BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31850_g1_i1 len=528 path=[26:0-527]

Length=528
                                                                      Score     E

gb|EYU30298.1|  hypothetical protein MIMGU_mgv1a017316mg              95.1    7e-22   
emb|CDP09931.1|  unnamed protein product                              85.1    1e-17   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  82.8    1e-16   
emb|CAA59472.1|  hybrid proline-rich protein                          82.4    1e-16   Catharanthus roseus [chatas]
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    2e-16   
emb|CAA81526.1|  14 kDa polypeptide                                   82.4    2e-16   Catharanthus roseus [chatas]
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    82.0    2e-16   Vitis vinifera
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              81.3    3e-16   
emb|CBI31904.3|  unnamed protein product                              80.9    3e-16   
gb|KCW71996.1|  hypothetical protein EUGRSUZ_E00449                   80.1    3e-16   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              81.6    4e-16   
gb|EPS73889.1|  hypothetical protein M569_00868                       80.9    5e-16   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           80.5    6e-16   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           80.5    6e-16   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    6e-16   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    9e-16   
ref|XP_002271792.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    80.1    1e-15   Vitis vinifera
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    80.1    1e-15   
dbj|BAF46299.1|  extensin like protein                                80.1    1e-15   Ipomoea nil [qian niu]
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    1e-15   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    1e-15   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    1e-15   
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    1e-15   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    2e-15   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...  79.3    2e-15   
dbj|BAK05563.1|  predicted protein                                    80.5    2e-15   
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     79.3    2e-15   
gb|ABG91752.1|  HyPRP2                                                79.3    2e-15   Gossypium hirsutum [American cotton]
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   79.3    2e-15   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              79.0    2e-15   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    2e-15   
gb|ABQ88334.1|  lipid transfer protein                                79.0    3e-15   Capsicum annuum
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
gb|AEX33654.1|  lipid transfer protein                                79.0    3e-15   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.6    3e-15   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          79.0    3e-15   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        79.0    3e-15   Capsicum chinense [bonnet pepper]
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
gb|EPS71802.1|  hypothetical protein M569_02964                       79.0    3e-15   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.6    3e-15   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              78.6    4e-15   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    4e-15   
emb|CAI48077.1|  extensin-like protein                                78.6    4e-15   Capsicum chinense [bonnet pepper]
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...  78.6    4e-15   
ref|XP_010093706.1|  hypothetical protein L484_019047                 78.6    4e-15   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    4e-15   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           78.6    4e-15   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.6    5e-15   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    5e-15   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  77.8    6e-15   Ricinus communis
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    6e-15   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    6e-15   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.6    7e-15   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  77.8    7e-15   Ricinus communis
gb|ABP35529.1|  proline-rich protein                                  77.4    8e-15   Ipomoea batatas [batate]
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    8e-15   
ref|XP_010093705.1|  hypothetical protein L484_019046                 77.0    9e-15   
emb|CBI31906.3|  unnamed protein product                              77.0    1e-14   
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  78.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88189.1|  hypothetical protein OsI_09636                        78.2    1e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001048668.1|  Os03g0103300                                     78.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   77.4    1e-14   
dbj|BAA05471.1|  tumor-related protein                                76.3    1e-14   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_010533776.1|  PREDICTED: lipid transfer protein EARLI 1        77.4    1e-14   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    1e-14   
dbj|BAG50511.1|  qLTG-3-1                                             78.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ08379.1|  qLTG3-1                                              78.2    1e-14   
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  78.2    1e-14   
dbj|BAJ08384.1|  qLTG3-1                                              78.2    1e-14   
dbj|BAJ08383.1|  qLTG3-1                                              78.2    1e-14   
dbj|BAJ08381.1|  qLTG3-1                                              78.2    1e-14   
dbj|BAJ08382.1|  qLTG3-1                                              78.2    1e-14   
dbj|BAJ08386.1|  qLTG3-1                                              78.2    1e-14   
dbj|BAJ08385.1|  qLTG3-1                                              78.2    1e-14   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    2e-14   
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  77.8    2e-14   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    2e-14   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    2e-14   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  79.0    2e-14   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    2e-14   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   76.3    2e-14   
gb|EYU31726.1|  hypothetical protein MIMGU_mgv1a019851mg              75.9    2e-14   
ref|XP_010088890.1|  hypothetical protein L484_020878                 76.3    2e-14   
ref|XP_008448870.1|  PREDICTED: lipid transfer protein EARLI 1-like   77.8    2e-14   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    75.9    2e-14   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  76.3    3e-14   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            76.3    3e-14   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  76.3    3e-14   Ricinus communis
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  77.4    3e-14   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    3e-14   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    75.9    3e-14   Vitis vinifera
ref|XP_006369032.1|  HyPRP family protein                             75.9    3e-14   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   75.9    3e-14   
dbj|BAA13155.1|  glycine-rich polypeptide                             75.1    3e-14   Nicotiana tabacum [American tobacco]
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    4e-14   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  76.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    4e-14   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    4e-14   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    4e-14   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    75.5    5e-14   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    75.5    5e-14   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    5e-14   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    5e-14   
ref|XP_002892674.1|  hypothetical protein ARALYDRAFT_471359           75.5    5e-14   
ref|NP_172673.1|  extensin-like protein                               75.5    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    5e-14   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   75.5    5e-14   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    5e-14   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    5e-14   
gb|ADD11814.1|  hybrid proline-rich protein                           75.1    5e-14   Cajanus cajan
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           75.5    5e-14   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           75.1    5e-14   
ref|XP_010434049.1|  PREDICTED: putative lipid-binding protein AIR1   75.5    6e-14   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           75.5    6e-14   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    6e-14   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           75.1    6e-14   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    7e-14   
dbj|BAA13150.1|  NT16 polypeptide                                     75.9    7e-14   Nicotiana tabacum [American tobacco]
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   75.1    7e-14   
gb|AFK47547.1|  unknown                                               75.1    8e-14   
ref|XP_004169260.1|  PREDICTED: putative lipid-binding protein At...  75.9    9e-14   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    9e-14   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    74.7    1e-13   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           74.7    1e-13   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  74.7    1e-13   
ref|XP_010696470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            75.5    1e-13   
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_010458633.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_006368194.1|  HyPRP family protein                             74.7    1e-13   
gb|KHN04353.1|  14 kDa proline-rich protein DC2.15                    74.3    1e-13   
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    75.1    1e-13   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
gb|AAC49369.1|  proline-rich 14 kDa protein                           74.3    1e-13   Phaseolus vulgaris [French bean]
emb|CDY31240.1|  BnaC08g15350D                                        74.3    1e-13   
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    1e-13   
ref|XP_007155643.1|  hypothetical protein PHAVU_003G219100g           73.9    1e-13   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    1e-13   
ref|XP_010439335.1|  PREDICTED: putative lipid-binding protein AIR1   74.3    1e-13   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   73.9    1e-13   
gb|AAM75351.1|AF520576_1  extensin-like protein                       75.1    1e-13   Glycine max [soybeans]
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    1e-13   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    1e-13   
gb|ACU21436.1|  unknown                                               74.7    2e-13   Glycine max [soybeans]
ref|XP_007210550.1|  hypothetical protein PRUPE_ppa014094mg           72.8    2e-13   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.2    2e-13   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    2e-13   
emb|CDP05328.1|  unnamed protein product                              73.9    2e-13   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       73.9    2e-13   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           73.9    2e-13   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           73.9    2e-13   
emb|CDP18670.1|  unnamed protein product                              73.9    2e-13   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    2e-13   
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    2e-13   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  74.3    2e-13   
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           73.6    2e-13   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        73.9    2e-13   
gb|AAD01800.1|  HyPRP                                                 73.9    2e-13   Fragaria x ananassa
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
emb|CDY31241.1|  BnaC08g15360D                                        73.6    2e-13   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.9    2e-13   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.9    2e-13   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           73.6    2e-13   Wolffia arrhiza
emb|CDY21034.1|  BnaA08g24910D                                        73.6    3e-13   
gb|AFK41425.1|  unknown                                               73.6    3e-13   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  73.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AIX10944.1|  PRP2-like protein                                     73.6    3e-13   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    73.6    3e-13   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           73.6    3e-13   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.6    3e-13   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    3e-13   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    3e-13   
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    3e-13   
emb|CDX82944.1|  BnaC01g13940D                                        73.2    3e-13   
gb|AFK37038.1|  unknown                                               73.2    3e-13   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   73.9    4e-13   
dbj|BAA11854.1|  extensin like protein                                73.2    4e-13   Populus nigra [black poplar]
ref|XP_004244453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_009612116.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_006357014.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    4e-13   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    4e-13   
emb|CDY21275.1|  BnaC03g29590D                                        72.8    4e-13   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    72.8    4e-13   Vitis vinifera
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        73.2    5e-13   
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  72.4    5e-13   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   72.8    5e-13   
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               73.2    5e-13   
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           72.8    5e-13   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
ref|XP_010676150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           72.8    5e-13   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           72.8    5e-13   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    5e-13   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           73.2    6e-13   
gb|AAC60566.1|  proline-rich SAC51                                    72.8    6e-13   Brassica napus [oilseed rape]
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    6e-13   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   72.4    6e-13   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    6e-13   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    6e-13   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   72.4    6e-13   
emb|CDP09932.1|  unnamed protein product                              72.8    6e-13   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  72.4    6e-13   Ricinus communis
emb|CDX90834.1|  BnaA03g25140D                                        72.4    7e-13   
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  72.4    7e-13   
ref|XP_004165755.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_008437105.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  72.8    8e-13   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    72.0    8e-13   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    8e-13   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    8e-13   
ref|XP_006367623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    8e-13   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    8e-13   
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       72.0    9e-13   
ref|XP_003608741.1|  Cortical cell-delineating protein                72.0    9e-13   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           71.6    1e-12   
ref|XP_009787417.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
emb|CDY61290.1|  BnaCnng37610D                                        72.0    1e-12   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    71.6    1e-12   Vitis vinifera
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  71.6    1e-12   Daucus carota [carrots]
ref|XP_004151035.1|  PREDICTED: uncharacterized protein LOC101220...  72.8    1e-12   
emb|CDY64848.1|  BnaC05g49400D                                        71.6    1e-12   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 71.6    1e-12   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           71.6    1e-12   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   71.6    1e-12   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               71.6    1e-12   
ref|XP_010676152.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    1e-12   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    1e-12   
gb|EMS52512.1|  14 kDa proline-rich protein DC2.15                    71.6    1e-12   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    1e-12   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       71.2    1e-12   
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           70.9    2e-12   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    71.2    2e-12   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    2e-12   
gb|KGN50238.1|  hypothetical protein Csa_5G161870                     71.2    2e-12   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    2e-12   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  71.2    2e-12   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           71.6    2e-12   
ref|XP_008796819.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.9    2e-12   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           70.9    2e-12   
gb|KHN04347.1|  14 kDa proline-rich protein DC2.15                    70.9    2e-12   
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           70.9    2e-12   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    2e-12   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.6    2e-12   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           71.2    2e-12   
ref|XP_004151036.1|  PREDICTED: uncharacterized protein LOC101220...  72.0    2e-12   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    2e-12   
ref|NP_192985.1|  putative lipid transfer protein                     71.6    2e-12   
gb|ACV74341.1|  proline-rich protein                                  70.9    2e-12   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  70.9    2e-12   
ref|XP_007155638.1|  hypothetical protein PHAVU_003G218700g           71.6    2e-12   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           70.9    2e-12   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    2e-12   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           70.5    2e-12   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    2e-12   
gb|KHG02760.1|  14 kDa proline-rich DC2                               70.9    2e-12   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-12   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.9    3e-12   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    3e-12   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    3e-12   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  70.5    3e-12   
ref|XP_003525814.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-12   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           70.9    3e-12   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-12   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           71.6    3e-12   
gb|AAM47507.1|  extensin-like protein                                 70.9    3e-12   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           71.6    3e-12   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    3e-12   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-12   
gb|KGN50240.1|  hypothetical protein Csa_5G161890                     70.5    3e-12   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-12   
emb|CDY32208.1|  BnaA03g54590D                                        70.5    3e-12   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   70.5    3e-12   
emb|CDX90837.1|  BnaA03g25170D                                        69.7    3e-12   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           70.1    3e-12   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.2    3e-12   
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    3e-12   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  71.6    4e-12   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           70.9    4e-12   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           70.1    4e-12   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           70.5    4e-12   
emb|CDY16710.1|  BnaA09g20880D                                        69.7    4e-12   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           70.1    4e-12   
gb|KGN55880.1|  hypothetical protein Csa_3G026160                     72.8    4e-12   
emb|CDY08680.1|  BnaC04g19890D                                        70.1    4e-12   
emb|CDY21276.1|  BnaC03g29600D                                        69.7    4e-12   
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    4e-12   
gb|AAX20042.1|  proline-rich protein                                  70.1    4e-12   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    4e-12   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   70.1    4e-12   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  70.1    4e-12   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  70.1    5e-12   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   69.7    5e-12   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  70.1    5e-12   
gb|AAK30571.1|AF346659_1  extensin-like protein                       70.1    5e-12   
gb|ADW80126.1|  hybrid proline-rich protein                           69.7    5e-12   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    5e-12   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           69.7    5e-12   
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       69.7    6e-12   
gb|AFK47889.1|  unknown                                               69.3    6e-12   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    6e-12   
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    6e-12   
ref|XP_003609035.1|  Proline-rich protein                             69.3    6e-12   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    6e-12   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    7e-12   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           69.7    7e-12   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               69.7    7e-12   
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   69.3    7e-12   
ref|XP_010544621.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    69.7    7e-12   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    69.7    7e-12   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    7e-12   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   69.3    7e-12   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  69.3    8e-12   
emb|CDX94516.1|  BnaC09g23200D                                        68.9    8e-12   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    8e-12   
emb|CAL07983.1|  arachidonic acid-induced DEA1-like protein           67.8    8e-12   
ref|XP_003603362.1|  Proline-rich protein                             69.3    8e-12   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    8e-12   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  69.3    9e-12   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        69.7    9e-12   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           69.3    9e-12   
ref|XP_002533291.1|  lipid binding protein, putative                  68.6    9e-12   
gb|ACE82175.1|  extensin-like protein                                 68.9    1e-11   
dbj|BAA99575.1|  DC2.15 like protein                                  68.9    1e-11   
emb|CAN80712.1|  hypothetical protein VITISV_033379                   69.3    1e-11   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    1e-11   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.9    1e-11   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  68.9    1e-11   
emb|CDY21277.1|  BnaC03g29610D                                        68.6    1e-11   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_010093708.1|  hypothetical protein L484_019049                 68.9    1e-11   
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    1e-11   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   68.9    1e-11   
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           68.9    1e-11   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   68.9    1e-11   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           68.9    1e-11   
ref|XP_003526352.1|  PREDICTED: extensin-like                         69.7    1e-11   
emb|CDX79156.1|  BnaA01g12230D                                        68.6    1e-11   
ref|XP_008448867.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    1e-11   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   68.6    2e-11   
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
gb|KCW77747.1|  hypothetical protein EUGRSUZ_D02041                   68.2    2e-11   
gb|KFK31980.1|  hypothetical protein AALP_AA6G184800                  68.9    2e-11   
ref|XP_010053449.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    68.2    2e-11   
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.9    2e-11   
gb|KHN09801.1|  14 kDa proline-rich protein DC2.15                    67.8    2e-11   
gb|EYU30297.1|  hypothetical protein MIMGU_mgv1a015941mg              68.6    2e-11   
ref|XP_006290090.1|  hypothetical protein CARUB_v10003735mg           67.8    2e-11   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    67.8    2e-11   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    2e-11   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  68.2    2e-11   
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           68.9    2e-11   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       68.2    2e-11   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        68.2    2e-11   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        68.2    2e-11   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  68.2    2e-11   
ref|NP_192984.1|  azelaic acid induced 1                              68.6    2e-11   
ref|XP_010529481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    2e-11   
emb|CDY21274.1|  BnaC03g29580D                                        68.6    2e-11   
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    2e-11   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   67.8    2e-11   
ref|XP_010422218.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.2    3e-11   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           68.6    3e-11   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    3e-11   
ref|XP_010048953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    3e-11   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        68.2    3e-11   
ref|XP_009625139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    3e-11   
ref|XP_008232631.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    3e-11   
emb|CDX94514.1|  BnaC09g23220D                                        68.2    3e-11   
ref|XP_006289530.1|  hypothetical protein CARUB_v10003073mg           68.2    3e-11   
ref|XP_010041938.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    3e-11   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    3e-11   
ref|XP_004165505.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa proli...  67.8    3e-11   
ref|XP_010099842.1|  hypothetical protein L484_008499                 67.4    3e-11   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        67.4    3e-11   
ref|XP_003588783.1|  14 kDa proline-rich protein DC2.15               67.8    3e-11   
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           67.4    4e-11   
emb|CDX90833.1|  BnaA03g25130D                                        67.8    4e-11   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   67.8    4e-11   
ref|XP_010433288.1|  PREDICTED: putative lipid-binding protein AIR1   66.6    4e-11   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    4e-11   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           67.8    4e-11   
ref|XP_009133710.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    67.0    4e-11   
emb|CDX95635.1|  BnaC03g25160D                                        67.0    4e-11   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  67.8    4e-11   
ref|XP_010539605.1|  PREDICTED: putative lipid-binding protein AIR1   67.4    4e-11   
ref|NP_001266108.1|  14 kDa proline-rich protein DC2.15-like prec...  67.0    4e-11   
ref|XP_009798523.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
dbj|BAB16428.1|  P-rich protein EIG-I30                               67.4    5e-11   
ref|NP_001148300.1|  cortical cell-delineating protein precursor      67.0    5e-11   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   67.4    5e-11   
gb|KHN08148.1|  Putative lipid-binding protein                        67.8    5e-11   
gb|ABQ01426.1|  bimodular protein                                     67.4    5e-11   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              67.0    5e-11   
gb|AAA32650.1|  bimodular protein                                     67.4    5e-11   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    5e-11   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        66.6    5e-11   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   67.0    6e-11   
ref|XP_009595495.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    6e-11   
gb|AAC02087.1|  hairy root 4                                          67.8    6e-11   
ref|NP_192986.1|  Bifunctional inhibitor/lipid-transfer protein/s...  67.4    6e-11   
gb|ACN26094.1|  unknown                                               66.6    6e-11   
ref|XP_004246067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    6e-11   
ref|NP_001151721.1|  LOC100285357 precursor                           66.6    6e-11   
ref|XP_002515493.1|  14 kDa proline-rich protein DC2.15 precursor...  66.6    6e-11   
ref|XP_009595506.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    7e-11   
ref|XP_010424613.1|  PREDICTED: putative lipid-binding protein AIR1   66.2    7e-11   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   66.2    7e-11   
ref|XP_009602607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    7e-11   
ref|XP_002454521.1|  hypothetical protein SORBIDRAFT_04g032620        66.6    7e-11   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    7e-11   
ref|XP_003559026.1|  PREDICTED: putative lipid-binding protein AIR1   66.6    8e-11   
ref|XP_007011824.1|  Bimodular protein                                66.6    8e-11   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  66.2    8e-11   
ref|XP_006647641.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    8e-11   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        66.2    8e-11   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        66.2    8e-11   
ref|NP_001053512.1|  Os04g0554600                                     66.2    9e-11   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   66.6    9e-11   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        66.2    9e-11   
ref|XP_003546415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    9e-11   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    1e-10   
ref|XP_007137003.1|  hypothetical protein PHAVU_009G092000g           66.6    1e-10   
gb|KHN33896.1|  14 kDa proline-rich protein DC2.15                    65.9    1e-10   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   66.6    1e-10   
gb|EMT15431.1|  14 kDa proline-rich protein                           65.9    1e-10   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   65.5    1e-10   
ref|NP_192992.1|  auxin-Induced in Root cultures 1                    65.5    1e-10   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   65.5    1e-10   
ref|XP_009401672.1|  PREDICTED: pEARLI1-like lipid transfer prote...  65.9    1e-10   
ref|XP_009775547.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    1e-10   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       67.4    1e-10   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   66.6    1e-10   
gb|EMS62564.1|  14 kDa proline-rich protein DC2.15                    65.9    1e-10   
ref|NP_849366.1|  Bifunctional inhibitor/lipid-transfer protein/s...  65.5    1e-10   
gb|EAY95110.1|  hypothetical protein OsI_16927                        65.9    1e-10   
ref|NP_001053511.1|  Os04g0554500                                     65.9    1e-10   
gb|AAM63191.1|  putative cell wall-plasma membrane disconnecting ...  65.1    2e-10   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  65.9    2e-10   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  65.9    2e-10   
ref|XP_010456925.1|  PREDICTED: putative lipid-binding protein AIR1   65.1    2e-10   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           65.1    2e-10   
ref|NP_001047650.1|  Os02g0662000                                     65.5    2e-10   
ref|XP_003588779.1|  14 kDa proline-rich protein DC2.15               66.2    2e-10   
gb|ACN54400.1|  hybrid proline-rich protein                           65.5    2e-10   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               65.9    2e-10   
ref|NP_001047651.1|  Os02g0662100                                     65.1    2e-10   
gb|AES59035.2|  Lipid transfer protein                                65.9    2e-10   
gb|EAY95111.1|  hypothetical protein OsI_16928                        65.5    2e-10   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       66.6    2e-10   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           65.1    2e-10   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        65.1    2e-10   
ref|XP_003588784.1|  14 kDa proline-rich protein DC2.15               65.9    2e-10   
ref|NP_001053513.2|  Os04g0554800                                     65.1    2e-10   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    2e-10   
ref|XP_011082205.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    2e-10   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        65.1    2e-10   
ref|XP_008232587.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    2e-10   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    3e-10   



>gb|EYU30298.1| hypothetical protein MIMGU_mgv1a017316mg [Erythranthe guttata]
Length=82

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  231  VKPFGVSLVQTLSSKLRERGTLRLMPRMFALMAVQRQTAASRSARPWMSEQHGVLGGVPT  52
            +K FG  L QTL SKL ERGT R +PR FALMAVQRQTAASRSA P M  QHGV GGVP 
Sbjct  1    MKSFGTFLEQTLRSKLSERGTFRFIPRTFALMAVQRQTAASRSANPAMRLQHGVFGGVPI  60

Query  51   VTLSKPLRRLAQTPNFR  1
            V    P  +L  TP+FR
Sbjct  61   VRPINPPSKLVHTPSFR  77



>emb|CDP09931.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GLLN+T+G PPK PCC+LIQGLADLEAAVCLCTAIKANILGINLN+PLS
Sbjct  51   LKLGVCANVLSGLLNITIGNPPKKPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLS  110

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K+ PKGF C
Sbjct  111  LSLLLNVCSKNVPKGFVC  128



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LN L+++ VGTPPKTPCC LIQGLADLEAAVCLCTAIKANILGINLNVP+S
Sbjct  61   LKLGVCANVLNDLIHLVVGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILGINLNVPVS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K+ PKGF C
Sbjct  121  LSLLLNYCGKNVPKGFQC  138



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL GL++  +G PPKTPCCSLI+GLADLEAAVCLCTAIKAN+LGINLNVP+S
Sbjct  60   LKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPVS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P+GF C
Sbjct  120  LSLLLNVCSKKVPEGFIC  137



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL GLL +T+GTPPKTPCC+LI+GLADLEAAVCLCTAIKANILGINLNVPLS
Sbjct  49   LKLGVCADLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILGINLNVPLS  108

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  PKGF C
Sbjct  109  LSLLLNVCSKKVPKGFVC  126



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL GL++  +G PPKTPCCSLI+GLADLEAAVCLCTAIKAN+LGINLNVP+S
Sbjct  60   LKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPVS  119

Query  182  lslllnvCTKDTPKGFTC  235
            L+LLLNVC+K  P+GF C
Sbjct  120  LTLLLNVCSKKVPEGFIC  137



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL GL+   VGTPPKTPCCSLIQGLADLEAAVCLCTAIKAN+LGINLN+PLS
Sbjct  57   LKLGVCANLLGGLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINLNIPLS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  117  LSLLLNVCSKKVPPGFQC  134



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LLNGLLNVTVGTPPKTPCCSLI+GL DLEAAVCLCTAIKAN+LGIN++VP+S
Sbjct  41   LKLGVCADLLNGLLNVTVGTPPKTPCCSLIEGLVDLEAAVCLCTAIKANVLGINIDVPIS  100

Query  182  lslllnvCTKDTPKGFTC  235
            L+LLLNVCTK  PK F C
Sbjct  101  LTLLLNVCTKSVPKDFVC  118



>emb|CBI31904.3| unnamed protein product [Vitis vinifera]
Length=111

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LL GLL V VG PPKTPCCSLIQGLADLEAAVCLCTAIKAN+LGINLN+PLS
Sbjct  33   LKLGVCVDLLGGLLGVVVGNPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINLNIPLS  92

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  93   LSLLLNVCSKKVPSGFQC  110



>gb|KCW71996.1| hypothetical protein EUGRSUZ_E00449 [Eucalyptus grandis]
Length=86

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  192  SKLRERGTLRLMPRMFALMAVQRQTAASRSARPWMSEQHGVLGGVPTVTLSKPLRRLAQT  13
            SKLRE G LRL+PRM ALMAVQRQTAASRS RP  +EQ G+ GGVP + L+ P   LA T
Sbjct  2    SKLREMGMLRLIPRMLALMAVQRQTAASRSRRPSRTEQQGMSGGVPMMALTGPSSTLAHT  61

Query  12   PNF  4
            P+F
Sbjct  62   PSF  64



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL GL+ +T+G+PPKTPCCSLI+GLADLEAAVCLCTAIKAN+LGINLNVP+S
Sbjct  68   LKLGVCADLLGGLIGLTIGSPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPIS  127

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K+ P GF C
Sbjct  128  LSLLLNVCSKNIPPGFQC  145



>gb|EPS73889.1| hypothetical protein M569_00868, partial [Genlisea aurea]
Length=137

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  LL + +GTPPKTPCCSLI+GLADLEAAVCLCTAIKAN+LGI+L+VP+S
Sbjct  60   LKLGVCADLLGSLLGLVIGTPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGISLDVPIS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C+K  P GF C
Sbjct  120  LSLLLNDCSKKLPTGFQC  137



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LN L+++ VGTPPKTPCCSLI+GL DLEAAVCLCTAIKANILGINLNVP+S
Sbjct  53   LKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINLNVPVS  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  113  LSLLLNFCGKKVPSGFQC  130



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCC+LIQGLADLEAAVCLCTAIKANILGINLN+PLS
Sbjct  54   LKLGVCANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P+GF C
Sbjct  114  LSLLLNVCSKSVPRGFQC  131



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LN L+++ VGTPPKTPCCSLI+GL DLEAAVCLCTAIKANILGINLNVP+S
Sbjct  56   LKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINLNVPVS  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  116  LSLLLNFCGKKVPSGFQC  133



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VGTPPK PCCSLI+GLADLEAAVCLCTAIKANILGI+LNVP+S
Sbjct  59   LKLGVCANLLNDLVHLVVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILGIHLNVPVS  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  119  LSLLLNYCGKKVPSGFQC  136



>ref|XP_002271792.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80710.1| hypothetical protein VITISV_033377 [Vitis vinifera]
Length=135

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LL GLL V VG PPKTPCCSLIQGLADLEAAVCLCTAIKAN+LGINLN+PLS
Sbjct  57   LKLGVCVDLLGGLLGVVVGNPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINLNIPLS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  117  LSLLLNVCSKKVPSGFQC  134



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VGTPPKTPCCSLI GLADLEAAVCLCTAIKAN+LGINLNVP+S
Sbjct  59   LKLGVCANLLNDLVHLVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGINLNVPVS  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  119  LSLLLNYCGKKVPSGFQC  136



>ref|XP_010933689.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=134

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +G PPK PCCSL+ GL DLEAAVCLCTA+KAN+LGI LN+P+ 
Sbjct  56   LKLGVCANVLNGLINVHLGRPPKKPCCSLLDGLVDLEAAVCLCTALKANVLGIKLNLPIH  115

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K+TPKGF CP
Sbjct  116  LSLLLNYCGKNTPKGFQCP  134



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN LL++ VGTPPKTPCCSLI+GLADLEAAVCLCTAIKANILG NLN+P+S
Sbjct  55   LKLGVCANLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILGNNLNIPIS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C +  PKGF C
Sbjct  115  LSLLLNYCGQGVPKGFQC  132



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + VG PPK PCCSLI+GL DLEAAVCLCTAIKANILGINLNVPLS
Sbjct  55   LKLGVCANVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGINLNVPLS  114

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  115  LSLLLNVCGKKVPSGFQCP  133



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LLNGL+N+ VGTPPKTPCCSL++GLADLEAAVCLCTAIKA++LGINLNVP+S
Sbjct  56   LKLGVCADLLNGLVNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLGINLNVPVS  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C KD P GF C
Sbjct  116  LSLLLNYCGKDVPYGFQC  133



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LL  LLNVTVGTPP  PCCS+IQGL DLEAAVCLCTAIKANILGINLN+P+S
Sbjct  54   LKLGVCAGLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIPVS  113

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  PKGF CP
Sbjct  114  LSLLLNVCGKKVPKGFQCP  132



>ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=124

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L GL+N+ +G PPK PCCSL++GL DLEAAVCLCTA++ANILGI LN+P+ 
Sbjct  46   LKLGVCANVLKGLINLNLGKPPKKPCCSLLEGLVDLEAAVCLCTALRANILGIKLNLPIH  105

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K TPKGF CP
Sbjct  106  LSLLLNYCGKKTPKGFQCP  124



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VGTPPKTPCC+LI+GLADLEAAVCLCTAIKAN+LGINLNVP+S
Sbjct  55   LKLGVCANLLNDLVHLVVGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVLGINLNVPVS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  115  LSLLLNYCGKKAPSGFQC  132



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G PPK PCC+LIQG+ADLEAA+CLCTAIKANILGINLNVPLS
Sbjct  52   LKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANILGINLNVPLS  111

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  112  LSLLLNVCGKQVPSGFQCP  130



>ref|XP_004306948.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VGTPPKTPCCSLI+GL DLEAAVCLCTA+KAN+LGINLNVP+S
Sbjct  57   LKLGVCANLLNDLVHLVVGTPPKTPCCSLIEGLVDLEAAVCLCTALKANVLGINLNVPIS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  117  LSLLLNYCGKGVPAGFQC  134



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ +GTPPK PCC+LI+GLADLEAAVCLCTAIKANILGI+LNVP+S
Sbjct  55   LKLGVCANLLNDLVHLVIGTPPKYPCCTLIEGLADLEAAVCLCTAIKANILGIHLNVPVS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  115  LSLLLNYCGKKVPSGFQC  132



>ref|XP_009591583.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Nicotiana tomentosiformis]
Length=135

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCCSLI+ L DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  57   LKLGVCANVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKANILGINLNLPIS  116

Query  182  lslllnvCTKDTPKGFTCP  238
            L+LLLNVC+K  PKGFTCP
Sbjct  117  LNLLLNVCSKKAPKGFTCP  135



>dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N+ +GTPPK PCC+LIQGLADLEAAVCLCTA+KANILGINLNVP+ 
Sbjct  114  LKLGVCANVLNGLINLQLGTPPKKPCCTLIQGLADLEAAVCLCTALKANILGINLNVPID  173

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLL+N C K+ P GF CP
Sbjct  174  LSLLVNYCGKNVPAGFQCP  192



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CA+LL GLLNVTVG PP  PCCSLIQGLADLEAAVCLCTAIKANILGINLN+P+S
Sbjct  62   LKLGICADLLGGLLNVTVGKPPVQPCCSLIQGLADLEAAVCLCTAIKANILGINLNIPVS  121

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K+ P GF C
Sbjct  122  LSLLLNVCSKNVPSGFQC  139



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL GLLNVT+GTPP  PCCSLIQGLADLEAAVCLCTAIKANILGINLNVPLS
Sbjct  59   LKLGVCADLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANILGINLNVPLS  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  119  LSLLLNVCSKKVPSGFQC  136



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +KLGVCAN+L  LL++ VGTPPKTPCCSLI GLADLEAAVCLCTAIKAN+LG+NLNVP+S
Sbjct  69   IKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNLNVPVS  128

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  129  LSLLLNYCGKKVPSGFQC  146



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VG+PPKTPCCSLI GLADLEAAVCLCTA+KAN+LGINLNVP+S
Sbjct  54   LKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLGINLNVPVS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  114  LSLLLNYCGKKVPSGFQC  131



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +KLGVCAN+L  LL++ VGTPPKTPCCSLI GLADLEAAVCLCTAIKAN+LG+NLNVP+S
Sbjct  53   IKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNLNVPVS  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  113  LSLLLNYCGKKVPSGFQC  130



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+L  LL V +G PPK PCCSLIQGL DLEAA+CLCTA+KANILGINLNVP+S
Sbjct  63   LKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGINLNVPIS  122

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  123  LSLLLNVCGKKVPSGFQCP  141



>ref|XP_008437101.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LL GL++VT+G PP TPCCSLI+GLADLEAAVCLCTAIKAN+LG+NLN+P+S
Sbjct  63   LKLGVCAKLLGGLVDVTIGKPPVTPCCSLIEGLADLEAAVCLCTAIKANLLGLNLNIPVS  122

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ PKGF C
Sbjct  123  LSLLLNVCQKNVPKGFQC  140



>ref|XP_009601879.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCCSLI  L DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  50   LKLGVCANVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPIS  109

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+KD PKGF CP
Sbjct  110  LSLLLNVCSKDIPKGFACP  128



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VG PPKTPCC+L++GLADLEAA+CLCTAIKAN+LGINLNVP+S
Sbjct  56   LKLGVCANLLNDLVHLVVGAPPKTPCCTLLKGLADLEAALCLCTAIKANVLGINLNVPVS  115

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K  P GF CP
Sbjct  116  LSLLLNYCGKKVPTGFQCP  134



>ref|XP_009783170.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=126

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCCSL+  L DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  48   LKLGVCANVLNGLLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGINLNIPIS  107

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+KD PKGFTCP
Sbjct  108  LSLLLNVCSKDIPKGFTCP  126



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL V +G PPK PCCSLI+GL DLEAA+CLCTAIKANILGINLNVPLS
Sbjct  59   LKLGVCANVLGNLLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGINLNVPLS  118

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  119  LSLLLNVCGKKAPSGFQCP  137



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+L  LL V +G PPK PCCSLIQGL DLEAA+CLCTA+KANILGINLNVP+S
Sbjct  63   LKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGINLNVPIS  122

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  123  LSLLLNVCGKKVPSGFQCP  141



>ref|XP_004165754.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50241.1| HyPRP2 [Cucumis sativus]
Length=140

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LL GLL++T+G PP TPCCSLI+GLADLEAAVCLCTAIKA+ILGINLNVPLS
Sbjct  63   LKLGVCAKLLGGLLDITIGKPPVTPCCSLIEGLADLEAAVCLCTAIKADILGINLNVPLS  122

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ PKGF C
Sbjct  123  LSLLLNVCQKNVPKGFQC  140



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  +L V +G PPK PCCSLI+GL DLEAA+CLCTAIKANILGINLNVPLS
Sbjct  59   LKLGVCANVLGNVLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGINLNVPLS  118

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K  P GF CP
Sbjct  119  LSLLLNACGKKAPSGFQCP  137



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL  LL V +GTPPK PCCS+IQGL DLEAAVCLCTAIKA+ILGINLN+P+S
Sbjct  68   LKLGVCANLLGDLLGVVIGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADILGINLNIPVS  127

Query  182  lslllnvCTKDTPKGFTCP  238
            LS+LLNVC+K  P GF CP
Sbjct  128  LSVLLNVCSKKVPPGFICP  146



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LLN L+ + VGTPPKTPCCSLI GL DLEAAVCLCTAIKAN+LGINL+VP+S
Sbjct  64   LKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLGINLDVPVS  123

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  124  LSLLLNYCGKSVPKGFQC  141



>ref|XP_010933688.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=131

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N+ +G PPK PCC+L+QGLADLE AVCLCTA+KANILGI+LNVP+ 
Sbjct  53   LKLGVCANVLNGLINLNLGNPPKKPCCTLLQGLADLEVAVCLCTALKANILGISLNVPID  112

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLL+N C K+ P GF CP
Sbjct  113  LSLLINYCGKNAPTGFQCP  131



>ref|XP_008786992.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=143

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++LNGL+++ +G PPK PCCSL+ GL DLEAAVCLCT +KANILGI LN+P+ 
Sbjct  65   LKLGVCADVLNGLIHLKLGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIKLNLPIH  124

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K+TPKGF CP
Sbjct  125  LSLLLNYCGKNTPKGFQCP  143



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VG+PPKTPCCSLI GL DLEAAVCLCTA+KAN+LGINLNVP+S
Sbjct  54   LKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVLGINLNVPVS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  114  LSLLLNYCGKKVPSGFQC  131



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LLN L+ + VGTPPKTPCCSLI GLADLEAAVCLCTAIKAN+LGINL+VP+S
Sbjct  67   LKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGINLDVPVS  126

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  127  LSLLLNYCGKSVPNGFQC  144



>emb|CAI48077.1| extensin-like protein [Capsicum chinense]
Length=137

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP  PCCSLI+ L DLEAAVCLCTA+KANILGI LN+P+S
Sbjct  59   LKLGVCANVLNGLLNVTLGKPPVEPCCSLIENLVDLEAAVCLCTALKANILGIKLNLPIS  118

Query  182  lslllnvCTKDTPKGFTCP  238
            L+LLLNVC+K  PKGFTCP
Sbjct  119  LNLLLNVCSKKAPKGFTCP  137



>ref|XP_011081227.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Sesamum indicum]
Length=139

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL GL+++T+GTPPKTPCC+LI+GLAD+EAAVCLCTAIKAN+LGINLNVPLS
Sbjct  61   LKLGVCANLLGGLIDLTIGTPPKTPCCTLIEGLADVEAAVCLCTAIKANVLGINLNVPLS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  121  LSLLLNVCSKKVPPGFQC  138



>ref|XP_010093706.1| hypothetical protein L484_019047 [Morus notabilis]
 gb|EXB54486.1| hypothetical protein L484_019047 [Morus notabilis]
Length=133

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCAN+L GL+N TVG PP TPCC+LIQGLADLEAA+CLCTAI+A+ILGIN+N+P++
Sbjct  55   LKIGVCANVLGGLVNATVGNPPVTPCCTLIQGLADLEAALCLCTAIRASILGININIPVN  114

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++++P GF CP
Sbjct  115  LSLLLNVCSRNSPPGFQCP  133



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G PPK PCC+LIQG+ADLEAAVCLCTAIKANILGINLNVPLS
Sbjct  54   LKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILGINLNVPLS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K  P GF C
Sbjct  114  LSLLLNVCGKKVPSGFQC  131



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC  LLNGL+++ VGTPPKTPCCSLI GLAD+EAAVCLCTAIKAN+LGINLNVP+S
Sbjct  61   LKLGVCGALLNGLVHLVVGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGINLNVPVS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  121  LSLLLNYCGKSVPTGFQC  138



>ref|XP_010919517.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=157

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N+  G PPK PCCSL+ GL DLEAAVCLCT +KANILGI LN+P+ 
Sbjct  79   LKLGVCANVLNGLINLKAGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIKLNLPIH  138

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K+TP+GF CP
Sbjct  139  LSLLLNYCGKNTPRGFQCP  157



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N+ +G PPK PCCSLI+GLADLEAAVCLCTA+KANILGI LN+P+ 
Sbjct  49   LKLGVCANVLNGLINLNLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGIKLNIPVD  108

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLL+N C K  P GF CP
Sbjct  109  LSLLINYCGKKVPTGFQCP  127



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LLN+ +G PP  PCCSLIQGL DLEAAVCLCTAIKANILGINLN+PLS
Sbjct  55   LKLGVCANVLGSLLNLNIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGINLNIPLS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K TP GF C
Sbjct  115  LSLLLNVCGKKTPSGFQC  132



>ref|XP_004152410.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=140

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LL GLL++T+G PP TPCCSLI GLADLEAAVCLCTAIKA+ILGINLNVPLS
Sbjct  63   LKLGVCAKLLGGLLDITIGKPPVTPCCSLIDGLADLEAAVCLCTAIKADILGINLNVPLS  122

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ PKGF C
Sbjct  123  LSLLLNVCQKNVPKGFQC  140



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCCSLIQGLADLEAAVCLCTAIKANILGINLN+P+S
Sbjct  59   LKLGVCANVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILGINLNIPIS  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    PKGF C
Sbjct  119  LSLLLNVCGNKVPKGFQC  136



>ref|XP_004516838.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=166

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCCSL+QGL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  88   LKLGVCANVLNGLLNVTLGQPPVTPCCSLLQGLVDLEAAVCLCTALKANILGINLNLPIS  147

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P+ F CP
Sbjct  148  LSLLLNVCSRQAPRDFQCP  166



>ref|XP_002511665.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50334.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LLN L+++ VGTPPK PCC LIQGLADLEAAVCLCTA+KANILGINLNVP+S
Sbjct  61   LKLGVCADLLNDLVHLVVGTPPKEPCCPLIQGLADLEAAVCLCTALKANILGINLNVPVS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  121  LSLLLNYCGKGVPAGFQC  138



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + VG PPK PCCS I+GL DLEAAVCLCTAIKAN+LGINLNVPLS
Sbjct  54   LKLGVCANVLGNLLGLVVGNPPKKPCCSFIEGLVDLEAAVCLCTAIKANVLGINLNVPLS  113

Query  182  lslllnvCTKDTPKGFTCP  238
            LSL LNVC K  P GF CP
Sbjct  114  LSLFLNVCGKKVPFGFQCP  132



>ref|XP_008232588.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LLNGL+++ +GTPPKTPCCSLI GLAD+EAAVCLCTAIKAN+LGINLNVP+S
Sbjct  61   LKLGVCGDLLNGLVHLVMGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGINLNVPVS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  121  LSLLLNYCGKSVPTGFQC  138



>ref|XP_010093705.1| hypothetical protein L484_019046 [Morus notabilis]
 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis]
Length=114

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L G + V VG+PP  PCCSL++GL DLEAAVCLCTAIKANILGINLN+P+S
Sbjct  36   LKLGVCADVLKGPVGVVVGSPPDVPCCSLLEGLIDLEAAVCLCTAIKANILGINLNIPIS  95

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL++ C KD P GF C
Sbjct  96   LSLLISTCRKDIPSGFQC  113



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LLN LL+  VGTPPK+PCCSLI GLADLEAAVCLCTAIKAN+LGI LNVP+S
Sbjct  35   LKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGIKLNVPVS  94

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P G+ C
Sbjct  95   LSLLLNYCGKKVPTGYQC  112



>gb|ABF93505.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=179

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  100  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  159

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  160  LSLLVNYCGRSVPSGFQC  177



>gb|EAY88189.1| hypothetical protein OsI_09636 [Oryza sativa Indica Group]
 dbj|BAJ08376.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08377.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08378.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08380.1| qLTG3-1 [Oryza sativa Indica Group]
Length=178

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  99   LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  158

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  159  LSLLVNYCGRSVPSGFQC  176



>ref|NP_001048668.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|ABF93504.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10582.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|EAZ25261.1| hypothetical protein OsJ_09069 [Oryza sativa Japonica Group]
 dbj|BAI60003.1| Low-temperature germinability 3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08375.1| qLTG3-1 [Oryza sativa Japonica Group]
Length=184

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  105  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  164

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  165  LSLLVNYCGRSVPSGFQC  182



>ref|XP_008344389.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Malus 
domestica]
Length=136

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC NLLN L+N+ VGTPPKTPCCSL+ GLADLEAAVCLCTAIKAN+LGINL+VP+S
Sbjct  58   LKLGVCGNLLNDLVNIVVGTPPKTPCCSLVGGLADLEAAVCLCTAIKANVLGINLDVPVS  117

Query  182  lslllnvCTKDTPKGFTC  235
            L LLLN C K  PKGF C
Sbjct  118  LGLLLNYCGKSIPKGFHC  135



>dbj|BAA05471.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=87

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   VG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  10   LKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  69

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  70   LSLVLNNCGRNPPTGFTC  87



>ref|XP_010533776.1| PREDICTED: lipid transfer protein EARLI 1 [Tarenaya hassleriana]
Length=139

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+ +G PP TPCCSLIQGLAD+EAAVCLCTA+KANILGINLN+P+S
Sbjct  61   LKLGVCANVLNGLLNLQLGQPPVTPCCSLIQGLADVEAAVCLCTALKANILGINLNLPIS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  121  LSLLLNVCSKKVPSGFQC  138



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN++VG PP  PCCSLIQGLADLEAAVCLCTA+KANILGINLN+P+S
Sbjct  61   LKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADLEAAVCLCTALKANILGINLNIPVS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    PKGF C
Sbjct  121  LSLLLNVCGNKVPKGFQC  138



>dbj|BAG50511.1| qLTG-3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08371.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08372.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08373.1| qLTG3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08374.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAN84541.1| QTL for low-temperature germinability 3-1 [Oryza sativa Japonica 
Group]
Length=184

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  105  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  164

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  165  LSLLVNYCGRSVPSGFQC  182



>dbj|BAJ08379.1| qLTG3-1 [Oryza sativa Indica Group]
Length=190

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  111  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  170

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  171  LSLLVNYCGRSVPSGFQC  188



>ref|XP_003559027.1| PREDICTED: putative glycine-rich cell wall structural protein 
1 [Brachypodium distachyon]
 gb|ACF22748.1| proline-rich protein [Brachypodium distachyon]
Length=186

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N+ +GTPPK PCC+LIQGLADLEAAVCLCTA++ANILGINLNVP+ 
Sbjct  108  LKLGVCANVLNGLINLELGTPPKKPCCTLIQGLADLEAAVCLCTALRANILGINLNVPID  167

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLL+N C K  P GF CP
Sbjct  168  LSLLVNYCGKRVPTGFQCP  186



>dbj|BAJ08384.1| qLTG3-1 [Oryza longistaminata]
Length=194

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  115  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  174

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  175  LSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08383.1| qLTG3-1 [Oryza glumipatula]
Length=194

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  115  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  174

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  175  LSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08381.1| qLTG3-1 [Oryza rufipogon]
Length=194

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  115  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  174

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  175  LSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08382.1| qLTG3-1 [Oryza barthii]
Length=198

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  119  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  178

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  179  LSLLVNYCGRSVPSGFQC  196



>dbj|BAJ08386.1| qLTG3-1 [Oryza meridionalis]
Length=199

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  120  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  179

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  180  LSLLVNYCGRSVPSGFQC  197



>dbj|BAJ08385.1| qLTG3-1 [Oryza longistaminata]
Length=204

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV +GTPP+ PCCSLIQGLADLEAAVCLCTA++ANILGINLN+P++
Sbjct  125  LKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPIN  184

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  185  LSLLVNYCGRSVPSGFQC  202



>ref|XP_009795761.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Nicotiana sylvestris]
Length=146

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+L+ GL+   +GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  69   LKLGVCASLVGGLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVLGINLNVPLS  128

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  129  LSLVLNNCGRNPPNGFTC  146



>ref|XP_010041843.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 ref|XP_010042382.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LL  L+NVTVGTPPK PCCSLIQGL DLEAAVCLCTAI+AN+LG++L+VPLS
Sbjct  43   LKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLVDLEAAVCLCTAIRANVLGLHLDVPLS  102

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  103  LSLLLNVCSKKVPPGFQC  120



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLNGL+N T+GTPP+TPCC+LIQGLADLEAAVCLCT ++AN+LGINLN+P++
Sbjct  123  LKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINLNLPIN  182

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  183  LSLLVNYCGRRVPSGFQC  200



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  LLNVTVG PP TPCCSL+ GL DLEAAVCLCTAIKANILGINLN+P+S
Sbjct  57   LKLGVCADVLGNLLNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILGINLNIPIS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  117  LSLLLNVCSKQVPPGFKC  134



>ref|XP_009795760.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Nicotiana sylvestris]
Length=158

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+L+ GL+   +GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  81   LKLGVCASLVGGLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVLGINLNVPLS  140

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  141  LSLVLNNCGRNPPNGFTC  158



>ref|XP_006355478.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=132

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+LNGLLNVT+GTPP  PCCSLI  L DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  54   LKLGICANVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPIS  113

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+K+ PKGF CP
Sbjct  114  LSLLLNVCSKEAPKGFICP  132



>ref|XP_009338026.1| PREDICTED: vegetative cell wall protein gp1-like [Pyrus x bretschneideri]
Length=334

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC NLLN L+N+ VGTPPKTPCCSL+ GLADLEAAVCLCTAIKAN+LGINL+VP+S
Sbjct  256  LKLGVCGNLLNDLVNIVVGTPPKTPCCSLVGGLADLEAAVCLCTAIKANVLGINLDVPVS  315

Query  182  lslllnvCTKDTPKGFTC  235
            L LLLN C K  PKGF C
Sbjct  316  LGLLLNYCGKSVPKGFQC  333



>ref|XP_006355479.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=131

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GLLNVT+GTPP  PCCSLI  L DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  53   LKLGVCANVLSGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPIS  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+KD PKGF C
Sbjct  113  LSLLLNVCSKDVPKGFIC  130



>ref|NP_001235511.1| uncharacterized protein LOC100500518 precursor [Glycine max]
 gb|ACU15619.1| unknown [Glycine max]
 gb|KHN09806.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCCSLIQGLADLEAAVCLCTA+KAN+LGINLNVP++
Sbjct  54   VKFGVCADVLGLINVQLGK-PPKTPCCSLIQGLADLEAAVCLCTALKANVLGINLNVPVN  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  113  LSLLLNYCGKGVPKGFVC  130



>gb|EYU31726.1| hypothetical protein MIMGU_mgv1a019851mg, partial [Erythranthe 
guttata]
Length=116

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -1

Query  237  GQVKPFGVSLVQTLSSKLRERGTLRLMPRMFALMAVQRQTAASRSARPWMSEQHGVL-GG  61
              +KP G  L Q    KL E GT RLMP   AL AVQRQTAASRS +P M  QHG    G
Sbjct  32   AHLKPDGTFLSQAFRIKLSEMGTFRLMPNTLALTAVQRQTAASRSVKPPMRVQHGFFESG  91

Query  60   VPTVTLSKPLRRLAQTPNFR  1
            VPT   +K   + AQ PN R
Sbjct  92   VPTTMPTKSFSKFAQAPNLR  111



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCA+LLNGL +V VGTPP TPCCSL++GLAD+EAAVCLCTAIKAN+LGINLN+P+S
Sbjct  57   LKFGVCADLLNGLEHVIVGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVLGINLNIPVS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  117  LSLLLNYCGKKAPKGFQC  134



>ref|XP_008448870.1| PREDICTED: lipid transfer protein EARLI 1-like [Cucumis melo]
Length=210

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCA +L+ +       PP TPCCSLIQGLADLEAA+CLCTAI+ANILG+N+++P++
Sbjct  133  LKIGVCARVLSIVNVTLGT-PPVTPCCSLIQGLADLEAAICLCTAIRANILGLNISLPIN  191

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+++TP+ F CP
Sbjct  192  LSLLLNVCSRNTPREFQCP  210



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LL  L+NVTVGTPPK PCCSLIQGLADLEAAVCLCTAI+A++LG++L+VPLS
Sbjct  43   LKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLADLEAAVCLCTAIRADVLGLHLDVPLS  102

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  103  LSLLLNVCSKKVPPGFQC  120



>ref|XP_006579357.1| PREDICTED: uncharacterized protein LOC100499693 isoform X1 [Glycine 
max]
Length=131

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA+KAN+LGINLNV ++
Sbjct  54   IKFGVCADVLGLINVQLGK-PPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVTVN  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  113  LSLLLNYCGKGVPKGFVC  130



>tpg|DAA37198.1| TPA: hypothetical protein ZEAMMB73_187029 [Zea mays]
 tpg|DAA42811.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=142

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLNGL+N T+GTPP+TPCC+LIQGLADLEAAVCLCT ++AN+LGINLN+P++
Sbjct  64   LKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINLNLPIN  123

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  124  LSLLVNYCGRRVPSGFQC  141



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN++VG PP  PCCSLIQGLAD+EAAVCLCTA+KANILGINLN+P+S
Sbjct  57   LKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADIEAAVCLCTALKANILGINLNIPIS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    PKGF C
Sbjct  117  LSLLLNVCGNKVPKGFQC  134



>ref|XP_002529775.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF32589.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  LLN+T+G PP  PCCSLIQGL DLEAAVCLCTAIKANILGINLN+PLS
Sbjct  61   LKLGVCADVLGSLLNITIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGINLNIPLS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K TP  F C
Sbjct  121  LSLLLNVCSKKTPSDFQC  138



>ref|XP_004986077.1| PREDICTED: putative glycine-rich cell wall structural protein 
1-like [Setaria italica]
Length=203

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L GL+NVT+GTPP+TPCC+LIQGLADLEAAVCLCTA++AN+LGI +N+P++
Sbjct  125  LKLGVCANVLQGLINVTLGTPPRTPCCTLIQGLADLEAAVCLCTALRANVLGITINLPIN  184

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  185  LSLLVNYCGRRVPNGFQC  202



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+TVG PP  PCCSLIQGL DLEAAVCLCTAI+ANILGINLN+PLS
Sbjct  67   LKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGINLNIPLS  126

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    PKGF C
Sbjct  127  LSLLLNVCGNKVPKGFQC  144



>ref|XP_009798258.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=135

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCCSLI+ L DLEAAVCLCTA+KA ILG+NLN+P+S
Sbjct  57   LKLGVCANVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKAKILGVNLNLPIS  116

Query  182  lslllnvCTKDTPKGFTCP  238
            L+LLLNVC+K  PKGFTCP
Sbjct  117  LNLLLNVCSKKAPKGFTCP  135



>ref|XP_009617786.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=146

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   +G+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  69   LKLGVCANLVGGLVGAVIGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  128

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  129  LSLVLNNCGRNPPTGFTC  146



>ref|XP_009782252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCCSLI  L DLEAAVCLCTA+KANIL INLN+P+S
Sbjct  55   LKLGVCANVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILSINLNLPIS  114

Query  182  lslllnvCTKDTPKGFTCP  238
            L+LLLNVC+K  PKGFTCP
Sbjct  115  LNLLLNVCSKKAPKGFTCP  133



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LLN LL+  VGTPPK+PCCSLI GLADLEAAVCLCTAIKAN+LGI LNVP+S
Sbjct  54   LKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGIKLNVPVS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P G+ C
Sbjct  114  LSLLLNYCGKKVPTGYQC  131



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  LLNVTVGTPP  PCCSLIQGL DLEAAVCLCTAIKANILGINLN+P+S
Sbjct  54   LKLGVCADLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILGINLNIPVS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K  PK F C
Sbjct  114  LSLLLNVCGKKVPKDFQC  131



>ref|XP_009796138.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
 ref|XP_009796140.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=152

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   +G+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  75   LKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  134

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  135  LSLVLNNCGRNPPTGFTC  152



>ref|XP_010448889.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLIQGL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  58   LKLGVCVNALNLLNDVTLGTPPVTPCCSLIQGLVDLEAAVCLCTALKASVLGINLNLPIN  117

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P+GF CP
Sbjct  118  LSLLLNVCSRKAPRGFQCP  136



>dbj|BAA13155.1| glycine-rich polypeptide [Nicotiana tabacum]
Length=98

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+ V VG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  21   LKLGVCANLVGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  80

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  81   LSLVLNNCGRNPPTGFTC  98



>ref|XP_009783445.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   +G+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  81   LKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  140

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  141  LSLVLNNCGRNPPTGFTC  158



>ref|XP_009796139.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL GL+   +GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  81   LKLGVCANLLGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  140

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  141  LSLVLNNCGRNPPTGFTC  158



>ref|NP_176440.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAD43608.1|AC005698_7 T3P18.7 [Arabidopsis thaliana]
 gb|AAQ65111.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD95067.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD93991.1| similar to 14KD proline-rich protein DC2.15 precursor [Arabidopsis 
thaliana]
 dbj|BAD94286.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAF01655.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 dbj|BAF02193.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 gb|AEE33973.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=149

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP  PCC+LIQGLADLEAA CLCTA+KANILGINLN+PLS
Sbjct  72   LKLGVCANVLNGLLNVTLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIPLS  131

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P+GF C
Sbjct  132  LSLLLNVCSKKVPRGFQC  149



>ref|XP_003525817.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=126

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA+KAN+LGINLNVP+ 
Sbjct  49   LKFGVCADVLGLINVQLGK-PPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVK  107

Query  182  lslllnvCTKDTPKGFTC  235
            L LLLN C K  PKGF C
Sbjct  108  LGLLLNYCGKGVPKGFVC  125



>ref|XP_009782706.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   +GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  81   LKLGVCANLVGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  140

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  141  LSLVLNNCGRNPPTGFTC  158



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ VGTPPKTPCC+LI+GLADLEAAVCLCTAIKAN+LG +LN+PLS
Sbjct  55   LKLGVCANLLNDLVHLVVGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLGNDLNIPLS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  115  LSLLLNYCGKKVPTGFQC  132



>gb|KHN09805.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA+KAN+LGINLNVP++
Sbjct  54   IKFGVCADVLGLINVQLGK-PPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVN  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  113  LSLLLNYCGKGVPKGFVC  130



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  LLNVT+G+PP  PCCS+IQGL DLEAAVCLCTAIKANILGINLN+PLS
Sbjct  62   LKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIPLS  121

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLL+NVC K  PK F CP
Sbjct  122  LSLLVNVCGKKVPKDFQCP  140



>ref|XP_009619251.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=158

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   VG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  81   LKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  140

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  141  LSLVLNNCGRNPPTGFTC  158



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+TVG PP  PCCSLIQGL DLEAAVCLCTAI+ANILGINLN+PLS
Sbjct  75   LKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGINLNIPLS  134

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    P+GF C
Sbjct  135  LSLLLNVCGNKVPRGFQC  152



>ref|XP_002892674.1| hypothetical protein ARALYDRAFT_471359 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68933.1| hypothetical protein ARALYDRAFT_471359 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KANILGINLN+P+S
Sbjct  63   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANILGINLNLPIS  122

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  123  LSLLLNVCSKQLPPGFQC  140



>ref|NP_172673.1| extensin-like protein [Arabidopsis thaliana]
 gb|AAC17607.1| Contains homology to extensin-like protein gb|D83227 from Populus 
nigra. ESTs gb|H76425, gb|T13883, gb|T45348, gb|H37743, 
gb|AA042634, gb|Z26960 and gb|Z25951 come from this gene. There 
is a similar ORF on the opposite strand [Arabidopsis thaliana]
 gb|AAC98387.1| extensin-like protein [Arabidopsis thaliana]
 gb|AAL25599.1| At1g12090/T28K15.14 [Arabidopsis thaliana]
 gb|AAM14027.1| putative pEARLI 1 [Arabidopsis thaliana]
 gb|AAM51297.1| putative pEARLI 1 [Arabidopsis thaliana]
 gb|AEE28836.1| extensin-like protein [Arabidopsis thaliana]
Length=137

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KANILGINLN+P+S
Sbjct  60   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANILGINLNLPIS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  120  LSLLLNVCSKQLPPGFQC  137



>ref|XP_006366172.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=120

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LN +  +    PP  PCCSLIQGL DLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  44   LKLGVCANILNLVNVIVGS-PPTLPCCSLIQGLTDLEAAVCLCTAIRANVLGINLNVPLS  102

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C K+ P GFTC
Sbjct  103  LSLILNSCGKNPPTGFTC  120



>ref|NP_001235888.1| uncharacterized protein LOC100500033 precursor [Glycine max]
 gb|ACU14667.1| unknown [Glycine max]
Length=131

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA+KAN+LGINLNVP++
Sbjct  54   IKFGVCADVLGLINVQLGK-PPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVN  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  113  LSLLLNYCGKGVPKGFVC  130



>ref|XP_009619252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAA95941.1| glycine-rich protein [Nicotiana tabacum]
Length=158

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANL+ GL+   VG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  81   LKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  140

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  141  LSLVLNNCGRNPPTGFTC  158



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L+GLLNVT+GTPPK PCCSL+ GL DLEAAVCLCTAIKANILGINLN+P+ 
Sbjct  51   LKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILGINLNIPVD  110

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  111  LSLLLNYCGKKVPSGFQC  128



>gb|ADD11814.1| hybrid proline-rich protein [Cajanus cajan]
Length=131

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCANLL  +       PPKTPCCSLI+GLADLEAAVCLCTA+KAN+LGINLNVP+ 
Sbjct  54   LKFGVCANLLGLVNVNLGK-PPKTPCCSLIEGLADLEAAVCLCTALKANVLGINLNVPVK  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K TPK F C
Sbjct  113  LSLLLNVCGKKTPKDFIC  130



>ref|XP_006413657.1| hypothetical protein EUTSA_v10026536mg [Eutrema salsugineum]
 gb|ESQ55110.1| hypothetical protein EUTSA_v10026536mg [Eutrema salsugineum]
Length=136

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  58   LKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPIN  117

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P+GF CP
Sbjct  118  LSLLLNVCSRKAPRGFQCP  136



>ref|XP_006445312.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
 ref|XP_006490869.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR58552.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
Length=130

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LLN L+++ VGTPP TPCC+L++GLADLEAAVCLCTAIKANILGINLN+P+S
Sbjct  51   LKLGVCADLLNDLVHLVVGTPPVTPCCALLKGLADLEAAVCLCTAIKANILGINLNLPIS  110

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C    P GF C
Sbjct  111  LSLLLNYCGNGVPSGFQC  128



>ref|XP_010434049.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  58   LKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPIN  117

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P+GF CP
Sbjct  118  LSLLLNVCSRKAPRGFQCP  136



>ref|XP_006304906.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
 gb|EOA37804.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
Length=138

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLNVP+S
Sbjct  61   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNVPIS  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  121  LSLLLNVCSKQLPSGFQC  138



>ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=152

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL     V VG PP TPCCSL+ GL DLEAAVCLCTAIKAN+LGINLN+P+S
Sbjct  74   LKLGVCANLLGRAAGVVVGNPPTTPCCSLLAGLVDLEAAVCLCTAIKANVLGINLNIPVS  133

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C +  P GFTC
Sbjct  134  LSLLLNACGRTPPTGFTC  151



>ref|XP_006286053.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
 gb|EOA18951.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
Length=137

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINL +P++
Sbjct  59   LKLGVCVNALNLLKDVTLGTPPVTPCCSLIEGLVDLEAAVCLCTALKASVLGINLYLPIN  118

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P+GF CP
Sbjct  119  LSLLLNVCSRKAPRGFQCP  137



>ref|XP_009600481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=170

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL GL+ V VG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  93   LKLGVCANLLGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  152

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  153  LSLVLNNCGRNPPTGFTC  170



>dbj|BAA13150.1| NT16 polypeptide [Nicotiana tabacum]
Length=170

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLL GL+ V VG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINLNVPLS
Sbjct  93   LKLGVCANLLGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGINLNVPLS  152

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  153  LSLVLNNCGRNPPTGFTC  170



>ref|NP_001235027.1| uncharacterized protein LOC100500229 precursor [Glycine max]
 gb|ACU15232.1| unknown [Glycine max]
 gb|KHN09804.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA+KAN+LGINLNVP+ 
Sbjct  54   IKFGVCADVLGLINVQLGK-PPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVK  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  113  LSLLLNYCGKGVPKGFVC  130



>gb|AFK47547.1| unknown [Lotus japonicus]
Length=139

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +KLGVCA++L  +       PPKTPCCSL+QGLADLEAAVCLCTA++AN+LGINLN+P++
Sbjct  62   IKLGVCADVLGLINVQLGK-PPKTPCCSLLQGLADLEAAVCLCTALRANVLGINLNIPIN  120

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C K  PKGF C
Sbjct  121  LSLILNYCGKGVPKGFVC  138



>ref|XP_004169260.1| PREDICTED: putative lipid-binding protein At4g00165-like [Cucumis 
sativus]
Length=199

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+G+CA +L+ +       PP TPCC+LIQGLADLEAA+CLCTAI+A+ILG+N+N+P++
Sbjct  122  LKIGICARVLSLVNATIGS-PPVTPCCTLIQGLADLEAAICLCTAIRASILGLNINLPIN  180

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+++TP+GF CP
Sbjct  181  LSLLLNVCSRNTPRGFQCP  199



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+L GLLNVT+GTPPK PCCSL++GL DLEAAVCLCTA+K N+LG+ LN+P+S
Sbjct  51   LKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKLNIPVS  110

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  PKGF C
Sbjct  111  LSLLINYCGKKVPKGFLC  128



>ref|XP_009110671.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDY21033.1| BnaA08g24920D [Brassica napus]
Length=137

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLN+P+S
Sbjct  60   LKLGVCANVLSGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLPIS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  120  LSLLLNVCSKQVPPGFQC  137



>ref|XP_006417266.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
 gb|ESQ35619.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
Length=139

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLN+P+S
Sbjct  62   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLPIS  121

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  122  LSLLLNVCSKQVPPGFQC  139



>gb|KFK28807.1| hypothetical protein AALP_AA7G051200 [Arabis alpina]
Length=133

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +KLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  55   IKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPIN  114

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P+GF CP
Sbjct  115  LSLLLNVCSRKAPRGFQCP  133



>ref|XP_010696470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=130

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  +  V    P  T CC+LI+GLAD+EAAVCLCTAIKANILGINLNVP+S
Sbjct  52   LKLGVCADVLGLVHAVLGNPPSGTKCCALIKGLADVEAAVCLCTAIKANILGINLNVPIS  111

Query  182  lslllnvCTKDTPKGFTC  235
            LS+LL+ C KD PKGF C
Sbjct  112  LSVLLSACQKDVPKGFQC  129



>tpg|DAA42812.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=189

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLNGL+N T+GTPP+TPCC+LIQGLADLEAAVCLCT ++AN+LGINLN+P++
Sbjct  111  LKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINLNLPIN  170

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C +  P GF C
Sbjct  171  LSLLVNYCGRRVPSGFQC  188



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLA+LEAAVCLCTA+KAN+LGINLN+P+S
Sbjct  65   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGINLNLPIS  124

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  125  LSLLLNVCSKQLPSGFQC  142



>ref|XP_010458633.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLN+P+S
Sbjct  65   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLPIS  124

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  125  LSLLLNVCSKQLPPGFQC  142



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+LN LLNVT+GTPP  PCC+LIQGLADLEAAVCLCTAI+A+ILGINLN+P++
Sbjct  66   LKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINLNIPIA  125

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C    P+GF C
Sbjct  126  LSLLLNACGNQVPRGFQC  143



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  LLNVT+G+PP  PCCS+IQGL DLEAA+CLCTAIKANILGINLN+P+S
Sbjct  62   LKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILGINLNIPIS  121

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLL+NVC K  PK F CP
Sbjct  122  LSLLINVCGKKVPKDFQCP  140



>gb|KHN04353.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=132

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  62   PPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvplslslllnvCTKDTPKGFTC  235
            PPKTPCC+LIQGLADLEAAVCLCTA+KAN+LGINLNVP++LSLLLN C K  PKGF C
Sbjct  74   PPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVPKGFVC  131



>gb|KHN04345.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=166

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCCSL+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  88   LKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLPIS  147

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+++ P+ F C
Sbjct  148  LSLLLNVCSRNAPRDFQC  165



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+L GLLNVT+GTPPK PCCSL++GL DLEAAVCLCTA+K N+LG+ LN+P+S
Sbjct  65   LKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKLNIPVS  124

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  PKGF C
Sbjct  125  LSLLINYCGKKVPKGFLC  142



>gb|AAC49369.1| proline-rich 14 kDa protein [Phaseolus vulgaris]
Length=127

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA++AN+LGINLNVP+ 
Sbjct  50   LKFGVCADVLGLIGVELGK-PPKTPCCNLIQGLADLEAAVCLCTALRANVLGINLNVPIK  108

Query  182  lslllnvCTKDTPKGFTC  235
            L+LLLN C K TPK F C
Sbjct  109  LNLLLNYCGKKTPKDFVC  126



>emb|CDY31240.1| BnaC08g15350D [Brassica napus]
Length=137

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLN+P+S
Sbjct  60   LKLGVCANVLNGLLDLTLGKPPVKPCCSLIQGLADVEAAVCLCTALKANVLGINLNLPIS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  120  LSLLLNVCSKQVPPGFQC  137



>ref|XP_003525810.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=172

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCCSL+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  94   LKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLPIS  153

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+++ P+ F C
Sbjct  154  LSLLLNVCSRNAPRDFQC  171



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  +  V    PP TPCCSL+ GLA++EAA+CLCTAIKANILGINLNVP+S
Sbjct  51   LKLGVCADVLGLVNAVIGS-PPVTPCCSLLSGLANVEAALCLCTAIKANILGINLNVPIS  109

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+K+ P GF CP
Sbjct  110  LSLLLNVCSKEAPSGFQCP  128



>ref|XP_007155643.1| hypothetical protein PHAVU_003G219100g [Phaseolus vulgaris]
 ref|XP_007155644.1| hypothetical protein PHAVU_003G219200g [Phaseolus vulgaris]
 gb|ESW27637.1| hypothetical protein PHAVU_003G219100g [Phaseolus vulgaris]
 gb|ESW27638.1| hypothetical protein PHAVU_003G219200g [Phaseolus vulgaris]
Length=131

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCA++L  +       PPKTPCC+LIQGLADLEAAVCLCTA++AN+LGINLNVP+ 
Sbjct  54   LKFGVCADVLGLIGVELGK-PPKTPCCNLIQGLADLEAAVCLCTALRANVLGINLNVPIK  112

Query  182  lslllnvCTKDTPKGFTC  235
            L+LLLN C K TPK F C
Sbjct  113  LNLLLNYCGKKTPKDFVC  130



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCAN+L GL+NV +G PPK PCCSL++GLADLEAAVCLCTAIKANILG NLNVP+ 
Sbjct  62   LKFGVCANVLQGLINVQLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILGTNLNVPVD  121

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P G+ C
Sbjct  122  LSLLLNYCGKKVPAGYKC  139



>ref|XP_010439335.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVC N LN L +VT+GTPP TPCCSLIQGL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  58   LKIGVCVNALNLLNDVTIGTPPVTPCCSLIQGLVDLEAAVCLCTALKASVLGINLNLPIN  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC++  P+GF C
Sbjct  118  LSLLLNVCSRKAPRGFQC  135



>ref|NP_001238461.1| uncharacterized protein LOC100499693 precursor [Glycine max]
 gb|ACU13264.1| unknown [Glycine max]
 gb|AEM45873.1| proline-rich protein [Glycine max]
Length=131

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCC+LI+GLADLEAAVCLCTA+KAN+LGINLNVP++
Sbjct  54   IKFGVCADVLGLINVQLGK-PPKTPCCNLIEGLADLEAAVCLCTALKANVLGINLNVPVN  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  PKGF C
Sbjct  113  LSLLLNYCGKGVPKGFVC  130



>gb|AAM75351.1|AF520576_1 extensin-like protein [Glycine max]
Length=179

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCCSL+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  101  LKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLPIS  160

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+++ P+ F C
Sbjct  161  LSLLLNVCSRNAPRDFQC  178



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+LN LLNVT+GTPP  PCC+LIQGLADLEAAVCLCTAI+A+ILGINLN+P++
Sbjct  74   LKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINLNIPIA  133

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C    P+GF C
Sbjct  134  LSLLLNACGNQVPRGFQC  151



>ref|XP_004245750.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+GTPP  PCCSL+  L DLEAAVCLCTA+KANILGINL++P+S
Sbjct  53   LKLGVCANVLNGLLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGINLDIPIS  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVCTK+ PKGF C
Sbjct  113  LSLLLNVCTKEAPKGFIC  130



>gb|ACU21436.1| unknown [Glycine max]
Length=172

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCCSL+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  94   LKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLPIS  153

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+++ P+ F C
Sbjct  154  LSLLLNVCSRNAPRDFQC  171



>ref|XP_007210550.1| hypothetical protein PRUPE_ppa014094mg [Prunus persica]
 gb|EMJ11749.1| hypothetical protein PRUPE_ppa014094mg [Prunus persica]
Length=87

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  192  SKLRERGTLRLMPRMFALMAVQRQTAASRSARPWMSEQHGVLGGVPTVTLSKPLRRLAQT  13
            +KL+  G LRL+PR+ ALMAVQR  A SRS  P    Q GV GG P +  + PL +LAQT
Sbjct  2    TKLKAMGILRLIPRILALMAVQRHIATSRSRSPSSKAQQGVSGGFPIIAPTAPLSKLAQT  61

Query  12   PNFR  1
            PNFR
Sbjct  62   PNFR  65



>ref|XP_009598876.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Nicotiana 
tomentosiformis]
Length=93

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G  PK PCC+LI+GLAD+EAA+CLCTAIKAN+LGINLNVPLS
Sbjct  15   LKLGVCANVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLGINLNVPLS  74

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  75   LSLLLNVCGKKVPSGFICP  93



>ref|XP_004245748.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GLLNVT+GTPP  PCCSLI  L DLEAA CLCTA+KAN+LGINLN+P+S
Sbjct  57   LKLGVCANVLSGLLNVTLGTPPVKPCCSLIGNLVDLEAAACLCTALKANVLGINLNIPIS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+KD PKGF C
Sbjct  117  LSLLLNVCSKDVPKGFIC  134



>emb|CDP05328.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  +       PP  PCCSL+QGLADLEAA+CLCTAI+ANILGINLN+P++
Sbjct  52   LKLGVCANVLGLIRVSIGA-PPTLPCCSLLQGLADLEAALCLCTAIRANILGINLNLPVT  110

Query  182  lslllnvCTKDTPKGFTCP  238
            LSL+LN C ++ P GF CP
Sbjct  111  LSLVLNNCGRNPPNGFICP  129



>gb|KDP28790.1| hypothetical protein JCGZ_14561 [Jatropha curcas]
Length=135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN L+++ +GTPPKTPCC L+QGLADLEAAVCLCTA+KA++LG+NLNVP+S
Sbjct  57   LKLGVCANLLNDLVHLVLGTPPKTPCCPLLQGLADLEAAVCLCTALKASVLGLNLNVPIS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C +  P GF C
Sbjct  117  LSLLLNYCGQGVPAGFQC  134



>ref|XP_006417265.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
 gb|ESQ35618.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
Length=134

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L+G +   +G PP TPCCS++QGL DLEAAVCLCTAIKANILGIN+++P+S
Sbjct  56   LKLGVCAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPIS  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P  F C
Sbjct  116  LSLLINTCGKKLPSDFIC  133



>ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
 gb|EMJ10944.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
Length=144

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCCSLIQGLAD+EAAVCLCTAIKANILGINLN+P+S
Sbjct  66   LKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGINLNIPIS  125

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    PK F C
Sbjct  126  LSLLLNVCGNKVPKDFQC  143



>emb|CDP18670.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  +       PP  PCCSL+QGLADLEAAVCLCTAI+AN+LGINLN P+S
Sbjct  71   LKLGVCANVLGLIGVTIGS-PPTLPCCSLLQGLADLEAAVCLCTAIRANVLGINLNFPVS  129

Query  182  lslllnvCTKDTPKGFTCP  238
            LSL+LN   ++TP GF CP
Sbjct  130  LSLILNNYGRNTPNGFICP  148



>ref|XP_008238564.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=147

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCCSLIQGLAD+EAAVCLCTAIKANILGINLN+P+S
Sbjct  69   LKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGINLNIPIS  128

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC    PK F C
Sbjct  129  LSLLLNVCGNKVPKDFQC  146



>ref|XP_010919519.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=143

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N+T+G PPK PCCSLI+GLADLEAAVCLCTA+KANILG NLN+P+ 
Sbjct  65   LKLGVCANVLNGLINLTLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGANLNIPID  124

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P GF C
Sbjct  125  LSLLINYCGKKVPTGFQC  142



>gb|KFK25909.1| hypothetical protein AALP_AA8G178400 [Arabis alpina]
Length=157

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCC+LIQGLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  80   LKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIPIS  139

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  140  LSLLLNVCSKKVPPGFQC  157



>ref|XP_004251936.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=123

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LN +       PP  PCCSLIQGL DLEAAVCLCTAI+AN+LGINLN+PLS
Sbjct  47   LKLGVCANVLNLVNVTVGS-PPPLPCCSLIQGLTDLEAAVCLCTAIRANVLGINLNIPLS  105

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  106  LSLVLNNCGRNPPTGFTC  123



>ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
 gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
Length=134

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  +  +    PPKTPCCSL+QGLA+LEAAVCLCTA+KAN+LGINLNVP+ 
Sbjct  57   LKLGVCADLLGLVNVLIGS-PPKTPCCSLLQGLANLEAAVCLCTALKANVLGINLNVPVD  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  116  LSLLLNYCGKKLPYGFQC  133



>ref|XP_009148613.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
 emb|CDY53347.1| BnaA06g38220D [Brassica napus]
Length=137

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            L+LGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLN+P+S
Sbjct  60   LQLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLPIS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  120  LSLLLNVCSKQVPPGFQC  137



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG +   VG PP  PCC+L++GL DLE AVCLCTAIKANILGINLN+P++
Sbjct  58   LKLGVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIA  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+++ C K+ P+GF C
Sbjct  118  LSLVIDGCAKNVPEGFKC  135



>ref|XP_009411010.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG CAN+L+GL++  VG PPK PCCSLI GL DLEAAVCLCTAIKAN+LGI+LN+P++
Sbjct  59   LKLGGCANVLDGLIHAKVGEPPKEPCCSLIDGLVDLEAAVCLCTAIKANVLGIHLNLPIN  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K +P GF C
Sbjct  119  LSLLLNYCGKQSPTGFKC  136



>ref|XP_010430305.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCC+LIQGLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  72   LKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIPIS  131

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  132  LSLLLNVCSKKVPPGFQC  149



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+LN LLNVT+GTPP  PCC+LIQGLADLEAAVCLCTAI+A+ILGINLN+P++
Sbjct  78   LKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINLNIPIA  137

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C    P+GF C
Sbjct  138  LSLLLNACGNQVPRGFQC  155



>ref|XP_010055513.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=132

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L+G +N  +GTPP  PCCS+++GL DLEAAVCLCTAIKANILGINLN+P+S
Sbjct  54   LKLGVCAKVLDGPVNAIIGTPPDMPCCSVLEGLLDLEAAVCLCTAIKANILGINLNIPIS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K+ P GF C
Sbjct  114  LSLLINTCGKNVPSGFQC  131



>emb|CDY31241.1| BnaC08g15360D [Brassica napus]
Length=132

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L+G +   +G PP TPCCS +QGL DLEAAVCLCTAIKANILGI++N+P+S
Sbjct  54   LKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDINIPIS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P  F C
Sbjct  114  LSLLINTCGKKLPSDFIC  131



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG +   VG PP  PCC+L++GL DLE AVCLCTAIKANILGINLN+P++
Sbjct  58   LKLGVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIA  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+++ C K+ P+GF C
Sbjct  118  LSLVIDGCAKNVPEGFKC  135



>ref|XP_010473467.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCC+LIQGLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  80   LKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIPIS  139

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  140  LSLLLNVCSKKVPPGFQC  157



>ref|XP_010418243.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCC+LIQGLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  80   LKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIPIS  139

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  140  LSLLLNVCSKKVPPGFQC  157



>gb|ADA67933.1| putative 14 kDa proline-rich protein DC2.15 [Wolffia arrhiza]
Length=135

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILG-Inlnvpl  178
            LKLGVCANLLNGL+N+ +GTPPKTPCC+LI+GLADLEAA+CLCT +KAN+LG I+LN+P+
Sbjct  56   LKLGVCANLLNGLINIQLGTPPKTPCCNLIKGLADLEAALCLCTVLKANVLGLISLNLPI  115

Query  179  slslllnvCTKDTPKGFTCP  238
            +LSLL+N C K  P GF CP
Sbjct  116  NLSLLVNYCGKSVPTGFICP  135



>emb|CDY21034.1| BnaA08g24910D [Brassica napus]
Length=134

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L+G +   +G PP TPCCS +QGL DLEAAVCLCTAIKANILGI++++P+S
Sbjct  56   LKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDIDIPIS  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P  F C
Sbjct  116  LSLLINTCGKKLPSDFIC  133



>gb|AFK41425.1| unknown [Lotus japonicus]
Length=142

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCC+L+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  64   LKLGVCANVLNGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPIS  123

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P+ F C
Sbjct  124  LSLLLNVCSKKVPRDFQC  141



>ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana]
 gb|AAB82643.1| expressed protein [Arabidopsis thaliana]
 gb|AAM62919.1| unknown [Arabidopsis thaliana]
 gb|AAV84511.1| At2g45180 [Arabidopsis thaliana]
 dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|ABI93898.1| At2g45180 [Arabidopsis thaliana]
 gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=134

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  +  V    PPKTPCC+L+QGLA+LEAAVCLCTA+KAN+LGINLNVP+ 
Sbjct  57   LKLGVCADLLGLVNVVVGS-PPKTPCCTLLQGLANLEAAVCLCTALKANVLGINLNVPID  115

Query  182  lslllnvCTKDTPKGFTC  235
            L+LLLN C K  P GF C
Sbjct  116  LTLLLNYCGKKVPHGFQC  133



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  +       PP  PCCSL++GLADLEAAVCLCTAIKANILGINLNVP+S
Sbjct  70   LKLGVCADLLGLIGISIGS-PPTKPCCSLLEGLADLEAAVCLCTAIKANILGINLNVPIS  128

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C K  PKGF C
Sbjct  129  LSLILNNCGKSVPKGFQC  146



>ref|XP_009110670.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=134

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L+G +   +G PP TPCCS +QGL DLEAAVCLCTAIKANILGI++++P+S
Sbjct  56   LKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDIDIPIS  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P  F C
Sbjct  116  LSLLINTCGKKLPSDFIC  133



>ref|XP_002867769.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44028.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
Length=133

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINLN+P+ 
Sbjct  55   LKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPID  114

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC++  P GF CP
Sbjct  115  LSLLLNVCSRKAPHGFQCP  133



>ref|XP_010539616.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=142

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L       PP  PCCSLIQGLADLEAAVCLCTA+KA+ILGINLNVP++
Sbjct  65   LKLGVCVNALNLLNVTLGS-PPVKPCCSLIQGLADLEAAVCLCTALKASILGINLNVPIN  123

Query  182  lslllnvCTKDTPKGFTCP  238
            L+LLLNVC++  P+GF CP
Sbjct  124  LTLLLNVCSRKAPRGFQCP  142



>ref|XP_010493734.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L+G +   +G PP TPCCS++QGL DLEAAVCLCTAIKANILGIN+++P+S
Sbjct  54   LKLGVCAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPIS  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL++ C K  P  F C
Sbjct  114  LSLLISTCGKKLPSDFIC  131



>ref|XP_010506455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Camelina sativa]
 ref|XP_010506456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Camelina sativa]
Length=131

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  +  +    PPKTPCCSL+QGLA+LEAAVCLCTA+KAN+LGINLNVP+ 
Sbjct  54   LKLGVCADLLGLVNVLVGS-PPKTPCCSLLQGLANLEAAVCLCTALKANVLGINLNVPID  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  113  LSLLLNYCGKKLPYGFQC  130



>ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  L+      PPK PCC+L++GL DLEAAVCLCTA+KANILGI LN+P+ 
Sbjct  49   LKLGVCADVLKALIVNIGK-PPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKLNIPVD  107

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K  PKGF CP
Sbjct  108  LSLLLNYCGKKVPKGFQCP  126



>emb|CDX82944.1| BnaC01g13940D [Brassica napus]
Length=136

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  58   LKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPIN  117

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC + +P GF CP
Sbjct  118  LSLLLNVCKRKSPPGFQCP  136



>gb|AFK37038.1| unknown [Lotus japonicus]
Length=132

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +KLGVCA++L  +       PPKTPCCSL++GL DLEAAVCLCTA+KAN+LGINLN+P++
Sbjct  55   IKLGVCADVLGLINVQLGK-PPKTPCCSLLEGLVDLEAAVCLCTALKANVLGINLNLPIN  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C K  PKGF C
Sbjct  114  LSLILNYCGKGVPKGFVC  131



>ref|NP_001235008.1| uncharacterized protein LOC100499716 precursor [Glycine max]
 gb|ACU13356.1| unknown [Glycine max]
Length=170

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCCSL+ GL DLEAAVCLCTA++ANILGINLN+P+S
Sbjct  92   LKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALRANILGINLNLPIS  151

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC++  P+ F C
Sbjct  152  LSLLLNVCSRQVPRDFQC  169



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  LLNVTVGTPP  PCCS+IQGL DLEAAVCLCTAIKANILGINLN+PLS
Sbjct  63   LKLGVCADLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIPLS  122

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K  PK F C
Sbjct  123  LSLLLNVCGKKVPKDFQC  140



>ref|XP_004244453.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=136

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  +  V    PP TPCCSLI GLAD+EAA+CLCTA+KAN+LGINLNVP+S
Sbjct  58   LKLGVCANVLGLVNVVVGS-PPVTPCCSLISGLADVEAALCLCTALKANVLGINLNVPIS  116

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+K  P GF CP
Sbjct  117  LSLLLNVCSKKVPNGFQCP  135



>ref|XP_009612116.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=138

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  +  V    PP  PCCSLI GLAD+EAA+CLCTAIKAN+LGINLNVP+S
Sbjct  60   LKLGVCANVLGLVNVVVGS-PPVKPCCSLISGLADVEAALCLCTAIKANVLGINLNVPIS  118

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+K+ P GF CP
Sbjct  119  LSLLLNVCSKNVPSGFQCP  137



>ref|XP_006357014.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  +  V    PP TPCCSLI GLAD+EAA+CLCTA+KAN+LGINLNVP+S
Sbjct  60   LKLGVCADVLGLVNVVVGS-PPVTPCCSLISGLADVEAALCLCTALKANVLGINLNVPIS  118

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+K  P GF CP
Sbjct  119  LSLLLNVCSKKVPYGFQCP  137



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLG+CAN+LN LLNVT+GTPP  PCC+LIQGLADLEAAVCLCTAI+A+ILGINLN+P++
Sbjct  88   LKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINLNIPIA  147

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C    P+GF C
Sbjct  148  LSLLLNACGNQVPRGFQC  165



>ref|XP_009333632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG +   VG PP  PCC+L++GL DLE AVCLCTAIKANILGINLN+P++
Sbjct  58   LKLGVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIA  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+++ C K+ P+GF C
Sbjct  118  LSLVIDGCAKNVPEGFKC  135



>ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=128

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA++L  L+      PPK PCC+L++GL DLEAAVCLCTA+KANILGI LN+P+ 
Sbjct  51   LKLGVCADVLKALVVKIGK-PPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKLNIPID  109

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C K  PKGF CP
Sbjct  110  LSLLLNYCGKKAPKGFQCP  128



>emb|CDY21275.1| BnaC03g29590D [Brassica napus]
Length=135

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G+PP  PCCSL++GL DLEAA CLCTA+KAN+LGI LNVP+S
Sbjct  57   LKLGVCANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKLNVPVS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C + TP+GF C
Sbjct  117  LSLLLNACGRKTPRGFIC  134



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GL+ V +GTPP TPCC+L+ GL DLEAA+CLCTAIKANILGINL++ LS
Sbjct  55   LKLGVCANVLSGLVGVVIGTPPDTPCCALLDGLLDLEAAICLCTAIKANILGINLDIHLS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  PK F C
Sbjct  115  LSLLINTCGKTLPKDFQC  132



>ref|XP_010553463.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Tarenaya 
hassleriana]
Length=143

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP  PCC+LIQGLAD+EAA CLCTA+KANILGINLN+P+S
Sbjct  65   LKLGVCANVLNGLLNVTLGQPPVEPCCTLIQGLADVEAAACLCTALKANILGINLNLPIS  124

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  125  LSLLLNVCSKKVPPGFQC  142



>ref|XP_009113072.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY19562.1| BnaC09g13410D [Brassica napus]
 emb|CDY12952.1| BnaA09g13220D [Brassica napus]
Length=147

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GLLN+T+G PP  PCC+LI+GLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  70   LKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANILGINLNIPIS  129

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  130  LSLLLNVCSKKVPPGFQC  147



>ref|XP_010695115.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKL VCAN+LNGLL +T+GTPP+  CCSLIQGLADL+AAVCLCTA++AN+LGI LNVP+S
Sbjct  38   LKLKVCANVLNGLLGLTIGTPPRHSCCSLIQGLADLDAAVCLCTALRANVLGIRLNVPIS  97

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLN C  + P GFTCP
Sbjct  98   LSLLLNACGCNYPDGFTCP  116



>ref|XP_009134274.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
Length=133

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +GTPP  PCCSL++GL DLEAA CLCTA+KAN+LGI LNVP+S
Sbjct  55   LKLGVCANVLKDLLKIELGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKLNVPVS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C + TP+GF C
Sbjct  115  LSLLLNACGRKTPRGFIC  132



>ref|XP_003608748.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90945.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK34609.1| unknown [Medicago truncatula]
Length=169

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLNVT+G PP TPCC+L+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  91   LKLGVCANVLNGLLNVTLGQPPVTPCCTLLNGLVDLEAAVCLCTALKANILGINLNLPIS  150

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P+ F C
Sbjct  151  LSLLLNVCSKQAPRDFQC  168



>ref|XP_007155641.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
 gb|ESW27635.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
Length=133

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+N T+G PP TPCC+L+ GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  55   LKLGVCANVLNGLVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPIS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC++  P+ F C
Sbjct  115  LSLLLNVCSRQAPRDFQC  132



>ref|XP_004516834.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=131

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA+LL  +       PPKTPCCSLI GLA+LEAAVCLCTA+KAN+LGINL++P++
Sbjct  53   IKFGVCADLLGLINVQLGK-PPKTPCCSLIDGLANLEAAVCLCTALKANVLGINLDLPIN  111

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C K  PKGF C
Sbjct  112  LSLILNYCGKGVPKGFVC  129



>ref|XP_009333674.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG++   VG PP  PCC+L++GL DLE AVCLCTAIKANILGINLN+P++
Sbjct  58   LKLGVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIA  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+++ C K+ P GF C
Sbjct  118  LSLVIDGCAKNVPAGFKC  135



>ref|XP_010676150.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+GTPPK+PCC LIQGL D EAAVCLCTAIKAN+LGINL +PLS
Sbjct  72   LKLGVCANVLNGLLDLTIGTPPKSPCCPLIQGLIDAEAAVCLCTAIKANVLGINLEIPLS  131

Query  182  lslllnvCTKDTPKGFTCP  238
            +SLL+N C    P GF CP
Sbjct  132  ISLLVNYCGCQLPHGFQCP  150



>ref|XP_009382414.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L GLLN+T+GTPPK PCC+L+QGL DLEAAVCLCTA+K N+LG+ LN+P+S
Sbjct  67   LKLGVCANVLGGLLNITLGTPPKEPCCTLLQGLVDLEAAVCLCTALKGNVLGLVLNLPIS  126

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K+ P GF C
Sbjct  127  LSLLLNYCGKEVPTGFLC  144



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +GTPP  PCCSLI+GL DLEAA CLCTAIKAN+LGINLNVP+S
Sbjct  57   LKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGINLNVPIS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K  P GF C
Sbjct  117  LSLLLNVCGKKVPSGFVC  134



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +GTPP  PCCSLI+GL DLEAA CLCTAIKAN+LGINLNVP+S
Sbjct  57   LKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGINLNVPVS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K  P GF C
Sbjct  117  LSLLLNVCGKKVPSGFKC  134



>ref|XP_010518131.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=134

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  +  +    PPKTPCCSL+QGLA+LEAAVCLCTAIKAN++GINLNVP+ 
Sbjct  57   LKLGVCADLLGLVNVLIGS-PPKTPCCSLLQGLANLEAAVCLCTAIKANVVGINLNVPID  115

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P GF C
Sbjct  116  LSLLLNYCGKKLPYGFQC  133



>ref|XP_006302912.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
 gb|EOA35810.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
Length=170

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLLN+T+G PP  PCC+LI+GLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  93   LKLGVCANVLNGLLNITLGKPPVEPCCTLIKGLADLEAAACLCTALKANILGINLNIPVS  152

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  153  LSLLLNVCSKKVPPGFQC  170



>gb|AAC60566.1| proline-rich SAC51 [Brassica napus]
Length=147

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L+GLLN+T+G PP  PCC+LI+GLADLEAA CLCTA+KANILGINLN+P+S
Sbjct  70   LKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANILGINLNIPIS  129

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P GF C
Sbjct  130  LSLLLNVCSKKVPPGFQC  147



>ref|XP_009623719.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=135

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G  PK PCC+LI+GLAD+EAA+CLCTAIKAN+LGINLNVPLS
Sbjct  57   LKLGVCANVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLGINLNVPLS  116

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC K  P GF CP
Sbjct  117  LSLLLNVCGKKVPSGFICP  135



>ref|XP_009135928.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=133

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC N LN L +VT+GTPP TPCCSLI+GL DLEAAVCLCTA+KA++LGINLN+P++
Sbjct  55   LKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPIN  114

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC + +P GF CP
Sbjct  115  LSLLLNVCKRKSPPGFQCP  133



>ref|XP_009333598.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG++   VG PP  PCC+L++GL DLE AVCLCTAIKANILGINLN+P++
Sbjct  58   LKLGVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIA  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+++ C K+ P GF C
Sbjct  118  LSLVIDGCAKNVPAGFKC  135



>ref|XP_008808738.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=131

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGL+NV++G PPK PCC+L++GL DLEAAVCLCTA+KANILGI LN+P+ 
Sbjct  53   LKLGVCANVLNGLINVSLGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKLNLPVD  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P G+ C
Sbjct  113  LSLLLNYCGKKVPAGWKC  130



>ref|XP_009134275.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
 emb|CDX90835.1| BnaA03g25150D [Brassica napus]
Length=133

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +GTPP  PCCSL+ GL DLEAA CLCTA+KAN+LGI LNVP+S
Sbjct  55   LKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIKLNVPVS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C + TP+GF C
Sbjct  115  LSLLLNACGRKTPRGFIC  132



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCANLLN +       PP  PCCSL+QGLADLEAA+CLCTAIKANILGINLNVP+S
Sbjct  70   LKLGVCANLLNIIGISIGS-PPTEPCCSLLQGLADLEAALCLCTAIKANILGINLNVPVS  128

Query  182  lslllnvCTKDTPKGFTC  235
            LS++LN C K  P GF C
Sbjct  129  LSVILNDCGKKVPNGFQC  146



>ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=140

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVC +LL  LL+VT+G PPKTPCCSLI  L DLEAAVCLCT+IKA++LGINLN+P+ 
Sbjct  62   LKLGVCVDLLKDLLSVTIGKPPKTPCCSLIGDLVDLEAAVCLCTSIKASLLGINLNLPVD  121

Query  182  lslllnvCTKDTPKGFTCP  238
            LSL+LN C K  P+GF CP
Sbjct  122  LSLVLNYCGKKVPEGFQCP  140



>emb|CDX90834.1| BnaA03g25140D [Brassica napus]
Length=133

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G+PP  PCCSL++GL DLEAA CLCTA+KAN+LG+ LNVP+S
Sbjct  55   LKLGVCANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGVKLNVPVS  114

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C + TP+GF C
Sbjct  115  LSLLLNACGRKTPRGFIC  132



>ref|XP_009397884.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +KLG CAN+L GL+N+ +GTPPK PCCSLI+GLAD EAA+CLCTAIKANILGI+LNV + 
Sbjct  54   VKLGACANVLGGLINLQIGTPPKKPCCSLIEGLADFEAALCLCTAIKANILGISLNVDVD  113

Query  182  lslllnvCTKDTPKGFTC  235
            L+LLLN C K  P G+ C
Sbjct  114  LTLLLNYCGKKVPYGYLC  131



>ref|XP_004152411.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCA LL GL+++T+G PP TPCC+L+QGLADLEAAVCLCTAIKA++LG  + +PL 
Sbjct  59   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGKTIKIPLH  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ P GF C
Sbjct  119  LSLLLNVCNKNLPNGFQC  136



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA+LL  LLNVTVG PP  PCCS+IQGL DLE+AVCLCTAIKANILGINLN+PLS
Sbjct  59   LKLGVCADLLGSLLNVTVGNPPVKPCCSVIQGLLDLESAVCLCTAIKANILGINLNIPLS  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K  PK F C
Sbjct  119  LSLLLNVCGKKVPKDFQC  136



>gb|KFK43474.1| hypothetical protein AALP_AA1G129700 [Arabis alpina]
Length=140

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LNGLL++T+G PP  PCCSLIQGLAD+EAAVCLCTA+KAN+LGINLN+P+S
Sbjct  63   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLPIS  122

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P  F C
Sbjct  123  LSLLLNVCSKKVPSDFQC  140



>ref|XP_004165755.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCA LL GL+++T+G PP TPCC+L+QGLADLEAAVCLCTAIKA++LG  + +PL 
Sbjct  59   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGNKIKIPLH  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ P GF C
Sbjct  119  LSLLLNVCNKNLPNGFQC  136



>ref|XP_008437105.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCA LL GL+++T+G PP TPCC+L+QGLADLEAAVCLCTAIKA++LG  + +PL 
Sbjct  59   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGNKIKIPLH  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ P GF C
Sbjct  119  LSLLLNVCNKNLPNGFQC  136



>ref|XP_004171279.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50237.1| hypothetical protein Csa_5G161860 [Cucumis sativus]
Length=136

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCA LL GL+++T+G PP TPCC+L+QGLADLEAAVCLCTAIKA++LG  + +PL 
Sbjct  59   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGKTIKIPLH  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ P GF C
Sbjct  119  LSLLLNVCNKNLPNGFQC  136



>ref|XP_010676148.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=161

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK GVCAN+L  LLN+ +GTPPKTPCC LI GL DLEAAVCLCTAIKANILGINLN+PLS
Sbjct  83   LKFGVCANVLTDLLNLNLGTPPKTPCCPLIAGLVDLEAAVCLCTAIKANILGINLNIPLS  142

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C    P+GF C
Sbjct  143  LSLLVNYCGTKVPRGFQC  160



>ref|XP_011018291.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=131

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG +   VG+PP TPCC+++QGL DLEAAVCLCTAIKANILGIN+++P+S
Sbjct  53   LKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILGINIDIPIS  112

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P  F C
Sbjct  113  LSLLINTCGKKLPSDFIC  130



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            L+LGVCAN+L GL+N+ +G PPK PCCSL++ L DLEAAVCLCTAIKANILGINLNVP+ 
Sbjct  58   LELGVCANVLQGLINLQLGNPPKKPCCSLLEDLVDLEAAVCLCTAIKANILGINLNVPVD  117

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C K  P G+ C
Sbjct  118  LSLLLNYCGKKVPAGYAC  135



>ref|XP_004152412.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50239.1| hypothetical protein Csa_5G161880 [Cucumis sativus]
Length=136

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LK+GVCA LL GL+++T+G PP TPCC+L+QGLADLEAAVCLCTAIKA++LG  + +PL 
Sbjct  59   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGNKIKIPLH  118

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC K+ P GF C
Sbjct  119  LSLLLNVCNKNLPNGFQC  136



>ref|XP_006367623.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=125

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+LN +  V    PP  PCCSLIQGL DLEAAVCLCTAI+AN+LGINLN+PLS
Sbjct  49   LKLGVCANVLNLVNVVVGS-PPTLPCCSLIQGLVDLEAAVCLCTAIRANVLGINLNIPLS  107

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C ++ P GFTC
Sbjct  108  LSLVLNNCGRNPPTGFTC  125



>ref|XP_004298650.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG +   VG+PP TPCC++++GL DLE AVCLCTAIKANILGINLN+P+S
Sbjct  57   LKLGVCAKLLNGAVGAVVGSPPDTPCCAVLEGLVDLEVAVCLCTAIKANILGINLNIPVS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLL+ C K  P GF C
Sbjct  117  LSLLLDGCAKKFPSGFQC  134



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA +L  LLN+T+G PP  PCCSL++GL DLEAAVCLCTAIKANILGINLNVPLS
Sbjct  60   LKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGINLNVPLS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC+K  P  F C
Sbjct  120  LSLLLNVCSKKVPSDFQC  137



>ref|XP_003608741.1| Cortical cell-delineating protein [Medicago truncatula]
 gb|AES90938.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK48033.1| unknown [Medicago truncatula]
Length=132

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            +K GVCA++L  +       PPKTPCCSLI GLA+LEAAVCLCTA+KAN+LGINLN+P++
Sbjct  55   IKFGVCADVLGLINVELGK-PPKTPCCSLIDGLANLEAAVCLCTALKANVLGINLNLPIN  113

Query  182  lslllnvCTKDTPKGFTC  235
            LSL+LN C K  PKGF C
Sbjct  114  LSLVLNYCGKGVPKGFVC  131



>ref|XP_006368193.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
 gb|ERP64762.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
Length=128

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCA LLNG +   VG+PP TPCC+++QGL DLEAAVCLCTAIKANILGIN+++P+S
Sbjct  50   LKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILGINIDIPIS  109

Query  182  lslllnvCTKDTPKGFTC  235
            LSLL+N C K  P  F C
Sbjct  110  LSLLINTCGKKLPSDFIC  127



>ref|XP_009787417.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=138

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  +  V    PP  PCCSLI GLAD+EAA+CLCTAIKAN+LGINLNVP+S
Sbjct  60   LKLGVCANVLGLVNVVVGS-PPVKPCCSLISGLADVEAALCLCTAIKANVLGINLNVPVS  118

Query  182  lslllnvCTKDTPKGFTCP  238
            LSLLLNVC+K  P GF CP
Sbjct  119  LSLLLNVCSKKVPSGFQCP  137



>ref|XP_003549907.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=138

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L GLLNVT+G PP TPCC+L+ GL DLEAAVCLCTA+KAN+LGINLN+P+S
Sbjct  60   LKLGVCANVLKGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANVLGINLNLPIS  119

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLNVC++  P+ F C
Sbjct  120  LSLLLNVCSRQVPRDFQC  137



>emb|CDY61290.1| BnaCnng37610D [Brassica napus]
Length=135

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LKLGVCAnllngllnvtvgtPPKTPCCSLIQGLADLEAAVCLCTAIKANILGInlnvpls  181
            LKLGVCAN+L  LL + +G+PP  PCCSL++GL D+EAA CLCTA+KAN+LGI LNVP+S
Sbjct  57   LKLGVCANVLKDLLKIELGSPPVKPCCSLLKGLVDIEAAACLCTALKANVLGIKLNVPVS  116

Query  182  lslllnvCTKDTPKGFTC  235
            LSLLLN C + TP+GF C
Sbjct  117  LSLLLNACGRKTPRGFIC  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527163007440