BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31820_g1_i1 len=696 path=[674:0-695]

Length=696
                                                                      Score     E

ref|XP_009593019.1|  PREDICTED: protein TAP1-like                     70.9    3e-12   
ref|XP_009793600.1|  PREDICTED: protein TAP1-like                     66.6    7e-11   
ref|XP_006356533.1|  PREDICTED: protein TAP1-like                     62.8    2e-09   
sp|Q04189.1|TAP1_ANTMA  RecName: Full=Protein TAP1; Flags: Precursor  53.9    3e-06   Antirrhinum majus [garden snapdragon]
gb|EYU22706.1|  hypothetical protein MIMGU_mgv1a016806mg              53.5    4e-06   
ref|NP_001234861.1|  uncharacterized protein LOC543739 precursor      50.4    5e-05   
gb|EYU22707.1|  hypothetical protein MIMGU_mgv1a016806mg              50.1    8e-05   



>ref|XP_009593019.1| PREDICTED: protein TAP1-like [Nicotiana tomentosiformis]
Length=103

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 8/83 (10%)
 Frame = -3

Query  487  NFAKLGCIAMCMRECRVVGLPAPACLKFCPKHCDPPLPSRPVFHCTLDC-LNQCVSSQST  311
            N  ++ CI +CM EC++ G+   ACLKFCP HC PP P   V +C L C L  CV  +  
Sbjct  27   NLMEVKCIQVCMNECKITGIATAACLKFCPLHCVPPTPPSEVRYCNLRCILGHCVDYK--  84

Query  310  RNNNNDEEKQDTCITSC-KNEKC  245
                NDEE+ + C++SC KN+ C
Sbjct  85   ----NDEERLEGCVSSCRKNDHC  103



>ref|XP_009793600.1| PREDICTED: protein TAP1-like [Nicotiana sylvestris]
Length=103

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 8/83 (10%)
 Frame = -3

Query  487  NFAKLGCIAMCMRECRVVGLPAPACLKFCPKHCDPPLPSRPVFHCTLDC-LNQCVSSQST  311
            N  ++ CI +CM EC+  G+   ACLKFCP HC PP P   V +C L C L  CV  +  
Sbjct  27   NLMEVKCIEVCMNECKKTGIATAACLKFCPLHCVPPTPPPEVRYCNLRCILQHCVDYK--  84

Query  310  RNNNNDEEKQDTCITSC-KNEKC  245
                NDEEK + C+++C KN+ C
Sbjct  85   ----NDEEKLEGCVSNCRKNDHC  103



>ref|XP_006356533.1| PREDICTED: protein TAP1-like [Solanum tuberosum]
Length=103

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = -3

Query  487  NFAKLGCIAMCMRECRVVGLPAPACLKFCPKHCDPPLP--SRPVFHCTLDC-LNQCVSSQ  317
            N  ++ CI  CM++C+ VG+P+ +CLKFCP HC PP P  S  V HC + C L++C+  +
Sbjct  24   NLMEVKCIKHCMKDCKKVGIPSASCLKFCPLHCIPPPPMLSSEVRHCDVRCILDRCLDYK  83

Query  316  STRNNNNDEEKQDTCITSCKN  254
                  N+ EK + C + CKN
Sbjct  84   ------NEAEKLEGCASKCKN  98



>sp|Q04189.1|TAP1_ANTMA RecName: Full=Protein TAP1; Flags: Precursor [Antirrhinum majus]
 emb|CAA40552.1| TAP1 [Antirrhinum majus]
Length=107

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = -3

Query  469  CIAMCMRECRVVGLPAPACLKFCPKHCDPPLPSRPVFHCTLDC-LNQCVSSQSTRNNNND  293
            CI  CM+EC++ G+   AC+K+CP HC PP  S     C L C L++C         N+D
Sbjct  33   CIDHCMKECKLSGIGVVACIKYCPVHCLPPDSSSKEHFCNLGCMLDKCAKF------NDD  86

Query  292  EEKQDTCITSCKNEKC  245
            E+K   C+  C+   C
Sbjct  87   EKKMSDCVFDCRKFHC  102



>gb|EYU22706.1| hypothetical protein MIMGU_mgv1a016806mg [Erythranthe guttata]
Length=106

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = -3

Query  469  CIAMCMRECRVVGLPAPACLKFCPKHCDPPLPSRPVFHCTLDC-LNQCVSSQSTRNNNND  293
            CI  C++EC+  G+    C+K+CP HC PP  S    +C L C L+QC    S      D
Sbjct  33   CIDHCLKECKSSGVGVAVCVKYCPVHCLPPDASTKEHYCNLGCMLDQCAKFTS------D  86

Query  292  EEKQDTCITSCKNEKC  245
            E+K + C++ C+   C
Sbjct  87   EKKMNDCVSKCRKYNC  102



>ref|NP_001234861.1| uncharacterized protein LOC543739 precursor [Solanum lycopersicum]
 emb|CAB42004.1| hypothetical protein [Solanum lycopersicum]
Length=104

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = -3

Query  487  NFAKLGCIAMCMRECRVVGL-PAPACLKFCPKHCDPPLP--SRPVFHCTLDC-LNQCVSS  320
            N  ++ CI  CM++C+ VG  P   CLKFCP  C PP P  S  + HC   C L++C+  
Sbjct  24   NLMEVKCIKHCMKDCKKVGHSPLFPCLKFCPLQCVPPPPVLSSELRHCDARCILDRCLDY  83

Query  319  QSTRNNNNDEEKQDTCITSCKNEK  248
            +      N++EK + C + CKN K
Sbjct  84   K------NEDEKLEGCASKCKNNK  101



>gb|EYU22707.1| hypothetical protein MIMGU_mgv1a016806mg [Erythranthe guttata]
Length=105

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 8/76 (11%)
 Frame = -3

Query  469  CIAMCMRECRVVGLPAPACLKFCPKHCDPPLPSRPVFHCTLDC-LNQCVSSQSTRNNNND  293
            CI  C++EC+  G+    C+K+CP HC PP  S    +C L C L+QC           +
Sbjct  33   CIDHCLKECKSSGVGVAVCVKYCPVHCLPPDASTKEHYCNLGCMLDQCAKF-------TN  85

Query  292  EEKQDTCITSCKNEKC  245
            E+K + C++ C+   C
Sbjct  86   EKKMNDCVSKCRKYNC  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1092032152992