
Sbjct  159  ISKDPEGFVPISVIAAFKKIKALVHNNS--LLAMALRTSSKLVVSDDGKKVRRQQPFTEL  216

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS------KGEY  849
            D EELQSR VVAENLP+DH + N+ K+F+ VGSV TIR C+PQ  N + +      K + 
Sbjct  217  DMEELQSRIVVAENLPEDHCYQNLMKVFSAVGSVNTIRTCYPQTSNGTTAQTNKPTKLDM  276

Query  850  FISNKLHALIEFESPEIADKAVEKLNDERNW  942
               N+LHA +E+E+ E A+KAV +LNDERNW
Sbjct  277  LFGNRLHAFVEYETVEDAEKAVSELNDERNW  307



>ref|XP_010930308.1| PREDICTED: la-related protein 6B-like [Elaeis guineensis]
Length=458

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 141/192 (73%), Gaps = 8/192 (4%)
 Frame = +1

Query  385  SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKK  564
            S P    ++ L DEV QKI KQVEY  SD++L   E+L + +SKDPEG+VPIS +A+ KK
Sbjct  124  SDPAPPARDGLSDEVIQKITKQVEYYFSDINLATTEHLMRFISKDPEGFVPISVIAAFKK  183

Query  565  IKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDH  744
            IK+L+ +N+  +LA AL++S+KL+VS DGKKV+R+QPFTE D EELQSR VVAENLP+DH
Sbjct  184  IKALVHNNS--LLAMALRTSSKLVVSDDGKKVRRQQPFTESDMEELQSRIVVAENLPEDH  241

Query  745  SHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIAD  906
             + N+ K+F+ VGSVK IR C+PQ  N +       +K +    N+LHA IE+E+ E A+
Sbjct  242  CYQNLMKVFSAVGSVKMIRTCYPQLTNGTTTSTNKSAKLDMLFGNRLHAFIEYETVEDAE  301

Query  907  KAVEKLNDERNW  942
            KA+ +LNDE+NW
Sbjct  302  KAIAELNDEKNW  313



>gb|EMT07023.1| La-related protein 7 [Aegilops tauschii]
Length=397

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 135/180 (75%), Gaps = 8/180 (4%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            D+V  KI KQVEY  SD++L   E+L + +SKDPEGYVP+S VAS KKIK+L+ +++  +
Sbjct  26   DDVLHKITKQVEYYFSDINLATTEHLMRFISKDPEGYVPMSVVASFKKIKALVQNSS--M  83

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL++S+KL+VS DG +VKR QPFTE D EELQ+R VVAENLPDDH + N+ KIF+ V
Sbjct  84   LASALRTSSKLVVSEDGNRVKRVQPFTESDLEELQARIVVAENLPDDHCYQNLMKIFSSV  143

Query  781  GSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSVKTIR C+PQ PN S       +K +   +NKLHA +E+E+ E A+KA+  LNDERNW
Sbjct  144  GSVKTIRTCYPQTPNGSGPVTNRSAKLDMLFANKLHAFVEYETIEDAEKAIVVLNDERNW  203



>ref|XP_003577639.1| PREDICTED: la-related protein 6B [Brachypodium distachyon]
Length=488

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 13/200 (7%)
 Frame = +1

Query  376  QNLSPP----QTQQKNSL-PDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPI  540
            Q + PP    Q QQ   L  D+V  KI KQVEY  SD++L   E+L + ++KDPEGYVPI
Sbjct  111  QAVPPPLVQAQQQQGRELTSDDVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPI  170

Query  541  SAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVV  720
            S VAS KKIK+L+ SN+  +LA AL++S+KL+V+ DG +VKR+QPFTE D EELQ+R VV
Sbjct  171  SVVASFKKIKALVQSNS--MLASALRTSSKLVVTEDGNRVKREQPFTESDLEELQARIVV  228

Query  721  AENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIE  882
            AENLPDDH + N+ KIF+ VGSVKTIR C+PQ PN +       +K +   +NKLHA +E
Sbjct  229  AENLPDDHCYQNLMKIFSAVGSVKTIRTCYPQTPNGTGPVTNRSAKLDMLFANKLHAFVE  288

Query  883  FESPEIADKAVEKLNDERNW  942
            +++ + A+KA+  LNDERNW
Sbjct  289  YDTIDGAEKAIVVLNDERNW  308



>tpg|DAA41895.1| TPA: hypothetical protein ZEAMMB73_789693 [Zea mays]
Length=355

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 133/175 (76%), Gaps = 8/175 (5%)
 Frame = +1

Query  436  KIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQAL  615
            KI KQVEY  SD++L   E+L + +SKDPEGYVPIS VA  KKIK+L+ SN+  +LA AL
Sbjct  118  KIRKQVEYYFSDINLATTEHLMRFISKDPEGYVPISVVAGFKKIKALVQSNS--MLASAL  175

Query  616  QSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKT  795
            ++S+KL+VS DG +VKR+QPFTE D EELQ+R VVAENLPDDH + N+ ++F+VVGSV+T
Sbjct  176  RTSSKLVVSDDGARVKREQPFTESDLEELQARIVVAENLPDDHCYQNLMRLFSVVGSVRT  235

Query  796  IRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            IR C+PQ PN +       +K +   +NKLHA +E+++ E A +A+ +LNDERNW
Sbjct  236  IRTCYPQTPNGTGPATNRSAKLDMLFANKLHAFVEYDTIEDAARAIVELNDERNW  290



>ref|XP_004159060.1| PREDICTED: la-related protein 7-like [Cucumis sativus]
Length=356

 Score =   204 bits (519),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 140/187 (75%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159  RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219  HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ  +        S+++ G ++ SNKLHA +E+ES E+A+KAV +
Sbjct  277  IFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKLHAFVEYESVELAEKAVAE  335

Query  922  LNDERNW  942
            LNDE NW
Sbjct  336  LNDEGNW  342



>dbj|BAK05864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 135/182 (74%), Gaps = 8/182 (4%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            + D+V  KI KQVEY  SD++L   E+L + ++KDPEGYVP+S VAS KKIK+L+ S++ 
Sbjct  120  ITDDVLHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPMSVVASFKKIKALVQSSS-  178

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
             +LA AL++S+KL+VS DG +VKR QPFTE D EELQSR VVAENLPDDH + N+ KIF+
Sbjct  179  -MLASALRTSSKLVVSEDGNRVKRGQPFTESDLEELQSRIVVAENLPDDHCYQNLMKIFS  237

Query  775  VVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDER  936
              GSVKTIR C+PQ PN S       +K +   +NKLHA +E+E+ E A+KA+  LNDER
Sbjct  238  SAGSVKTIRTCYPQTPNGSGPVTNRSAKLDMLFANKLHAFVEYETVEDAEKAIVVLNDER  297

Query  937  NW  942
            NW
Sbjct  298  NW  299



>ref|XP_009389160.1| PREDICTED: la-related protein 6B-like [Musa acuminata subsp. 
malaccensis]
Length=446

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 137/184 (74%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            + L DEV QKI KQVEY  SD +L   E+L + ++KDPEG+VPIS VA+ KKIK+L+ +N
Sbjct  117  DGLSDEVIQKITKQVEYYFSDANLATTEHLMRFITKDPEGFVPISVVAAFKKIKALVHNN  176

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +   LA ALQ+STKL+VS DGKKV+R+QPFT+ D EELQSR V+AENLP+DH + N+ KI
Sbjct  177  SQ--LAMALQTSTKLVVSDDGKKVRRQQPFTKSDMEELQSRIVMAENLPEDHCYQNLMKI  234

Query  769  FNVVGSVKTIRICHPQDPNSSRS------KGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+ +GSVKTIR C+PQ  N + +      K E    N+LHA +E+E+ E A+KAV +LN+
Sbjct  235  FSSIGSVKTIRTCYPQPSNGAAAVTNRPTKLEMHFGNRLHAFVEYETVEDAEKAVAELNN  294

Query  931  ERNW  942
            E+NW
Sbjct  295  EKNW  298



>ref|XP_009404917.1| PREDICTED: la-related protein 6B-like [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 137/185 (74%), Gaps = 8/185 (4%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ L +EV QKI KQVEY  SD++L   E+L + ++KDP+G+VPIS VA  KKI++L+ +
Sbjct  127  RDGLSEEVTQKITKQVEYYFSDVNLATTEHLMRFINKDPDGFVPISVVAGFKKIRALVHN  186

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA AL++S+KL+VS DGKKV R+QPFTE D EELQSR VVAENLP+DH + N+ K
Sbjct  187  NSQ--LAMALRTSSKLVVSDDGKKVGRQQPFTESDMEELQSRIVVAENLPEDHCYQNLMK  244

Query  766  IFNVVGSVKTIRICHPQDPNSSR------SKGEYFISNKLHALIEFESPEIADKAVEKLN  927
            IF+ VGSVKTIR C+PQ PN +       +K E    N+LHA + +E+ E A+KAV +LN
Sbjct  245  IFSAVGSVKTIRTCYPQPPNGTAAAVNRPTKLEMLFGNRLHAFVVYETLEDAEKAVAELN  304

Query  928  DERNW  942
            DE+NW
Sbjct  305  DEKNW  309



>ref|XP_008447187.1| PREDICTED: la-related protein 6B isoform X4 [Cucumis melo]
Length=403

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 140/187 (75%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159  RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219  HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ  +        S+++ G ++ SNKLHA +E+ES E+A+KAV +
Sbjct  277  IFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKLHAFVEYESVELAEKAVAE  335

Query  922  LNDERNW  942
            LNDE NW
Sbjct  336  LNDEGNW  342



>ref|XP_008667401.1| PREDICTED: uncharacterized protein LOC100217316 isoform X2 [Zea 
mays]
Length=468

 Score =   205 bits (521),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 135/180 (75%), Gaps = 8/180 (4%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            D+   KI KQVEY  SD++L   E+L + +SKDPEGYVPIS VA  KKIK+L+ SN+  +
Sbjct  113  DDPVPKIRKQVEYYFSDINLATTEHLMRFISKDPEGYVPISVVAGFKKIKALVQSNS--M  170

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL++S+KL+VS DG +VKR+QPFTE D EELQ+R VVAENLPDDH + N+ ++F+VV
Sbjct  171  LASALRTSSKLVVSDDGARVKREQPFTESDLEELQARIVVAENLPDDHCYQNLMRLFSVV  230

Query  781  GSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSV+TIR C+PQ PN +       +K +   +NKLHA +E+++ E A +A+ +LNDERNW
Sbjct  231  GSVRTIRTCYPQTPNGTGPATNRSAKLDMLFANKLHAFVEYDTIEDAARAIVELNDERNW  290



>ref|XP_008667400.1| PREDICTED: uncharacterized protein LOC100217316 isoform X1 [Zea 
mays]
 tpg|DAA41896.1| TPA: hypothetical protein ZEAMMB73_789693 [Zea mays]
Length=470

 Score =   205 bits (521),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 135/180 (75%), Gaps = 8/180 (4%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            D+   KI KQVEY  SD++L   E+L + +SKDPEGYVPIS VA  KKIK+L+ SN+  +
Sbjct  113  DDPVPKIRKQVEYYFSDINLATTEHLMRFISKDPEGYVPISVVAGFKKIKALVQSNS--M  170

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL++S+KL+VS DG +VKR+QPFTE D EELQ+R VVAENLPDDH + N+ ++F+VV
Sbjct  171  LASALRTSSKLVVSDDGARVKREQPFTESDLEELQARIVVAENLPDDHCYQNLMRLFSVV  230

Query  781  GSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSV+TIR C+PQ PN +       +K +   +NKLHA +E+++ E A +A+ +LNDERNW
Sbjct  231  GSVRTIRTCYPQTPNGTGPATNRSAKLDMLFANKLHAFVEYDTIEDAARAIVELNDERNW  290



>ref|XP_008447186.1| PREDICTED: la-related protein 6B isoform X3 [Cucumis melo]
Length=428

 Score =   204 bits (518),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 139/187 (74%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159  RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219  HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766  IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ           S+++ G ++ SNKLHA +E+ES E+A+KAV +
Sbjct  277  IFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKLHAFVEYESVELAEKAVAE  335

Query  922  LNDERNW  942
            LNDE NW
Sbjct  336  LNDEGNW  342



>ref|XP_004251985.1| PREDICTED: la-related protein 6B [Solanum lycopersicum]
Length=473

 Score =   204 bits (520),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 150/271 (55%), Gaps = 40/271 (15%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYFYPYFQYQDWIYVGDQDPTPFYSNNQNLSPPQT-----  399
            KLN QAP F+PR+ +    +    P  Q    I + +Q     Y+   +L  PQ+     
Sbjct  34   KLNAQAPAFLPRTSSGRVYATRAAPLHQITTHIAIQNQF---LYAPQLSLQSPQSPYYGG  90

Query  400  -----------------------QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQM  510
                                    +   L +E  QKI+ QVE+  SD++L   ENL + M
Sbjct  91   GGVARRFVDQEVAAATTADADISAKNGGLTEEAAQKIVNQVEFYFSDLNLATTENLIRHM  150

Query  511  SKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKD  690
             KDPEGYVPIS VAS KKIK+L+ S+    LA+ L+ S  L+VS DGKKVKRK P TE  
Sbjct  151  IKDPEGYVPISVVASFKKIKALIGSHAQ--LAEVLRCSINLVVSEDGKKVKRKNPLTEAA  208

Query  691  KEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEY-------  849
             EELQSR VVAENLP+DH H N+ KIF+ VG VK IR CHPQ  N   S           
Sbjct  209  LEELQSRIVVAENLPEDHCHQNLMKIFSAVGRVKMIRTCHPQPSNGGASSASRSAKSDST  268

Query  850  FISNKLHALIEFESPEIADKAVEKLNDERNW  942
              SNKLHA +E+++ E+A+KAV +LND  NW
Sbjct  269  MYSNKLHAFVEYDAVELAEKAVLELNDVDNW  299



>ref|XP_008447185.1| PREDICTED: la-related protein 6B isoform X2 [Cucumis melo]
Length=444

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 140/187 (75%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159  RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219  HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ  +        S+++ G ++ SNKLHA +E+ES E+A+KAV +
Sbjct  277  IFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKLHAFVEYESVELAEKAVAE  335

Query  922  LNDERNW  942
            LNDE NW
Sbjct  336  LNDEGNW  342



>ref|XP_006577368.1| PREDICTED: la-related protein 6-like isoform X2 [Glycine max]
Length=366

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 9/194 (5%)
 Frame = +1

Query  382  LSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTK  561
            + P     K+ + DE  QKI+ QVEY  SD++L   ++L + ++KDPEG+VPIS VAS K
Sbjct  143  VDPDHAPSKSKMSDEASQKILNQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFK  202

Query  562  KIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDD  741
            KIK+L++S++   LA  L++S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+D
Sbjct  203  KIKALIASHSQ--LATVLRNSSKLVVSEDGKKIKRQYPLTESDIEELQSRIVVAENLPED  260

Query  742  HSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYF-------ISNKLHALIEFESPEI  900
            H H N+ K+F+ VGSVKTIR C PQ  NS  S            +SNKLHA +E+ S E+
Sbjct  261  HCHQNLMKVFSAVGSVKTIRTCPPQTSNSGASATSRLGKVDGMPLSNKLHAFVEYGSVEL  320

Query  901  ADKAVEKLNDERNW  942
            A++AV +LNDE NW
Sbjct  321  AERAVAELNDEGNW  334



>ref|XP_011074010.1| PREDICTED: la-related protein 6B-like [Sesamum indicum]
Length=445

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 155/274 (57%), Gaps = 43/274 (16%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYFYPYFQYQDWIYVG-------------------DQDPT  357
            KLN +APEFVPR       +    P       +Y                      Q+ T
Sbjct  20   KLNAEAPEFVPR--VSSAATPPPPPPPPLLPPVYARPPSFVPPLPPPYYGYENYYQQNLT  77

Query  358  PFYSNNQNLSPP------------QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLA  501
            PFY  N N   P             T  KN L D   QKII QVE+  SD++L   + L 
Sbjct  78   PFYGYNVNPVGPVEFAADGKNGITATSTKNGLSDS-HQKIINQVEFYFSDINLATTDQLF  136

Query  502  KQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFT  681
            + MSKDPEGYVP+S VAS KKIK+ +S +T   LA  L+SS KL+VS DGKKVKR+ P T
Sbjct  137  RYMSKDPEGYVPLSVVASFKKIKTAISDSTQ--LASILRSSNKLLVSEDGKKVKRQHPLT  194

Query  682  EKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS------KG  843
            E D EELQSR V+AENLP+DHSH N+ KIF+ VGSVK+IR C PQ  N+  S      KG
Sbjct  195  ESDMEELQSRIVIAENLPEDHSHQNLMKIFSSVGSVKSIRTCPPQSSNNGASYASKAGKG  254

Query  844  EYF-ISNKLHALIEFESPEIADKAVEKLNDERNW  942
            +    S K HA +E+ES E+A++AV +L D+ NW
Sbjct  255  DGLQFSGKFHAFVEYESAELAERAVAELKDDGNW  288



>ref|XP_004978967.1| PREDICTED: la-related protein 6-like [Setaria italica]
Length=473

 Score =   203 bits (516),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 8/180 (4%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            D+   KI KQVEY  SD++L   E+L + +SKDPEGYVPIS V   KKIK+L+ SN+  +
Sbjct  117  DDPVHKIRKQVEYYFSDINLATTEHLMRFISKDPEGYVPISVVGGFKKIKALVQSNS--M  174

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL++S+KL+VS DG +VKR+QPFTE D EELQ+R VVAENLPDDH + N+ ++F+  
Sbjct  175  LASALRTSSKLVVSDDGTRVKRQQPFTESDLEELQARIVVAENLPDDHCYQNLMRLFSAA  234

Query  781  GSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSV+TIR C+PQ PN +       +K + F +NKLHA +E+++ E A +A+ +LNDERNW
Sbjct  235  GSVRTIRTCYPQTPNGTGPATNRSAKLDMFFANKLHAFVEYDTMEDASRAIVELNDERNW  294



>ref|XP_002449258.1| hypothetical protein SORBIDRAFT_05g006890 [Sorghum bicolor]
 gb|EES08246.1| hypothetical protein SORBIDRAFT_05g006890 [Sorghum bicolor]
Length=481

 Score =   202 bits (515),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 134/180 (74%), Gaps = 8/180 (4%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            D+   KI KQVEY  SD++L   E+L + +SKDPEGYVP+S VA  KKIK+L+ SN+  +
Sbjct  114  DDPVPKIRKQVEYYFSDINLATTEHLMRFISKDPEGYVPMSVVAGFKKIKALVQSNS--M  171

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL++S+KL+VS DG +VKR+QPFTE D EELQ+R VVAENLPDDH + N+ ++F+ V
Sbjct  172  LASALRTSSKLVVSDDGARVKREQPFTESDLEELQARIVVAENLPDDHCYQNLMRLFSAV  231

Query  781  GSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSVKTIR C+PQ PN +       +K +   +NKLHA +E++S E A +A+ +LNDERNW
Sbjct  232  GSVKTIRTCYPQTPNGTGPATNRSAKLDMLFANKLHAFVEYDSIEDAARAIVELNDERNW  291



>gb|AAX96755.1| At2g43970/F6E13.10 [Oryza sativa Japonica Group]
Length=505

 Score =   203 bits (517),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 143/207 (69%), Gaps = 24/207 (12%)
 Frame = +1

Query  388  PPQTQQ--KNSLPDEVKQKIIKQ--------------VEYQLSDMSLLANENLAKQMSKD  519
            PP  QQ  ++ + D+V  KI KQ              VEY  SD++L   E+L + ++KD
Sbjct  112  PPPGQQSGRDGISDDVVHKITKQLARGCLLVHAVVPKVEYYFSDINLATTEHLMRFITKD  171

Query  520  PEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEE  699
            PEGYVPIS VA  KKIK+L+ SN   +LA AL++S+KL+VS+DG +VKR+QPFTE D EE
Sbjct  172  PEGYVPISVVAGFKKIKALIQSNA--MLASALRTSSKLVVSNDGTRVKREQPFTESDLEE  229

Query  700  LQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEYFISN  861
            LQ+R VVAENLPDDH + N+ K+F+ VGSVKTIR C+PQ PN +       +K +   +N
Sbjct  230  LQARIVVAENLPDDHCYQNLMKLFSTVGSVKTIRTCYPQTPNGTGPVTNRSAKLDMLFAN  289

Query  862  KLHALIEFESPEIADKAVEKLNDERNW  942
            KLHA +E+++ E A+KA+ +LNDERNW
Sbjct  290  KLHAFVEYDTVEDAEKAIVELNDERNW  316



>ref|XP_006353141.1| PREDICTED: uncharacterized protein LOC102593695 [Solanum tuberosum]
Length=495

 Score =   203 bits (516),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 150/268 (56%), Gaps = 34/268 (13%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYFYPYFQYQDWIYVGDQ----------DP-TPFYSNN--  375
            KLN QAP F+PR+ +    +    P  Q    + + +Q           P +P+Y     
Sbjct  33   KLNAQAPAFLPRTSSGRIYATRASPLHQITTHVAIQNQFLYAPQMPLQSPQSPYYGGGGV  92

Query  376  ------------QNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKD  519
                               + +   L +E  QKI+ QVE+  SD++L   ENL + M KD
Sbjct  93   ARRFVDQEVAAAATADADNSAKNGGLTEEAAQKIVNQVEFYFSDLNLATTENLIRHMIKD  152

Query  520  PEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEE  699
            PEGYVPIS VAS KKIK+L+ S+    LA+ L+SS  L+VS DGKKVKR+ P TE   EE
Sbjct  153  PEGYVPISVVASFKKIKALIGSHAQ--LAEVLRSSINLVVSDDGKKVKRQNPLTEAALEE  210

Query  700  LQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEY-------FIS  858
            LQSR VVAENLP+DH H N+ KIF+ VG VK IR CHPQ  N   S             S
Sbjct  211  LQSRIVVAENLPEDHCHQNLMKIFSAVGRVKMIRTCHPQPSNGGASSASRSAKSDSTMYS  270

Query  859  NKLHALIEFESPEIADKAVEKLNDERNW  942
            NKLHA +E+++ E+A+KAV +LND  NW
Sbjct  271  NKLHAFVEYDAVELAEKAVLELNDVDNW  298



>gb|AFW56663.1| hypothetical protein ZEAMMB73_374856 [Zea mays]
Length=382

 Score =   200 bits (508),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 169/277 (61%), Gaps = 45/277 (16%)
 Frame = +1

Query  235  KLNVQAPEFVPRS---------------ITQM------PVSGYFYPYFQYQDWIY---VG  342
            +LN QAPEFVPR                + +M      P  G F+   Q + + Y   +G
Sbjct  36   RLNAQAPEFVPRGPPPPAPAVVLPPPPQVIRMFAAPPPPPRGGFFSAPQPRPFEYYAPIG  95

Query  343  DQDPTPFYSNNQN-------LSPPQTQQK----NSLPDEVKQKIIKQVEYQLSDMSLLAN  489
            ++  + F +  Q        + PP   +     + L DEV  KI KQVEY  SD++L   
Sbjct  96   ER--SGFAAKEQQAPELEAEMLPPAAVKTEPVVDGLDDEVVHKITKQVEYYFSDINLATT  153

Query  490  ENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRK  669
            E+L + ++KD EG+VPIS +A  KK+K+ + +N   +LA AL++S+KL+VS DGK+VKR+
Sbjct  154  EHLMRFITKDSEGFVPISVIAGFKKVKTSVRNNV--MLAAALRTSSKLVVSDDGKRVKRQ  211

Query  670  QPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------  831
            QPFTE D +ELQSR VVAENLP D S+ N++KIF+ VGS+ +IR C+PQ PN +      
Sbjct  212  QPFTESDLQELQSRIVVAENLPGDPSYQNLKKIFSAVGSLISIRTCYPQTPNGTGPATNR  271

Query  832  RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
             SK +   +NKLHA +E+E+PE A KA+ +LNDE+NW
Sbjct  272  SSKLDMLFANKLHAFVEYETPEDAAKAILELNDEKNW  308



>ref|XP_007202011.1| hypothetical protein PRUPE_ppa005181mg [Prunus persica]
 gb|EMJ03210.1| hypothetical protein PRUPE_ppa005181mg [Prunus persica]
Length=473

 Score =   202 bits (514),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 9/183 (5%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            L DE   KI+ QVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S + 
Sbjct  147  LSDEATSKILNQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFKKIKALVNSQSQ  206

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              LA  L++S+KL+V  DGKKV+R+ P T+ D EELQSR VVAENLP+DH H N+ K+F+
Sbjct  207  --LATVLRNSSKLVVHEDGKKVRRQHPLTQSDMEELQSRIVVAENLPEDHCHQNLMKVFS  264

Query  775  VVGSVKTIRICHPQDPNSSRSKG-------EYFISNKLHALIEFESPEIADKAVEKLNDE  933
              GSVKTIR C PQ  NSS S             SNKLHA +E+ESPE+A+KAV +LNDE
Sbjct  265  AAGSVKTIRTCQPQTSNSSASPASRSTKADSTLFSNKLHAFVEYESPELAEKAVAELNDE  324

Query  934  RNW  942
             NW
Sbjct  325  ANW  327



>ref|XP_010101330.1| La-related protein 7 [Morus notabilis]
 gb|EXB88277.1| La-related protein 7 [Morus notabilis]
Length=480

 Score =   202 bits (514),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 9/186 (5%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            KN L D+   K++ QVEY  SD++L   ++L + +SKDPEG+VPIS VAS KKIK+L+  
Sbjct  149  KNKLSDDATLKLLNQVEYYFSDLNLATTDHLMRFISKDPEGFVPISVVASFKKIKALI--  206

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            NT   LA  L++S+KL+VS DGKKV+R  P TE D +ELQSR +VAENLP+DH H N+ K
Sbjct  207  NTHSQLAAVLRNSSKLVVSEDGKKVRRLHPLTESDMDELQSRIIVAENLPEDHCHQNLMK  266

Query  766  IFNVVGSVKTIRICHPQDPN-----SSRS--KGEYFISNKLHALIEFESPEIADKAVEKL  924
            IF+ VGSVKTIR C PQ PN     +SR+        SNKLHA +E+ES E+A+KAV +L
Sbjct  267  IFSSVGSVKTIRTCQPQTPNGGAPSASRAAKSDNMLFSNKLHAFVEYESVELAEKAVTEL  326

Query  925  NDERNW  942
            NDE NW
Sbjct  327  NDEGNW  332



>ref|XP_002443059.1| hypothetical protein SORBIDRAFT_08g007220 [Sorghum bicolor]
 gb|EES16897.1| hypothetical protein SORBIDRAFT_08g007220 [Sorghum bicolor]
Length=489

 Score =   202 bits (515),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 117/279 (42%), Positives = 163/279 (58%), Gaps = 47/279 (17%)
 Frame = +1

Query  235  KLNVQAPEFVPRS---------------ITQMPVSG------------------YFYPYF  315
            +LN QAPEFVPR                + +M  +                   Y+ P  
Sbjct  36   RLNAQAPEFVPRGPPSPAPAVVVPPPPQVIRMFAAPPPPPRAAFFAAPPPRPFEYYAPVA  95

Query  316  QYQDWIYVGDQDPTPFYSNNQNLSPPQTQQK----NSLPDEVKQKIIKQVEYQLSDMSLL  483
                +     Q P P       + PP   +     + L DEV  KI KQVEY  SD++L 
Sbjct  96   GRGGFAAKEQQAPEP--EPEAEMLPPAAVKAEPVVDGLDDEVVHKITKQVEYYFSDINLA  153

Query  484  ANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVK  663
              E+L + ++KDPEGYVPIS +A  KK+K+ + +N   +LA AL++S+KL+VS DGK+VK
Sbjct  154  TTEHLMRFITKDPEGYVPISVIAGFKKVKASVHNNV--MLAAALRTSSKLVVSDDGKRVK  211

Query  664  RKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS----  831
            R++PFTE D +ELQSR VVAENLP D S+ N++KIF+ VGSV +IR C+PQ PN +    
Sbjct  212  RQEPFTESDLQELQSRIVVAENLPGDPSYQNLKKIFSAVGSVISIRTCYPQTPNGTGPAT  271

Query  832  --RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
               +K +   +NKLHA +E+E+PE A+KA+ +LNDE+NW
Sbjct  272  NRSAKLDMLFANKLHAFVEYETPEDAEKAILELNDEKNW  310



>ref|XP_002878301.1| hypothetical protein ARALYDRAFT_907506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54560.1| hypothetical protein ARALYDRAFT_907506 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score =   200 bits (509),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 181/343 (53%), Gaps = 78/343 (23%)
 Frame = +1

Query  406   KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
             K+ LP++  QKI+ QVEY  SD++L   + L   +S DP+GYVP+  VAS  KIKS ++S
Sbjct  121   KSGLPEDTVQKIVNQVEYYFSDLNLATTDLLMGFISNDPQGYVPMHIVASFNKIKSSINS  180

Query  586   NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             N+   LA  LQ+S+KL+VS DGK+V+R  P TE   EELQSR VVAENLP+DH + N+ K
Sbjct  181   NSQ--LATVLQNSSKLVVSEDGKRVRRLYPITESALEELQSRIVVAENLPEDHCYQNLLK  238

Query  766   IFNVVGSVKTIRICHPQD-----PNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
             IF+ VGSVK IR   PQ+     P+++RS    F SNK+HA +E+E  E+A+KAV +LN+
Sbjct  239   IFSAVGSVKHIRTSQPQNSGSGPPSAARSAKTDF-SNKVHAFVEYERVELAEKAVAELNE  297

Query  931   ERNWrkglrvklllrrS--PRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLE  1104
             ERNW       +L   +  P+ VL+ R     G  E+DD    +E               
Sbjct  298   ERNWSGLRIRLMLQHETKEPKHVLQER-----GRKEEDDVMRTIEQG-------------  339

Query  1105  STETNVEESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPM  1284
                                         R Q H GRG                  S +PM
Sbjct  340   ----------------------------RGQNHYGRG--------------NHHVSNNPM  357

Query  1285  KQAS--------KGPRMPDGTRGFTMGRGKPLNTTAAPPSSVP  1389
                +        +GPRMPDGTRGF++GRGKP++  A    S P
Sbjct  358   NNKTDQVSMGKQQGPRMPDGTRGFSLGRGKPVSVHARVNRSCP  400



>gb|KDO51617.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=387

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQD--------PNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  364

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  365  AELNDEGNW  373



>ref|XP_008243073.1| PREDICTED: la-related protein 6B [Prunus mume]
Length=473

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 129/183 (70%), Gaps = 9/183 (5%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            L DE   KI+ QVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S + 
Sbjct  147  LSDEATSKILNQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFKKIKALVNSQSQ  206

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              LA  L++S+KL+V  DGKKV+R+ P T+ D EELQSR VVAENLP+DH H N+ K+F+
Sbjct  207  --LATVLRNSSKLVVHEDGKKVRRQHPLTQSDMEELQSRIVVAENLPEDHCHQNLMKVFS  264

Query  775  VVGSVKTIRICHPQDPNSSRSKG-------EYFISNKLHALIEFESPEIADKAVEKLNDE  933
              GSVKTIR C PQ  NS  S             SNKLHA +E+ESPE+A+KAV +LNDE
Sbjct  265  AAGSVKTIRTCQPQTSNSGASSASRSTKADSTLFSNKLHAFVEYESPELAEKAVAELNDE  324

Query  934  RNW  942
             NW
Sbjct  325  ANW  327



>ref|XP_010238604.1| PREDICTED: la-related protein 6B-like [Brachypodium distachyon]
Length=475

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 136/184 (74%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            + L DE  QKI KQVEY  SD++L   E+L + +SKDP+GYVPIS +A  KKIK+L+ +N
Sbjct  113  DGLTDEKVQKITKQVEYYFSDINLATTEHLMRFISKDPQGYVPISVIAGFKKIKALVHNN  172

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +  +LA AL++S+KL+VS DGK++KR+QPFTE D ++ QSR VVAENLP D S+ N+ KI
Sbjct  173  S--MLAAALRTSSKLVVSDDGKRIKRRQPFTESDMQDFQSRIVVAENLPGDPSYQNLMKI  230

Query  769  FNVVGSVKTIRICHPQDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+VVGSV+ IR C+PQ PN +       +K +   +NKLHA +E+E+ E A+KA  +LND
Sbjct  231  FSVVGSVRAIRTCYPQTPNGTGPATNRSAKLDMLFANKLHAFVEYETREDAEKASLELND  290

Query  931  ERNW  942
            ERNW
Sbjct  291  ERNW  294



>gb|KDO51616.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=405

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQD--------PNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  364

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  365  AELNDEGNW  373



>ref|XP_003521844.1| PREDICTED: la-related protein 6-like isoformX1 [Glycine max]
 gb|KHN16371.1| La-related protein 7 [Glycine soja]
Length=475

 Score =   201 bits (511),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 9/194 (5%)
 Frame = +1

Query  382  LSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTK  561
            + P     K+ + DE  QKI+ QVEY  SD++L   ++L + ++KDPEG+VPIS VAS K
Sbjct  143  VDPDHAPSKSKMSDEASQKILNQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFK  202

Query  562  KIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDD  741
            KIK+L++S++   LA  L++S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+D
Sbjct  203  KIKALIASHSQ--LATVLRNSSKLVVSEDGKKIKRQYPLTESDIEELQSRIVVAENLPED  260

Query  742  HSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYF-------ISNKLHALIEFESPEI  900
            H H N+ K+F+ VGSVKTIR C PQ  NS  S            +SNKLHA +E+ S E+
Sbjct  261  HCHQNLMKVFSAVGSVKTIRTCPPQTSNSGASATSRLGKVDGMPLSNKLHAFVEYGSVEL  320

Query  901  ADKAVEKLNDERNW  942
            A++AV +LNDE NW
Sbjct  321  AERAVAELNDEGNW  334



>ref|XP_004244780.1| PREDICTED: la-related protein 6B [Solanum lycopersicum]
Length=456

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 154/255 (60%), Gaps = 24/255 (9%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPV-----SGYFYP---YFQYQDWIYVGDQDPTPFYSNNQ----  378
            +LN  AP FVPRSI+  P         F+P   ++ Y   + V  Q P+P+Y        
Sbjct  42   RLNALAPAFVPRSISPTPSLNDLNQADFHPLPNHYVYAPQLQV--QYPSPYYGGGGGGVA  99

Query  379  NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAST  558
            ++      ++  L DE  QKI+ QVE+  SD++L   ++L K M KD EGYVPIS VA  
Sbjct  100  DVDHASASKRGGLTDEAAQKIVNQVEFYFSDLNLATTDHLIKHMLKDQEGYVPISVVALF  159

Query  559  KKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPD  738
            KKIK+L+ ++    LAQ L+SSTKL+VS DG KVKRK P  E D +ELQSR V+AENLP+
Sbjct  160  KKIKALIRNHAQ--LAQVLRSSTKLVVSEDGMKVKRKIPLAETDLKELQSRIVIAENLPE  217

Query  739  DHSHHNIEKIFNVVGSVKTIRICHPQDPNS-------SRSKGEYFISNKLHALIEFESPE  897
            DH H N+ KIF+ VGSVK IR C PQ  N        +        SNKLHA +E+E+ E
Sbjct  218  DHCHQNLMKIFSAVGSVKMIRTCLPQSSNGGASSGSRTAKSDSTLHSNKLHAFVEYETAE  277

Query  898  IADKAVEKLNDERNW  942
            +A++A  +LND+ NW
Sbjct  278  LAERAAVELNDD-NW  291



>gb|KHG02211.1| La-related 7 [Gossypium arboreum]
Length=422

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            KN L +E   KI+ QVEY   D++L   ++L + ++KDP+GYVPIS VAS KKIK+L+++
Sbjct  138  KNGLSEEATLKILNQVEYYFGDLNLATTDHLMRFINKDPDGYVPISVVASFKKIKALVTT  197

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            ++   LA  L++S KL+VS DGKKV+R+ P TE D EELQSR +VAENLP+DH H N+ K
Sbjct  198  HSQ--LATVLRNSAKLVVSEDGKKVRRQHPLTESDMEELQSRIIVAENLPEDHCHQNLMK  255

Query  766  IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVKTIR C PQ           S++S G +F SNKLHA +E+E+ E+A+KAV +
Sbjct  256  IFSAVGSVKTIRTCQPQPSGGGMSSASRSAKSDGMHF-SNKLHAFVEYETVELAEKAVAE  314

Query  922  LNDERNW  942
            LN+E NW
Sbjct  315  LNEEGNW  321



>ref|XP_003554803.1| PREDICTED: la-related protein 6-like isoform 1 [Glycine max]
 gb|KHN11343.1| La-related protein 7 [Glycine soja]
Length=467

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 9/186 (5%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K+ + DE  QKI+ QVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S
Sbjct  143  KSKMSDEASQKILNQVEYYFSDLNLATTDHLMRFVNKDPEGFVPISVVASFKKIKALIAS  202

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            ++   LA  L++S+KL+VS DGKK+KR+ P TE D EE+QSR VVAENLP+DH H N+ K
Sbjct  203  HSQ--LATVLRNSSKLVVSEDGKKIKRQYPLTESDIEEIQSRIVVAENLPEDHCHQNLMK  260

Query  766  IFNVVGSVKTIRICHPQDPNSSRSKGEYF-------ISNKLHALIEFESPEIADKAVEKL  924
            +F+ VGSVKTIR C PQ  NS  S            +SNKLHA +E+ES E+A++AV +L
Sbjct  261  VFSAVGSVKTIRTCPPQTSNSGASSASRLGKVDGMPLSNKLHAFVEYESVELAERAVAEL  320

Query  925  NDERNW  942
            N+E NW
Sbjct  321  NEEGNW  326



>ref|NP_001148460.1| LOC100282075 [Zea mays]
 gb|ACG31573.1| RNA binding protein [Zea mays]
Length=490

 Score =   201 bits (510),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 169/277 (61%), Gaps = 45/277 (16%)
 Frame = +1

Query  235  KLNVQAPEFVPRS---------------ITQM------PVSGYFYPYFQYQDWIY---VG  342
            +LN QAPEFVPR                + +M      P  G F+   Q + + Y   +G
Sbjct  36   RLNAQAPEFVPRGPPPPAPAVVLPPPPQVIRMFAAPPPPPRGGFFSAPQPRPFEYYAPIG  95

Query  343  DQDPTPFYSNNQN-------LSPPQTQQK----NSLPDEVKQKIIKQVEYQLSDMSLLAN  489
            ++  + F +  Q        + PP   +     + L DEV  KI KQVEY  SD++L   
Sbjct  96   ER--SGFAAKEQQAPELEAEMLPPAAVKTEPVVDGLDDEVVHKITKQVEYYFSDINLATT  153

Query  490  ENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRK  669
            E+L + ++KD EGYVPIS +A  KK+K+ + +N   +LA AL++S+KL+VS DGK+VKR+
Sbjct  154  EHLMRFITKDSEGYVPISVIAGFKKVKTSVRNNV--MLAAALRTSSKLVVSDDGKRVKRQ  211

Query  670  QPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------  831
            QPFTE D +ELQSR VVAENLP D S+ N++KIF+ VGS+ +IR C+PQ PN +      
Sbjct  212  QPFTESDLQELQSRIVVAENLPGDPSYQNLKKIFSAVGSLISIRTCYPQTPNGTGPATNR  271

Query  832  RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
             SK +   +NKLHA +E+E+PE A KA+ +LNDE+NW
Sbjct  272  SSKLDMLFANKLHAFVEYETPEDAAKAILELNDEKNW  308



>ref|XP_004960758.1| PREDICTED: la-related protein 6-like [Setaria italica]
Length=494

 Score =   200 bits (509),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 159/279 (57%), Gaps = 47/279 (17%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSG----------------------------------YFYPY  312
            +LN QAPEFVPR                                           Y+ P 
Sbjct  36   RLNAQAPEFVPRGPPSPAPPAVVVPPPPQVIRVFAAPPPPPRAAFFAPPPPRPFEYYAPV  95

Query  313  FQYQDWIYVGDQDPTPFYSNNQNLSPPQT---QQKNSLPDEVKQKIIKQVEYQLSDMSLL  483
                 +     Q P P    +  L PP     Q  + L DEV  KI KQVEY  SD++L 
Sbjct  96   GGRGGFTTKEQQVPEP--EPDAELLPPAAKAEQAVDGLEDEVVHKITKQVEYYFSDINLA  153

Query  484  ANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVK  663
              E+L + ++KDPEGYVPIS +A  KK+K+ + +N   +LA+AL++S+KL+VS DGK+VK
Sbjct  154  TTEHLMRFITKDPEGYVPISVIAGFKKVKASVRNNF--MLAEALRTSSKLVVSDDGKRVK  211

Query  664  RKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS----  831
            R++PFTE D +EL+SR VVAENLP D S+ N++KIF+ VGSV +IR C+PQ PN S    
Sbjct  212  RQEPFTESDLQELKSRIVVAENLPGDPSYQNLKKIFSAVGSVISIRTCYPQTPNGSGPAT  271

Query  832  --RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
               +K +   SNKLHA +E+E+PE A+KA+  L+DE NW
Sbjct  272  NRSAKLDMLFSNKLHAFVEYETPEDAEKAIVALSDEENW  310



>gb|KDO51615.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=451

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  364

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  365  AELNDEGNW  373



>gb|ACR36891.1| unknown [Zea mays]
 gb|AFW56662.1| RNA binding protein [Zea mays]
Length=490

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 169/277 (61%), Gaps = 45/277 (16%)
 Frame = +1

Query  235  KLNVQAPEFVPRS---------------ITQM------PVSGYFYPYFQYQDWIY---VG  342
            +LN QAPEFVPR                + +M      P  G F+   Q + + Y   +G
Sbjct  36   RLNAQAPEFVPRGPPPPAPAVVLPPPPQVIRMFAAPPPPPRGGFFSAPQPRPFEYYAPIG  95

Query  343  DQDPTPFYSNNQN-------LSPPQTQQK----NSLPDEVKQKIIKQVEYQLSDMSLLAN  489
            ++  + F +  Q        + PP   +     + L DEV  KI KQVEY  SD++L   
Sbjct  96   ER--SGFAAKEQQAPELEAEMLPPAAVKTEPVVDGLDDEVVHKITKQVEYYFSDINLATT  153

Query  490  ENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRK  669
            E+L + ++KD EG+VPIS +A  KK+K+ + +N   +LA AL++S+KL+VS DGK+VKR+
Sbjct  154  EHLMRFITKDSEGFVPISVIAGFKKVKTSVRNNV--MLAAALRTSSKLVVSDDGKRVKRQ  211

Query  670  QPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------  831
            QPFTE D +ELQSR VVAENLP D S+ N++KIF+ VGS+ +IR C+PQ PN +      
Sbjct  212  QPFTESDLQELQSRIVVAENLPGDPSYQNLKKIFSAVGSLISIRTCYPQTPNGTGPATNR  271

Query  832  RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
             SK +   +NKLHA +E+E+PE A KA+ +LNDE+NW
Sbjct  272  SSKLDMLFANKLHAFVEYETPEDAAKAILELNDEKNW  308



>gb|EPS72682.1| hypothetical protein M569_02071, partial [Genlisea aurea]
Length=320

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 160/277 (58%), Gaps = 50/277 (18%)
 Frame = +1

Query  238  LNVQAPEFVPRSITQ------------MPVSGYFY-----------PYFQYQDWIYVGDQ  348
            LN +APEFVPRS +             +P +  +             Y+ Y+++     Q
Sbjct  24   LNAEAPEFVPRSSSSSSAAATTPSAQLLPQAALYARPPSFIRPLVPAYYGYENYF---PQ  80

Query  349  DPTPFYSNNQNLSP-------------PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLAN  489
               PFY    N+SP             P    +N L D   QK+I QVE+  SD++L   
Sbjct  81   KVVPFYG--YNVSPLSQRDFSVDGSNSPAAPVRNGLTD-AHQKVINQVEFYFSDINLATT  137

Query  490  ENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRK  669
            + L + M KDPEGY PIS VAS KKIK+ +S ++   LA  L++S KLIVS DGKKVKR+
Sbjct  138  DQLFRFMCKDPEGYAPISVVASFKKIKNAISDSSQ--LASVLRNSNKLIVSEDGKKVKRQ  195

Query  670  QPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS----  837
            QP TE D EELQ+R +VAENLP+DHSH N+ KIF+ VGSVK+IR C PQ  N   S    
Sbjct  196  QPLTESDMEELQARIIVAENLPEDHSHQNLLKIFSSVGSVKSIRTCPPQSWNGVSSASKT  255

Query  838  -KGEYF-ISNKLHALIEFESPEIADKAVEKLNDERNW  942
             KG+   ++ KLH  +E++S E A+KAV +LND+ NW
Sbjct  256  PKGDGLNLNGKLHTFVEYKSAEEAEKAVMELNDDGNW  292



>gb|ABA96798.2| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=310

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            +  PDEV  KI KQVEY  SD++L   E+L + ++KDPEGYVPI+ +A   KIK+L+ +N
Sbjct  113  DGFPDEVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPITVIAGFNKIKALVHNN  172

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +  +LA AL++S+KL+VS DGK+VKR Q FT  D ++LQSR VVAENLP D  + N+ KI
Sbjct  173  S--MLAAALRTSSKLVVSDDGKRVKRLQSFTVSDMQDLQSRIVVAENLPGDPCYQNLMKI  230

Query  769  FNVVGSVKTIRICHPQ-----DPNSSRS-KGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+ VGSVKTIR C+PQ      P ++RS K +   +NKLHA +E+E+ E A+KA+ +LND
Sbjct  231  FSTVGSVKTIRTCYPQSSNGNSPATNRSAKLDMLFANKLHAFVEYETLEDAEKAILELND  290

Query  931  ERNW  942
            E+NW
Sbjct  291  EKNW  294



>ref|XP_011011378.1| PREDICTED: la-related protein 6B-like isoform X2 [Populus euphratica]
Length=405

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 10/181 (6%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+++++N+   
Sbjct  166  DEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAVVNNNSQ--  223

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA  L++STKL+VS DGKKV+R+ P TE D EELQSR VVAENLP+DH H N+ KIF+ V
Sbjct  224  LATILRNSTKLVVSEDGKKVRRQHPLTESDVEELQSRIVVAENLPEDHCHQNLMKIFSAV  283

Query  781  GSVKTIRICHPQ-------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVKTIR C PQ          S ++ G +F SNKLHA +E+E+ EIA+KAV +LNDE N
Sbjct  284  GSVKTIRTCPPQPSGGASSASRSGKADGMHF-SNKLHAFVEYETVEIAEKAVAELNDEGN  342

Query  940  W  942
            W
Sbjct  343  W  343



>ref|XP_011001840.1| PREDICTED: la-related protein 6B-like isoform X2 [Populus euphratica]
Length=405

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 10/181 (6%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+++++N+   
Sbjct  166  DEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAVVNNNSQ--  223

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA  L++STKL+VS DGKKV+R+ P TE D EELQSR VVAENLP+DH H N+ KIF+ V
Sbjct  224  LATILRNSTKLVVSEDGKKVRRQHPLTESDVEELQSRIVVAENLPEDHCHQNLMKIFSAV  283

Query  781  GSVKTIRICHPQ-------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVKTIR C PQ          S ++ G +F SNKLHA +E+E+ EIA+KAV +LNDE N
Sbjct  284  GSVKTIRTCPPQPSGGASSASRSGKADGMHF-SNKLHAFVEYETVEIAEKAVAELNDEGN  342

Query  940  W  942
            W
Sbjct  343  W  343



>dbj|BAJ88869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 126/169 (75%), Gaps = 8/169 (5%)
 Frame = +1

Query  454  EYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKL  633
            EY  SD++L   E+L + ++KDPEGYVP+S VAS KKIK+L+ S++  +LA AL++S+KL
Sbjct  1    EYYFSDINLATTEHLMRFITKDPEGYVPMSVVASFKKIKALVQSSS--MLASALRTSSKL  58

Query  634  IVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHP  813
            +VS DG +VKR QPFTE D EELQSR VVAENLPDDH + N+ KIF+  GSVKTIR C+P
Sbjct  59   VVSEDGNRVKRGQPFTESDLEELQSRIVVAENLPDDHCYQNLMKIFSSAGSVKTIRTCYP  118

Query  814  QDPNSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            Q PN S       +K +   +NKLHA +E+E+ E A+KA+  LNDERNW
Sbjct  119  QTPNGSGPVTNRSAKLDMLFANKLHAFVEYETVEDAEKAIVVLNDERNW  167



>ref|XP_006493132.1| PREDICTED: lateral signaling target protein 2 homolog [Citrus 
sinensis]
Length=536

 Score =   198 bits (504),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  186  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  245

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  246  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  303

Query  760  EKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  304  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  362

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  363  AELNDEGNW  371



>ref|XP_006442037.1| hypothetical protein CICLE_v10019649mg [Citrus clementina]
 gb|ESR55277.1| hypothetical protein CICLE_v10019649mg [Citrus clementina]
Length=536

 Score =   198 bits (504),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  185  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  244

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  245  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  302

Query  760  EKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  303  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  361

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  362  AELNDEGNW  370



>gb|KDO51612.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=532

 Score =   198 bits (504),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  364

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  365  AELNDEGNW  373



>gb|KDO51613.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=539

 Score =   198 bits (504),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  364

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  365  AELNDEGNW  373



>gb|KDO51614.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=539

 Score =   198 bits (504),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 11/189 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KA+
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAI  364

Query  916  EKLNDERNW  942
             +LNDE NW
Sbjct  365  AELNDEGNW  373



>ref|XP_002323712.2| hypothetical protein POPTR_0017s04020g [Populus trichocarpa]
 gb|EEF03845.2| hypothetical protein POPTR_0017s04020g [Populus trichocarpa]
Length=483

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 10/181 (6%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+++++N+   
Sbjct  166  DEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAVVNNNSQ--  223

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA  L++STKL+VS DGKKV+R+ P TE D EELQSR VVAENLP+DH H N+ KIF+ V
Sbjct  224  LATILRNSTKLVVSEDGKKVRRQHPLTESDVEELQSRIVVAENLPEDHCHQNLMKIFSAV  283

Query  781  GSVKTIRICHPQ-------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVKTIR C PQ          S ++ G +F SNKLHA +E+E+ EIA+KAV +LNDE N
Sbjct  284  GSVKTIRTCPPQPSGGASSASRSGKADGMHF-SNKLHAFVEYETVEIAEKAVAELNDEGN  342

Query  940  W  942
            W
Sbjct  343  W  343



>ref|XP_008394254.1| PREDICTED: la-related protein 6B [Malus domestica]
Length=490

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 129/183 (70%), Gaps = 9/183 (5%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            L DE   KI+ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+L++SN  
Sbjct  152  LSDEATSKILNQVEYYFSDLNLATTDHLMRFINKDPEGYVPISVVASFKKIKALVNSNXQ  211

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              LA  L++S+KL+V  DGKKV+R+ P T+ D +ELQSR VVAENLP+DH H N+ K+F+
Sbjct  212  --LASILRNSSKLVVHEDGKKVRRQHPLTQLDMDELQSRIVVAENLPEDHCHQNLMKVFS  269

Query  775  VVGSVKTIRICHPQDPNSSRSKGE-------YFISNKLHALIEFESPEIADKAVEKLNDE  933
              GSVKTIR C PQ  NS  S             SNKLHA +E+ESPEIA+KAV +LNDE
Sbjct  270  AAGSVKTIRTCQPQASNSGASSASRSAKADGMLFSNKLHAFVEYESPEIAEKAVAELNDE  329

Query  934  RNW  942
             NW
Sbjct  330  ANW  332



>ref|XP_011011377.1| PREDICTED: la-related protein 6B-like isoform X1 [Populus euphratica]
Length=483

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 10/181 (6%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+++++N+   
Sbjct  166  DEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAVVNNNSQ--  223

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA  L++STKL+VS DGKKV+R+ P TE D EELQSR VVAENLP+DH H N+ KIF+ V
Sbjct  224  LATILRNSTKLVVSEDGKKVRRQHPLTESDVEELQSRIVVAENLPEDHCHQNLMKIFSAV  283

Query  781  GSVKTIRICHPQ-------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVKTIR C PQ          S ++ G +F SNKLHA +E+E+ EIA+KAV +LNDE N
Sbjct  284  GSVKTIRTCPPQPSGGASSASRSGKADGMHF-SNKLHAFVEYETVEIAEKAVAELNDEGN  342

Query  940  W  942
            W
Sbjct  343  W  343



>ref|XP_011001839.1| PREDICTED: la-related protein 6B-like isoform X1 [Populus euphratica]
Length=483

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 10/181 (6%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+++++N+   
Sbjct  166  DEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAVVNNNSQ--  223

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA  L++STKL+VS DGKKV+R+ P TE D EELQSR VVAENLP+DH H N+ KIF+ V
Sbjct  224  LATILRNSTKLVVSEDGKKVRRQHPLTESDVEELQSRIVVAENLPEDHCHQNLMKIFSAV  283

Query  781  GSVKTIRICHPQ-------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVKTIR C PQ          S ++ G +F SNKLHA +E+E+ EIA+KAV +LNDE N
Sbjct  284  GSVKTIRTCPPQPSGGASSASRSGKADGMHF-SNKLHAFVEYETVEIAEKAVAELNDEGN  342

Query  940  W  942
            W
Sbjct  343  W  343



>ref|XP_009366258.1| PREDICTED: la-related protein 6B-like [Pyrus x bretschneideri]
Length=491

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 153/228 (67%), Gaps = 11/228 (5%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             L DE   KI+ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KKIK+L++ N+ 
Sbjct  156   LSDEATSKILNQVEYYFSDLNLATTDHLMRFINKDPEGYVPISVVASFKKIKALINGNSQ  215

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
               LA  L++S+KL+V  DGKKV+R  P T+ D EELQSR VVAENLP+DH H N+ K+F+
Sbjct  216   --LATVLRNSSKLVVHEDGKKVRRLHPLTQLDMEELQSRIVVAENLPEDHCHQNLMKVFS  273

Query  775   VVGSVKTIRICHPQDPNSSRSKGE-------YFISNKLHALIEFESPEIADKAVEKLNDE  933
               GSVKTIR C PQ  NS  S             SNKLHA +E+ESPEIA+ AV +LNDE
Sbjct  274   AAGSVKTIRTCQPQGSNSGASSASRSAKADGMLFSNKLHAFVEYESPEIAENAVAELNDE  333

Query  934   RNWrkglrvklllrrS--PRSVLKTRKSEFEGCLEDDDQAPPVESAPE  1071
              NWR GLRV+L+L R+  P  V   +  + E  LE++D + P + A E
Sbjct  334   ANWRSGLRVRLMLGRASKPAQVRGKKGLDGEVQLEEEDASTPEQQANE  381



>ref|XP_006342440.1| PREDICTED: la-related protein 6-like [Solanum tuberosum]
Length=518

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            L DE  QKII QVE+  SD++L   ++L + M KDPEGYVP+S VAS KKIK+L S++  
Sbjct  173  LSDEACQKIINQVEFYFSDINLATTDHLIRIMFKDPEGYVPMSVVASFKKIKALTSNHA-  231

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              +A+ LQ STKL+VS DG+KV+R+ P +EKD EELQSR VVAENLPDDH H N+ KIF+
Sbjct  232  -YVAKILQCSTKLVVSEDGRKVRRQFPLSEKDLEELQSRIVVAENLPDDHCHQNLMKIFS  290

Query  775  VVGSVKTIRICHPQ---DPNSSRSKGE---YFISNKLHALIEFESPEIADKAVEKLNDER  936
             VGSV+ IR C PQ     +++   G+      SNKLHA +E+ES E+A+KAV +LNDE 
Sbjct  291  AVGSVRMIRTCQPQLNGGASAASRTGKSDSTLYSNKLHAFVEYESIELAEKAVMELNDED  350

Query  937  NW  942
            NW
Sbjct  351  NW  352



>ref|XP_002529112.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF33296.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=524

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 134/182 (74%), Gaps = 11/182 (6%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            DE  QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KK+K+ ++SN+   
Sbjct  200  DEPMQKLLNQVEYYFSDLNLATTDHLMRFINKDPDGYVPISVVASFKKVKAAINSNSH--  257

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA  L++S KL+VS DGK+V+R+ P TE D EELQSR VVAENLP+DH H N+ KIF+ V
Sbjct  258  LASILRNSAKLVVSEDGKRVRRQNPLTELDVEELQSRIVVAENLPEDHCHQNLMKIFSAV  317

Query  781  GSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDER  936
            GSVKTIR C PQ           S++ +G +F SNKLHA +E+ES EIA+KAV +LNDE+
Sbjct  318  GSVKTIRTCPPQTSGGGASSASRSAKGEGMHF-SNKLHAFVEYESVEIAEKAVAELNDEQ  376

Query  937  NW  942
            NW
Sbjct  377  NW  378



>ref|XP_006380252.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
 gb|ERP58049.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
Length=461

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 137/194 (71%), Gaps = 11/194 (6%)
 Frame = +1

Query  385  SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKK  564
            S     + +S  DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK
Sbjct  174  SSDHASKSDSKSDEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKK  233

Query  565  IKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDH  744
            +K+ ++SN+   LA  L++STKL+VS DGKKV+R+ P T+ D EELQSR VVAENLP+DH
Sbjct  234  VKAAINSNSQ--LANILRNSTKLVVSDDGKKVRRQHPLTDSDVEELQSRIVVAENLPEDH  291

Query  745  SHHNIEKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEI  900
             H N+ KIF+ VGSVKTIR C PQ           S+++ G +F SNKLHA +E+E+ EI
Sbjct  292  CHQNLMKIFSAVGSVKTIRTCPPQTSGGGASSASRSAKADGMHF-SNKLHAFVEYETIEI  350

Query  901  ADKAVEKLNDERNW  942
            A+KAV +LNDE NW
Sbjct  351  AEKAVAELNDEGNW  364



>ref|XP_006664435.1| PREDICTED: la-related protein 7-like [Oryza brachyantha]
Length=402

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 135/184 (73%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            + LPDEV  KI KQVE+  SD++L   E+L + ++KDPEGYVPI+ +A   KIK+L+ +N
Sbjct  38   DGLPDEVVHKITKQVEFYFSDINLATTEHLMRFITKDPEGYVPITVIAGFNKIKALVHNN  97

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +  +LA AL++S+KL+VS DGK+VKR Q FTE D + LQSR VVAENLP D  + N+ KI
Sbjct  98   S--MLAAALRTSSKLVVSDDGKRVKRLQSFTESDMQYLQSRIVVAENLPGDPCYQNLMKI  155

Query  769  FNVVGSVKTIRICHPQ-----DPNSSRS-KGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+ VGSVKTIR C+PQ      P ++RS K +   +NKLHA +E+E+ E A+KA+ +LND
Sbjct  156  FSAVGSVKTIRTCYPQSSNGNSPATNRSAKLDMLFANKLHAFVEYETIEDAEKAILELND  215

Query  931  ERNW  942
            E+NW
Sbjct  216  EKNW  219



>ref|XP_004253040.1| PREDICTED: la-related protein 6B-like [Solanum lycopersicum]
Length=514

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            L DE  QKII QVE+  SD++L   ++L + M KDPEGYVP+S VAS KKIK+L S++  
Sbjct  170  LSDEACQKIINQVEFYFSDINLATTDHLIRIMFKDPEGYVPMSVVASFKKIKALTSNHA-  228

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              +A+ LQ STKL+VS DG+KV+R+ P +EKD EELQSR VVAENLPDDH H N+ KIF+
Sbjct  229  -YVAKILQCSTKLVVSEDGRKVRRQFPLSEKDLEELQSRIVVAENLPDDHCHQNLMKIFS  287

Query  775  VVGSVKTIRICHPQ---DPNSSRSKGE---YFISNKLHALIEFESPEIADKAVEKLNDER  936
             VGSV+ IR C PQ     +++   G+      SNKLHA +E+ES E+A+KAV +LNDE 
Sbjct  288  AVGSVRMIRTCQPQLNGGASAASRTGKSDTTLYSNKLHAFVEYESIELAEKAVMELNDED  347

Query  937  NW  942
            NW
Sbjct  348  NW  349



>ref|XP_002310383.2| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
 gb|EEE90833.2| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
Length=516

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 135/186 (73%), Gaps = 11/186 (6%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            +S  DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+ ++SN
Sbjct  182  DSKSDEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAAINSN  241

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +   LA  L++STKL+VS DGKKV+R+ P T+ D EELQSR VVAENLP+DH H N+ KI
Sbjct  242  SQ--LANILRNSTKLVVSDDGKKVRRQHPLTDSDVEELQSRIVVAENLPEDHCHQNLMKI  299

Query  769  FNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKL  924
            F+ VGSVKTIR C PQ           S+++ G +F SNKLHA +E+E+ EIA+KAV +L
Sbjct  300  FSAVGSVKTIRTCPPQTSGGGASSASRSAKADGMHF-SNKLHAFVEYETIEIAEKAVAEL  358

Query  925  NDERNW  942
            NDE NW
Sbjct  359  NDEGNW  364



>ref|NP_001067617.1| Os11g0248200 [Oryza sativa Japonica Group]
 dbj|BAF27980.1| Os11g0248200, partial [Oryza sativa Japonica Group]
Length=354

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 126/166 (76%), Gaps = 8/166 (5%)
 Frame = +1

Query  463  LSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVS  642
             SD++L   E+L + ++KDPEGYVPIS VA  KKIK+L+ SN   +LA AL++S+KL+VS
Sbjct  2    FSDINLATTEHLMRFITKDPEGYVPISVVAGFKKIKALIQSNA--MLASALRTSSKLVVS  59

Query  643  SDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDP  822
            +DG +VKR+QPFTE D EELQ+R VVAENLPDDH + N+ K+F+ VGSVKTIR C+PQ P
Sbjct  60   NDGTRVKREQPFTESDLEELQARIVVAENLPDDHCYQNLMKLFSTVGSVKTIRTCYPQTP  119

Query  823  NSS------RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            N +       +K +   +NKLHA +E+++ E A+KA+ +LNDERNW
Sbjct  120  NGTGPVTNRSAKLDMLFANKLHAFVEYDTVEDAEKAIVELNDERNW  165



>ref|XP_006380251.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
 gb|ERP58048.1| hypothetical protein POPTR_0007s00450g [Populus trichocarpa]
Length=515

 Score =   196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 135/186 (73%), Gaps = 11/186 (6%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            +S  DE   K++ QVEY  SD++L   ++L + ++KDPEGYVPIS VAS KK+K+ ++SN
Sbjct  182  DSKSDEAMNKLLNQVEYYFSDLNLATTDHLMRFITKDPEGYVPISVVASFKKVKAAINSN  241

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +   LA  L++STKL+VS DGKKV+R+ P T+ D EELQSR VVAENLP+DH H N+ KI
Sbjct  242  SQ--LANILRNSTKLVVSDDGKKVRRQHPLTDSDVEELQSRIVVAENLPEDHCHQNLMKI  299

Query  769  FNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKL  924
            F+ VGSVKTIR C PQ           S+++ G +F SNKLHA +E+E+ EIA+KAV +L
Sbjct  300  FSAVGSVKTIRTCPPQTSGGGASSASRSAKADGMHF-SNKLHAFVEYETIEIAEKAVAEL  358

Query  925  NDERNW  942
            NDE NW
Sbjct  359  NDEGNW  364



>ref|XP_009598306.1| PREDICTED: la-related protein 6B [Nicotiana tomentosiformis]
Length=491

 Score =   194 bits (494),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 155/279 (56%), Gaps = 50/279 (18%)
 Frame = +1

Query  238  LNVQAPEFVPRS-----------ITQMPVSG------YFYP---------YFQYQDWIYV  339
            LN  AP F+PR+           +T +  +G      Y  P         +F Y   + V
Sbjct  53   LNALAPAFIPRTSSSPSISPSTSLTDLNQAGKTLVHVYATPAATLHPVQNHFVYAPQLPV  112

Query  340  GDQDPTPFYSN-----------NQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLA  486
              Q P+PFY               +L      +   L +E  QKII QVE+  SD++L  
Sbjct  113  --QYPSPFYGGVLAGVAQEMVIGADLD--HASKNGGLTEEALQKIINQVEFYFSDLNLAT  168

Query  487  NENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKR  666
             ++L K M KDPEGYVPIS VA  KKIK+L+ S+    LAQ L+SSTKL+VS DG KVKR
Sbjct  169  TDHLIKHMLKDPEGYVPISVVALFKKIKALVDSHAQ--LAQVLRSSTKLVVSDDGMKVKR  226

Query  667  KQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKG-  843
            K   TE D +EL SR V+AENLP+DH H N+ KIF+ VGSVK IR C PQ  +   S G 
Sbjct  227  KISLTETDLKELLSRIVIAENLPEDHCHQNLMKIFSAVGSVKMIRTCQPQYSSGWASSGS  286

Query  844  ------EYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
                      SNKLHA +E+ES ++A++AV +LNDE NW
Sbjct  287  RTAKSDSMMYSNKLHAFVEYESIKLAERAVAELNDEDNW  325



>gb|EAY82629.1| hypothetical protein OsI_37849 [Oryza sativa Indica Group]
Length=478

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 135/184 (73%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            + LPDEV  KI KQVEY  SD++L   E+L + ++KDPEGYVPI+ +A   KIK+L+ +N
Sbjct  113  DGLPDEVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPITVIAGFNKIKALVHNN  172

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +  +LA AL++S+KL+VS DGK+VKR Q FT  D ++LQSR VVAENLP D  + N+ KI
Sbjct  173  S--MLAAALRTSSKLVVSDDGKRVKRLQSFTVSDMQDLQSRIVVAENLPGDPCYQNLMKI  230

Query  769  FNVVGSVKTIRICHPQ-----DPNSSRS-KGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+ VGSVKTIR C+PQ      P ++RS K +   +NKLHA +E+E+ E A+KA+ +LND
Sbjct  231  FSTVGSVKTIRTCYPQSSNGNSPATNRSAKLDMLFANKLHAFVEYETLEDAEKAILELND  290

Query  931  ERNW  942
            E+NW
Sbjct  291  EKNW  294



>gb|EAZ20013.1| hypothetical protein OsJ_35608 [Oryza sativa Japonica Group]
Length=481

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            +  PDEV  KI KQVEY  SD++L   E+L + ++KDPEGYVPI+ +A   KIK+L+ +N
Sbjct  116  DGFPDEVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPITVIAGFNKIKALVHNN  175

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +  +LA AL++S+KL+VS DGK+VKR Q FT  D ++LQSR VVAENLP D  + N+ KI
Sbjct  176  S--MLAAALRTSSKLVVSDDGKRVKRLQSFTVSDMQDLQSRIVVAENLPGDPCYQNLMKI  233

Query  769  FNVVGSVKTIRICHPQ-----DPNSSRS-KGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+ VGSVKTIR C+PQ      P ++RS K +   +NKLHA +E+E+ E A+KA+ +LND
Sbjct  234  FSTVGSVKTIRTCYPQSSNGNSPATNRSAKLDMLFANKLHAFVEYETLEDAEKAILELND  293

Query  931  ERNW  942
            E+NW
Sbjct  294  EKNW  297



>ref|XP_008447188.1| PREDICTED: la-related protein 6B isoform X5 [Cucumis melo]
Length=306

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 174/301 (58%), Gaps = 40/301 (13%)
 Frame = +1

Query  532   VPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSR  711
             VPIS VAS KKIK+L++S+    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR
Sbjct  15    VPISVVASFKKIKALINSHFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSR  72

Query  712   TVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKL  867
              V+AENLP+DH H N+ KIF+ VGSVK IR C PQ           S+++ G ++ SNKL
Sbjct  73    IVIAENLPEDHCHQNLMKIFSAVGSVKNIRTCQPQISDSGASSTSKSAKADGMHY-SNKL  131

Query  868   HALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLKTRKSEFEGCLE----D  1035
             HA +E+ES E+A+KAV +LNDE NWR  LR++L+L  S +S     K    G +     D
Sbjct  132   HAFVEYESVELAEKAVAELNDEGNWRNALRLRLMLSCSSKSAPVRGKKGHNGEMNYKDVD  191

Query  1036  DDQAPPVESAPED-SVSSPLHQLESTETNVEESSgggaakkgwgkgrgkTRLRTQIHG-G  1209
               + P +E   +D S    +H  E  E +  E  GGG             R+R ++ G G
Sbjct  192   ASEQPAIEKHVDDLSDQVDVHPPEQREEHGNEKDGGGQR-----------RVRNRVRGKG  240

Query  1210  RGLLaaspqcssssssasgqsesP------------MKQASKGPRMPDGTRGFTMGRGKP  1353
             RG        ++  +  +     P            MKQ   GPRMPDGTRGF MGRGKP
Sbjct  241   RGRSQYHHNHNNIHNHGNHVGTPPPSSSTTIEQAGTMKQQPPGPRMPDGTRGFAMGRGKP  300

Query  1354  L  1356
             +
Sbjct  301   V  301



>gb|ABA96797.2| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=478

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 8/184 (4%)
 Frame = +1

Query  409  NSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSN  588
            +  PDEV  KI KQVEY  SD++L   E+L + ++KDPEGYVPI+ +A   KIK+L+ +N
Sbjct  113  DGFPDEVVHKITKQVEYYFSDINLATTEHLMRFITKDPEGYVPITVIAGFNKIKALVHNN  172

Query  589  TTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKI  768
            +  +LA AL++S+KL+VS DGK+VKR Q FT  D ++LQSR VVAENLP D  + N+ KI
Sbjct  173  S--MLAAALRTSSKLVVSDDGKRVKRLQSFTVSDMQDLQSRIVVAENLPGDPCYQNLMKI  230

Query  769  FNVVGSVKTIRICHPQ-----DPNSSRS-KGEYFISNKLHALIEFESPEIADKAVEKLND  930
            F+ VGSVKTIR C+PQ      P ++RS K +   +NKLHA +E+E+ E A+KA+ +LND
Sbjct  231  FSTVGSVKTIRTCYPQSSNGNSPATNRSAKLDMLFANKLHAFVEYETLEDAEKAILELND  290

Query  931  ERNW  942
            E+NW
Sbjct  291  EKNW  294



>ref|XP_006351072.1| PREDICTED: la-related protein 6-like isoform X2 [Solanum tuberosum]
Length=360

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 171/286 (60%), Gaps = 37/286 (13%)
 Frame = +1

Query  235  KLNVQAPEFVPRS------------ITQMPVSGYFYP---YFQYQDWIYVGDQDPTPFYS  369
            +LN  AP FVPRS            +T +  +G F+P   ++ Y   + V  Q P+P+Y 
Sbjct  40   RLNALAPAFVPRSSSSSASISPTPSLTDLNQAG-FHPVRNHYVYTPQLQV--QYPSPYYG  96

Query  370  NNQ---------NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDP  522
                        +L      ++  L DE   KI+ QVE+  SD++L   ++L K M KD 
Sbjct  97   GGVQEVGGGGAADLDHASASKRGGLTDEAALKIVNQVEFYFSDLNLATTDHLIKHMLKDQ  156

Query  523  EGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEEL  702
            EGYVPIS VA  KKIK+L+ ++    LAQ L+SSTKL+VS DG KVKRK P TE D EEL
Sbjct  157  EGYVPISVVALFKKIKALIRNHAQ--LAQVLRSSTKLVVSEDGMKVKRKIPLTETDLEEL  214

Query  703  QSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNS-------SRSKGEYFISN  861
            QSR V+AENLP+DH H N+ KIF+ VGSVK IR C PQ  N        +        SN
Sbjct  215  QSRIVIAENLPEDHCHQNLMKIFSAVGSVKMIRTCLPQSSNGGASSGSRTAKSDSTLHSN  274

Query  862  KLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrSPRSVLK  999
            KLH  +E+E+ E+A++AV +LND+ NWR  L+V+LLLR S +S+LK
Sbjct  275  KLHTFVEYETAELAERAVVELNDD-NWRNALKVRLLLRSSKQSLLK  319



>emb|CDX79791.1| BnaA05g03650D [Brassica napus]
Length=500

 Score =   192 bits (489),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 131/187 (70%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + +SKDPEGYVPI  VAS KK+K+++S 
Sbjct  143  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFISKDPEGYVPIQVVASFKKVKAVVSG  202

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+STKL+VS DGKKV+R  P TE   EELQSR V+AENLP+DH + N+ K
Sbjct  203  NSQ--LATVLQNSTKLVVSEDGKKVRRMNPVTEAALEELQSRIVIAENLPEDHCYQNLMK  260

Query  766  IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ           S++S G  F SNK+HA +E+E+ E+A+KAV +
Sbjct  261  IFSTVGSVKNIRTCQPQITGNAVPPAARSAKSDGNLF-SNKVHAFVEYETVELAEKAVAE  319

Query  922  LNDERNW  942
            LN+  NW
Sbjct  320  LNEAGNW  326



>ref|XP_009798623.1| PREDICTED: la-related protein 6B-like [Nicotiana sylvestris]
Length=483

 Score =   192 bits (487),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 128/191 (67%), Gaps = 11/191 (6%)
 Frame = +1

Query  394  QTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
               +   L +E  QKII QVE+  SD++L   ++L K M KDPEGYVPIS VA  KKIK+
Sbjct  141  HASKNGGLTEEAVQKIINQVEFYFSDLNLATTDHLIKHMLKDPEGYVPISVVALFKKIKA  200

Query  574  LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
            L  S+    LAQ L+SSTKL+VS DG KVKRK P TE D +ELQSR V+AENLP+DH H 
Sbjct  201  LADSHAQ--LAQVLRSSTKLVVSDDGMKVKRKIPLTETDLKELQSRIVIAENLPEDHCHQ  258

Query  754  NIEKIFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADK  909
            N+ KIF+ VGSVK IR C PQ           +++S    + SNKLHA +E+ES ++A+ 
Sbjct  259  NLMKIFSTVGSVKMIRTCQPQYSSGGASSGSRTAKSDSMMY-SNKLHAFVEYESIKLAET  317

Query  910  AVEKLNDERNW  942
            AV +LNDE NW
Sbjct  318  AVAELNDEDNW  328



>ref|XP_009800734.1| PREDICTED: la-related protein 6B-like [Nicotiana sylvestris]
Length=535

 Score =   193 bits (490),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 131/185 (71%), Gaps = 11/185 (6%)
 Frame = +1

Query  412  SLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNT  591
             L +E  QKI+ QVE+  SD++L   ++L + M KDPEGYVP+S VAS KKIK+L SS+ 
Sbjct  186  GLSEEACQKIVNQVEFYFSDINLATTDHLIRIMFKDPEGYVPMSVVASFKKIKALTSSHA  245

Query  592  TQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIF  771
              ++A+ L++STKL+VS DGKKV+R+ P +EKD EELQSR VVAENLP+DH H N+ KIF
Sbjct  246  --LVAKILRTSTKLVVSEDGKKVRRQFPLSEKDLEELQSRIVVAENLPEDHCHQNLMKIF  303

Query  772  NVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
            + VGSVK IR C PQ           + +S    + S KLHA +E+ES E+A+KAV +LN
Sbjct  304  SAVGSVKMIRTCQPQSSNGGASSASRTGKSDSTLY-STKLHAFVEYESVELAEKAVMELN  362

Query  928  DERNW  942
            DE NW
Sbjct  363  DENNW  367



>emb|CDY17896.1| BnaC04g03230D [Brassica napus]
Length=453

 Score =   191 bits (485),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + +SKDPEGYVPI  VAS KK+K+++S 
Sbjct  102  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFISKDPEGYVPIQVVASFKKVKAVVSG  161

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR V+AENLP+DH + N+ K
Sbjct  162  NSQ--LATVLQNSAKLVVSEDGKKVRRMNPVTETALEELQSRIVIAENLPEDHCYQNLMK  219

Query  766  IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ           S++S G  F SNK+HA +E+E+ E+A+KAV +
Sbjct  220  IFSTVGSVKNIRTCQPQITGNAVPPAARSAKSDGTLF-SNKVHAFVEYETVELAEKAVAE  278

Query  922  LNDERNW  942
            LN+  NW
Sbjct  279  LNEAGNW  285



>emb|CDP19151.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 134/321 (42%), Positives = 186/321 (58%), Gaps = 25/321 (8%)
 Frame = +1

Query  448   QVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSST  627
             QVE+  SD++L     L K M KDPEG+VPIS +AS KKIK+L  S +   LA  L+ S+
Sbjct  10    QVEFYFSDINLATTGFLYKIMVKDPEGFVPISVIASIKKIKTLTKSQSQ--LASVLKGSS  67

Query  628   KLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRIC  807
             KL+VS DGKKV+R  P TE D E++QSR ++AENLP+DH H N+ KIF+ VGSVK+IR C
Sbjct  68    KLVVSEDGKKVRRLHPLTELDMEDVQSRIIIAENLPEDHCHQNLLKIFSAVGSVKSIRSC  127

Query  808   HPQDP----NSSRSKGEYF-ISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklll  972
              P  P     S  +KG+    SNKLHA +E+ES E+A+KAV +LN E NWR GL+V+LLL
Sbjct  128   QPSGPTVTSTSRAAKGDPVNFSNKLHAFVEYESVELAEKAVLELN-EGNWRNGLKVRLLL  186

Query  973   rrSPRSV-LKTRKSEFEG--CLEDDDQAPPV-----ESAPEDSVSSPLHQLESTETNVEE  1128
             +RSP++   + +K+  EG    +D+D   P      E   +D V  P   +     N +E
Sbjct  187   KRSPKAAQARDKKAGHEGEYSFKDEDGFGPEHIQQHEKCLDDYVQPPNEPMWEEHGNNKE  246

Query  1129  SSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKG--  1302
                  +  + + +             GRG  A +     +    +      ++Q +    
Sbjct  247   GGLRKSRSREFREVNENRGWGK----GRGRPAYNSNNRGNHPGVASNVPLNIEQPTAAKQ  302

Query  1303  ---PRMPDGTRGFTMGRGKPL  1356
                PRMPDGT+GF+MGRGKP+
Sbjct  303   PPVPRMPDGTKGFSMGRGKPV  323



>gb|KEH24676.1| LA-related protein 6 LA RNA-binding domain protein, putative 
[Medicago truncatula]
Length=363

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 128/177 (72%), Gaps = 9/177 (5%)
 Frame = +1

Query  433  QKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQA  612
             KI+KQVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S++   LA  
Sbjct  116  HKILKQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFKKIKALITSHSQ--LANV  173

Query  613  LQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVK  792
            L++S+KL+VS DGKK+KR+   TE D EELQSR V+AENLP+DH H N+ K+F+ VGSVK
Sbjct  174  LRNSSKLVVSEDGKKIKRQYSPTESDIEELQSRIVIAENLPEDHCHQNLMKVFSAVGSVK  233

Query  793  TIRICHPQDPNSSRSKGEYF-------ISNKLHALIEFESPEIADKAVEKLNDERNW  942
            TIR C PQ  N+  S            + NKLHA +E+ES E+A++AV +LNDE NW
Sbjct  234  TIRTCPPQTSNNGTSSASRSGKVDGIPLHNKLHAFVEYESVELAERAVTELNDEGNW  290



>gb|KFK37220.1| hypothetical protein AALP_AA4G229300 [Arabis alpina]
Length=515

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 130/187 (70%), Gaps = 10/187 (5%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  L ++  QKI+ QVEY  SD++L   ++L + +SKDPEGYVPI  VAS KK+K++++S
Sbjct  159  KTGLAEDTIQKIVNQVEYYFSDLNLATTDHLMRFISKDPEGYVPIHVVASFKKVKAVINS  218

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S+KL+VS DGKKV+R  P TE   EELQSR V+AENLPDDH + N+ K
Sbjct  219  NSQ--LAMVLQNSSKLVVSEDGKKVRRVNPITESAIEELQSRMVIAENLPDDHCYQNLMK  276

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ+          S++S G  F  NK+HA +E+E  E+A+KAV +
Sbjct  277  IFSTVGSVKNIRTCQPQNTGSGAPAAARSAKSDGSLFSINKVHAFVEYEIVELAEKAVAE  336

Query  922  LNDERNW  942
            LN+  NW
Sbjct  337  LNEAGNW  343



>gb|KDO51618.1| hypothetical protein CISIN_1g009251mg [Citrus sinensis]
Length=401

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 11/184 (6%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
             Q   L DE  QK++ QVEY  SD++L   ++L + + KDPEGYVPIS VAS KKIK+++
Sbjct  188  HQHGGLNDESIQKVLNQVEYYFSDLNLATTDHLIRFILKDPEGYVPISTVASFKKIKAII  247

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
            SS++   LA  L+ S+KL+VS DGKK+KR+ P TE D EELQSR VVAENLP+DH H N+
Sbjct  248  SSHSH--LASVLRKSSKLVVSEDGKKIKRQNPLTESDLEELQSRIVVAENLPEDHCHQNL  305

Query  760  EKIFNVVGSVKTIRICHPQD--------PNSSRSKGEYFISNKLHALIEFESPEIADKAV  915
             KIF+ VGSVKTIR C PQ           S++S+G  F SNKLHA +E+ES E+A+KAV
Sbjct  306  MKIFSAVGSVKTIRTCLPQTSGGGASSGSRSAKSEGMLF-SNKLHAFVEYESVELAEKAV  364

Query  916  EKLN  927
              L+
Sbjct  365  SHLH  368



>ref|XP_009142983.1| PREDICTED: la-related protein 6B [Brassica rapa]
Length=495

 Score =   191 bits (484),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + +SKDPEGYVPI  VAS KK+K+++S 
Sbjct  140  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFISKDPEGYVPIQVVASFKKVKAVVSG  199

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR V+AENLP+DH + N+ K
Sbjct  200  NSQ--LATVLQNSAKLVVSEDGKKVRRLNPVTEAALEELQSRIVIAENLPEDHCYQNLMK  257

Query  766  IFNVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ           S++S G  F SNK+HA +E+E+ E+A+KAV +
Sbjct  258  IFSTVGSVKNIRTCQPQITGNAVPPAARSAKSDGNLF-SNKVHAFVEYETVELAEKAVAE  316

Query  922  LNDERNW  942
            LN+  NW
Sbjct  317  LNEAGNW  323



>ref|XP_006351071.1| PREDICTED: la-related protein 6-like isoform X1 [Solanum tuberosum]
Length=465

 Score =   189 bits (480),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 156/267 (58%), Gaps = 37/267 (14%)
 Frame = +1

Query  235  KLNVQAPEFVPRS------------ITQMPVSGYFYP---YFQYQDWIYVGDQDPTPFYS  369
            +LN  AP FVPRS            +T +  +G F+P   ++ Y   + V  Q P+P+Y 
Sbjct  40   RLNALAPAFVPRSSSSSASISPTPSLTDLNQAG-FHPVRNHYVYTPQLQV--QYPSPYYG  96

Query  370  NNQ---------NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDP  522
                        +L      ++  L DE   KI+ QVE+  SD++L   ++L K M KD 
Sbjct  97   GGVQEVGGGGAADLDHASASKRGGLTDEAALKIVNQVEFYFSDLNLATTDHLIKHMLKDQ  156

Query  523  EGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEEL  702
            EGYVPIS VA  KKIK+L+ ++    LAQ L+SSTKL+VS DG KVKRK P TE D EEL
Sbjct  157  EGYVPISVVALFKKIKALIRNHAQ--LAQVLRSSTKLVVSEDGMKVKRKIPLTETDLEEL  214

Query  703  QSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNS-------SRSKGEYFISN  861
            QSR V+AENLP+DH H N+ KIF+ VGSVK IR C PQ  N        +        SN
Sbjct  215  QSRIVIAENLPEDHCHQNLMKIFSAVGSVKMIRTCLPQSSNGGASSGSRTAKSDSTLHSN  274

Query  862  KLHALIEFESPEIADKAVEKLNDERNW  942
            KLH  +E+E+ E+A++AV +LND+ NW
Sbjct  275  KLHTFVEYETAELAERAVVELNDD-NW  300



>ref|XP_010524198.1| PREDICTED: la-related protein 6B-like [Tarenaya hassleriana]
Length=522

 Score =   190 bits (482),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 135/187 (72%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ LP++  QKI+ QVEY  SD++L   ++L + ++KDPEG VPI  VAS KKIK+++SS
Sbjct  186  RSGLPEDTVQKIVNQVEYYFSDLNLATTDHLIRFINKDPEGNVPIHVVASFKKIKAVISS  245

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQSS+KL+VS DGKKV+R+ P T+   +ELQSR VVAENLP+DH + N+ K
Sbjct  246  NSQ--LAAVLQSSSKLVVSEDGKKVRRQHPITDSSIKELQSRIVVAENLPEDHCYQNLLK  303

Query  766  IFNVVGSVKTIRICHPQDPNS--------SRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ+  S        ++S G  F +NK+HA +E+E+ E+A+KAV +
Sbjct  304  IFSAVGSVKNIRTCQPQNSGSGAPSAARTAKSDGALF-TNKVHAFVEYETVELAEKAVAE  362

Query  922  LNDERNW  942
            LN+E NW
Sbjct  363  LNEEGNW  369



>gb|KEH24675.1| LA-related protein 6 LA RNA-binding domain protein, putative 
[Medicago truncatula]
Length=440

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 128/177 (72%), Gaps = 9/177 (5%)
 Frame = +1

Query  433  QKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQA  612
             KI+KQVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S++   LA  
Sbjct  116  HKILKQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFKKIKALITSHSQ--LANV  173

Query  613  LQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVK  792
            L++S+KL+VS DGKK+KR+   TE D EELQSR V+AENLP+DH H N+ K+F+ VGSVK
Sbjct  174  LRNSSKLVVSEDGKKIKRQYSPTESDIEELQSRIVIAENLPEDHCHQNLMKVFSAVGSVK  233

Query  793  TIRICHPQDPNSSRSKGEYF-------ISNKLHALIEFESPEIADKAVEKLNDERNW  942
            TIR C PQ  N+  S            + NKLHA +E+ES E+A++AV +LNDE NW
Sbjct  234  TIRTCPPQTSNNGTSSASRSGKVDGIPLHNKLHAFVEYESVELAERAVTELNDEGNW  290



>ref|XP_009603304.1| PREDICTED: la-related protein 6B-like [Nicotiana tomentosiformis]
Length=537

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 129/185 (70%), Gaps = 11/185 (6%)
 Frame = +1

Query  412  SLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNT  591
             L +E  QKI+ QVE+  SD++L   ++L + M KDPEGYVP+S VAS KKIK+L SS+ 
Sbjct  186  GLSEEACQKIVNQVEFYFSDINLATTDHLIRIMFKDPEGYVPMSVVASFKKIKALTSSHA  245

Query  592  TQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIF  771
               +A+ L++STKL+VS DGKKV+R+ P +E D EELQSR VVAENLP+DH H N+ KIF
Sbjct  246  Q--VAKILRTSTKLVVSEDGKKVRRQFPLSEMDLEELQSRIVVAENLPEDHCHQNLMKIF  303

Query  772  NVVGSVKTIRICHPQ--------DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLN  927
            + VGSVK IR C PQ           + +S    + S KLHA +E+ES E+A+KAV +LN
Sbjct  304  SAVGSVKMIRTCQPQSSNGGASSASRTGKSDSTLY-STKLHAFVEYESIELAEKAVMELN  362

Query  928  DERNW  942
            DE NW
Sbjct  363  DENNW  367



>ref|XP_004494976.1| PREDICTED: uncharacterized protein LOC101512171 [Cicer arietinum]
Length=641

 Score =   190 bits (483),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 135/195 (69%), Gaps = 9/195 (5%)
 Frame = +1

Query  379  NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAST  558
            ++ P  T  K+   D+  QKI+KQVEY  SD++L   ++L + ++KDPEG+VP+S VAS 
Sbjct  306  HVEPDHTPFKSKHSDDADQKILKQVEYYFSDLNLATTDHLMRFINKDPEGFVPLSVVASF  365

Query  559  KKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPD  738
            KKIK+L++S++   LA  L++S+KL+VS DG K+KR+   TE D EELQSR V+AENLP+
Sbjct  366  KKIKALITSHSQ--LANVLRNSSKLVVSEDGMKIKRQYSPTESDIEELQSRIVIAENLPE  423

Query  739  DHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYF-------ISNKLHALIEFESPE  897
            DH H N+ K+F+ VGSV TIR C PQ  N+  S            +SNKLHA +E+ES E
Sbjct  424  DHCHQNLMKVFSAVGSVNTIRTCPPQTSNNGTSSASRLGKVDGIPLSNKLHAFVEYESVE  483

Query  898  IADKAVEKLNDERNW  942
            +A+ AV +LNDE NW
Sbjct  484  LAENAVAELNDEGNW  498



>ref|XP_010506300.1| PREDICTED: la-related protein 6B [Camelina sativa]
Length=534

 Score =   188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK++++S
Sbjct  183  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINS  242

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR ++AENLP+DH + N+ K
Sbjct  243  NSQ--LAAVLQNSAKLVVSEDGKKVRRINPITESAIEELQSRIIIAENLPEDHCYQNLMK  300

Query  766  IFNVVGSVKTIRICHPQD--------PNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ+          S++S G  F SNK+HA +E+E  E+A+KAV  
Sbjct  301  IFSTVGSVKNIRTCQPQNNGSGAPPAARSAKSDGTLF-SNKVHAFVEYEMVELAEKAVAD  359

Query  922  LNDERNW  942
            LN+  NW
Sbjct  360  LNEAGNW  366



>ref|XP_010508353.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=535

 Score =   188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK++++S
Sbjct  184  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINS  243

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR ++AENLP+DH + N+ K
Sbjct  244  NSQ--LAAVLQNSAKLVVSEDGKKVRRINPITESAIEELQSRIIIAENLPEDHCYQNLMK  301

Query  766  IFNVVGSVKTIRICHPQD--------PNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ+          S++S G  F SNK+HA +E+E  E+A+KAV  
Sbjct  302  IFSTVGSVKNIRTCQPQNNGSGAPPAARSAKSDGTLF-SNKVHAFVEYEMVELAEKAVAD  360

Query  922  LNDERNW  942
            LN+  NW
Sbjct  361  LNEAGNW  367



>ref|XP_006397570.1| hypothetical protein EUTSA_v10001395mg [Eutrema salsugineum]
 gb|ESQ39023.1| hypothetical protein EUTSA_v10001395mg [Eutrema salsugineum]
Length=532

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 130/187 (70%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ Q+EY  SD++L   ++L + +SKDPEGYVPI  VAS KKIK+++S 
Sbjct  180  KTGLPEDTVQKIVNQIEYYFSDLNLATTDHLMRFISKDPEGYVPIHVVASFKKIKTVISG  239

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR V+AENLP+DH + N+ K
Sbjct  240  NSQ--LATVLQNSAKLVVSEDGKKVRRVNPITEAAIEELQSRIVIAENLPEDHCYQNLMK  297

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ+          S++S G  F SNK+HA +E+E  E+A+KAV +
Sbjct  298  IFSTVGSVKNIRTCQPQNTGSGGPPAARSAKSDGTLF-SNKVHAFVEYELVELAEKAVAE  356

Query  922  LNDERNW  942
            L++  NW
Sbjct  357  LSEAGNW  363



>ref|XP_011085065.1| PREDICTED: la-related protein 6B-like isoform X2 [Sesamum indicum]
Length=435

 Score =   186 bits (471),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 149/264 (56%), Gaps = 43/264 (16%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMP----VSGYFYP------------YFQYQDWIYVGDQDPTPFY  366
            KLN +APEFVPRS    P    V    Y             Y+ Y+++     Q P  FY
Sbjct  21   KLNAEAPEFVPRSSATAPPLHSVLQNVYARPPPFVSPLPPAYYGYENFY---QQPPMQFY  77

Query  367  SNNQN-LSP-----------PQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQM  510
              N N LSP           P    KN L D    KI+ QVE+  SD++L   + L + M
Sbjct  78   GYNSNPLSPAELAADRNNGSPAAVTKNGLSD-AHLKILNQVEFYFSDINLATTDQLFRFM  136

Query  511  SKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKD  690
            SKDPEGYVPIS VAS KKIKS +  N +  L+  LQSS KL+VS DGK VKR+QP TE D
Sbjct  137  SKDPEGYVPISVVASFKKIKSAI--NGSAELSSILQSSKKLLVSEDGKMVKRRQPLTESD  194

Query  691  KEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLH  870
             EELQSR ++AENLP+DHSH N+ +IF+ VGSVK+IR C PQ+ N+S S    F + K  
Sbjct  195  MEELQSRIIIAENLPEDHSHQNLMRIFSSVGSVKSIRTCPPQNSNNSASSA--FKTGKGD  252

Query  871  ALIEFESPEIADKAVEKLNDERNW  942
            A+          K +E L DE NW
Sbjct  253  AM------HFNGKVIE-LTDEGNW  269



>gb|AAX95155.1| At2g43970/F6E13.10 [Oryza sativa Japonica Group]
 gb|ABA92362.1| La domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=341

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 117/151 (77%), Gaps = 8/151 (5%)
 Frame = +1

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            ++KDPEGYVPIS VA  KKIK+L+ SN   +LA AL++S+KL+VS+DG +VKR+QPFTE 
Sbjct  4    ITKDPEGYVPISVVAGFKKIKALIQSNA--MLASALRTSSKLVVSNDGTRVKREQPFTES  61

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEY  849
            D EELQ+R VVAENLPDDH + N+ K+F+ VGSVKTIR C+PQ PN +       +K + 
Sbjct  62   DLEELQARIVVAENLPDDHCYQNLMKLFSTVGSVKTIRTCYPQTPNGTGPVTNRSAKLDM  121

Query  850  FISNKLHALIEFESPEIADKAVEKLNDERNW  942
              +NKLHA +E+++ E A+KA+ +LNDERNW
Sbjct  122  LFANKLHAFVEYDTVEDAEKAIVELNDERNW  152



>ref|XP_010469262.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=371

 Score =   184 bits (466),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 8/184 (4%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K+ LP++  QKI+KQVEY   D++L   + L + +SKDP+ YVP+  VAS  KIKS ++S
Sbjct  52   KSGLPEDTVQKIVKQVEYYFGDLNLATTDLLMRFISKDPQSYVPVHVVASFNKIKSFINS  111

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            ++   LA  LQ+S+KL+VS DG+KV+R  P T+   EELQSR V+A NLP DH +HN+ K
Sbjct  112  DSQ--LASVLQNSSKLVVSEDGQKVRRIYPVTKIALEELQSRIVIAGNLPADHCYHNLMK  169

Query  766  IFNVVGSVKTIRICHPQD-----PNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
            IF+ VGSVK IR C PQ+     P+++RS    F SNK+HA +E+E  E+A+KAV +LN 
Sbjct  170  IFSAVGSVKHIRTCQPQNPGYGFPSAARSANTDF-SNKVHAFVEYERVELAEKAVAELNG  228

Query  931  ERNW  942
            ERNW
Sbjct  229  ERNW  232



>gb|ABG22428.1| La domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=324

 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 117/151 (77%), Gaps = 8/151 (5%)
 Frame = +1

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            ++KDPEGYVPIS VA  KKIK+L+ SN   +LA AL++S+KL+VS+DG +VKR+QPFTE 
Sbjct  4    ITKDPEGYVPISVVAGFKKIKALIQSNA--MLASALRTSSKLVVSNDGTRVKREQPFTES  61

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEY  849
            D EELQ+R VVAENLPDDH + N+ K+F+ VGSVKTIR C+PQ PN +       +K + 
Sbjct  62   DLEELQARIVVAENLPDDHCYQNLMKLFSTVGSVKTIRTCYPQTPNGTGPVTNRSAKLDM  121

Query  850  FISNKLHALIEFESPEIADKAVEKLNDERNW  942
              +NKLHA +E+++ E A+KA+ +LNDERNW
Sbjct  122  LFANKLHAFVEYDTVEDAEKAIVELNDERNW  152



>gb|ADE76238.1| unknown [Picea sitchensis]
Length=465

 Score =   186 bits (471),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 108/253 (43%), Positives = 160/253 (63%), Gaps = 30/253 (12%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYFYPYF-------QYQDWIYVGDQ-----DPTPFYSNNQ  378
            KLN QAP FVPR+   + V G     F       Q+ +   VG +      PTP  S+  
Sbjct  82   KLNAQAPVFVPRAQVAVHVGGLIPSSFTEHSLPEQFIEQEVVGSEPESAATPTPTPSS--  139

Query  379  NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAST  558
                     K  L +E++QK++KQVE+  SD +L  ++ L K + KDPEG+VPI  +A+ 
Sbjct  140  ---------KAVLTEELRQKVVKQVEFYFSDANLPTDKYLMKFVKKDPEGFVPIPFLANF  190

Query  559  KKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPD  738
            +K+K+L+S+++  ++A AL++S++L+VS DGKKV+R  P  + D EE+QSRTVVAENLP+
Sbjct  191  RKVKNLVSNHS--LVAAALRTSSQLVVSEDGKKVRRLHPLADTDIEEVQSRTVVAENLPN  248

Query  739  DHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-----SKGEYFISNKLHALIEFESPEIA  903
            D+S  N+EK F  VG+VK +R+  PQ  +S +      + + F+S+KLHAL+E+E+ E A
Sbjct  249  DYSIQNLEKRFGAVGNVKLVRVFQPQRYDSGQVSMKAHRNDMFVSSKLHALVEYETVEQA  308

Query  904  DKAVEKLNDERNW  942
            +KAV  LND  NW
Sbjct  309  EKAVADLNDGGNW  321



>ref|XP_010517979.1| PREDICTED: la-related protein 6B-like isoform X2 [Camelina sativa]
Length=543

 Score =   187 bits (475),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK++++S
Sbjct  192  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINS  251

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR ++AENLP+DH + N+ K
Sbjct  252  NSQ--LAAVLQNSAKLVVSEDGKKVRRINPITESAIEELQSRIIIAENLPEDHCYQNLMK  309

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ+          S++S G  F SNK+HA +E+E  E+A+KAV  
Sbjct  310  IFSTVGSVKNIRTCQPQNSGGGAPPAARSAKSDGTLF-SNKVHAFVEYEMVELAEKAVAD  368

Query  922  LNDERNW  942
            L++  NW
Sbjct  369  LHEAGNW  375



>ref|XP_006296119.1| hypothetical protein CARUB_v10025271mg [Capsella rubella]
 gb|EOA29017.1| hypothetical protein CARUB_v10025271mg [Capsella rubella]
Length=540

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK++++S
Sbjct  186  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINS  245

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  L++S KL+VS DGKKV+R  P TE   EELQSR ++AENLP+DH + N+ K
Sbjct  246  NSQ--LAAVLENSAKLVVSEDGKKVRRINPITESAIEELQSRIIIAENLPEDHCYQNLMK  303

Query  766  IFNVVGSVKTIRICHPQD--------PNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
            IF+ VGSVK IR C PQ           S++S G  F SNK+HA +E+E  E+A+KAV +
Sbjct  304  IFSTVGSVKNIRTCQPQSNGSGAPPAARSAKSDGTLF-SNKVHAFVEYEMVELAEKAVAE  362

Query  922  LNDERNW  942
            LN+  NW
Sbjct  363  LNEAGNW  369



>ref|XP_010512276.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=402

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 130/184 (71%), Gaps = 8/184 (4%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K+ LP++  QKI+KQVEY   D++L   + L + +SKDP+GYVP+  VAS  KIKS +  
Sbjct  93   KSGLPEDTVQKIVKQVEYYFGDLNLATTDLLMRFISKDPQGYVPVHVVASFNKIKSFI--  150

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S+KL+VS D +KV+R  P T+   EELQSR V+A NLP DH +HN+ K
Sbjct  151  NSVSQLATVLQNSSKLVVSEDEQKVRRIYPITKIALEELQSRIVIAGNLPADHCYHNLMK  210

Query  766  IFNVVGSVKTIRICHPQD-----PNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLND  930
            IF+ VGSVK IR C PQ+     P+++RS    F SNK+HA +E+E+ E+A++AV +LN+
Sbjct  211  IFSAVGSVKHIRTCQPQNSGYSFPSAARSANTDF-SNKVHAFVEYETVELAERAVAELNE  269

Query  931  ERNW  942
            ERNW
Sbjct  270  ERNW  273



>ref|XP_003574867.1| PREDICTED: la-related protein 6B-like [Brachypodium distachyon]
Length=407

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            +E+ ++++KQVE+  SD++L   ++L K ++KDP+G+VP+S VAS +KI+ L+   T  +
Sbjct  95   EELARRVVKQVEFYFSDINLTTTDHLMKFITKDPDGFVPMSVVASFRKIRELI---TRPL  151

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            L  AL++ST+L+VS DGK V+R+ PFT+ D EE+QSR VVAE LPDDH H N+ +IF+VV
Sbjct  152  LPAALRTSTELVVSDDGKMVRRRVPFTDSDSEEVQSRIVVAEKLPDDHRHQNLMRIFSVV  211

Query  781  GSVKTIRICHPQ-----DPNSSR-SKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            GSVK+IR C+PQ      P + + S+ E   +N+LHA +E+E+ E A++AV + N  RNW
Sbjct  212  GSVKSIRTCYPQVVDVSGPAAGKASRIEMLFANRLHAFVEYETVEAAERAVAEFNGGRNW  271



>ref|XP_010069204.1| PREDICTED: la-related protein 6B [Eucalyptus grandis]
 gb|KCW57478.1| hypothetical protein EUGRSUZ_H00248 [Eucalyptus grandis]
Length=298

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 115/153 (75%), Gaps = 11/153 (7%)
 Frame = +1

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            +SKDPEGYVPIS VAS KKIK+L++SN    LA  LQ+S+KLIVS DGKKVKR+ P T+ 
Sbjct  4    ISKDPEGYVPISVVASFKKIKALITSNAQ--LASILQNSSKLIVSEDGKKVKRRYPLTDS  61

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQ--------DPNSSRSKG  843
            D EELQSR V+AENLP+DH H N+ K+F+ VGSVK IR C PQ         P S ++ G
Sbjct  62   DMEELQSRVVIAENLPEDHCHQNLMKLFSAVGSVKAIRTCQPQASNGGASSAPRSGKADG  121

Query  844  EYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
             ++ +NKLHA +E+ES ++A+KAVE+LN+E NW
Sbjct  122  MHY-TNKLHAFVEYESIDVAEKAVEELNEEGNW  153



>ref|XP_010526876.1| PREDICTED: la-related protein 6B [Tarenaya hassleriana]
Length=522

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 133/186 (72%), Gaps = 9/186 (5%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ LP++  QKI+ QVEY  SD++L   ++L + ++KD EG VPI  VAS KK+K+++SS
Sbjct  185  RSGLPEDTVQKIVNQVEYYFSDLNLATTDHLIRYINKDTEGNVPIHVVASFKKVKAVISS  244

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  L+SS+KL VS DGKKV+R+ P T+   EELQSR VVAENLP+DH + N+ K
Sbjct  245  NSQ--LAAVLRSSSKLDVSEDGKKVRRQHPITDSAIEELQSRIVVAENLPEDHCYQNLMK  302

Query  766  IFNVVGSVKTIRICHPQD-----PNSSRSKGE--YFISNKLHALIEFESPEIADKAVEKL  924
            IF+ VGSVK IR C PQ+     P++SRS        +NK+HA +E+E+ E+A+KAV +L
Sbjct  303  IFSAVGSVKNIRTCQPQNSGSGAPSASRSGKSDGALYTNKVHAYVEYETVELAEKAVAEL  362

Query  925  NDERNW  942
            N+E NW
Sbjct  363  NEEGNW  368



>ref|XP_002881943.1| hypothetical protein ARALYDRAFT_322062 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58202.1| hypothetical protein ARALYDRAFT_322062 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   182 bits (463),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 130/188 (69%), Gaps = 12/188 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK++++S
Sbjct  180  KTGLPEDSIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINS  239

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL VS DGKKV+R  P TE   EELQSR ++AENLP+DH + N+ K
Sbjct  240  NSQ--LAAVLQNSAKLFVSEDGKKVRRINPITESAIEELQSRIIIAENLPEDHCYQNLMK  297

Query  766  IFNVVGSVKTIRICHPQD---------PNSSRSKGEYFISNKLHALIEFESPEIADKAVE  918
            IF+ VGSVK IR C PQ+          ++++S G   +SNK+HA +E+E  E+A+KAV 
Sbjct  298  IFSTVGSVKNIRTCQPQNNGSSAPPAARSAAKSDG-TLLSNKVHAFVEYEMVELAEKAVA  356

Query  919  KLNDERNW  942
            +LN+  NW
Sbjct  357  ELNEAGNW  364



>ref|XP_006662857.1| PREDICTED: la-related protein 6-like [Oryza brachyantha]
Length=341

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 114/151 (75%), Gaps = 8/151 (5%)
 Frame = +1

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            ++KDPEGYVPIS VA  KKIK+L+  N   +LA AL++S+KL+VS DG +VKR+Q FTE 
Sbjct  4    ITKDPEGYVPISVVAGFKKIKALIQGNA--MLASALRTSSKLVVSDDGTRVKREQQFTES  61

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSS------RSKGEY  849
            D EELQ+R VVAENLPDDH + N+ K+F+ VGSVKTIR C+PQ PN +       +K + 
Sbjct  62   DLEELQARIVVAENLPDDHCYQNLMKLFSTVGSVKTIRTCYPQTPNGTGPVTNRSAKLDM  121

Query  850  FISNKLHALIEFESPEIADKAVEKLNDERNW  942
              +NKLHA +E+++ E A+KA+ +LNDERNW
Sbjct  122  LFANKLHAFVEYDTVEDAEKAIVELNDERNW  152



>dbj|BAH57224.1| AT2G43970 [Arabidopsis thaliana]
Length=494

 Score =   181 bits (459),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 128/188 (68%), Gaps = 12/188 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK+++++
Sbjct  135  KTGLPEDSIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINN  194

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL VS DGKKV+R  P TE   EELQSR +VAENLP+DH + N+ K
Sbjct  195  NSQ--LAAVLQNSAKLFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMK  252

Query  766  IFNVVGSVKTIRICHPQDPNS---------SRSKGEYFISNKLHALIEFESPEIADKAVE  918
            IF  VGSVK IR C PQ+  S         ++S G  F SNK+HA +E+E  E+A++AV 
Sbjct  253  IFPTVGSVKNIRTCQPQNNGSGAPPAARSAAKSDGTLF-SNKVHAFVEYEIVELAERAVT  311

Query  919  KLNDERNW  942
            +L++  NW
Sbjct  312  ELSEAGNW  319



>ref|NP_566004.1| RNA-binding protein [Arabidopsis thaliana]
 sp|O80567.2|LRP6B_ARATH RecName: Full=La-related protein 6B; Short=AtLARP6b; AltName: 
Full=VirF-interacting protein FIP1 [Arabidopsis thaliana]
 gb|AAK52994.1|AF375410_1 At2g43970/F6E13.10 [Arabidopsis thaliana]
 gb|AAK56266.1|AF367277_1 At2g43970/F6E13.10 [Arabidopsis thaliana]
 gb|AAK06847.1| VirF-interacting protein FIP1 [Arabidopsis thaliana]
 gb|AAL07087.1| unknown protein [Arabidopsis thaliana]
 gb|AAC23405.2| expressed protein [Arabidopsis thaliana]
 gb|AAM91060.1| At2g43970/F6E13.10 [Arabidopsis thaliana]
 gb|AEC10356.1| RNA-binding protein [Arabidopsis thaliana]
Length=545

 Score =   182 bits (461),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 129/188 (69%), Gaps = 12/188 (6%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK+++++
Sbjct  186  KTGLPEDSIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINN  245

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL VS DGKKV+R  P TE   EELQSR +VAENLP+DH + N+ K
Sbjct  246  NSQ--LAAVLQNSAKLFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMK  303

Query  766  IFNVVGSVKTIRICHPQDPNS---------SRSKGEYFISNKLHALIEFESPEIADKAVE  918
            IF+ VGSVK IR C PQ+  S         ++S G  F SNK+HA +E+E  E+A++AV 
Sbjct  304  IFSTVGSVKNIRTCQPQNNGSGAPPAARSAAKSDGTLF-SNKVHAFVEYEIVELAERAVT  362

Query  919  KLNDERNW  942
            +L++  NW
Sbjct  363  ELSEAGNW  370



>gb|EMT12290.1| La-related protein 7 [Aegilops tauschii]
Length=429

 Score =   179 bits (454),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 128/186 (69%), Gaps = 24/186 (13%)
 Frame = +1

Query  451  VEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTK  630
            VEY  SD++L   E+L + +SKDP+GYVPIS +A  KKIK+L+ +N   +LA AL++S+K
Sbjct  80   VEYYFSDINLATTEHLMRFISKDPQGYVPISVIAGFKKIKALVHNNP--MLAAALRTSSK  137

Query  631  LIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICH  810
            L+VS DGK+VKR+ PFTE D +E QSR VVAENLP D S+ N+ KIF+ VGSV+TIR C+
Sbjct  138  LVVSGDGKRVKRRHPFTESDMQEFQSRIVVAENLPGDPSYQNLMKIFSAVGSVRTIRTCY  197

Query  811  PQDPN-----SSRS-KGEYFISNK----------------LHALIEFESPEIADKAVEKL  924
            PQ PN     ++RS K +   +NK                LHA +E+E+ E A+KA+ +L
Sbjct  198  PQTPNGPGPATNRSAKLDMLFANKVFWVYPCKESLSKASELHAFVEYETHEDAEKAILEL  257

Query  925  NDERNW  942
            NDERNW
Sbjct  258  NDERNW  263



>ref|XP_006660346.1| PREDICTED: la-related protein 6-like [Oryza brachyantha]
Length=415

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 130/184 (71%), Gaps = 7/184 (4%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            +  LP++V ++++KQVE+  SD++L   E+L K M +DPEG+VP++ VAS +KI+ L+S 
Sbjct  94   EGGLPEDVARRVVKQVEFYFSDVNLATTEHLMKFMVRDPEGFVPMTVVASFRKIRELVSE  153

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
             ++  LA  L++S +L++S DGKKV+R+ PFTE D EE+QSR VVAENL ++H + N+ K
Sbjct  154  RSS--LAAVLRTSAELVISDDGKKVRRRVPFTEADAEEVQSRIVVAENLREEHRYPNLMK  211

Query  766  IFNVVGSVKTIRICHPQDPNSSRSKG-----EYFISNKLHALIEFESPEIADKAVEKLND  930
            IF+  GSVK+IR C+PQ   +  S G     E   +NK+HA +E+E+ + A+KAV + + 
Sbjct  212  IFSAFGSVKSIRTCYPQGDAAGTSTGKASKIEMLFANKVHAFVEYETVDDAEKAVSEFSS  271

Query  931  ERNW  942
             R+W
Sbjct  272  ARSW  275



>ref|XP_010517978.1| PREDICTED: la-related protein 6B-like isoform X1 [Camelina sativa]
Length=547

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 15/191 (8%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK++++S
Sbjct  192  KTGLPEDTIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINS  251

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL+VS DGKKV+R  P TE   EELQSR ++AENLP+DH + N+ K
Sbjct  252  NSQ--LAAVLQNSAKLVVSEDGKKVRRINPITESAIEELQSRIIIAENLPEDHCYQNLMK  309

Query  766  IFNVVGSVKTIRICHPQDPN--------SSRSKGEYFISNKLHALIEFESPEIADKA---  912
            IF+ VGSVK IR C PQ+          S++S G  F SNK+HA +E+E  E+A+KA   
Sbjct  310  IFSTVGSVKNIRTCQPQNSGGGAPPAARSAKSDGTLF-SNKVHAFVEYEMVELAEKAECV  368

Query  913  -VEKLNDERNW  942
             V  L++  NW
Sbjct  369  QVADLHEAGNW  379



>gb|EMS51819.1| La-related protein 7 [Triticum urartu]
Length=350

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 150/224 (67%), Gaps = 9/224 (4%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             LP+E+ ++++KQVE+  SD++L   ++L K ++KDP+G+VP++ VAS +KI+ L+  +  
Sbjct  44    LPEELARRVVKQVEFYFSDVNLATTDHLMKYITKDPDGFVPMTVVASFRKIRELIDRS--  101

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              +L  AL++ST+L+VS DGK V+R+ PF++ D EE+QSR +VAE LP+DH + N+ +IF+
Sbjct  102   -LLPGALRTSTELVVSDDGKMVRRRVPFSDVDAEEVQSRIIVAEKLPEDHRYQNLMRIFS  160

Query  775   VVGSVKTIRICHPQDPNSSRSKG---EYFISNKLHALIEFESPEIADKAVEKLNDERNWr  945
              VGSVK+IR C+PQ  + S  K    E   +NKLHA +E+ + E A+KAV + +  RNWR
Sbjct  161   TVGSVKSIRTCYPQGIDISAGKSSRIEMLFANKLHAFVEYGTVEDAEKAVAEFSGGRNWR  220

Query  946   kglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDS  1077
              G RV+ LL      + + RK   E   ++DD   P E   ED+
Sbjct  221   DGPRVRSLLGCLKHGIGQGRKGGDEEAADEDD---PEEYEAEDA  261



>ref|XP_002963146.1| hypothetical protein SELMODRAFT_35606, partial [Selaginella moellendorffii]
 gb|EFJ36609.1| hypothetical protein SELMODRAFT_35606, partial [Selaginella moellendorffii]
Length=270

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 124/181 (69%), Gaps = 9/181 (5%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            ++ + ++++QVE+  SD +L  +  L K + KDPEG+VPI  + S +KIK L  +     
Sbjct  78   EDTRTQVVQQVEFYFSDANLPTDNYLMKFIKKDPEGFVPIPIIGSFRKIKQL--TKNYGA  135

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL+SS+KL+VS DGKKV+R +P  + D +E+Q RTVVAENLP+DHS  ++EK+F  +
Sbjct  136  LAAALRSSSKLVVSEDGKKVRRAEPLADIDLDEIQGRTVVAENLPEDHSIQSLEKLFGTI  195

Query  781  GSVKTIRICHPQDPNS-------SRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVK +R+C P   NS         SK +  +SNKLHAL+E+E+ E A+KAV +L D+RN
Sbjct  196  GSVKMVRVCEPGSANSVNSAALAKHSKTDRVVSNKLHALVEYETLEQAEKAVAELTDQRN  255

Query  940  W  942
            W
Sbjct  256  W  256



>ref|XP_002980176.1| hypothetical protein SELMODRAFT_35604, partial [Selaginella moellendorffii]
 gb|EFJ18436.1| hypothetical protein SELMODRAFT_35604, partial [Selaginella moellendorffii]
Length=270

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 124/181 (69%), Gaps = 9/181 (5%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            ++ + ++++QVE+  SD +L  +  L K + KDPEG+VPI  + S +KIK L  +     
Sbjct  78   EDTRAQVVQQVEFYFSDANLPTDNYLMKFIKKDPEGFVPIPIIGSFRKIKQL--TKNYGA  135

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            LA AL+SS+KL+VS DGKKV+R +P  + D +E+Q RTVVAENLP+DHS  ++EK+F  +
Sbjct  136  LAAALRSSSKLVVSEDGKKVRRAEPLADIDLDEIQGRTVVAENLPEDHSIQSLEKLFGTI  195

Query  781  GSVKTIRICHPQDPNS-------SRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERN  939
            GSVK +R+C P   NS         SK +  +SNKLHAL+E+E+ E A+KAV +L D+RN
Sbjct  196  GSVKMVRVCEPGSANSVNNAALAKHSKTDRVVSNKLHALVEYETLEQAEKAVAELTDQRN  255

Query  940  W  942
            W
Sbjct  256  W  256



>gb|KCW57477.1| hypothetical protein EUGRSUZ_H00248 [Eucalyptus grandis]
Length=299

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 12/154 (8%)
 Frame = +1

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            +SKDPEGYVPIS VAS KKIK+L++SN    LA  LQ+S+KLIVS DGKKVKR+ P T+ 
Sbjct  4    ISKDPEGYVPISVVASFKKIKALITSNAQ--LASILQNSSKLIVSEDGKKVKRRYPLTDS  61

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGS-VKTIRICHPQ--------DPNSSRSK  840
            D EELQSR V+AENLP+DH H N+ K+F+ VG  VK IR C PQ         P S ++ 
Sbjct  62   DMEELQSRVVIAENLPEDHCHQNLMKLFSAVGRYVKAIRTCQPQASNGGASSAPRSGKAD  121

Query  841  GEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            G ++ +NKLHA +E+ES ++A+KAVE+LN+E NW
Sbjct  122  GMHY-TNKLHAFVEYESIDVAEKAVEELNEEGNW  154



>gb|ADE76297.1| unknown [Picea sitchensis]
Length=461

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 156/253 (62%), Gaps = 34/253 (13%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYFYPYF-------QYQDWIYVGDQ-----DPTPFYSNNQ  378
            KLN QAP FVPR+   + V G     F       Q+ +   VG +      PTP  S+  
Sbjct  82   KLNAQAPVFVPRAQVAVHVGGLIPSSFTEHSLPEQFIEQEVVGSEPESAATPTPTPSS--  139

Query  379  NLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVAST  558
                     K  L +E++QK    VE+  SD +L  ++ L K + KDPEG+VPI  +A+ 
Sbjct  140  ---------KAVLTEELRQK----VEFYFSDANLPTDKYLMKFVKKDPEGFVPIPFLANF  186

Query  559  KKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPD  738
            +K+K+L+S+++  ++A AL++S++L+VS DGKKV+R  P  + D EE+QSRTVVAENLP+
Sbjct  187  RKVKNLVSNHS--LVAAALRTSSQLVVSEDGKKVRRLHPLADTDIEEVQSRTVVAENLPN  244

Query  739  DHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR-----SKGEYFISNKLHALIEFESPEIA  903
            D+S  N+EK F  VG+VK +R+  PQ  +S +      + + F+S+KLHAL+E+E+ E A
Sbjct  245  DYSIQNLEKRFGAVGNVKLVRVFQPQRYDSGQVSMKAHRNDMFVSSKLHALVEYETVEQA  304

Query  904  DKAVEKLNDERNW  942
            +KAV  LND  NW
Sbjct  305  EKAVADLNDGGNW  317



>ref|XP_006845325.1| hypothetical protein AMTR_s00141p00064150 [Amborella trichopoda]
 gb|ERN07000.1| hypothetical protein AMTR_s00141p00064150 [Amborella trichopoda]
Length=450

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 126/189 (67%), Gaps = 5/189 (3%)
 Frame = +1

Query  385  SPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKK  564
            +PP    K  L DE++ KIIKQVEY  S+ +L  ++ L K M KD EG+VPIS +AS +K
Sbjct  135  TPPTYSSKPVLTDELRDKIIKQVEYYFSNENLHTDKFLMKYMKKDKEGFVPISLIASFRK  194

Query  565  IKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDH  744
            +K L+   +  ++  AL +S++L+VS++GKKVKR  P    D    +SRTV+ ENLP+DH
Sbjct  195  MKKLVQDKS--LVVAALGASSQLVVSANGKKVKRLHPLPATDATTAKSRTVLVENLPEDH  252

Query  745  SHHNIEKIFNVVGSVKTIRICHPQDPNSSRSKG---EYFISNKLHALIEFESPEIADKAV  915
            S  NIE+IF  VG V ++RI  PQ    + +K    E  IS+KLHAL+E+E+ E A+KAV
Sbjct  253  SAQNIERIFGDVGKVNSVRITEPQSSTHAFAKSNKPEMMISSKLHALVEYETVEAAEKAV  312

Query  916  EKLNDERNW  942
              LNDERNW
Sbjct  313  AVLNDERNW  321



>ref|NP_001062396.1| Os08g0542900 [Oryza sativa Japonica Group]
 dbj|BAD08982.1| putative RNA recognition motif (RRM)-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF24310.1| Os08g0542900 [Oryza sativa Japonica Group]
 dbj|BAG93754.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83973.1| hypothetical protein OsI_30107 [Oryza sativa Indica Group]
 gb|EEE69086.1| hypothetical protein OsJ_28141 [Oryza sativa Japonica Group]
Length=427

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 126/183 (69%), Gaps = 9/183 (5%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            +P++V ++++KQVE+  SD++L   E+L K M +DPEG+VP+S VAS +KI+ L+S  + 
Sbjct  103  IPEDVARRVVKQVEFYFSDVNLATTEHLMKFMIRDPEGFVPMSVVASFRKIRELVSERS-  161

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              LA  L++S +L+VS DGK+V+R+  FTE D EE+QSR VVAENL ++H + N+ KIF+
Sbjct  162  -ALAAVLRTSAELVVSDDGKRVRRRVLFTEADAEEVQSRIVVAENLREEHRYPNLMKIFS  220

Query  775  VVGSVKTIRICHPQD-------PNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
              GSVK+IR C+PQ             SK E   +NK+HA +E+E+ E A+KAV + +  
Sbjct  221  AFGSVKSIRTCYPQGGIDGAGTSTGKASKIEMLFANKVHAFVEYETVEDAEKAVSEFSSG  280

Query  934  RNW  942
            R+W
Sbjct  281  RSW  283


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  1300  GPRMPDGTRGFTMGRGKPLNTTAA  1371
             GPRMPDGTRGFTMGRGKPLN T A
Sbjct  403   GPRMPDGTRGFTMGRGKPLNPTNA  426



>dbj|BAJ97952.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 146/225 (65%), Gaps = 9/225 (4%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             LP+E+ ++++KQVE+  SD++L   ++L K ++KDP+G+VP++ VAS +KI+ L+  +  
Sbjct  87    LPEELARRVVKQVEFYFSDVNLATTDHLMKYITKDPDGFVPMTVVASFRKIRELIDRS--  144

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              +L  AL++ST+L+VS DGK V+R+ PF++ D EE+QSR +VAE LP+DH   N+ +IF+
Sbjct  145   -LLPGALRTSTELVVSDDGKMVRRRVPFSDVDAEEVQSRIIVAERLPEDHRFQNLMRIFS  203

Query  775   VVGSVKTIRICHPQDPNSSRSKG---EYFISNKLHALIEFESPEIADKAVEKLNDERNWr  945
              VGSVK+IR C+PQ  + S  K    E   +NKLHA +E+E+ E A+KAV +    R+ R
Sbjct  204   TVGSVKSIRTCYPQGIDISAGKSSRIEMIFANKLHAFVEYETVEDAEKAVAEFIGGRSLR  263

Query  946   kglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSV  1080
              G +   LL      V + RK   E   ++DD   P E   ED+ 
Sbjct  264   DGPKAHSLLDCLKHGVGQGRKGGDEEAADEDD---PEEYEAEDAA  305



>ref|XP_002445763.1| hypothetical protein SORBIDRAFT_07g025380 [Sorghum bicolor]
 gb|EES15258.1| hypothetical protein SORBIDRAFT_07g025380 [Sorghum bicolor]
Length=437

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 150/265 (57%), Gaps = 34/265 (13%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSG-------------------------YFYPYFQYQDWIYV  339
            +LN  APEF PRS TQ    G                         + +   ++Q     
Sbjct  26   RLNAAAPEFTPRSATQHHNHGNNPHRRGPHHHHQQHHHHHYHHHQPHQHYQPRHQHHQAE  85

Query  340  GDQDPTPFYSNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKD  519
             +        + +  +     Q++ LP+   +K++KQVE+  SD++L   E+L K ++KD
Sbjct  86   DEGSAAATAEDREGPAGAGQAQQHRLPEPEARKLVKQVEFYFSDINLATTEHLMKFITKD  145

Query  520  PEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEE  699
            P+G+VPIS VAS +KI+ ++   +  +L  AL++S++L+VS DGK+VKR QPF   + EE
Sbjct  146  PDGFVPISVVASFRKIREIVYDRS--LLVAALRASSELVVSEDGKQVKRSQPF---NAEE  200

Query  700  LQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSR----SKGEYFISNKL  867
            +QSR VVAENLP+D  H  + KIF+ VGSVK+IR C+PQD  ++     S+ E   +NKL
Sbjct  201  VQSRIVVAENLPEDQKHQTLMKIFSAVGSVKSIRTCYPQDVAAAAANKTSRIEMIFANKL  260

Query  868  HALIEFESPEIADKAVEKLNDERNW  942
            HA +E+ + E A+KAV +     NW
Sbjct  261  HAFVEYSTVEDAEKAVAEFGGGGNW  285



>gb|KGN44212.1| Lupus la ribonucleoprotein [Cucumis sativus]
Length=378

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 110/144 (76%), Gaps = 2/144 (1%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            ++ L DEV QK++ QVEY  SD++L   ++L + ++KDP+GYVPIS VAS KKIK+L++S
Sbjct  159  RSKLTDEVSQKLLNQVEYYFSDLNLATTDHLMRFVNKDPDGYVPISVVASFKKIKALINS  218

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            +    LA  L++S+KL+VS DGKKVKRKQPF+E D EELQSR V+AENLP+DH H N+ K
Sbjct  219  HFQ--LANILRNSSKLLVSEDGKKVKRKQPFSESDMEELQSRIVIAENLPEDHCHQNLMK  276

Query  766  IFNVVGSVKTIRICHPQDPNSSRS  837
            IF+ VGSVK IR C PQ  +S  S
Sbjct  277  IFSAVGSVKNIRTCQPQISDSGAS  300



>ref|XP_001766501.1| predicted protein [Physcomitrella patens]
 gb|EDQ68829.1| predicted protein [Physcomitrella patens]
Length=913

 Score =   172 bits (437),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 130/197 (66%), Gaps = 20/197 (10%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  L + +K KI+KQVE+  SD +L  +  L K + KDPEG+VPI  VA  +KIK+L+ +
Sbjct  379  KAVLTEGLKAKIVKQVEFYFSDANLPTDNYLMKFVKKDPEGFVPIPVVALFRKIKNLVKN  438

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            ++  V+A AL+SST+L+VS DGKKV+R  P  E D EE+Q+RTVVAENLP++ S   IE 
Sbjct  439  HS--VVAAALRSSTQLVVSEDGKKVRRAHPLPEVDLEEIQARTVVAENLPENPSIETIEP  496

Query  766  IFNVVGSVKTIRICHPQDPNSSRS------KGEYFISNK------------LHALIEFES  891
            +F  VG+VK +RIC P+  N + S      K +  ISNK            LHAL+EFE+
Sbjct  497  LFRKVGTVKMVRICSPEAANGANSTAAKHPKTDMLISNKVNRNCGSDNVFTLHALVEFET  556

Query  892  PEIADKAVEKLNDERNW  942
             E+A+KAV +L D+RNW
Sbjct  557  VELAEKAVAELTDQRNW  573



>gb|EMT23549.1| La-related protein 7 [Aegilops tauschii]
Length=296

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 139/213 (65%), Gaps = 9/213 (4%)
 Frame = +1

Query  451   VEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTK  630
             VE+  SD++L   ++L K ++KDP+G+VP++ VAS +KI+ L+  +   +L  AL++ST+
Sbjct  2     VEFYFSDVNLATTDHLMKYITKDPDGFVPMTVVASFRKIRELIDRS---LLPGALRTSTE  58

Query  631   LIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICH  810
             L+VS DGK V+R+ PF++ D EE+QSR +VAE LP+DH + N+ +IF+ VGSVK+IR C+
Sbjct  59    LVVSDDGKMVRRRVPFSDVDAEEVQSRIIVAEKLPEDHRYQNLMRIFSTVGSVKSIRTCY  118

Query  811   PQDPNSSRSKG---EYFISNKLHALIEFESPEIADKAVEKLNDERNWrkglrvklllrrS  981
             PQ  + S  K    E   +NKLHA +E+ + E A+KAV + +  RNWR G RV+ LL   
Sbjct  119   PQGIDISAGKSSRIEMLFANKLHAFVEYGTVEDAEKAVAEFSGGRNWRDGPRVRSLLGCL  178

Query  982   PRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSV  1080
                + + RK   E   ++DD   P E   ED+ 
Sbjct  179   KHGIGQGRKGGDEEAADEDD---PEEYEAEDAA  208



>ref|XP_008664459.1| PREDICTED: la-related protein 6B-like [Zea mays]
 tpg|DAA48338.1| TPA: hypothetical protein ZEAMMB73_076919 [Zea mays]
Length=430

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 149/265 (56%), Gaps = 38/265 (14%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYF-------------------------YPYFQYQDWIYV  339
            +LN  APEF PRS  Q   +                            + + Q Q     
Sbjct  23   RLNAAAPEFTPRSAAQHHGNNAHRRGPHHHHQPHHHPHYHPHQHYQPRHQHHQAQ----A  78

Query  340  GDQDPTPFYSNNQNLSPPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKD  519
             D+      + ++       Q ++ LP+   +K++KQVE+  SD++L   E+L K ++KD
Sbjct  79   EDEGSAAATAEDREGPAGAVQPQHRLPEPEARKLVKQVEFYFSDINLATTEHLMKFIAKD  138

Query  520  PEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEE  699
            P+G+VPIS VAS +KI+ ++   +  +L  AL++S++L+VS DGK VKR QPF   + EE
Sbjct  139  PDGFVPISVVASFRKIREIVYDRS--LLVAALRTSSELVVSEDGKHVKRLQPF---NAEE  193

Query  700  LQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQD--PNSSR--SKGEYFISNKL  867
            +QSR VVAENLP+D  H  + KIF+ VG+VK+IR C+PQD  P ++   S+ E   +NKL
Sbjct  194  VQSRIVVAENLPEDQKHQTLMKIFSAVGNVKSIRTCYPQDISPAAANRTSRIEMIFANKL  253

Query  868  HALIEFESPEIADKAVEKLNDERNW  942
            H+ +E+ + E A+KAV +     NW
Sbjct  254  HSFVEYSTVEDAEKAVAEFGGGGNW  278



>ref|XP_001766431.1| predicted protein [Physcomitrella patens]
 gb|EDQ68759.1| predicted protein [Physcomitrella patens]
Length=507

 Score =   166 bits (419),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 127/199 (64%), Gaps = 27/199 (14%)
 Frame = +1

Query  421  DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
            +E+K KI+KQVEY  SD +L  +  L K + KD EG+VPI  VAS +KIK+L+ ++   V
Sbjct  146  EELKDKILKQVEYYFSDANLSTDTYLMKFVKKDAEGFVPIPVVASFRKIKNLMKNHG--V  203

Query  601  LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
            +A AL+ ST+L++S DGKKV+R  P  + D EE+Q+RTVVAENLP++HS  ++E++F  V
Sbjct  204  VAAALRKSTRLVLSEDGKKVRRALPLPDVDSEEVQARTVVAENLPEEHSIESMEQLFGKV  263

Query  781  GSVKTIRICHP------QDPNSSRSKGEYFISNKLHALIEFESPEIADKA----------  912
            G+VK +RIC P             +K +  +SNKLHAL+E+E+ E+A+KA          
Sbjct  264  GTVKLVRICSPDAAIGTHGAGGRHTKSDMLVSNKLHALVEYETVELAEKAGSKRLQSGAN  323

Query  913  ---------VEKLNDERNW  942
                     V +L DERNW
Sbjct  324  AYKVTSSAQVTELTDERNW  342



>ref|XP_009101528.1| PREDICTED: la-related protein 6A isoform X1 [Brassica rapa]
Length=405

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 126/330 (38%), Positives = 187/330 (57%), Gaps = 17/330 (5%)
 Frame = +1

Query  421   DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
             DE+KQKII+QVEY  SD +L  ++ L   M K+ +G+VPIS++A+  K+K L  +    +
Sbjct  79    DELKQKIIRQVEYYFSDENLPTDKFLLNAMKKNKKGFVPISSIATFHKMKKL--TRDLDL  136

Query  601   LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
             +  AL+ S+ L+VSSDGKKVKR  P  E    + +  TV+ ENLP+DHS  NI  IF   
Sbjct  137   IVSALKESSFLVVSSDGKKVKRLSPLPE--ARDPKVFTVLVENLPEDHSDENIRAIFGKA  194

Query  781   GSVKTIRICHPQDPNSSR-----SKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWr  945
             GS+K++ IC   DPN++       K + FI  +LHA +E+E+ E A+KA   LN+E++WR
Sbjct  195   GSIKSVSIC---DPNAAEESEKGCKKDKFIRTRLHAFVEYETVEAAEKAAATLNNEQDWR  251

Query  946   kglrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVE  1125
              GLRVKLL +    +  +  + E +   ++  +        E+  S+          + +
Sbjct  252   NGLRVKLLEQAVKYAQRRPARKEVDPEKDNAGRVHDQTGGEENKNSNEHQHHRHHHHHSD  311

Query  1126  ESSgggaakkgwgkgrgkTRLRTQIH-GGRGLLaaspqcssssssasgqsesPMKQASK-  1299
               +      K   K R + R R Q H G  G++  +   SSSS   +     P++ + + 
Sbjct  312   TPADNDGGDKNGNKDRTRGRGRRQNHQGSNGIVHGTSPSSSSSFHHNYNHHHPVEVSKRP  371

Query  1300  -GPRMPDGTRGFTMGRGKPLNTTAAPPSSV  1386
              GP+MPDGTRGFTMGRGKPL+T   PP+S 
Sbjct  372   PGPKMPDGTRGFTMGRGKPLST--PPPTSA  399



>ref|XP_010413626.1| PREDICTED: la-related protein 6B-like [Camelina sativa]
Length=398

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 136/243 (56%), Gaps = 24/243 (10%)
 Frame = +1

Query  235  KLNVQAPEFVPRSITQMPVSGYFYPYFQYQDW-IYVGDQDPTPFYSNNQNLSPPQTQQ--  405
            +LN  APEFVP     M      + Y  Y    ++ G   P     + +    P+T    
Sbjct  35   RLNASAPEFVPARPRMMIPPPPPHMYLHYPSPPLFTG---PHERRRDRKKKEQPETGASV  91

Query  406  ----KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKS  573
                K+ LP++  QKI+KQVEY   D++L   + L + +SKDP+GYVP+  VAS  KIKS
Sbjct  92   SIDPKSGLPEDTVQKIVKQVEYYFGDLNLATTDLLMRFISKDPQGYVPVHVVASFNKIKS  151

Query  574  LLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHH  753
             ++S++   LA  LQ S+K +VS DG+KV+R  P T+   EELQSR V+A NLP DH +H
Sbjct  152  FINSDSQ--LASVLQYSSKFVVSEDGQKVRRIYPITKIALEELQSRIVIAGNLPADHCYH  209

Query  754  NIEKIFNVVGSVKTIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDE  933
            N+ KIF+ VGSVK IR C PQ+       G  F S    A  +F +       V +LN+E
Sbjct  210  NLMKIFSAVGSVKHIRTCQPQN------SGNGFPSAARSANTDFSN------KVAELNEE  257

Query  934  RNW  942
            RNW
Sbjct  258  RNW  260



>ref|XP_002276730.2| PREDICTED: la-related protein 6A isoform X2 [Vitis vinifera]
 emb|CBI30861.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 187/318 (59%), Gaps = 22/318 (7%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             L D+++ KIIKQVEY  SD +L  ++ L   + KD  G+VPI+ +AS +K+K L  +   
Sbjct  36    LADDIRGKIIKQVEYYFSDENLPTDKYLMNLLKKDKNGFVPIAVIASFRKMKKL--TQDI  93

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
             Q++  AL+ S++L+VSSDGKKVKR  P +  + ++ +  TV+ ENLP+DHS  NI++IF 
Sbjct  94    QLIVAALRESSQLVVSSDGKKVKRLHPLSLTEVKDSKICTVLIENLPEDHSTENIQRIFG  153

Query  775   VVGSVKTIRICHP--QDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrk  948
               G++K I I  P   + ++  S+ E  IS KLHA++++E+ E A++AV  LN+E++WR 
Sbjct  154   AAGNIKKICIHDPYATEESTKDSRVEKLISGKLHAIVDYETVEAAERAVATLNNEQDWRN  213

Query  949   glrvklllrrSPRSVLKTRKSEFEGC-LEDDDQAPPVESAP-EDSVSSPLHQLESTETNV  1122
             G+RVKLL ++  +     R+  ++G  +E +    P   A  E++ SS  H     E + 
Sbjct  214   GMRVKLLHKQMGK--YGQRRKGWKGSDMEKNSSVGPAHPAGDEENNSSERHDETPDEEDG  271

Query  1123  EESSgggaakkgwgkgrgkTRLRTQIHG-GRGLLaaspqcssssssasgqsesPMKQASK  1299
             E  +      +G  +GR + +    ++G G G L++S     S             +   
Sbjct  272   EHLTKEKNGPRGRNRGRSRGQKYRCMNGQGHGTLSSSYGAEGS-------------KPPP  318

Query  1300  GPRMPDGTRGFTMGRGKP  1353
             GP+MPDGTRGFTMGRG+P
Sbjct  319   GPKMPDGTRGFTMGRGRP  336



>gb|EMS68293.1| La-related protein 7 [Triticum urartu]
Length=246

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  400  QQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLL  579
            Q+    P  V       VEY  SD++L   E+L + +SKDP+GYVPIS +A  KKIK+L+
Sbjct  85   QRCQITPKIVYNDCQGNVEYYFSDINLATTEHLMRFISKDPQGYVPISVIAGFKKIKALV  144

Query  580  SSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNI  759
             +N   +LA AL++S+KL+VS DGK+VKR+ PFTE D +E QSR VVAENLP D S+ N+
Sbjct  145  HNNP--MLAAALRTSSKLVVSGDGKRVKRRHPFTESDMQEFQSRIVVAENLPGDPSYQNL  202

Query  760  EKIFNVVGSVKTIRICHPQDPNS  828
             KIF+ VGSV+TIR C+PQ PN 
Sbjct  203  MKIFSAVGSVRTIRTCYPQTPNG  225



>gb|KEH24677.1| LA-related protein 6 LA RNA-binding domain protein, putative 
[Medicago truncatula]
Length=424

 Score =   159 bits (403),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = +1

Query  433  QKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQA  612
             KI+KQVEY  SD++L   ++L + ++KDPEG+VPIS VAS KKIK+L++S++   LA  
Sbjct  116  HKILKQVEYYFSDLNLATTDHLMRFINKDPEGFVPISVVASFKKIKALITSHSQ--LANV  173

Query  613  LQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVK  792
            L++S+KL+VS DGKK+KR+   TE D EELQSR V+AENLP+DH H N+ K+F+ VGSVK
Sbjct  174  LRNSSKLVVSEDGKKIKRQYSPTESDIEELQSRIVIAENLPEDHCHQNLMKVFSAVGSVK  233

Query  793  TIRICHPQDPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            TIR C PQ  N+  S      S K+  +       + +K  E LNDE NW
Sbjct  234  TIRTCPPQTSNNGTSSASR--SGKVDGI------PLHNKVTE-LNDEGNW  274



>ref|XP_009402690.1| PREDICTED: la-related protein 6A [Musa acuminata subsp. malaccensis]
Length=412

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 176/316 (56%), Gaps = 20/316 (6%)
 Frame = +1

Query  415   LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
             L DE++ +I++QVEY  SD +L  ++ L K + KD +GYVPI+ +AS +++K L+     
Sbjct  101   LSDELRDQIVRQVEYYFSDENLPTDKFLLKFIKKDKKGYVPIAVIASFRRMKKLVQD--L  158

Query  595   QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              ++  AL++S++L+VS DGKKV+R  P       E +SRT++ ENLPDD S  N+++IF 
Sbjct  159   SLIEAALRTSSQLVVSEDGKKVRRLNPLPVVATTEAKSRTILVENLPDDRSEENMQRIFG  218

Query  775   VVGSVKTIRICHPQ--DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrk  948
              +G +  I +  P+  D ++S  K    IS+K+HAL+E+E+ + A  AV  LNDE+NWR 
Sbjct  219   KLGKIVKITLHDPRSVDKSASNWKSGATISSKVHALVEYETVDAAASAVSSLNDEKNWRS  278

Query  949   glrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLE-STETNVE  1125
             G+RV          +L  R  ++ G +    +A  VE +    V  P    E S+  N E
Sbjct  279   GMRV---------ELLLKRMGKY-GLVPKGRKATSVEKSNSAQVDEPTADREKSSLDNHE  328

Query  1126  ESSgggaakkgwgkgrgkTRLRTQIHGGRGLLaaspqcssssssasgqsesPMKQASKGP  1305
             E       ++G G  R + + R     GRG +  S        +    +     +  +GP
Sbjct  329   ELPTTEEGEQGKGVRRNRYKSR-----GRGQVRQSDNGHGHGRNPPASAVDFPHKPVQGP  383

Query  1306  RMPDGTRGFTMGRGKP  1353
             RMPDGTRGF+ GRGKP
Sbjct  384   RMPDGTRGFSFGRGKP  399



>gb|AAL06505.1|AF412052_1 At2g43970/F6E13.10 [Arabidopsis thaliana]
Length=329

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 107/154 (69%), Gaps = 12/154 (8%)
 Frame = +1

Query  508  MSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEK  687
            + KDPEGYVPI  VAS KKIK+++++N+   LA  LQ+S KL VS DGKKV+R  P TE 
Sbjct  4    ICKDPEGYVPIHVVASFKKIKAVINNNSQ--LAAVLQNSAKLFVSEDGKKVRRISPITES  61

Query  688  DKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNS---------SRSK  840
              EELQSR +VAENLP+DH + N+ KIF+ VGSVK IR C PQ+  S         ++S 
Sbjct  62   AIEELQSRIIVAENLPEDHCYQNLMKIFSTVGSVKNIRTCQPQNNGSGAPPAARSAAKSD  121

Query  841  GEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            G  F SNK+HA +E+E  E+A++AV +L++  NW
Sbjct  122  GTLF-SNKVHAFVEYEIVELAERAVTELSEAGNW  154



>ref|XP_004134576.1| PREDICTED: la protein homolog [Cucumis sativus]
 gb|KGN49390.1| hypothetical protein Csa_6G523320 [Cucumis sativus]
Length=388

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            LP+++KQ+I+KQVEY  SD +L +++ L   + K+ EGYVPI+ +AS K+++ L  ++  
Sbjct  66   LPEDLKQRIVKQVEYYFSDENLPSDKYLLGLVKKNKEGYVPIAIIASFKRMRKL--THDR  123

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              +  AL+ S+ L+VSS+GKKVKR  P +  +  + +  T++ ENLP+DHS  N+++IF 
Sbjct  124  SFITAALRESSVLVVSSNGKKVKRLHPISLPETRDPKLFTILVENLPEDHSEENMKRIFG  183

Query  775  VVGSVKTIRICHPQ--DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            V G +++I IC P   D     SKG+  ISNKLHAL+E+E+ E ++KAV  LNDE++W
Sbjct  184  VAGRIRSITICDPHVVDKLGKSSKGDVLISNKLHALVEYETLEASEKAVATLNDEQDW  241



>ref|XP_003542932.1| PREDICTED: stress response protein NST1-like isoform X1 [Glycine 
max]
Length=400

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 180/318 (57%), Gaps = 27/318 (8%)
 Frame = +1

Query  421   DEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTTQV  600
             +++K KIIKQ EY  SD +L  ++ L   + ++ EG+VP+S +AS +KIK L   +    
Sbjct  97    EDLKLKIIKQAEYYFSDENLPTDKYLLGFVKRNKEGFVPVSVIASFRKIKKLTRDHA--F  154

Query  601   LAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFNVV  780
             +  AL+ S+ L+VS DG++VKR  P    +  + +  TV+ ENLP+DHS  NI++IF+  
Sbjct  155   IVAALKESSLLVVSGDGRRVKRLNPLRFNESRDHKLYTVLVENLPEDHSKKNIQQIFHEA  214

Query  781   GSVKTIRICHPQDPNSS---RSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNWrkg  951
             G++K I I  P   + S    +K E  ISNKLHAL+E+E+ E A+KAV  LN+E++WR G
Sbjct  215   GNIKRITIHDPHSTSESAKQHNKQEMLISNKLHALVEYETMEAAEKAVAMLNNEQDWRNG  274

Query  952   lrvklllrrSPRSVLKTRKSEFEGCLEDDDQAPPVESAPEDSVSSPLHQLESTETNVEES  1131
             +RVKLL           +K  ++G   + + + P ++  E++  S  H     +T+ EE 
Sbjct  275   MRVKLLKGMGK---YGHKKQAWKGHHSEKNSSRPEQTGDEENHGSNDHH---EDTHEEED  328

Query  1132  SgggaakkgwgkgrgkTRLRTQIH-GGRGLLaaspqcssssssasgqsesPMKQASK---  1299
                 +  KG  + R + R R   +  G G+   S   + ++            +ASK   
Sbjct  329   GDHLSKDKGGQRYRNQGRSRKHKYRAGNGMGHGSAPSTHAA------------EASKSPP  376

Query  1300  GPRMPDGTRGFTMGRGKP  1353
             GPRMPDGTRGF +GRG+P
Sbjct  377   GPRMPDGTRGFAVGRGRP  394



>ref|NP_850406.1| RNA-binding protein [Arabidopsis thaliana]
 gb|AEC10357.1| RNA-binding protein [Arabidopsis thaliana]
Length=529

 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 112/168 (67%), Gaps = 12/168 (7%)
 Frame = +1

Query  406  KNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSS  585
            K  LP++  QKI+ QVEY  SD++L   ++L + + KDPEGYVPI  VAS KKIK+++++
Sbjct  186  KTGLPEDSIQKIVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINN  245

Query  586  NTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEK  765
            N+   LA  LQ+S KL VS DGKKV+R  P TE   EELQSR +VAENLP+DH + N+ K
Sbjct  246  NSQ--LAAVLQNSAKLFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMK  303

Query  766  IFNVVGSVKTIRICHPQDPNS---------SRSKGEYFISNKLHALIE  882
            IF+ VGSVK IR C PQ+  S         ++S G  F SNK+  L E
Sbjct  304  IFSTVGSVKNIRTCQPQNNGSGAPPAARSAAKSDGTLF-SNKVTELSE  350



>ref|XP_008439642.1| PREDICTED: la-related protein 6A [Cucumis melo]
Length=394

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  415  LPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNTT  594
            LP+++KQ+I+KQVEY  SD +L +++ L   + K+ EGYVPI+ +AS K++K L  ++  
Sbjct  72   LPEDLKQRIVKQVEYYFSDENLPSDKYLLGLIKKNKEGYVPIAIIASFKRMKKL--THDR  129

Query  595  QVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIFN  774
              +  AL+ S+ L+VSS+GKKVKR  P +  +  + +  T++ ENLP+DHS  NI++IF 
Sbjct  130  SFITAALRESSVLVVSSNGKKVKRLHPISLPETRDSKLFTILVENLPEDHSEENIKRIFG  189

Query  775  VVGSVKTIRICHPQ--DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            V G +++I IC P   D     +K +  ISNKLHAL+E+E+ E ++KAV  LNDE++W
Sbjct  190  VAGRIRSITICDPHVVDKLGKSNKSDVLISNKLHALVEYETLEASEKAVATLNDEQDW  247



>ref|XP_001774093.1| predicted protein [Physcomitrella patens]
 gb|EDQ61145.1| predicted protein [Physcomitrella patens]
Length=295

 Score =   150 bits (380),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = +1

Query  502  KQMSKDPEGYVPISAVASTKKIKSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFT  681
            K + KDPEG+VPI  VAS +KIK+L+ ++   V+A AL++ST L+VS DGK+V+R  P  
Sbjct  2    KFVKKDPEGFVPIPVVASLRKIKNLVKNHG--VVAAALRNSTLLVVSEDGKRVRRAHPLP  59

Query  682  EKDKEELQSRTVVAENLPDDHSHHNIEKIFNVVGSVKTIRICHPQDPNSSRS------KG  843
            E + EE+QSRTVVAE+LP++ S  +I+++F  VG VK++RIC P+  N + S      K 
Sbjct  60   EVNLEEVQSRTVVAEDLPENSSIGSIQELFGKVGKVKSVRICPPEVANGAISSSAKHPKT  119

Query  844  EYFISNKLHALIEFESPEIADKAVEKLNDERNW  942
            +  ISNKLHAL+EFE+ E+A+KAV +L +ERNW
Sbjct  120  DILISNKLHALVEFETVELAEKAVVELTNERNW  152



>ref|XP_008225473.1| PREDICTED: la-related protein 6A [Prunus mume]
Length=376

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 126/187 (67%), Gaps = 5/187 (3%)
 Frame = +1

Query  388  PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
            P Q+     L D++KQKIIKQVEY  SD +L +++++   + K+ EG+VPIS +AS +K+
Sbjct  58   PDQSSGTGGLSDDLKQKIIKQVEYYFSDENLPSDKHMLSLIKKNKEGFVPISVIASFRKM  117

Query  568  KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
            K L+ +N+  ++A AL+ S+ L+VSS+GKK+KR  P    +  + +  TV+ ENLP+DHS
Sbjct  118  KKLIRNNS--LIAAALRESSLLVVSSNGKKLKRLHPLPLPENRDAKC-TVLVENLPEDHS  174

Query  748  HHNIEKIFNVVGSVKTIRICHPQ--DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
              N+++IF   G++K + I  P   + ++   K E  ISNKLHAL+E+++ E ADKAV  
Sbjct  175  VENLKRIFGEAGNIKDVCILDPHAIEASTKGGKAEKLISNKLHALVEYDTVEAADKAVTT  234

Query  922  LNDERNW  942
            LN+E +W
Sbjct  235  LNNEEDW  241



>ref|XP_010232344.1| PREDICTED: la-related protein 6A [Brachypodium distachyon]
Length=513

 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 185/328 (56%), Gaps = 28/328 (9%)
 Frame = +1

Query  412   SLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKIKSLLSSNT  591
              L DE+++KI+KQVEY  SD +L  ++++ K +  + +G+VP+  +AS +K+K L  +  
Sbjct  187   GLTDELREKIVKQVEYYFSDENLPTDDHMLKFVKNNKQGFVPLGVIASFRKMKKL--TQD  244

Query  592   TQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHSHHNIEKIF  771
               ++  AL++S+KL+VSS+GK+++R  P    + ++++ RTV+ ENLP D S  +I++ F
Sbjct  245   LSIIEAALRTSSKLVVSSNGKRIRRLHPLPCNELKDVKKRTVLVENLPLDFSMESIQEKF  304

Query  772   NVVGSVKTIRICHPQDPNSSRS--KGEYFISNKLHALIEFESPEIADKAVEKLNDERNWr  945
               VG +  I I  P     S +  K ++ +SNK+HA++E+E+ E+A+KA   LNDERNWR
Sbjct  305   GTVGKIMKITIHDPHAVGESAASKKPDFMLSNKVHAVVEYEAVEVAEKAATTLNDERNWR  364

Query  946   kglrvklllrrSPRSVLKTRKS--EFEGCLE---DDDQAPPVESAPEDSVSSPLHQLEST  1110
              G+RV LL +RS     +  +S  E  G +    ++DQ+       + SVS      +S 
Sbjct  365   TGMRVILLAKRSVTGSARHIQSSKENHGTVSKKNNEDQS----LKEQGSVSEQNGGADSG  420

Query  1111  ETNVEESSgggaakkgwgkgrgkT--------RLRTQIHGGRGLLaaspqcssssssasg  1266
             E  +++ +          +   KT        R R+Q   G+GL+  +       S  S 
Sbjct  421   EVALDKENMNSDVNHEEVRRHQKTIAKGGQKGRYRSQ---GKGLIQQNTSGHGHGSFPSD  477

Query  1267  qsesPMKQASKGPRMPDGTRGFTMGRGK  1350
                 P+     GPRMPDGTRGFTMGRG+
Sbjct  478   SMNKPI----SGPRMPDGTRGFTMGRGR  501



>ref|XP_007211445.1| hypothetical protein PRUPE_ppa007255mg [Prunus persica]
 gb|EMJ12644.1| hypothetical protein PRUPE_ppa007255mg [Prunus persica]
Length=376

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +1

Query  388  PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
            P Q+     L +++KQKIIKQVEY  SD +L +++++   + K+ EG+VPIS +AS +K+
Sbjct  58   PDQSSGTGGLSNDLKQKIIKQVEYYFSDENLPSDKHMLSLIKKNKEGFVPISVIASFRKM  117

Query  568  KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
            K L+ +N+  ++A AL+ S+ L+VSS+GKK+KR  P    +  + +  TV+ ENLP+DHS
Sbjct  118  KKLIRNNS--LIAAALRESSLLVVSSNGKKLKRLHPLPLPENRDAKC-TVLVENLPEDHS  174

Query  748  HHNIEKIFNVVGSVKTIRICHPQ--DPNSSRSKGEYFISNKLHALIEFESPEIADKAVEK  921
              N+++IF   G++K + I  P   + ++  SK E  ISNKLHAL+E+++ E ADKAV  
Sbjct  175  VENLKRIFGEAGNIKDVCILDPHAIEASTKGSKAEKLISNKLHALVEYDTVEAADKAVTT  234

Query  922  LNDERNW  942
            LN+E +W
Sbjct  235  LNNEEDW  241



>ref|XP_009360880.1| PREDICTED: la-related protein 6A [Pyrus x bretschneideri]
Length=381

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 120/187 (64%), Gaps = 5/187 (3%)
 Frame = +1

Query  388  PPQTQQKNSLPDEVKQKIIKQVEYQLSDMSLLANENLAKQMSKDPEGYVPISAVASTKKI  567
            P Q+     L +++KQKIIKQVEY  SD +L  +  ++  + K+ EGYVPIS +AS +K+
Sbjct  65   PDQSSGAGGLSEDLKQKIIKQVEYYFSDENLPTDNYMSSMIKKNKEGYVPISVIASFRKM  124

Query  568  KSLLSSNTTQVLAQALQSSTKLIVSSDGKKVKRKQPFTEKDKEELQSRTVVAENLPDDHS  747
            K L+  N++  +A AL+ ST L+VSS+GKKVKR  P    +  + +  TV+ ENLP+DHS
Sbjct  125  KKLIQDNSS--IADALRESTLLVVSSNGKKVKRIHPLPSTENRDPKC-TVLVENLPEDHS  181

Query  748  HHNIEKIFNVVGSVKTIRICHPQDPNSSRSKG--EYFISNKLHALIEFESPEIADKAVEK  921
              N++ IF   G +K + I  P    +S   G  E  ISNKLHAL+E+++ E ADKAV  
Sbjct  182  VENLKTIFGEAGKIKDLCILDPHALEASTKGGKTEKLISNKLHALVEYDTVEAADKAVTT  241

Query  922  LNDERNW  942
            LN+E +W
Sbjct  242  LNNEGDW  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4294633319592