BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31787_g1_i1 len=1321 path=[1:0-1320]

Length=1321
                                                                      Score     E

ref|XP_006346979.1|  PREDICTED: peroxidase 72-like                      513   4e-178   
ref|XP_004233538.1|  PREDICTED: peroxidase 72-like                      509   1e-176   
ref|XP_009778388.1|  PREDICTED: peroxidase 72-like                      502   8e-174   
ref|XP_009621858.1|  PREDICTED: peroxidase 72-like                      501   2e-173   
ref|XP_009778389.1|  PREDICTED: peroxidase 72-like                      501   3e-173   
ref|XP_011083175.1|  PREDICTED: peroxidase 72-like                      501   4e-173   
ref|XP_009599956.1|  PREDICTED: peroxidase 72-like                      498   5e-172   
ref|XP_002521512.1|  Peroxidase 72 precursor, putative                  497   8e-172   Ricinus communis
ref|XP_007046814.1|  Peroxidase superfamily protein                     496   2e-171   
ref|XP_010252386.1|  PREDICTED: peroxidase 72-like                      496   3e-171   
ref|XP_009793693.1|  PREDICTED: peroxidase 72-like                      496   4e-171   
ref|XP_010252387.1|  PREDICTED: peroxidase 72-like                      494   1e-170   
ref|XP_009762369.1|  PREDICTED: peroxidase 72-like                      493   2e-170   
gb|ACI22425.1|  pericarp peroxidase 3                                   493   5e-170   Litchi chinensis [litchi]
ref|XP_006425607.1|  hypothetical protein CICLE_v10026054mg             492   1e-169   
ref|XP_006466861.1|  PREDICTED: peroxidase 72-like                      491   2e-169   
gb|KDO71031.1|  hypothetical protein CISIN_1g020149mg                   491   2e-169   
gb|KHG08031.1|  Peroxidase 72 -like protein                             491   3e-169   
ref|XP_009591264.1|  PREDICTED: peroxidase 72-like                      489   7e-169   
ref|XP_011025859.1|  PREDICTED: peroxidase 72                           488   6e-168   
ref|XP_009587109.1|  PREDICTED: peroxidase 72                           487   7e-168   
gb|ABG49114.1|  peroxidase                                              486   1e-167   Dimocarpus longan [longan]
ref|XP_009771827.1|  PREDICTED: peroxidase 72-like                      485   5e-167   
ref|XP_006343385.1|  PREDICTED: peroxidase 72-like                      485   5e-167   
ref|XP_009346064.1|  PREDICTED: peroxidase 72-like                      484   8e-167   
ref|XP_004234547.1|  PREDICTED: peroxidase 72                           484   1e-166   
ref|XP_006340671.1|  PREDICTED: peroxidase 72-like                      483   3e-166   
ref|XP_008344257.1|  PREDICTED: peroxidase 72-like                      483   3e-166   
ref|XP_008241745.1|  PREDICTED: peroxidase 72-like                      483   3e-166   
gb|AHL39156.1|  class III peroxidase                                    483   4e-166   
ref|XP_008337713.1|  PREDICTED: peroxidase 72-like                      483   4e-166   
ref|XP_004232440.1|  PREDICTED: peroxidase 72-like                      482   7e-166   
ref|XP_002310274.1|  Peroxidase 49 precursor family protein             482   8e-166   Populus trichocarpa [western balsam poplar]
ref|XP_010275548.1|  PREDICTED: peroxidase 72-like                      482   1e-165   
gb|EYU31175.1|  hypothetical protein MIMGU_mgv1a009720mg                482   1e-165   
emb|CDP01966.1|  unnamed protein product                                481   1e-165   
ref|XP_011028580.1|  PREDICTED: peroxidase 72-like                      481   2e-165   
ref|XP_006340672.1|  PREDICTED: peroxidase 72-like                      481   3e-165   
gb|AAP42506.1|  anionic peroxidase swpb1                                480   4e-165   Ipomoea batatas [batate]
ref|XP_007202348.1|  hypothetical protein PRUPE_ppa008349mg             480   5e-165   
ref|XP_008337703.1|  PREDICTED: peroxidase 72-like                      479   7e-165   
ref|XP_006383152.1|  hypothetical protein POPTR_0005s12070g             479   1e-164   
ref|XP_009606959.1|  PREDICTED: peroxidase 72-like                      479   2e-164   
ref|XP_010109912.1|  Peroxidase 72                                      477   7e-164   
ref|XP_003517206.1|  PREDICTED: peroxidase 72-like                      476   2e-163   
ref|XP_010254703.1|  PREDICTED: peroxidase 72-like                      476   2e-163   
ref|XP_010029741.1|  PREDICTED: peroxidase 72                           476   3e-163   
ref|XP_006590700.1|  PREDICTED: peroxidase 72-like                      475   5e-163   
gb|ABR23055.1|  basic peroxidase swpb5                                  475   5e-163   Ipomoea batatas [batate]
ref|XP_004509315.1|  PREDICTED: peroxidase 72-like                      474   7e-163   
ref|XP_004232441.1|  PREDICTED: peroxidase 72-like                      473   2e-162   
gb|ABZ80408.1|  class III peroxidase                                    472   1e-161   Casuarina glauca
gb|KHG06184.1|  Peroxidase 72                                           471   1e-161   
ref|XP_010924103.1|  PREDICTED: peroxidase 72-like                      471   2e-161   
ref|XP_006340670.1|  PREDICTED: peroxidase 49-like                      472   3e-161   
ref|XP_008338047.1|  PREDICTED: peroxidase 72-like                      470   4e-161   
ref|XP_006340673.1|  PREDICTED: peroxidase 49-like                      470   4e-161   
ref|XP_008352450.1|  PREDICTED: peroxidase 72-like                      471   4e-161   
ref|XP_003629389.1|  Peroxidase                                         470   5e-161   
ref|XP_010484652.1|  PREDICTED: peroxidase 72                           470   6e-161   
ref|XP_010679791.1|  PREDICTED: peroxidase 72-like                      469   9e-161   
ref|XP_006281424.1|  hypothetical protein CARUB_v10027498mg             469   1e-160   
ref|XP_004232442.2|  PREDICTED: peroxidase 49-like                      469   2e-160   
gb|AAP42507.1|  anionic peroxidase swpb2                                468   3e-160   Ipomoea batatas [batate]
ref|XP_010444803.1|  PREDICTED: peroxidase 72-like                      469   5e-160   
ref|XP_007158602.1|  hypothetical protein PHAVU_002G166300g             466   2e-159   
ref|XP_008452113.1|  PREDICTED: peroxidase 72-like                      465   6e-159   
ref|NP_201440.1|  peroxidase 72                                         464   9e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679794.1|  PREDICTED: peroxidase 72-like                      464   9e-159   
ref|XP_002275309.1|  PREDICTED: peroxidase 72                           463   2e-158   Vitis vinifera
ref|XP_004512077.1|  PREDICTED: peroxidase 72-like                      462   6e-158   
gb|ADN96690.1|  peroxidase 3                                            462   7e-158   
gb|ABB45838.1|  hypothetical protein                                    462   9e-158   Eutrema halophilum
ref|XP_010679795.1|  PREDICTED: peroxidase 72-like                      462   1e-157   
ref|XP_010465558.1|  PREDICTED: peroxidase 72-like isoform X1           461   2e-157   
ref|XP_006393821.1|  hypothetical protein EUTSA_v10004548mg             461   3e-157   
ref|XP_003612078.1|  Peroxidase                                         459   5e-157   
ref|XP_004287858.1|  PREDICTED: peroxidase 72-like                      459   6e-157   
ref|XP_009395537.1|  PREDICTED: peroxidase 72-like                      459   1e-156   
ref|XP_010679792.1|  PREDICTED: peroxidase 72-like                      458   2e-156   
emb|CAA66964.1|  peroxidase                                             457   4e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112290.1|  PREDICTED: peroxidase 72-like                      456   1e-155   
ref|XP_006840851.1|  hypothetical protein AMTR_s00083p00110830          455   2e-155   
ref|XP_010679790.1|  PREDICTED: peroxidase 72-like                      455   2e-155   
emb|CDX81401.1|  BnaC09g08120D                                          455   5e-155   
emb|CDY65385.1|  BnaCnng46860D                                          454   1e-154   
ref|XP_003612079.1|  Peroxidase                                         453   2e-154   
ref|XP_004146491.1|  PREDICTED: peroxidase 72-like                      453   3e-154   
ref|XP_009103543.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 72      452   3e-154   
gb|KHN00512.1|  Peroxidase 72                                           452   3e-154   
ref|XP_009396319.1|  PREDICTED: peroxidase 72-like                      452   5e-154   
ref|XP_003520284.1|  PREDICTED: peroxidase 72                           452   5e-154   
ref|XP_008440774.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 49      452   6e-154   
gb|KFK28312.1|  hypothetical protein AALP_AA8G500000                    450   3e-153   
ref|XP_010936646.1|  PREDICTED: peroxidase 72-like                      450   3e-153   
gb|ADQ43201.1|  unknown                                                 448   2e-152   
ref|XP_009393610.1|  PREDICTED: peroxidase 72-like                      447   3e-152   
ref|XP_010550432.1|  PREDICTED: peroxidase 72                           447   4e-152   
gb|AAF63027.1|AF244924_1  peroxidase prx15 precursor                    446   2e-151   Spinacia oleracea
ref|XP_008784965.1|  PREDICTED: peroxidase 72-like                      444   7e-151   
ref|XP_004149985.1|  PREDICTED: peroxidase 72-like                      441   9e-150   
ref|XP_008655973.1|  PREDICTED: peroxidase 72-like                      441   2e-149   
ref|XP_010548306.1|  PREDICTED: peroxidase 49                           440   2e-149   
gb|AAF63026.1|AF244923_1  peroxidase prx14 precursor                    439   5e-149   Spinacia oleracea
ref|XP_003547959.1|  PREDICTED: peroxidase 72-like                      439   9e-149   
gb|KHN27034.1|  Peroxidase 72                                           438   1e-148   
ref|XP_002455760.1|  hypothetical protein SORBIDRAFT_03g024460          438   2e-148   Sorghum bicolor [broomcorn]
gb|KDP37453.1|  hypothetical protein JCGZ_08294                         433   1e-147   
ref|XP_009417065.1|  PREDICTED: peroxidase 72-like                      434   5e-147   
ref|XP_004968895.1|  PREDICTED: peroxidase 72-like                      434   5e-147   
ref|XP_006343383.1|  PREDICTED: peroxidase 72-like                      432   2e-146   
dbj|BAB89258.1|  putative peroxidase ATP6a                              432   2e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645977.1|  PREDICTED: peroxidase 72-like                      437   3e-146   
gb|AAF63025.1|AF244922_1  peroxidase prx13 precursor                    429   3e-145   Spinacia oleracea
ref|XP_007156087.1|  hypothetical protein PHAVU_003G257400g             429   3e-145   
ref|XP_010033444.1|  PREDICTED: peroxidase 49                           429   3e-145   
ref|NP_001043276.1|  Os01g0543100                                       429   5e-145   Oryza sativa Japonica Group [Japonica rice]
gb|KFK30268.1|  hypothetical protein AALP_AA7G239300                    428   1e-144   
ref|XP_006644025.1|  PREDICTED: peroxidase 72-like                      428   1e-144   
gb|EAY74439.1|  hypothetical protein OsI_02330                          428   2e-144   Oryza sativa Indica Group [Indian rice]
ref|XP_006343384.1|  PREDICTED: peroxidase 72-like                      427   4e-144   
ref|XP_010231893.1|  PREDICTED: peroxidase 72-like                      426   6e-144   
gb|EAY73397.1|  hypothetical protein OsI_01277                          426   1e-143   Oryza sativa Indica Group [Indian rice]
ref|NP_001042657.1|  Os01g0263300                                       425   2e-143   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21494.1|  Peroxidase 72                                           425   3e-143   
dbj|BAJ98142.1|  predicted protein                                      425   3e-143   
dbj|BAA94962.1|  peroxidase                                             424   4e-143   Asparagus officinalis
ref|XP_002455405.1|  hypothetical protein SORBIDRAFT_03g010240          424   6e-143   Sorghum bicolor [broomcorn]
ref|XP_004967774.1|  PREDICTED: peroxidase 72-like                      425   7e-143   
gb|ABI37011.1|  peroxidase                                              423   1e-142   Oryza sativa [red rice]
gb|KHN36076.1|  Peroxidase 72                                           420   3e-142   
ref|XP_002455406.1|  hypothetical protein SORBIDRAFT_03g010250          422   3e-142   Sorghum bicolor [broomcorn]
gb|KHN41941.1|  Peroxidase 72                                           419   5e-142   
ref|XP_004234603.1|  PREDICTED: peroxidase 72-like                      421   1e-141   
ref|NP_001148509.1|  peroxidase 72 precursor                            420   2e-141   Zea mays [maize]
ref|XP_004967776.1|  PREDICTED: peroxidase 72-like                      420   2e-141   
ref|XP_004967775.1|  PREDICTED: peroxidase 72-like                      420   2e-141   
gb|EMS60222.1|  Peroxidase 72                                           419   4e-141   
ref|NP_179407.1|  peroxidase 15                                         418   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195361.1|  peroxidase 49                                         416   4e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566708.1|  PREDICTED: peroxidase 72-like                      416   5e-140   
gb|AAM61616.1|  putative peroxidase                                     416   5e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566702.1|  PREDICTED: peroxidase 72-like                      416   6e-140   
ref|XP_010467620.1|  PREDICTED: peroxidase 15-like                      416   7e-140   
ref|XP_009138426.1|  PREDICTED: peroxidase 49                           415   2e-139   
ref|XP_010437350.1|  PREDICTED: peroxidase 49-like                      414   3e-139   
ref|XP_010413957.1|  PREDICTED: peroxidase 15-like                      414   3e-139   
ref|XP_006284092.1|  hypothetical protein CARUB_v10005221mg             414   3e-139   
emb|CDM82666.1|  unnamed protein product                                414   3e-139   
gb|AAM28296.1|  peroxidase                                              414   4e-139   Ananas comosus
gb|EMT23112.1|  Peroxidase 72                                           414   4e-139   
emb|CDM82667.1|  unnamed protein product                                414   4e-139   
emb|CDY64926.1|  BnaAnng19770D                                          414   5e-139   
dbj|BAJ94853.1|  predicted protein                                      414   5e-139   
ref|XP_010446794.1|  PREDICTED: peroxidase 49-like                      413   1e-138   
gb|EMT23111.1|  Peroxidase 72                                           413   1e-138   
emb|CCJ34843.1|  horseradish peroxidase isoenzyme HRP_08562.1           412   2e-138   
gb|EMS54022.1|  Peroxidase 72                                           412   2e-138   
emb|CCJ34840.1|  horseradish peroxidase isoenzyme HRP_6117              412   2e-138   
ref|XP_002886150.1|  hypothetical protein ARALYDRAFT_480719             412   3e-138   
emb|CCJ34844.1|  horseradish peroxidase isoenzyme HRP_08562.4           412   3e-138   
emb|CDX75574.1|  BnaA01g01280D                                          411   6e-138   
emb|CDM82668.1|  unnamed protein product                                411   8e-138   
gb|EMT08941.1|  Peroxidase 72                                           410   1e-137   
ref|XP_006299700.1|  hypothetical protein CARUB_v10015891mg             410   1e-137   
ref|XP_009144604.1|  PREDICTED: peroxidase 49-like                      410   1e-137   
dbj|BAM05630.1|  peroxidase 1                                           407   3e-137   
ref|XP_006412001.1|  hypothetical protein EUTSA_v10025683mg             409   3e-137   
ref|XP_006296673.1|  hypothetical protein CARUB_v10016420mg             409   5e-137   
ref|XP_010489511.1|  PREDICTED: peroxidase 15                           409   5e-137   
gb|ABD47725.1|  peroxidase                                              405   8e-137   Eucalyptus globulus subsp. globulus
emb|CDX69223.1|  BnaC01g02300D                                          408   8e-137   
ref|XP_010432175.1|  PREDICTED: peroxidase 49                           408   8e-137   
ref|XP_009102275.1|  PREDICTED: peroxidase 15                           408   1e-136   
ref|XP_003566714.1|  PREDICTED: peroxidase 72-like                      408   1e-136   
gb|KFK40198.1|  hypothetical protein AALP_AA3G342700                    407   2e-136   
emb|CDY46313.1|  BnaA07g01880D                                          407   2e-136   
gb|EAZ12255.1|  hypothetical protein OsJ_02142                          408   2e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652285.1|  PREDICTED: peroxidase 72-like                      407   2e-136   
gb|KFK34345.1|  hypothetical protein AALP_AA5G133200                    407   3e-136   
ref|XP_006409192.1|  hypothetical protein EUTSA_v10022774mg             406   6e-136   
ref|NP_001136736.1|  uncharacterized protein LOC100216875 precursor     405   2e-135   Zea mays [maize]
emb|CDY25139.1|  BnaC07g03680D                                          405   2e-135   
emb|CDY25140.1|  BnaC07g03670D                                          405   2e-135   
ref|XP_002876063.1|  predicted protein                                  404   4e-135   
emb|CDY59700.1|  BnaC07g51170D                                          403   5e-135   
ref|XP_009129875.1|  PREDICTED: peroxidase 49-like                      404   6e-135   
emb|CDM82669.1|  unnamed protein product                                403   8e-135   
dbj|BAJ94181.1|  predicted protein                                      403   9e-135   
gb|ACG44598.1|  peroxidase 72 precursor                                 403   9e-135   Zea mays [maize]
ref|XP_006403967.1|  hypothetical protein EUTSA_v10011077mg             402   3e-134   
ref|NP_190668.2|  peroxidase 36                                         400   1e-133   Arabidopsis thaliana [mouse-ear cress]
emb|CAB62621.1|  peroxidase-like protein                                399   2e-133   Arabidopsis thaliana [mouse-ear cress]
gb|EMS55762.1|  Peroxidase 72                                           398   2e-132   
gb|EMT08942.1|  Peroxidase 15                                           397   2e-132   
ref|NP_179406.1|  peroxidase 14                                         395   8e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426640.1|  PREDICTED: peroxidase 36                           395   8e-132   
ref|XP_009771021.1|  PREDICTED: peroxidase 9-like                       395   1e-131   
ref|XP_010503773.1|  PREDICTED: peroxidase 36-like                      395   1e-131   
ref|XP_006292998.1|  hypothetical protein CARUB_v10019275mg             394   4e-131   
gb|ABR17480.1|  unknown                                                 394   6e-131   Picea sitchensis
gb|ADP95696.1|  class III heme peroxidase                               390   2e-130   
ref|XP_008667349.1|  PREDICTED: hypothetical protein isoform X1         391   4e-130   
gb|ABK26974.1|  unknown                                                 391   6e-130   Picea sitchensis
ref|XP_010515480.1|  PREDICTED: peroxidase 36-like                      390   1e-129   
dbj|BAM05631.1|  peroxidase 1                                           387   1e-129   
gb|EAY94133.1|  hypothetical protein OsI_15906                          389   6e-129   Oryza sativa Indica Group [Indian rice]
ref|XP_002446477.1|  hypothetical protein SORBIDRAFT_06g016610          389   7e-129   Sorghum bicolor [broomcorn]
emb|CDX77970.1|  BnaA09g31650D                                          388   7e-129   
ref|NP_001052799.1|  Os04g0423800                                       388   7e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115779.1|  PREDICTED: peroxidase 36                           387   2e-128   
dbj|BAM05632.1|  peroxidase 1                                           382   7e-128   
gb|EMT26481.1|  Peroxidase 72                                           382   3e-127   
ref|XP_007017633.1|  Peroxidase superfamily protein                     384   3e-127   
ref|XP_009599290.1|  PREDICTED: peroxidase 9                            383   5e-127   
dbj|BAM05633.1|  peroxidase 1                                           380   7e-127   
emb|CDX73762.1|  BnaC08g22410D                                          383   7e-127   
ref|XP_003579740.2|  PREDICTED: peroxidase 72-like                      381   1e-126   
ref|XP_010110020.1|  Peroxidase 9                                       382   1e-126   
ref|NP_001168269.1|  uncharacterized protein LOC100382033 precursor     381   5e-126   Zea mays [maize]
gb|KHG27001.1|  Peroxidase 9 -like protein                              381   6e-126   
gb|KFK40197.1|  hypothetical protein AALP_AA3G342600                    379   2e-125   
gb|EYU32893.1|  hypothetical protein MIMGU_mgv1a009418mg                378   9e-125   
ref|XP_004968729.1|  PREDICTED: peroxidase 72-like                      378   1e-124   
emb|CDX75576.1|  BnaA01g01260D                                          392   3e-124   
ref|XP_007226292.1|  hypothetical protein PRUPE_ppa020321mg             375   2e-123   
gb|KHN27032.1|  Peroxidase 72                                           373   3e-123   
ref|XP_003547960.2|  PREDICTED: peroxidase 72-like                      374   4e-123   
ref|XP_011074620.1|  PREDICTED: peroxidase 9                            373   5e-123   
ref|XP_008221352.1|  PREDICTED: peroxidase 9                            374   6e-123   
gb|EMS61935.1|  Peroxidase 72                                           372   1e-122   
emb|CDP07473.1|  unnamed protein product                                371   4e-122   
ref|XP_010531058.1|  PREDICTED: peroxidase 49                           370   9e-122   
ref|XP_010061268.1|  PREDICTED: peroxidase 9                            370   1e-121   
ref|XP_006364989.1|  PREDICTED: peroxidase 9-like                       368   4e-121   
gb|KHG06183.1|  hypothetical protein F383_31802                         392   9e-121   
ref|XP_004238287.1|  PREDICTED: peroxidase 9                            366   2e-120   
emb|CDY12580.1|  BnaC06g01060D                                          365   1e-119   
ref|XP_011028910.1|  PREDICTED: peroxidase 9                            364   2e-119   
ref|XP_009129550.1|  PREDICTED: peroxidase 9                            364   3e-119   
ref|XP_002281048.1|  PREDICTED: peroxidase 9                            360   8e-118   Vitis vinifera
ref|XP_009785386.1|  PREDICTED: peroxidase 9-like                       359   1e-117   
ref|XP_006341976.1|  PREDICTED: peroxidase 9-like                       359   1e-117   
ref|XP_006601328.1|  PREDICTED: peroxidase 9-like                       359   1e-117   
ref|XP_006393684.1|  hypothetical protein EUTSA_v10011616mg             359   2e-117   
emb|CAA62615.1|  PRX                                                    357   4e-117   Mercurialis annua [annual mercury]
ref|XP_009592461.1|  PREDICTED: peroxidase 9-like                       358   5e-117   
ref|XP_002300745.2|  hypothetical protein POPTR_0002s03260g             358   6e-117   Populus trichocarpa [western balsam poplar]
ref|XP_004238027.1|  PREDICTED: peroxidase 9                            357   6e-117   
ref|XP_007160719.1|  hypothetical protein PHAVU_001G011300g             357   1e-116   
ref|XP_010275549.1|  PREDICTED: peroxidase 9                            357   2e-116   
gb|KDO84664.1|  hypothetical protein CISIN_1g041231mg                   356   2e-116   
ref|XP_006473561.1|  PREDICTED: peroxidase 9-like                       356   3e-116   
gb|KFK36173.1|  hypothetical protein AALP_AA4G087700                    356   3e-116   
ref|XP_003545265.2|  PREDICTED: peroxidase 9-like                       355   5e-116   
gb|KHN12678.1|  Peroxidase 9                                            355   7e-116   
gb|EMS54021.1|  Peroxidase 72                                           353   8e-116   
ref|XP_010552483.1|  PREDICTED: peroxidase 9                            355   8e-116   
gb|AAM63684.1|  peroxidase, putative                                    355   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291839.1|  PREDICTED: peroxidase 9-like                       354   3e-115   
ref|XP_006304450.1|  hypothetical protein CARUB_v10011083mg             352   1e-114   
ref|NP_175117.1|  peroxidase 9                                          352   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891306.1|  hypothetical protein ARALYDRAFT_891426             352   1e-114   
ref|XP_008388019.1|  PREDICTED: peroxidase 9                            352   3e-114   
emb|CAD92857.1|  peroxidase                                             350   5e-114   Picea abies
ref|XP_010479069.1|  PREDICTED: peroxidase 9-like                       350   6e-114   
ref|XP_010500174.1|  PREDICTED: peroxidase 9 isoform X1                 349   2e-113   
ref|XP_004967777.1|  PREDICTED: peroxidase 9-like                       347   2e-112   
ref|XP_002510443.1|  Peroxidase 9 precursor, putative                   347   2e-112   Ricinus communis
ref|XP_010672794.1|  PREDICTED: peroxidase 9                            345   6e-112   
ref|XP_003566698.1|  PREDICTED: peroxidase 9-like                       344   1e-111   
ref|XP_009335850.1|  PREDICTED: peroxidase 9                            345   1e-111   
ref|XP_002457609.1|  hypothetical protein SORBIDRAFT_03g010230          342   8e-111   Sorghum bicolor [broomcorn]
ref|XP_004499202.1|  PREDICTED: peroxidase 9-like                       341   2e-110   
ref|NP_001042655.1|  Os01g0263000                                       341   3e-110   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23113.1|  Peroxidase 9                                            339   2e-109   
ref|XP_003589326.1|  Peroxidase like protein                            337   6e-109   
ref|XP_006404939.1|  hypothetical protein EUTSA_v10000286mg             334   8e-109   
gb|AII99882.1|  peroxidase                                              343   4e-108   
gb|AFK38468.1|  unknown                                                 331   4e-108   
gb|ABK21983.1|  unknown                                                 330   3e-106   
emb|CAL25298.1|  properoxidase                                          330   6e-106   
emb|CAL25299.1|  properoxidase                                          329   7e-106   
gb|KHN20948.1|  Peroxidase 9                                            338   2e-105   
ref|XP_010500175.1|  PREDICTED: peroxidase 9 isoform X2                 324   2e-104   
ref|XP_006645738.1|  PREDICTED: peroxidase 9-like                       326   2e-104   
gb|AHH91637.1|  POD2 protein                                            323   3e-104   
gb|EAZ30754.1|  hypothetical protein OsJ_14819                          323   7e-104   
gb|ABK22680.1|  unknown                                                 323   1e-103   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             318   6e-102   
ref|XP_002980452.1|  hypothetical protein SELMODRAFT_444510             319   7e-102   
ref|XP_002962639.1|  hypothetical protein SELMODRAFT_230146             318   1e-101   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       317   6e-101   
gb|EMS55761.1|  Peroxidase 72                                           318   1e-100   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       313   5e-100   
gb|KHG00505.1|  Peroxidase 20 -like protein                             312   1e-99    
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           312   2e-99    
ref|XP_008788685.1|  PREDICTED: peroxidase 20                           312   4e-99    
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       310   1e-98    
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       310   2e-98    
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       309   2e-98    
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            309   3e-98    
dbj|BAK02557.1|  predicted protein                                      305   4e-98    
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           308   6e-98    
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       308   9e-98    
ref|XP_010934866.1|  PREDICTED: peroxidase 20                           308   1e-97    
ref|XP_010677294.1|  PREDICTED: peroxidase 20                           307   2e-97    
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       306   4e-97    
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      306   4e-97    
ref|XP_007011212.1|  Peroxidase superfamily protein                     306   4e-97    
ref|XP_007209356.1|  hypothetical protein PRUPE_ppa008666mg             306   5e-97    
ref|XP_002279208.1|  PREDICTED: peroxidase 20                           306   8e-97    
emb|CDP12962.1|  unnamed protein product                                306   8e-97    
emb|CBI17443.3|  unnamed protein product                                302   9e-97    
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           305   1e-96    
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      305   1e-96    
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       304   2e-96    
ref|XP_008373603.1|  PREDICTED: peroxidase 20                           305   2e-96    
ref|XP_008238359.1|  PREDICTED: peroxidase 20                           305   2e-96    
ref|XP_002987834.1|  hypothetical protein SELMODRAFT_235371             304   2e-96    
ref|XP_004148517.1|  PREDICTED: peroxidase 20-like                      304   3e-96    
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      303   5e-96    
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         303   6e-96    
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            303   7e-96    
ref|XP_008365012.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 9...    302   1e-95    
gb|AGN03454.1|  class III secretory peroxidase                          302   1e-95    
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      302   1e-95    
gb|ACU82387.2|  peroxidase 1                                            301   3e-95    
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          301   4e-95    
gb|AFR44628.1|  class III secretory peroxidase                          301   4e-95    
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              300   6e-95    
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              300   6e-95    
ref|XP_007039570.1|  Peroxidase superfamily protein                     301   6e-95    
ref|XP_009365524.1|  PREDICTED: peroxidase 9-like                       300   6e-95    
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      300   7e-95    
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              300   8e-95    
ref|XP_003516641.1|  PREDICTED: peroxidase 20-like                      300   9e-95    
emb|CAB65334.1|  SPI2 protein                                           301   9e-95    
ref|XP_007048724.1|  Peroxidase superfamily protein                     300   1e-94    
ref|XP_009371221.1|  PREDICTED: peroxidase 20                           301   1e-94    
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      298   3e-94    
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        298   3e-94    
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      298   4e-94    
ref|XP_002273359.1|  PREDICTED: peroxidase 40                           299   4e-94    
ref|XP_009365523.1|  PREDICTED: peroxidase 9-like                       298   4e-94    
gb|ABR18139.1|  unknown                                                 298   4e-94    
ref|XP_003611449.1|  Peroxidase                                         298   5e-94    
ref|XP_002320417.1|  peroxidase family protein                          298   5e-94    
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      298   7e-94    
ref|XP_006849541.1|  hypothetical protein AMTR_s00024p00166170          298   7e-94    
gb|AAX53172.1|  peroxidase                                              297   8e-94    
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       297   1e-93    
ref|XP_007033589.1|  Peroxidase superfamily protein                     297   1e-93    
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       297   1e-93    
emb|CAH10840.1|  peroxidase                                             297   1e-93    
ref|XP_007014789.1|  Peroxidase superfamily protein, putative           298   2e-93    
ref|XP_010260327.1|  PREDICTED: peroxidase P7-like                      296   3e-93    
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              296   3e-93    
ref|XP_008465937.1|  PREDICTED: peroxidase 20 isoform X1                296   3e-93    
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  296   4e-93    
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      296   4e-93    
gb|KDP27943.1|  hypothetical protein JCGZ_19023                         296   5e-93    
ref|XP_010066504.1|  PREDICTED: peroxidase 70-like                      295   5e-93    
emb|CDP10156.1|  unnamed protein product                                296   5e-93    
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              295   6e-93    
dbj|BAM05634.1|  peroxidase 2                                           296   6e-93    
gb|KDP34262.1|  hypothetical protein JCGZ_12830                         296   6e-93    
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           295   6e-93    
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      295   6e-93    
ref|XP_011018622.1|  PREDICTED: peroxidase 20                           296   7e-93    
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              295   7e-93    
ref|XP_002982182.1|  hypothetical protein SELMODRAFT_421525             295   7e-93    
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              295   9e-93    
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       295   1e-92    
dbj|BAM05635.1|  peroxidase 2                                           295   1e-92    
ref|XP_006368439.1|  Peroxidase 20 precursor family protein             295   1e-92    
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   295   1e-92    
gb|AHL39159.1|  class III peroxidase                                    295   1e-92    
gb|AHL39105.1|  class III peroxidase                                    295   2e-92    
ref|XP_002992288.1|  hypothetical protein SELMODRAFT_430498             303   2e-92    
ref|XP_009405166.1|  PREDICTED: peroxidase 59-like                      294   2e-92    
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      293   3e-92    
gb|ACI03401.1|  peroxidase 1                                            293   3e-92    
ref|XP_011019625.1|  PREDICTED: peroxidase 40-like                      294   3e-92    
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           293   4e-92    
dbj|BAK02665.1|  predicted protein                                      293   5e-92    
ref|XP_002960752.1|  hypothetical protein SELMODRAFT_229828             293   6e-92    
ref|XP_002983918.1|  hypothetical protein SELMODRAFT_234418             293   6e-92    
emb|CAH10839.1|  peroxidase                                             293   6e-92    
emb|CAL25300.1|  properoxidase                                          292   6e-92    
ref|XP_010042071.1|  PREDICTED: peroxidase 70-like                      292   9e-92    
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             292   9e-92    
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       292   9e-92    
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              292   1e-91    
ref|XP_010066484.1|  PREDICTED: peroxidase 70-like                      292   1e-91    
dbj|BAM05637.1|  peroxidase 2                                           293   1e-91    
ref|XP_002519251.1|  Peroxidase 40 precursor, putative                  295   1e-91    
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           292   1e-91    
ref|XP_004511773.1|  PREDICTED: peroxidase 20-like                      292   1e-91    
gb|KDP45138.1|  hypothetical protein JCGZ_17470                         292   1e-91    
ref|XP_010257485.1|  PREDICTED: peroxidase A2-like                      292   1e-91    
ref|XP_009385729.1|  PREDICTED: peroxidase 20                           293   1e-91    
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              291   2e-91    
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       291   2e-91    
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      291   2e-91    
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      291   2e-91    
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              291   2e-91    
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              291   2e-91    
ref|XP_010041911.1|  PREDICTED: peroxidase P7-like                      291   3e-91    
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       291   3e-91    
ref|XP_004307711.1|  PREDICTED: peroxidase 4-like                       291   3e-91    
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              291   3e-91    
dbj|BAA77389.1|  peroxidase 3                                           291   4e-91    
gb|KHF98953.1|  Peroxidase 20 -like protein                             289   4e-91    
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       290   5e-91    
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      290   5e-91    
gb|AFY97686.1|  peroxidase 3                                            291   6e-91    
ref|XP_007162335.1|  hypothetical protein PHAVU_001G143300g             291   6e-91    
gb|KHG00581.1|  hypothetical protein F383_17561                         301   6e-91    
ref|XP_009375169.1|  PREDICTED: peroxidase A2-like                      291   6e-91    
emb|CAN81400.1|  hypothetical protein VITISV_038539                     290   6e-91    
gb|ACZ51443.1|  peroxidase protein                                      290   6e-91    
ref|XP_010520028.1|  PREDICTED: peroxidase A2-like                      291   7e-91    
ref|XP_003596716.1|  Peroxidase                                         290   7e-91    
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           290   7e-91    
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              290   7e-91    
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         290   8e-91    
ref|XP_007156646.1|  hypothetical protein PHAVU_002G005400g             290   8e-91    
ref|XP_008228270.1|  PREDICTED: peroxidase 59                           290   9e-91    
ref|XP_010058197.1|  PREDICTED: peroxidase A2-like                      290   1e-90    
dbj|BAA82306.1|  peroxidase                                             290   1e-90    
ref|XP_010915493.1|  PREDICTED: peroxidase P7-like                      289   1e-90    
gb|ACJ11762.1|  class III peroxidase                                    290   1e-90    
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              289   1e-90    
gb|AAR31106.1|  peroxidase precursor                                    290   1e-90    
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      289   2e-90    
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    289   2e-90    
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      289   2e-90    
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      289   2e-90    
gb|AAL92037.1|AF488305_1  apoplastic anionic gaiacol peroxidase         290   2e-90    
ref|XP_010915491.1|  PREDICTED: peroxidase P7-like                      289   2e-90    
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      289   2e-90    
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   289   2e-90    
ref|XP_002974373.1|  hypothetical protein SELMODRAFT_101253             289   2e-90    
ref|XP_001769208.1|  predicted protein                                  289   2e-90    
emb|CAH10841.1|  peroxidase                                             288   2e-90    
ref|XP_010042156.1|  PREDICTED: peroxidase P7-like                      288   3e-90    
ref|XP_008370639.1|  PREDICTED: peroxidase 9-like                       288   3e-90    
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       288   3e-90    
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   288   3e-90    
ref|NP_192618.1|  peroxidase 38                                         289   3e-90    
ref|XP_010093550.1|  Cationic peroxidase 1                              288   3e-90    
ref|XP_006399146.1|  hypothetical protein EUTSA_v10014029mg             289   3e-90    
ref|XP_009364156.1|  PREDICTED: peroxidase N-like                       288   4e-90    
ref|XP_002312317.1|  peroxidase 40 family protein                       288   4e-90    
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      288   4e-90    
ref|XP_008465938.1|  PREDICTED: peroxidase 20 isoform X2                288   4e-90    
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      288   4e-90    
ref|XP_002872414.1|  hypothetical protein ARALYDRAFT_489775             289   4e-90    
gb|AFK41406.1|  unknown                                                 288   4e-90    
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      288   4e-90    
ref|XP_006354189.1|  PREDICTED: lignin-forming anionic peroxidase...    288   4e-90    
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              288   5e-90    
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       288   5e-90    
ref|XP_003521220.1|  PREDICTED: peroxidase 15-like                      288   5e-90    
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              288   5e-90    
ref|XP_010041993.1|  PREDICTED: peroxidase P7-like                      288   6e-90    
pir||S60054  peroxidase (EC 1.11.1.7) A3a precursor - Japanese as...    288   6e-90 
gb|KHN07440.1|  Peroxidase 15                                           288   6e-90    
gb|AAM65211.1|  peroxidase                                              288   6e-90    
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      287   7e-90    
ref|XP_009143676.1|  PREDICTED: peroxidase 20                           288   7e-90    
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      287   8e-90    
ref|XP_007206866.1|  hypothetical protein PRUPE_ppb006944mg             288   9e-90    
pir||S60055  peroxidase (EC 1.11.1.7) A4a precursor - Japanese as...    288   9e-90 
dbj|BAD97435.1|  peroxidase                                             287   1e-89    
gb|EPS58869.1|  peroxidase                                              286   1e-89    
emb|CAA66037.1|  peroxidase                                             288   1e-89    
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      287   1e-89    
emb|CDX98949.1|  BnaC09g48860D                                          288   1e-89    
gb|KHN42624.1|  Peroxidase 20                                           286   1e-89    
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              286   1e-89    
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    288   1e-89    
ref|XP_010505042.1|  PREDICTED: peroxidase 20-like                      287   1e-89    
emb|CCJ34826.1|  horseradish peroxidase isoenzyme HRP_A2B               287   1e-89    
emb|CCJ34825.1|  horseradish peroxidase isoenzyme HRP_A2A               287   1e-89    
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              286   1e-89    
ref|XP_010041825.1|  PREDICTED: peroxidase P7-like                      286   1e-89    
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      286   2e-89    
gb|ACM47317.1|  peroxidase                                              286   2e-89    
dbj|BAF33315.1|  peroxidase                                             287   2e-89    
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              286   2e-89    
emb|CAH10842.1|  peroxidase                                             286   2e-89    
ref|XP_006288094.1|  hypothetical protein CARUB_v10001325mg             287   2e-89    
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            286   2e-89    
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                      286   2e-89    
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              286   2e-89    
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              286   2e-89    
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              286   2e-89    
gb|AGF25269.1|  peroxidase 2                                            286   2e-89    



>ref|XP_006346979.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=331

 Score =   513 bits (1322),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             FFM I LL  A +CL SK+YGGYL+PQFYDRSCP+A++IV+S+VAKAVAKE RMAASLLR
Sbjct  7     FFMVIVLLAFAPICLSSKTYGGYLFPQFYDRSCPQAKQIVKSIVAKAVAKEARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLD+SG+I SEKRSNPNRNS RGFEVIDEIK  LE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDNSGTIISEKRSNPNRNSVRGFEVIDEIKKTLEKECPQTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVLAGGPNWEVPLGR+DSRG SLSGSN NIPAPNNTF TILTKFKL+GLD
Sbjct  127   DILALAARDSTVLAGGPNWEVPLGRKDSRGASLSGSNYNIPAPNNTFNTILTKFKLKGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GNSLPDYTL+QSYAA+LR RCP+SGGDQTLF
Sbjct  187   IVDLVALSGSHTIGNARCTSFRQRLYNQSGNSLPDYTLEQSYAAQLRVRCPRSGGDQTLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              +DFV+P +FDNSYFKNLLA KGLLNSDQVLVTK+  SL LVK YAEN+ELFF+HFAKSM
Sbjct  247   FMDFVSPIKFDNSYFKNLLASKGLLNSDQVLVTKNQESLALVKQYAENNELFFEHFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKINH  299
             VKMGNISPLTGF GEIRKNCRKIN+
Sbjct  307   VKMGNISPLTGFRGEIRKNCRKINN  331



>ref|XP_004233538.1| PREDICTED: peroxidase 72-like [Solanum lycopersicum]
Length=331

 Score =   509 bits (1312),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 301/332 (91%), Gaps = 1/332 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S FFM I LL  A +CL SK+YGGYL+PQFYDRSCP+A+EIV+S+VAKAVAKE R
Sbjct  1     MAQSMS-FFMVIVLLAFAPICLSSKTYGGYLFPQFYDRSCPQAKEIVKSIVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLD+SG+I SEKRSNPNRNS RGFEVIDEIK  LE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDNSGTIISEKRSNPNRNSVRGFEVIDEIKKTLEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVL GGPNWEVPLGRRDSRG SLSGSN NIPAPNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLVGGPNWEVPLGRRDSRGASLSGSNYNIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKL+GLD+VDLVALSGSHTIGNARC SFRQRLYNQ+GNSLPDYTL+QSYAA+LR  CP+S
Sbjct  180   FKLKGLDIVDLVALSGSHTIGNARCTSFRQRLYNQSGNSLPDYTLEQSYAAQLRATCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+P +FDNSYFKNLLA KGLLNSDQVLVTK+  SL LVK YAEN+ELFF
Sbjct  240   GGDQNLFFLDFVSPMKFDNSYFKNLLASKGLLNSDQVLVTKNQQSLALVKQYAENNELFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             +HFAKSMVKMGNISPLTGF GEIRKNCRKIN+
Sbjct  300   EHFAKSMVKMGNISPLTGFKGEIRKNCRKINN  331



>ref|XP_009778388.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=332

 Score =   502 bits (1293),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 275/332 (83%), Positives = 300/332 (90%), Gaps = 2/332 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MAK VS FFM I+LL  A +C CSKS Y GYLYPQFYD SCP+A+EIV+SVVAKAVA+E 
Sbjct  1     MAKSVS-FFMVISLLAFAPICFCSKSNYYGYLYPQFYDWSCPQAKEIVKSVVAKAVAREA  59

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDAS+LLDSS ++ SEKRSN NRNS RGFEVIDEIK+ALE E
Sbjct  60    RMAASLLRLHFHDCFVKGCDASLLLDSSATLISEKRSNTNRNSVRGFEVIDEIKSALEKE  119

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF TILT
Sbjct  120   CPQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRDASLSGSNNNIPAPNNTFNTILT  179

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKL+GLDLVDLV LSGSHTIGNARC SFRQRLYNQ+GNSLPDYTLDQ+YAA+LRTRCPK
Sbjct  180   KFKLKGLDLVDLVTLSGSHTIGNARCTSFRQRLYNQSGNSLPDYTLDQTYAAQLRTRCPK  239

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF +DFV+PT+FDNSYFKNLLA +GL NSDQVLVTK+ A+L LVK YAEN+E+F
Sbjct  240   SGGDQNLFVMDFVSPTKFDNSYFKNLLASRGLFNSDQVLVTKNQATLALVKLYAENNEIF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F+ FAKSMVKMGNISPLTG+ GEIRKNCR +N
Sbjct  300   FEQFAKSMVKMGNISPLTGYRGEIRKNCRMMN  331



>ref|XP_009621858.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=330

 Score =   501 bits (1290),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 277/331 (84%), Positives = 297/331 (90%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S FF+ I LL  A LC  +K+ GG LYPQ+Y RSCP+AQEIV+SVVAKAVAKE R
Sbjct  1     MAQSMSFFFL-IGLLAFAPLCFSTKTSGGSLYPQYYYRSCPKAQEIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSS  I +EKRSNPNRNSARGFEVIDEIK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEKRSNPNRNSARGFEVIDEIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSRG SLSGSNN+IPAPNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRGASLSGSNNDIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSGSHTIGN+RC SFRQRLYNQ+GNS PD TLDQSYAA+LR RCPKS
Sbjct  180   FKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNSQPDSTLDQSYAAQLRNRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFKNLLA KGLLNSDQVL TKS ASL LVK YAEN+ELFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLNSDQVLTTKSQASLALVKQYAENNELFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             +HFAKSMVKMGNISPLTG  GEIRKNCRK+N
Sbjct  300   EHFAKSMVKMGNISPLTGSRGEIRKNCRKMN  330



>ref|XP_009778389.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=332

 Score =   501 bits (1289),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 278/332 (84%), Positives = 301/332 (91%), Gaps = 2/332 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             M K VS FFM I+LL  A +C CSKS Y GYLYPQFYD SCP+A+EIV+SVVAKAVA+E 
Sbjct  1     MVKSVS-FFMVISLLAFAPICFCSKSNYYGYLYPQFYDWSCPQAKEIVKSVVAKAVAREA  59

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDAS+LLDSSG+I SEK SN NRNSARGFEVIDEIK+ALE E
Sbjct  60    RMAASLLRLHFHDCFVKGCDASLLLDSSGTIISEKISNTNRNSARGFEVIDEIKSALEKE  119

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF TILT
Sbjct  120   CPQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRDASLSGSNNNIPAPNNTFNTILT  179

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKL+GLDLVDLVALSGSHTIGNARC SFRQRLYNQ+GN+LPDYTLDQSYAA+LRTRCPK
Sbjct  180   KFKLKGLDLVDLVALSGSHTIGNARCTSFRQRLYNQSGNNLPDYTLDQSYAAQLRTRCPK  239

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF +DFV+PT+FDN YFKNLLA KGL NSDQVLVTK+ ASL+LV+ YAEN+ELF
Sbjct  240   SGGDQNLFFMDFVSPTKFDNYYFKNLLASKGLFNSDQVLVTKNQASLELVRLYAENNELF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F+ FAKSMVKMGNISPLTG+ GEIRKNCR +N
Sbjct  300   FEQFAKSMVKMGNISPLTGYRGEIRKNCRMMN  331



>ref|XP_011083175.1| PREDICTED: peroxidase 72-like [Sesamum indicum]
Length=331

 Score =   501 bits (1289),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 301/331 (91%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MAK +   F+A+ LL  A LC    SYGGYLYPQFYDRSCPRAQEIV SVVAK+VAKE R
Sbjct  1     MAKSIY-LFLALTLLDFAPLCFSHNSYGGYLYPQFYDRSCPRAQEIVRSVVAKSVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFVKGCDASILLDS+GS+ SEKRSNPNRNSARGFEVIDEIK+ALE EC
Sbjct  60    MAASLVRLHFHDCFVKGCDASILLDSTGSLVSEKRSNPNRNSARGFEVIDEIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADI+ALAARDSTVL GGP+W VPLGRRDS+G SLSGSNNNIPAPNNTFQTILTK
Sbjct  120   PQTVSCADIMALAARDSTVLVGGPSWVVPLGRRDSKGASLSGSNNNIPAPNNTFQTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLD+VDLVALSGSHTIGN+RC SFRQRLYNQ+GNS PD+TLDQSYAA+LR RCP+S
Sbjct  180   FKLQGLDIVDLVALSGSHTIGNSRCASFRQRLYNQSGNSQPDFTLDQSYAAQLRARCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFKNLL++KGLL+SDQVLVTK+ ASL+LVK YAE++ELFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKNLLSFKGLLSSDQVLVTKNQASLELVKMYAESNELFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FAKSMVKMGNISPLTG  GEIRKNCR+IN
Sbjct  300   EQFAKSMVKMGNISPLTGSRGEIRKNCRRIN  330



>ref|XP_009599956.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=332

 Score =   498 bits (1281),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 273/333 (82%), Positives = 303/333 (91%), Gaps = 2/333 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MAK VS FFM I+L+  A +C CSKS Y GYLYPQFYD SCP+A+EIV+SVVAKAVA+E 
Sbjct  1     MAKAVS-FFMVISLIAFAPICFCSKSNYYGYLYPQFYDWSCPQAKEIVKSVVAKAVAREA  59

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDAS+LLDSSG++ SEK SN NRNSARGFEVIDEIK+ALE E
Sbjct  60    RMAASLLRLHFHDCFVKGCDASLLLDSSGTLVSEKISNTNRNSARGFEVIDEIKSALEKE  119

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILALAARDSTVL GGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF TILT
Sbjct  120   CPQTVSCADILALAARDSTVLVGGPNWEVPLGRRDSRDASLSGSNNNIPAPNNTFNTILT  179

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKL+GLDLVDLVALSGSHTIGNARC SFRQRLYNQ+GN+LPDYTLDQSYAA+LRTRCPK
Sbjct  180   KFKLKGLDLVDLVALSGSHTIGNARCTSFRQRLYNQSGNNLPDYTLDQSYAAQLRTRCPK  239

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF +DFV+PT+FDN+YFKNLLA +GL NSDQVLVTK+ A+L+LVK YAEN+E+F
Sbjct  240   SGGDQNLFVMDFVSPTKFDNNYFKNLLASRGLFNSDQVLVTKNQATLELVKLYAENNEIF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             F+ FAKS+VKMGNISPLTG+ GEIRKNCR +N+
Sbjct  300   FEQFAKSIVKMGNISPLTGYRGEIRKNCRMMNY  332



>ref|XP_002521512.1| Peroxidase 72 precursor, putative [Ricinus communis]
 gb|EEF40783.1| Peroxidase 72 precursor, putative [Ricinus communis]
Length=331

 Score =   497 bits (1280),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 276/331 (83%), Positives = 300/331 (91%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S  F+ + LL SA LCLC KS GGYLYPQFYD SCP AQ+IV+SVVAKAVAKE R
Sbjct  1     MAQCMS-LFLVLTLLGSAPLCLCWKSNGGYLYPQFYDHSCPNAQQIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDASILLDSSGSI SEK SNPNRNSARGFEVIDEIKAA+E EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASILLDSSGSIISEKGSNPNRNSARGFEVIDEIKAAIEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTK
Sbjct  120   PETVSCADILALAARDSTVLAGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             +KLQGL++VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDYTLDQSYAA+LRT CP+S
Sbjct  180   YKLQGLNVVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYTLDQSYAAQLRTNCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDF +PT+FDNSYFKNLLA KGLLNSDQVL+TK+ AS++LVK YAEN+ELFF
Sbjct  240   GGDQNLFFLDFASPTKFDNSYFKNLLASKGLLNSDQVLLTKNEASMELVKNYAENNELFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FAKSM+KMGNISP TG  GE+RKNCRKIN
Sbjct  300   EQFAKSMIKMGNISPFTGSRGEVRKNCRKIN  330



>ref|XP_007046814.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX90971.1| Peroxidase superfamily protein [Theobroma cacao]
Length=333

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 269/327 (82%), Positives = 292/327 (89%), Gaps = 1/327 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSY-GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLL  1097
             F + ++LL  A LCLC K+  GGYLYPQFYD SCP+AQEIV+ +VAKAVAKE RMAASLL
Sbjct  7     FIIVLSLLAIAPLCLCGKTIAGGYLYPQFYDHSCPKAQEIVKYIVAKAVAKEARMAASLL  66

Query  1096  RLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSC  917
             RLHFHDCFVKGCDASILLDSS +I SEKRSNPNR+SARGFEVIDEIKAALE  CPHTVSC
Sbjct  67    RLHFHDCFVKGCDASILLDSSRTIISEKRSNPNRDSARGFEVIDEIKAALEKACPHTVSC  126

Query  916   ADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGL  737
             ADI+ALAARDSTVL GGPNWEVPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFK QGL
Sbjct  127   ADIMALAARDSTVLTGGPNWEVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKRQGL  186

Query  736   DLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTL  557
             ++VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDYTLDQSYAA+LRT CP+SGGDQ L
Sbjct  187   NIVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYTLDQSYAAQLRTNCPRSGGDQNL  246

Query  556   FHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKS  377
             F LDFV+P +FDNSYFKNLL+YKGLLNSDQVL TKSA S +LVK YA N ELFFQ FAKS
Sbjct  247   FFLDFVSPIKFDNSYFKNLLSYKGLLNSDQVLFTKSAVSRELVKKYAYNQELFFQQFAKS  306

Query  376   MVKMGNISPLTGFSGEIRKNCRKINHY  296
             M+KMGNISPLTG+ GE+RKNCRK+N Y
Sbjct  307   MIKMGNISPLTGYRGEVRKNCRKVNAY  333



>ref|XP_010252386.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=332

 Score =   496 bits (1276),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 269/326 (83%), Positives = 292/326 (90%), Gaps = 0/326 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F M + LL     C   K+ GGYLYPQFYD SCP+AQEIV+S+VAKAVA+E RMAASLLR
Sbjct  7     FLMVLLLLAFTPFCFSHKTSGGYLYPQFYDYSCPKAQEIVKSIVAKAVAREARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLD+SGSI SEKRSNPNRNS RGFEVIDEIK ALE ECPHTVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDNSGSIISEKRSNPNRNSVRGFEVIDEIKYALEKECPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVLAGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKLQGL+
Sbjct  127   DILALAARDSTVLAGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLN  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDY+LDQSYA +LR+RCP+SGGDQ LF
Sbjct  187   IVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYSLDQSYAMQLRSRCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFVTPT+FDN YFKN+LA KGLLNSDQVL TKS AS++LVK YAEN+ELFF+ FAKSM
Sbjct  247   FLDFVTPTKFDNHYFKNILASKGLLNSDQVLFTKSKASMELVKKYAENNELFFEQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKINHY  296
             VKMGNISPLTG  GEIRKNCR+IN Y
Sbjct  307   VKMGNISPLTGSKGEIRKNCRRINSY  332



>ref|XP_009793693.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=331

 Score =   496 bits (1276),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 269/324 (83%), Positives = 295/324 (91%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             FFM I LL  A +C  +K+YGGYL+PQFYD+SCP+A+EIV+ +VAKAVAKE RMAASLLR
Sbjct  7     FFMVIVLLAFAPICFSTKTYGGYLFPQFYDQSCPQAKEIVKFIVAKAVAKEARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDSSGSI SEKRSNPNRNSARGFEVIDEIK ALE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDSSGSIISEKRSNPNRNSARGFEVIDEIKKALEKECPQTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GGPNWEVPLGRRDSRG S+SGSNNNIPAPNNTF TILT+FKL+GLD
Sbjct  127   DILALAARDSTVLVGGPNWEVPLGRRDSRGASISGSNNNIPAPNNTFNTILTQFKLKGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SF+QRLYNQ+GNS PD+TL+QSYAA+LRT+CP+SGGDQ LF
Sbjct  187   IVDLVALSGSHTIGNARCTSFKQRLYNQSGNSKPDFTLEQSYAAQLRTKCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+FDNSYFKNLLA KGLLNSDQVLVTK+  SL LVK YAEN+ LFF+ FAKSM
Sbjct  247   FLDFVSPTKFDNSYFKNLLASKGLLNSDQVLVTKNQESLNLVKQYAENNGLFFEQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNISPLTG  GEIRKNCRKIN
Sbjct  307   VKMGNISPLTGSRGEIRKNCRKIN  330



>ref|XP_010252387.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=332

 Score =   494 bits (1272),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 269/326 (83%), Positives = 293/326 (90%), Gaps = 0/326 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F M + LL  A  C   K  GGYLYPQFYD SCPRAQEIV+S+VAKAVA+E RMAASLLR
Sbjct  7     FLMVLLLLSFASFCFSHKINGGYLYPQFYDYSCPRAQEIVKSIVAKAVAREARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDSSGSI+SEKRSNPNRNS RGFEVIDEIK+ALE ECPHTVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDSSGSITSEKRSNPNRNSVRGFEVIDEIKSALEKECPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVLAGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKLQGL+
Sbjct  127   DILALAARDSTVLAGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLN  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDY+LDQSYA +LR+RCP+SGGDQ LF
Sbjct  187   IVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYSLDQSYAMQLRSRCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFVTPT+FDN YFKN+LA KGLLNSDQVL TKS AS++LVK Y+EN+ELFF+ FAKSM
Sbjct  247   FLDFVTPTKFDNHYFKNILASKGLLNSDQVLFTKSKASMELVKKYSENNELFFEQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKINHY  296
             VKMGN+SPLT   GEIRKNCR+IN Y
Sbjct  307   VKMGNVSPLTDSKGEIRKNCRRINSY  332



>ref|XP_009762369.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=330

 Score =   493 bits (1270),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 270/331 (82%), Positives = 295/331 (89%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S FF+ I LL  A LC  +K+ GG LYPQ+Y RSCP+AQEIV+SVVAK+VAKE R
Sbjct  1     MAQSMSFFFL-IGLLAFAPLCFSAKTSGGSLYPQYYYRSCPKAQEIVKSVVAKSVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSS  I +EKRSNPNRNSARGFEVIDEIK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEKRSNPNRNSARGFEVIDEIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNN+IP+PNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNDIPSPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGL LVDLVALSGSHTIGN+RC SFRQRLYNQ+GNS PD TLDQSYAA+L  RCP+S
Sbjct  180   FKRQGLGLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNSQPDSTLDQSYAAQLHNRCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFKNLLA KGLLNSDQVL+TKS ASL LVK YAEN+ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLNSDQVLITKSQASLALVKQYAENNALFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             +HFAKSMVKMGNISPLTG +GEIRKNCRK+N
Sbjct  300   EHFAKSMVKMGNISPLTGSTGEIRKNCRKMN  330



>gb|ACI22425.1| pericarp peroxidase 3 [Litchi chinensis]
Length=332

 Score =   493 bits (1268),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 271/331 (82%), Positives = 296/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ VS     ++L+  A LC  +K   GYL+PQFYD SCP+A +IV+SVVAKAVAKE R
Sbjct  1     MARSVSFLLFVVSLIAFAPLCFSAKHNDGYLFPQFYDHSCPKALQIVKSVVAKAVAKEAR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSSG+I SEKRSNPNRNSARGFEV+DEIK+ALE EC
Sbjct  61    MAASLLRLHFHDCFVKGCDASLLLDSSGTIISEKRSNPNRNSARGFEVLDEIKSALEKEC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILALAARDSTVLAGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTK
Sbjct  121   PHTVSCADILALAARDSTVLAGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLD+VDLVALSGSHTIGN+RC SFRQRLYNQ+GN  PD TLDQSYAA+LRTRCP+S
Sbjct  181   FKLQGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGQPDLTLDQSYAAQLRTRCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYF+NLLA KGLLNSDQVLVTKS  S+ LVK YA ++ELFF
Sbjct  241   GGDQILFFLDFVSPTKFDNSYFENLLASKGLLNSDQVLVTKSKESMDLVKKYAAHNELFF  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             Q FAKSMVKMGNISPLTG  GEIRKNCRKIN
Sbjct  301   QQFAKSMVKMGNISPLTGSKGEIRKNCRKIN  331



>ref|XP_006425607.1| hypothetical protein CICLE_v10026054mg [Citrus clementina]
 gb|ESR38847.1| hypothetical protein CICLE_v10026054mg [Citrus clementina]
Length=330

 Score =   492 bits (1266),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 269/324 (83%), Positives = 292/324 (90%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F +A +LL  A LC C KS  GYLYPQFYD SCP+AQEIV+ +VAKAVAKE RMAASLLR
Sbjct  7     FLIAFSLLAFAPLCFCGKSSSGYLYPQFYDHSCPKAQEIVKCIVAKAVAKETRMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDASILLDSSGSI SEKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GGP+WEVPLGRRDS+G SLSGSNN+IPAPNNTFQTILTKFKLQGLD
Sbjct  127   DILALAARDSTVLTGGPSWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PD TLDQSYAA+LR  CP+SGGDQ LF
Sbjct  187   IVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDNTLDQSYAAQLRIGCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+FDNSYFKN+LA KGLLNSDQVL TK+ AS++LVK YAEN++LFFQ FAKSM
Sbjct  247   FLDFVSPTKFDNSYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNISPLTG  GEIR+NCR+IN
Sbjct  307   VKMGNISPLTGNRGEIRRNCRRIN  330



>ref|XP_006466861.1| PREDICTED: peroxidase 72-like [Citrus sinensis]
Length=330

 Score =   491 bits (1265),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 268/324 (83%), Positives = 292/324 (90%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F +A +LL  A LC C KS  GYLYPQFYD SCP+AQEIV+ +VAKAVAKE RMAASLLR
Sbjct  7     FLIAFSLLAFAPLCFCGKSSSGYLYPQFYDHSCPKAQEIVKCIVAKAVAKETRMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDASILLD+SGSI SEKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASILLDNSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GGP+WEVPLGRRDS+G SLSGSNN+IPAPNNTFQTILTKFKLQGLD
Sbjct  127   DILALAARDSTVLTGGPSWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PD TLDQSYAA+LR  CP+SGGDQ LF
Sbjct  187   IVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDNTLDQSYAAQLRIGCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+FDNSYFKN+LA KGLLNSDQVL TK+ AS++LVK YAEN++LFFQ FAKSM
Sbjct  247   FLDFVSPTKFDNSYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNISPLTG  GEIR+NCR+IN
Sbjct  307   VKMGNISPLTGNRGEIRRNCRRIN  330



>gb|KDO71031.1| hypothetical protein CISIN_1g020149mg [Citrus sinensis]
Length=330

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 268/324 (83%), Positives = 292/324 (90%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F +A +LL  A LC C KS  GYLYPQFYD SCP+AQEIV+ +VAKAVAKE RMAASLLR
Sbjct  7     FLIAFSLLAFAPLCFCGKSSSGYLYPQFYDHSCPKAQEIVQCIVAKAVAKETRMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDASILLDSSGSI SEKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GGP+WEVPLGRRDS+G SLSGSNN+IPAPNNTFQTILTKFKLQGLD
Sbjct  127   DILALAARDSTVLTGGPSWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PD TLD+SYAA+LR  CP+SGGDQ LF
Sbjct  187   IVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDNTLDESYAAQLRMGCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+FDNSYFKN+LA KGLLNSDQVL TK+ AS++LVK YAEN++LFFQ FAKSM
Sbjct  247   FLDFVSPTKFDNSYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNISPLTG  GEIR+NCR+IN
Sbjct  307   VKMGNISPLTGNRGEIRRNCRRIN  330



>gb|KHG08031.1| Peroxidase 72 -like protein [Gossypium arboreum]
 gb|KHG19534.1| Peroxidase 72 -like protein [Gossypium arboreum]
Length=334

 Score =   491 bits (1263),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 268/328 (82%), Positives = 289/328 (88%), Gaps = 2/328 (1%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGG--YLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASL  1100
             F   ++LL    LCL  K YGG  YLYPQFYD SCP+AQEIV+  VAKAVA++PRMAASL
Sbjct  7     FITVLSLLAIVPLCLSGKIYGGGGYLYPQFYDHSCPKAQEIVKHFVAKAVAEDPRMAASL  66

Query  1099  LRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVS  920
             LRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNR+SARGFEVIDEIKAA+E ECPHTVS
Sbjct  67    LRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFEVIDEIKAAIEKECPHTVS  126

Query  919   CADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQG  740
             CADI+ALAARDSTVL GGPNW+VPLGRRDSR  SLSGSNNNIPAPNNTFQTILTKFKLQG
Sbjct  127   CADIMALAARDSTVLTGGPNWDVPLGRRDSRDASLSGSNNNIPAPNNTFQTILTKFKLQG  186

Query  739   LDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQT  560
             LD+VDLVALSGSHTIGNARC SFRQRLYNQ GN  PDYTLDQSYAA LRT CPKSGGDQ 
Sbjct  187   LDIVDLVALSGSHTIGNARCTSFRQRLYNQAGNGKPDYTLDQSYAAHLRTHCPKSGGDQN  246

Query  559   LFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAK  380
             LF LDFV+P +FDNSYFKNLLAYKGLL+SD+VL TK+A S +LVK YA N ELFFQ FAK
Sbjct  247   LFFLDFVSPVKFDNSYFKNLLAYKGLLSSDEVLFTKNAESRELVKTYAYNQELFFQQFAK  306

Query  379   SMVKMGNISPLTGFSGEIRKNCRKINHY  296
             SM+KMGNISPLTG+ GEIRK CRK+N Y
Sbjct  307   SMIKMGNISPLTGYKGEIRKYCRKVNAY  334



>ref|XP_009591264.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=330

 Score =   489 bits (1260),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 271/331 (82%), Positives = 293/331 (89%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA  VS FF+ I+LL  A +C  +K+  G LYPQ+Y RSCP+AQEIV+S+VAKAVAKE R
Sbjct  1     MAWSVS-FFIFISLLVFAPICFSTKTNDGNLYPQYYYRSCPKAQEIVKSIVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSS  I +EK SNPNRNSARGFEV+DEIK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEKGSNPNRNSARGFEVLDEIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF TIL+K
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNNIPAPNNTFSTILSK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSGSHTIGN+RC SFRQRLYNQ+GNS PD TLDQSYAA+LR RCPKS
Sbjct  180   FKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNSQPDSTLDQSYAAQLRNRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFKNLLA KGLLNSDQVL TKS ASL LVK YAEN+ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLNSDQVLATKSQASLALVKQYAENNRLFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             +HFAKSMVKMGNISPLTG  GEIRKNCRK+N
Sbjct  300   EHFAKSMVKMGNISPLTGSRGEIRKNCRKMN  330



>ref|XP_011025859.1| PREDICTED: peroxidase 72 [Populus euphratica]
Length=333

 Score =   488 bits (1255),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 262/311 (84%), Positives = 289/311 (93%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K+ GGYLYPQFYDRSCP+AQEIV S+VAKAVAKE RMAASLLRLHFHDCFVKGCDA
Sbjct  22    CFCGKTNGGYLYPQFYDRSCPKAQEIVNSIVAKAVAKEARMAASLLRLHFHDCFVKGCDA  81

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             SILLDSSGSI +EKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCADI+ALAARDSTV+
Sbjct  82    SILLDSSGSIITEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADIMALAARDSTVI  141

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
             AGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKLQGL++VDLVALSGSHTI
Sbjct  142   AGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLNVVDLVALSGSHTI  201

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GNARC SFRQRLYNQ+GN  PD++L QS+AA+LR RCP+SGGDQ LF LDFV+PT+FDNS
Sbjct  202   GNARCTSFRQRLYNQSGNGKPDFSLQQSFAAQLRNRCPRSGGDQNLFFLDFVSPTKFDNS  261

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             YFKN+LA KGLL+SDQVL+TK+ AS++LVK YAEN+ELFF  FAKSMVKMGNISPLTG+ 
Sbjct  262   YFKNILASKGLLSSDQVLLTKNEASMELVKKYAENNELFFVQFAKSMVKMGNISPLTGYR  321

Query  334   GEIRKNCRKIN  302
             GEIRK+CRKIN
Sbjct  322   GEIRKSCRKIN  332



>ref|XP_009587109.1| PREDICTED: peroxidase 72 [Nicotiana tomentosiformis]
Length=331

 Score =   487 bits (1254),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 298/331 (90%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S F M I LL  A +C   K+YGGYL+PQ+YD+SCP+A+EI++ +VAKAVAKE R
Sbjct  1     MAQSLS-FLMVIVLLAFAPICFSIKTYGGYLFPQYYDQSCPQAKEIIKFIVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDC VKGCDAS+LLDSSGSI SEKRSNPNRNSARGFEVIDEIK ALE EC
Sbjct  60    MAASLLRLHFHDCLVKGCDASLLLDSSGSIISEKRSNPNRNSARGFEVIDEIKKALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSRG SLSGSNNNIPAPNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRGASLSGSNNNIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKL+GL++VDLVALSGSHTIGNARC SFRQRLYNQ+GN+ PD+TL++SYAA+LRT+CP+S
Sbjct  180   FKLKGLNIVDLVALSGSHTIGNARCTSFRQRLYNQSGNNKPDFTLEESYAAQLRTKCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFKNLLA KGLLNSDQVLVTK+  SL LVK YAEN+E FF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLNSDQVLVTKNQESLNLVKQYAENNEFFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FAKSMVKMGNISPLTG  GEIRK+CRKIN
Sbjct  300   EQFAKSMVKMGNISPLTGSRGEIRKSCRKIN  330



>gb|ABG49114.1| peroxidase [Dimocarpus longan]
Length=332

 Score =   486 bits (1252),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 270/331 (82%), Positives = 294/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+FVS     ++L+  A LC  +K   GYL+P+FYD SCP+AQ+IV+SVVAKAVAKE R
Sbjct  1     MAQFVSFLLFVVSLIAFAPLCFSAKHNNGYLFPEFYDHSCPKAQQIVKSVVAKAVAKEAR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSSGSI SEKRSNPNRNSARGFEV+D+IK+ALE EC
Sbjct  61    MAASLLRLHFHDCFVKGCDASLLLDSSGSIISEKRSNPNRNSARGFEVLDDIKSALEKEC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILALAARDSTVL GGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTK
Sbjct  121   PHTVSCADILALAARDSTVLTGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLD+VDLVALSGSHTIGN+RC SFRQRLYNQ+GN  PD TLDQSYAA+LRTRCP+S
Sbjct  181   FKLQGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGQPDLTLDQSYAAQLRTRCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQTLF LDFV+ T+FDNSYFK LLA KGLLNSDQVLVTKS  SL LVK YA ++ELF 
Sbjct  241   GGDQTLFFLDFVSTTKFDNSYFKLLLASKGLLNSDQVLVTKSKESLDLVKKYAAHNELFL  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
               FAKSMVKMGNISPLTG  GEIRKNCRKIN
Sbjct  301   PQFAKSMVKMGNISPLTGSRGEIRKNCRKIN  331



>ref|XP_009771827.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=330

 Score =   485 bits (1248),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 268/324 (83%), Positives = 287/324 (89%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             FF+ IALL  A +C   KS   YLYPQ+Y RSCP+AQEIV+SVVAKAVAKE RMAASLLR
Sbjct  7     FFIFIALLAFAPICFSFKSNNDYLYPQYYYRSCPKAQEIVKSVVAKAVAKEARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDSS  I +EK SN NRNSARGFEV+DEIK+ALE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDSSRGIVTEKGSNANRNSARGFEVLDEIKSALEKECPQTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF TIL+KFK QGLD
Sbjct  127   DILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNNIPAPNNTFDTILSKFKRQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             LVDLVALSGSHTIGN+RC SFRQRLYNQ+GN+ PD TLDQSYAA+LR RCPKSGGDQ LF
Sbjct  187   LVDLVALSGSHTIGNSRCTSFRQRLYNQSGNNQPDSTLDQSYAAQLRNRCPKSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+FDNSYFKNLLA KGLLNSDQVL TKS ASL LVK YAEN+ LFF+HFAKSM
Sbjct  247   FLDFVSPTKFDNSYFKNLLASKGLLNSDQVLATKSQASLALVKQYAENNALFFEHFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNISPLTG  GEIRKNCRK+N
Sbjct  307   VKMGNISPLTGSRGEIRKNCRKMN  330



>ref|XP_006343385.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=333

 Score =   485 bits (1248),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 266/333 (80%), Positives = 299/333 (90%), Gaps = 2/333 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALL-YSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK +S F M  ++L ++  LCL SK+ Y GYLYPQFYD SCP A+EIV+SVVAKAVA+E
Sbjct  1     MAKILSLFIMVTSILAFAPILCLSSKTNYYGYLYPQFYDWSCPNAKEIVKSVVAKAVARE  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASLLRLHFHDCFVKGCDAS+LLDSSG+I SEK SN NRNSARGFEVIDEIK+ALE 
Sbjct  61    ARMAASLLRLHFHDCFVKGCDASLLLDSSGTIISEKLSNTNRNSARGFEVIDEIKSALEM  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTVLAGGP+WEVPLGRRDSR  S+SGSNNNIPAPNNTF TIL
Sbjct  121   ECPQTVSCADILALAARDSTVLAGGPSWEVPLGRRDSRDASISGSNNNIPAPNNTFNTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKF L+GLDLVDLVALSGSHTIGNARC SF+QRLYNQ+GN+LPDYTLDQSYAA+L T CP
Sbjct  181   TKFNLKGLDLVDLVALSGSHTIGNARCTSFKQRLYNQSGNNLPDYTLDQSYAAQLSTMCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             K GGDQ LF LD+VTPT+FDN+Y+KNLLA +GLLNSDQ+LVTK+ A+L+LVK YAEN+E+
Sbjct  241   KFGGDQNLFFLDYVTPTKFDNNYYKNLLASRGLLNSDQILVTKNQATLELVKLYAENNEI  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FF+HFAKSMVKMGNISPLTG+ GEIRKNCR +N
Sbjct  301   FFEHFAKSMVKMGNISPLTGYKGEIRKNCRYMN  333



>ref|XP_009346064.1| PREDICTED: peroxidase 72-like [Pyrus x bretschneideri]
Length=331

 Score =   484 bits (1247),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 261/312 (84%), Positives = 287/312 (92%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LC C K+ GGYLYPQFYDRSCPRA+EIV+SVVAKAVA+E RMAASLLRLHFHDCFVKGCD
Sbjct  19    LCFCDKTPGGYLYPQFYDRSCPRAKEIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS +I +EKRS PN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTV
Sbjct  79    ASLLLDSSQNIITEKRSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGPNWEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKL+ LD+VDLVALSGSHT
Sbjct  139   LTGGPNWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN L D+TLDQSYAA+LRTRCP+SGGDQ LF +DFV+PT+FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQNLFVMDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             +YFKNLLA KGLLNSD+VLVTKS  S QLV+ YAEN+ELFF+ FAKSMVKMGNISP+TG 
Sbjct  259   NYFKNLLASKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFKQFAKSMVKMGNISPITGS  318

Query  337   SGEIRKNCRKIN  302
              GEIRK+CRK+N
Sbjct  319   RGEIRKSCRKVN  330



>ref|XP_004234547.1| PREDICTED: peroxidase 72 [Solanum lycopersicum]
Length=333

 Score =   484 bits (1246),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 265/333 (80%), Positives = 294/333 (88%), Gaps = 2/333 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALL-YSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK +S F M  +LL +S  LCL SK+ Y GYLYPQFYD SCP A+EIV+SVVAKAV +E
Sbjct  1     MAKILSLFIMVTSLLVFSPTLCLSSKTNYYGYLYPQFYDWSCPNAKEIVKSVVAKAVTRE  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASLLRLHFHDCFVKGCD S+LLDS+G I SEK SN NRNSARGFEVIDEIK+ALE 
Sbjct  61    ARMAASLLRLHFHDCFVKGCDVSLLLDSNGPIISEKLSNTNRNSARGFEVIDEIKSALEM  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTVLAGGP+WEVPLGRRDSR  S+SGSNNNIPAPNNTF TIL
Sbjct  121   ECPQTVSCADILALAARDSTVLAGGPSWEVPLGRRDSRDASISGSNNNIPAPNNTFDTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFKL+GLDLVDLV LSGSHTIGNARC SF+QRLYNQ+GN+LPDYTLDQSYA ELRT CP
Sbjct  181   TKFKLKGLDLVDLVTLSGSHTIGNARCTSFKQRLYNQSGNNLPDYTLDQSYATELRTMCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             K GGDQ LF LD+VTPT+FDN+Y+KNLLA +GLLNSDQ+LVTK+ A+L+LVK YAEN+E+
Sbjct  241   KFGGDQNLFFLDYVTPTKFDNNYYKNLLASRGLLNSDQILVTKNQATLELVKLYAENNEI  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FF  FAKSMVKMGNISPLTG+ GEIRKNCR +N
Sbjct  301   FFDQFAKSMVKMGNISPLTGYKGEIRKNCRYMN  333



>ref|XP_006340671.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=332

 Score =   483 bits (1244),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 270/331 (82%), Positives = 292/331 (88%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S FF+ +ALL  A +C   KS    LYPQ+Y +SCP+AQEIV+SVVAKAVAKE R
Sbjct  1     MAQSTS-FFVLVALLVFAPICFSFKSDNDNLYPQYYYKSCPQAQEIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDS GSI +EKRSNPNRNSARGF+VID+IK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSRGSIVTEKRSNPNRNSARGFDVIDDIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNN+IPAPNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNDIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLD+VDLVALSGSHTIGN+RCVSFRQRLYNQ+GNS PD TLD+SYAA+LR RCPKS
Sbjct  180   FKRQGLDVVDLVALSGSHTIGNSRCVSFRQRLYNQSGNSKPDTTLDESYAAQLRNRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS ASL LVK YAEN+ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSEASLALVKQYAENNALFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              HFAKSMVKMGNISPLTG SGEIRK CRKIN
Sbjct  300   DHFAKSMVKMGNISPLTGSSGEIRKTCRKIN  330



>ref|XP_008344257.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   483 bits (1243),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 261/312 (84%), Positives = 286/312 (92%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LC C K+ GGYLYPQFYDRSCPRA+EIV+SVVAKAVA+E RMAASLLRLHFHDCFVKGCD
Sbjct  19    LCFCXKTPGGYLYPQFYDRSCPRAKEIVKSVVAKAVARETRMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS +I +EKRS PN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTV
Sbjct  79    ASLLLDSSQNIITEKRSVPNQNSARGFEVIDEIKSALEXECPSTVSCADILALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGPNW VPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKL+ LD+VDLVALSGSHT
Sbjct  139   LTGGPNWXVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN L D+TLDQSYAA+LRTRCP+SGGDQ LF +DFV+PT+FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQNLFVMDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLA KGLLNSD+VLVTKS  S QLV+ YAEN+ELFF+ FAKSMVKMGNISP+TG 
Sbjct  259   SYFKNLLAIKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFEQFAKSMVKMGNISPITGS  318

Query  337   SGEIRKNCRKIN  302
              GEIRK+CRK+N
Sbjct  319   RGEIRKSCRKVN  330



>ref|XP_008241745.1| PREDICTED: peroxidase 72-like [Prunus mume]
Length=336

 Score =   483 bits (1244),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 260/312 (83%), Positives = 286/312 (92%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC K+ GGYLYPQFYD SCPRA EIV+SVVAKAVA+E RMAASLLRLHFHDCFV+GCD
Sbjct  19    LCLCDKTLGGYLYPQFYDHSCPRATEIVKSVVAKAVAREARMAASLLRLHFHDCFVQGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS SI +EKRS PN+NSARGFEVIDEIK+ALE ECP+TVSCADILALAARDST 
Sbjct  79    ASVLLDSSKSIITEKRSVPNQNSARGFEVIDEIKSALEKECPNTVSCADILALAARDSTE  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L+GGPNWEVPLGRRDS+G SLSGSNNNIPAPNNTFQTILTKFK Q L++VDLVALSGSHT
Sbjct  139   LSGGPNWEVPLGRRDSKGASLSGSNNNIPAPNNTFQTILTKFKRQNLNIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN L D+TLDQSYAA+LRTRCP+SGGDQTLF LDFV+PT+FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQTLFFLDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLA KGLLNSD++L+TKS  + QLV+ YAEN+ELFF+ FAKSMVKMGNISPLTG 
Sbjct  259   SYFKNLLASKGLLNSDEILITKSQVTKQLVQQYAENTELFFEQFAKSMVKMGNISPLTGS  318

Query  337   SGEIRKNCRKIN  302
              GEIRK CRKIN
Sbjct  319   RGEIRKRCRKIN  330



>gb|AHL39156.1| class III peroxidase [Populus trichocarpa]
Length=333

 Score =   483 bits (1243),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 261/311 (84%), Positives = 286/311 (92%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K+ GGYLYPQFYDRSCP+AQEIV S+VAKAVAKE RMAASLLRLHFHDCFVKGCDA
Sbjct  22    CFCGKTSGGYLYPQFYDRSCPKAQEIVNSIVAKAVAKEARMAASLLRLHFHDCFVKGCDA  81

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             SILLDSSGSI +EK SNPNRNS RGFEVID+IK+ALE ECP TVSCADI+ALAARDSTV+
Sbjct  82    SILLDSSGSIITEKSSNPNRNSVRGFEVIDKIKSALEKECPKTVSCADIMALAARDSTVI  141

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
             AGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKLQGLD+VDLVALSGSHTI
Sbjct  142   AGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLDVVDLVALSGSHTI  201

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GNARC SFRQRLYNQ+GN  PD TL QS+AA+LRTRCP+SGGDQ LF LDFV+PT+FDNS
Sbjct  202   GNARCTSFRQRLYNQSGNGQPDSTLQQSFAAQLRTRCPRSGGDQNLFFLDFVSPTKFDNS  261

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             YF N+LA KGLL+SDQVL+TK+ AS++LVK YAEN+ELFF+ FAKSMVKMGNISPLTG  
Sbjct  262   YFNNILASKGLLSSDQVLLTKNEASMELVKKYAENNELFFEQFAKSMVKMGNISPLTGSR  321

Query  334   GEIRKNCRKIN  302
             GEIRK+CRKIN
Sbjct  322   GEIRKSCRKIN  332



>ref|XP_008337713.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   483 bits (1243),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 261/312 (84%), Positives = 286/312 (92%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LC C K+ GGYLYPQFYDRSCPRA+EIV+SVVAKAVA+E RMAASLLRLHFHDCFVKGCD
Sbjct  19    LCFCDKTPGGYLYPQFYDRSCPRAKEIVKSVVAKAVARETRMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS +I +EKRS PN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTV
Sbjct  79    ASLLLDSSQNIITEKRSVPNQNSARGFEVIDEIKSALENECPSTVSCADILALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGPNW VPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKL+ LD+VDLVALSGSHT
Sbjct  139   LTGGPNWXVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN L D+TLDQSYAA+LRTRCP+SGGDQ LF +DFV+PT+FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQNLFVMDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLA KGLLNSD+VLVTKS  S QLV+ YAEN+ELFF+ FAKSMVKMGNISP+TG 
Sbjct  259   SYFKNLLAIKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFEQFAKSMVKMGNISPITGS  318

Query  337   SGEIRKNCRKIN  302
              GEIRK+CRK+N
Sbjct  319   RGEIRKSCRKVN  330



>ref|XP_004232440.1| PREDICTED: peroxidase 72-like [Solanum lycopersicum]
Length=332

 Score =   482 bits (1241),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 269/331 (81%), Positives = 291/331 (88%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S FF+ + LL  A +C   KS    LYPQ+Y +SCP+AQEIV+SVVAKAVAKE R
Sbjct  1     MAQSTS-FFVLVTLLVFAPICFSFKSDNANLYPQYYYKSCPKAQEIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDS GSI +EKRSNPNRNSARGF+VID+IK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSRGSIVTEKRSNPNRNSARGFDVIDDIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNN+IPAPNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNDIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSGSHTIGN+RCVSFRQRLYNQ+GNS PD TLD+SYAA+LR+RCPKS
Sbjct  180   FKRQGLDLVDLVALSGSHTIGNSRCVSFRQRLYNQSGNSKPDTTLDESYAAQLRSRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS ASL LVK YAEN+ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              HFAKSMVKMGNISPLTG  GEIRK CRKIN
Sbjct  300   DHFAKSMVKMGNISPLTGSRGEIRKTCRKIN  330



>ref|XP_002310274.1| Peroxidase 49 precursor family protein [Populus trichocarpa]
 gb|EEE90724.1| Peroxidase 49 precursor family protein [Populus trichocarpa]
Length=333

 Score =   482 bits (1241),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 261/311 (84%), Positives = 285/311 (92%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K+ GGYLYPQFYDRSCP+AQEIV S+VAKAVAKE RMAASLLRLHFHDCFVKGCDA
Sbjct  22    CFCGKTSGGYLYPQFYDRSCPKAQEIVNSIVAKAVAKEARMAASLLRLHFHDCFVKGCDA  81

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             SILLDSSGSI +EK SNPNRNS RGFEVIDEIK+ALE ECP TVSCADI+ALAARDSTV+
Sbjct  82    SILLDSSGSIITEKSSNPNRNSVRGFEVIDEIKSALEKECPKTVSCADIMALAARDSTVI  141

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
             AGGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKLQGLD+VDLVALSGSHTI
Sbjct  142   AGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLDVVDLVALSGSHTI  201

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GNARC SFRQRLYNQ+GN  PD TL QS+AA+LRTRCP+SGGDQ LF LDFV+P +FDNS
Sbjct  202   GNARCTSFRQRLYNQSGNGQPDSTLQQSFAAQLRTRCPRSGGDQNLFFLDFVSPRKFDNS  261

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             YF N+LA KGLL+SDQVL+TK+ AS++LVK YAEN+ELFF+ FAKSMVKMGNISPLTG  
Sbjct  262   YFNNILASKGLLSSDQVLLTKNEASMELVKKYAENNELFFEQFAKSMVKMGNISPLTGSR  321

Query  334   GEIRKNCRKIN  302
             GEIRK+CRKIN
Sbjct  322   GEIRKSCRKIN  332



>ref|XP_010275548.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=332

 Score =   482 bits (1240),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 293/324 (90%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
               M ++LL  + LC   KS GG LYPQFYD SCPRAQ+IV+S+VAKAVAKE RMAASLLR
Sbjct  7     ILMVLSLLALSPLCFSQKSNGGDLYPQFYDHSCPRAQKIVKSIVAKAVAKELRMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDSSG+I SEKRSNPNRNSARGFEVIDEIK+ALE ECPHTVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDSSGTIISEKRSNPNRNSARGFEVIDEIKSALEKECPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVLAGGP+WEVPLGRRD+RG SLSGSNNNIPAPNNTFQTILTKFKL+GL+
Sbjct  127   DILALAARDSTVLAGGPSWEVPLGRRDARGASLSGSNNNIPAPNNTFQTILTKFKLKGLN  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDY+LDQSYAA+LRTRCP+SGGDQ LF
Sbjct  187   VVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYSLDQSYAAQLRTRCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+F+N Y+KN+L  KGLLNSDQVL+TKS AS++LVK YAEN++LFF+ FA SM
Sbjct  247   FLDFVSPTKFNNHYYKNILDSKGLLNSDQVLLTKSEASMELVKEYAENNQLFFEQFAISM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGN+SPLT   GEIRKNCR++N
Sbjct  307   VKMGNLSPLTRSKGEIRKNCRRVN  330



>gb|EYU31175.1| hypothetical protein MIMGU_mgv1a009720mg [Erythranthe guttata]
Length=333

 Score =   482 bits (1240),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 262/332 (79%), Positives = 294/332 (89%), Gaps = 1/332 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS-KSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MAK ++  F+ +ALL  A LCLC   ++GGYLYPQFYDRSCP+AQ+IV SVV+KAVA+E 
Sbjct  1     MAKSINFVFLILALLAFAPLCLCHVNTFGGYLYPQFYDRSCPQAQQIVNSVVSKAVAREA  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASL+RLHFHDCFVKGCDASILLDS+  I SEK S PN+NS RG EVIDEIK+ LE +
Sbjct  61    RMAASLVRLHFHDCFVKGCDASILLDSASGIISEKGSKPNKNSIRGLEVIDEIKSELEKQ  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CPHTVSCADI+ALAARDSTVLAGGP+W VPLGRRDS+G SLSGSNNNIPAPNNTFQTILT
Sbjct  121   CPHTVSCADIMALAARDSTVLAGGPSWVVPLGRRDSKGASLSGSNNNIPAPNNTFQTILT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKLQGLD+VDLVALSGSHTIGNARCVSFRQRLYNQ+GNS PD TLDQSYAA LRTRCPK
Sbjct  181   KFKLQGLDIVDLVALSGSHTIGNARCVSFRQRLYNQSGNSKPDPTLDQSYAATLRTRCPK  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
              GGDQ L  LD V+PT+FDNSYFKNLL++KGLL+SDQ+LVTK+  S +LVK YAE++E+F
Sbjct  241   FGGDQNLSFLDLVSPTKFDNSYFKNLLSFKGLLSSDQILVTKNQVSFELVKKYAESNEVF  300

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F+ FAKSMVKMGNISPLTGF GEIR NCRKIN
Sbjct  301   FEQFAKSMVKMGNISPLTGFKGEIRSNCRKIN  332



>emb|CDP01966.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   481 bits (1239),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 292/324 (90%), Gaps = 2/324 (1%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F +  A+L  A LCLC  + GGYLYPQFYDR+CP+A+EIV S+VAKAVA+E RMAASL+R
Sbjct  7     FLIIAAMLAFAPLCLCGMTSGGYLYPQFYDRTCPKAKEIVYSIVAKAVAREARMAASLIR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDSSG+I SEK SNPNRNSARGFEVIDEIK+ALE ECPHTVSCA
Sbjct  67    LHFHDCFVKGCDASLLLDSSGAIISEKMSNPNRNSARGFEVIDEIKSALEKECPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             D+LALAARDST  +GGP+WEVPLGRRDSRG SLSGSN+NIPAPNNTFQTILTKFKLQGLD
Sbjct  127   DLLALAARDST--SGGPSWEVPLGRRDSRGASLSGSNSNIPAPNNTFQTILTKFKLQGLD  184

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLVALSGSHTIGN+RC SFRQRLYNQ+GN  PD+TL+Q+YA +LRTRCP+SGGDQ LF
Sbjct  185   IVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGQPDFTLNQAYANQLRTRCPRSGGDQNLF  244

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFVTPT+FDNSYFKNLLA KGLLNSDQVLVTKSA SLQLVK YA+N++LFF+ F KSM
Sbjct  245   VLDFVTPTKFDNSYFKNLLASKGLLNSDQVLVTKSAVSLQLVKQYAQNNQLFFEQFPKSM  304

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             +KM NISPLTG  GEIRKNCR +N
Sbjct  305   LKMANISPLTGSKGEIRKNCRTVN  328



>ref|XP_011028580.1| PREDICTED: peroxidase 72-like [Populus euphratica]
Length=333

 Score =   481 bits (1237),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 260/332 (78%), Positives = 295/332 (89%), Gaps = 1/332 (0%)
 Frame = -1

Query  1294  MAKFVSCFF-MAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MA+ +S    + +A L  + +C C K+ GGYLYPQFYDRSCP+A+EIV S+VAKAVAKE 
Sbjct  1     MAQLISVVLVLGLAFLAFSPICFCGKTTGGYLYPQFYDRSCPKAREIVNSIVAKAVAKEA  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDASILLDS+G I SEK +NPNRNSARGFEVIDEIK+ALE E
Sbjct  61    RMAASLLRLHFHDCFVKGCDASILLDSTGRIISEKGANPNRNSARGFEVIDEIKSALEEE  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILAL+ARDSTVL GGP+WEVPLGRRDSR  SLSGSNNNIPAPNNTFQTILT
Sbjct  121   CPETVSCADILALSARDSTVLTGGPSWEVPLGRRDSRSASLSGSNNNIPAPNNTFQTILT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KF LQGL++VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PD++L QS+AA+LR RCP+
Sbjct  181   KFMLQGLNVVDLVALSGSHTIGNARCTSFRQRLYNQSGNGKPDFSLQQSFAAQLRNRCPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF LDFV+PT+FDNSYFKN+LA KGLL+SDQVL+TK+ AS++LVK YAE +ELF
Sbjct  241   SGGDQNLFFLDFVSPTKFDNSYFKNILASKGLLSSDQVLLTKNEASMELVKKYAECNELF  300

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F+ F+KSMVKMGNISPLTGF GEIRK+CRKIN
Sbjct  301   FEQFSKSMVKMGNISPLTGFRGEIRKSCRKIN  332



>ref|XP_006340672.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=332

 Score =   481 bits (1237),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 269/331 (81%), Positives = 290/331 (88%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S F + +ALL  A +C   KS    LYPQ+Y +SCP+AQEIV+SVVAKAVAKE R
Sbjct  1     MAQSTSLFVL-VALLAFAPICFSFKSDNDNLYPQYYYKSCPQAQEIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDS GSI +EKRSNPNRNSARGF+VID+IK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSRGSIVTEKRSNPNRNSARGFDVIDDIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNN+IPAPNNTF TILTK
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNDIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLD+VDLVALSGSHTIGN+RCVSFRQRLYNQ+GNS PD TLDQSYAA+LR RCPKS
Sbjct  180   FKRQGLDVVDLVALSGSHTIGNSRCVSFRQRLYNQSGNSKPDSTLDQSYAAQLRNRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS  SL LVK YAEN+ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSEESLALVKQYAENNALFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              HFAKSMVKMGNISPLTG SGEIRK CRKIN
Sbjct  300   DHFAKSMVKMGNISPLTGSSGEIRKTCRKIN  330



>gb|AAP42506.1| anionic peroxidase swpb1 [Ipomoea batatas]
Length=332

 Score =   480 bits (1236),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 261/331 (79%), Positives = 288/331 (87%), Gaps = 0/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +SCFFMAI LL  A + LC K YGG LYPQ+Y++SCPRA EIV S VAKAVAKE R
Sbjct  1     MARSISCFFMAITLLAFAPVSLCYKGYGGSLYPQYYEKSCPRALEIVRSEVAKAVAKEAR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RL FHDCFV+GCDASILLDS   I+SEK SNPNRNSARGF+VID+IKAALE EC
Sbjct  61    MAASLIRLSFHDCFVQGCDASILLDSGNGITSEKNSNPNRNSARGFDVIDDIKAALEKEC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADI+ LAARDST L+GGP WEVP+GR+DSR  SLSGSNNNIPAPN+TFQTIL +
Sbjct  121   PQTVSCADIMQLAARDSTHLSGGPFWEVPVGRKDSRSASLSGSNNNIPAPNSTFQTILNR  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSGSHTIGN+RCVSFRQRLYNQ GN+ PD TLDQ YAA+LR RCP+S
Sbjct  181   FKNQGLDLVDLVALSGSHTIGNSRCVSFRQRLYNQAGNNQPDSTLDQYYAAQLRNRCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGD  LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TK+ ASLQLVKAYAEN+ELF 
Sbjct  241   GGDSNLFFLDFVSPTKFDNSYFKLLLANKGLLNSDQVLTTKNEASLQLVKAYAENNELFL  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             QHFA SM+KM NISPLTG +GEIRKNCRKIN
Sbjct  301   QHFASSMIKMANISPLTGSNGEIRKNCRKIN  331



>ref|XP_007202348.1| hypothetical protein PRUPE_ppa008349mg [Prunus persica]
 gb|EMJ03547.1| hypothetical protein PRUPE_ppa008349mg [Prunus persica]
Length=336

 Score =   480 bits (1236),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 258/312 (83%), Positives = 285/312 (91%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LC C K+ GGYLYPQFYD SCPRA EIV+SVVAKAVA+E RMAASLLRLHFHDCFV+GCD
Sbjct  19    LCFCDKTLGGYLYPQFYDHSCPRATEIVKSVVAKAVAREARMAASLLRLHFHDCFVQGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             ASILLDSS +I +EKRS PN+NSARGFEVIDEIK+ALE ECP+ VSCADILALAARDSTV
Sbjct  79    ASILLDSSKNIITEKRSVPNQNSARGFEVIDEIKSALEKECPNRVSCADILALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L+GGPNWEVPLGRRDS+G SLSGSNNNIPAPNNTFQT+LTKFK Q L++VDLVALSGSHT
Sbjct  139   LSGGPNWEVPLGRRDSKGASLSGSNNNIPAPNNTFQTVLTKFKRQKLNIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN L D+TLDQSYAA+LRTRCP+SGGDQTLF LDFV+PT+FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQTLFFLDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLA KGLLNSD++L+TKS  + QLV+ YAEN+ELFF+ FAKSMVKMGNISPLTG 
Sbjct  259   SYFKNLLASKGLLNSDEILITKSEVTKQLVQQYAENTELFFEQFAKSMVKMGNISPLTGS  318

Query  337   SGEIRKNCRKIN  302
              GEIRK CRKIN
Sbjct  319   RGEIRKRCRKIN  330



>ref|XP_008337703.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   479 bits (1234),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 258/312 (83%), Positives = 286/312 (92%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LC C K+ GGYLYPQFYDRSCPRA+EIV+SVVAKAVA+E RMAASLLRLHFHDCFVKGCD
Sbjct  19    LCFCHKTPGGYLYPQFYDRSCPRAKEIVKSVVAKAVARETRMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             ASILLDSS ++ +EK S PN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTV
Sbjct  79    ASILLDSSQNVITEKMSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGPNWEVPLGRRDSRG SLSGSN+NIPAPNNTFQTILTKFKL+ LD+VDLVALSGSHT
Sbjct  139   LTGGPNWEVPLGRRDSRGASLSGSNSNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC +FRQRLY Q+GN L D+TLDQS+AA+LRTRCP+SGGDQ LF +DFV+PT+FDN
Sbjct  199   IGNARCTTFRQRLYIQSGNGLADFTLDQSFAAQLRTRCPRSGGDQNLFVMDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLA KGLLNSD+VLVTKS  S QLV+ YAEN+ELFF+ FAKSMVKMGNISP+TG 
Sbjct  259   SYFKNLLASKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFEQFAKSMVKMGNISPITGS  318

Query  337   SGEIRKNCRKIN  302
             SGEIRK+CRK+N
Sbjct  319   SGEIRKSCRKVN  330



>ref|XP_006383152.1| hypothetical protein POPTR_0005s12070g [Populus trichocarpa]
 gb|ERP60949.1| hypothetical protein POPTR_0005s12070g [Populus trichocarpa]
 gb|AHL39138.1| class III peroxidase [Populus trichocarpa]
Length=333

 Score =   479 bits (1233),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 260/332 (78%), Positives = 293/332 (88%), Gaps = 1/332 (0%)
 Frame = -1

Query  1294  MAKFVSCFF-MAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             M + +S    + +A L  + +C C K+ GGYLYPQFYDRSCP+A+EIV S+VAKAVAKE 
Sbjct  1     MPQLISVVLVLGLAFLAFSPICFCGKTAGGYLYPQFYDRSCPKAREIVNSIVAKAVAKEA  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDASILLDS+GSI SEK SNPNRNSARGFEVIDEIK+ALE E
Sbjct  61    RMAASLLRLHFHDCFVKGCDASILLDSTGSIISEKGSNPNRNSARGFEVIDEIKSALEKE  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADI+AL+ARDSTVL GGP+WEVPLGRRDSR  SLSGSNNNIPAPNNTFQTILT
Sbjct  121   CPKTVSCADIMALSARDSTVLTGGPSWEVPLGRRDSRSASLSGSNNNIPAPNNTFQTILT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKLQGL++VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDY+L QS AA+LR RCP+
Sbjct  181   KFKLQGLNVVDLVALSGSHTIGNARCTSFRQRLYNQSGNGKPDYSLQQSLAAQLRNRCPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF LDF +P +FDNSYFKN+LA KGLLNSDQVL+TK+ AS++LVK YAE++ELF
Sbjct  241   SGGDQNLFFLDFASPKKFDNSYFKNILASKGLLNSDQVLLTKNEASMELVKKYAESNELF  300

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F+ F+KSMVKMGNISPLTG  GEIRK+CRKIN
Sbjct  301   FEQFSKSMVKMGNISPLTGSRGEIRKSCRKIN  332



>ref|XP_009606959.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=364

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 274/358 (77%), Positives = 306/358 (85%), Gaps = 8/358 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MAK VS FFM I+LL  A +C CSKS Y GYLYPQFYD SCP+A+EIV+SVVAKAVA+E 
Sbjct  1     MAKSVS-FFMVISLLAFAPICFCSKSNYYGYLYPQFYDWSCPQAKEIVKSVVAKAVAREA  59

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDAS+LLDSSG++ SEK SN NRNSARGFEVIDEIK+ALE E
Sbjct  60    RMAASLLRLHFHDCFVKGCDASLLLDSSGTLISEKISNTNRNSARGFEVIDEIKSALEKE  119

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF TILT
Sbjct  120   CPQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRDASLSGSNNNIPAPNNTFNTILT  179

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKL+GLDLVDLVALSGSHTIGNARC SF+QRLYNQ+GN+LPDYTLDQSYAA+LRTRCPK
Sbjct  180   KFKLKGLDLVDLVALSGSHTIGNARCTSFKQRLYNQSGNNLPDYTLDQSYAAQLRTRCPK  239

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF +DFV+PT+FDN+YFKNLLA +GL NSDQVLVTK+ A+L+LVK YAEN+E+F
Sbjct  240   SGGDQNLFVMDFVSPTKFDNNYFKNLLASRGLFNSDQVLVTKNQATLKLVKLYAENNEIF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY*YDQIFFVNN----TKICVFINFH  236
             F+ FAKS+VKMGNISPLTG++        +I    YD+ F  N     TK+   I  H
Sbjct  300   FEQFAKSIVKMGNISPLTGYTTTNMIFIHEIIS--YDEKFVTNYLFSVTKVTFRIQIH  355



>ref|XP_010109912.1| Peroxidase 72 [Morus notabilis]
 gb|EXC24881.1| Peroxidase 72 [Morus notabilis]
Length=333

 Score =   477 bits (1228),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 259/333 (78%), Positives = 292/333 (88%), Gaps = 0/333 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+    F + + L     LCLC +  GGYLYPQFYD SCP+AQEIV+S+VAK VAKE R
Sbjct  1     MAQLSVSFLLVLPLFAFVPLCLCGRYQGGYLYPQFYDHSCPQAQEIVKSIVAKHVAKETR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDS+G++ SEKRSNPNRNSARGFE+IDEIK +LE EC
Sbjct  61    MAASLLRLHFHDCFVKGCDASLLLDSNGNLVSEKRSNPNRNSARGFEIIDEIKYSLEKEC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILAL ARDST L GGP +EVPLGRRDSRG+SLSGSNNNIPAPNNTFQTILTK
Sbjct  121   PHTVSCADILALVARDSTALTGGPYYEVPLGRRDSRGSSLSGSNNNIPAPNNTFQTILTK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLD+VDLVALSGSHTIGN+RC SFRQRLYNQTGN  PD+TL+QSYAA+LR++CP+S
Sbjct  181   FKLQGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQTGNGQPDFTLEQSYAAQLRSQCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+P +FDNSYFK LLA KGLL+SD+VLVT S  S QLV+ YAEN+ELFF
Sbjct  241   GGDQNLFFLDFVSPAKFDNSYFKLLLASKGLLSSDEVLVTGSQVSKQLVQKYAENNELFF  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             + FAKSM+KMGNISPLTG  GEIRK+CRKIN+Y
Sbjct  301   EQFAKSMIKMGNISPLTGSRGEIRKHCRKINNY  333



>ref|XP_003517206.1| PREDICTED: peroxidase 72-like [Glycine max]
Length=331

 Score =   476 bits (1225),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 256/311 (82%), Positives = 282/311 (91%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K  GGYLYPQFYD SCPRAQEIV+S+VAKAVAKEPRMAASLLRLHFHDCFVKGCDA
Sbjct  20    CHCKKKIGGYLYPQFYDGSCPRAQEIVQSIVAKAVAKEPRMAASLLRLHFHDCFVKGCDA  79

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             S+LLDSSG+I SEKRSNPNR+SARGFEVIDEIK+ALE ECPHTVSCADILALAARDSTVL
Sbjct  80    SVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVL  139

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
              GGP+W VPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSGSHTI
Sbjct  140   TGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTI  199

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GN+RC SFRQRLYNQTGN   D+TLDQ YAAELRTRCP+SGGDQ LF LDFVTP +FDN 
Sbjct  200   GNSRCTSFRQRLYNQTGNGKADFTLDQVYAAELRTRCPRSGGDQNLFVLDFVTPIKFDNF  259

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             Y+KNLLA KGLL+SD++L+TK+  S  LVK YAEN+++FF+ FAKSMVKMGNI+PLTG  
Sbjct  260   YYKNLLANKGLLSSDEILLTKNKVSADLVKQYAENNDIFFEQFAKSMVKMGNITPLTGSR  319

Query  334   GEIRKNCRKIN  302
             GEIRKNCR+IN
Sbjct  320   GEIRKNCRRIN  330



>ref|XP_010254703.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=328

 Score =   476 bits (1224),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 256/311 (82%), Positives = 283/311 (91%), Gaps = 1/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C +S GG L PQFYD SCP+ QEIV+SVVAKAVAKE RMAASLLRLHFHDCFVKGCDA
Sbjct  19    CFCQQSNGG-LSPQFYDHSCPKVQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDA  77

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             SILLDSSG I SEKR+NPNRNSARGFEVIDEIK+A+E ECP TVSCADIL LAARDSTVL
Sbjct  78    SILLDSSGGIISEKRANPNRNSARGFEVIDEIKSAVEKECPQTVSCADILTLAARDSTVL  137

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
             AGGP+WEVPLGRRD++  SLSGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSGSHTI
Sbjct  138   AGGPSWEVPLGRRDAKSASLSGSNNNIPAPNNTFQTILTKFKLKGLDVVDLVALSGSHTI  197

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GNARC SFRQRLYNQTGN  PDY+LDQSYAA+L+TRCP+SGGDQ LF LDFV+PT+FDN+
Sbjct  198   GNARCTSFRQRLYNQTGNGQPDYSLDQSYAAQLKTRCPRSGGDQNLFFLDFVSPTKFDNN  257

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             Y+KN+L  KGLLNSDQVL+TK+ AS+ LVK YAENS++FF+ FAKSMVKMGNISPLTG  
Sbjct  258   YYKNILVSKGLLNSDQVLLTKNEASMDLVKKYAENSQIFFEQFAKSMVKMGNISPLTGSQ  317

Query  334   GEIRKNCRKIN  302
             GEIRKNCRK+N
Sbjct  318   GEIRKNCRKVN  328



>ref|XP_010029741.1| PREDICTED: peroxidase 72 [Eucalyptus grandis]
Length=336

 Score =   476 bits (1224),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 260/325 (80%), Positives = 290/325 (89%), Gaps = 1/325 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKS-YGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLL  1097
             F +   +L  A L LC+K+ YGGYLYPQFYD SCP+AQEIV+SVVAKAVAK+PRM ASLL
Sbjct  11    FLIIFCVLALAPLGLCAKAGYGGYLYPQFYDHSCPKAQEIVKSVVAKAVAKDPRMGASLL  70

Query  1096  RLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSC  917
             RLHFHDCFVKGCDAS+LLDSSG+I SEKRS PN NSARGFEV+DEIK+ALE ECP TVSC
Sbjct  71    RLHFHDCFVKGCDASLLLDSSGTIISEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSC  130

Query  916   ADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGL  737
             AD+LALAARDSTVL GGP+W VPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKL+GL
Sbjct  131   ADLLALAARDSTVLTGGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGL  190

Query  736   DLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTL  557
             D+VDLVALSGSHTIGNARC +FRQRLYNQTGN  PD+TLDQSYAA+LRTRCP+SGGDQ L
Sbjct  191   DIVDLVALSGSHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNL  250

Query  556   FHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKS  377
             F LDFV+P +FDNSYFKNLLA KGLL+SD+VLVT+S A+LQLVK YA N ELFF+ FAKS
Sbjct  251   FFLDFVSPIKFDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKS  310

Query  376   MVKMGNISPLTGFSGEIRKNCRKIN  302
             MVKMGNI+PLTG  G+IRK CR++N
Sbjct  311   MVKMGNITPLTGSKGQIRKRCRQVN  335



>ref|XP_006590700.1| PREDICTED: peroxidase 72-like [Glycine max]
Length=331

 Score =   475 bits (1222),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 257/311 (83%), Positives = 281/311 (90%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K  GGYLYPQFYD SCPRAQEIV+S+VAKAVAKEPRMAASLLRLHFHDCFVKGCDA
Sbjct  20    CHCKKKIGGYLYPQFYDGSCPRAQEIVQSIVAKAVAKEPRMAASLLRLHFHDCFVKGCDA  79

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             S+LLDSSG+I SEKRSNPNR+SARGFEVIDEIK+ALE ECPHTVSCADILALAARDSTVL
Sbjct  80    SVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVL  139

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
              GGP+W VPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSGSHTI
Sbjct  140   TGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTI  199

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GN+RC SFRQRLYNQTGN   D+TLDQ YAAELRTRCP+SGGDQ LF LDFVTP +FDN 
Sbjct  200   GNSRCTSFRQRLYNQTGNGKADFTLDQVYAAELRTRCPRSGGDQNLFVLDFVTPIKFDNF  259

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             Y+KNLLA KGLL+SD++L+TK+  S  LVK YAEN++LFF+ FAKSMVKMGNI+PLTG  
Sbjct  260   YYKNLLANKGLLSSDEILLTKNQVSADLVKQYAENNDLFFEQFAKSMVKMGNITPLTGSR  319

Query  334   GEIRKNCRKIN  302
             GEIRKNCR IN
Sbjct  320   GEIRKNCRGIN  330



>gb|ABR23055.1| basic peroxidase swpb5 [Ipomoea batatas]
Length=336

 Score =   475 bits (1222),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 264/336 (79%), Positives = 286/336 (85%), Gaps = 3/336 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGG---YLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MA  +SCFFM I LL  A L LC + YGG    LYPQ+Y++SCP+A EIV   VAKAVAK
Sbjct  1     MAGSISCFFMVIILLAFAPLSLCYEVYGGEGGSLYPQYYEKSCPKALEIVRCEVAKAVAK  60

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASLLRL FHDCFV+GCDAS+LLDS   I+SEK SNPNRNS RGF VID+IKAALE
Sbjct  61    EARMAASLLRLSFHDCFVQGCDASLLLDSGNGITSEKNSNPNRNSVRGFNVIDDIKAALE  120

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
              ECPHTVSCADIL LAARDSTVL+GGP WEVPLGR+DSR  SLSGSNNNIPAPN+TFQTI
Sbjct  121   KECPHTVSCADILQLAARDSTVLSGGPFWEVPLGRKDSRSASLSGSNNNIPAPNSTFQTI  180

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             LTKFK QGLDLVDLVALSGSHTIGN+RCVSFRQRLYNQ GN+ PD TLD+ YAAELR RC
Sbjct  181   LTKFKRQGLDLVDLVALSGSHTIGNSRCVSFRQRLYNQAGNNKPDSTLDEYYAAELRNRC  240

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SGGD  LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TK+  SLQLVKAYAEN+E
Sbjct  241   PRSGGDSNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLSTKNEESLQLVKAYAENNE  300

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             LFFQHFA SM+KM NISPLTG  GEIRKNCRKIN Y
Sbjct  301   LFFQHFASSMIKMANISPLTGSHGEIRKNCRKINSY  336



>ref|XP_004509315.1| PREDICTED: peroxidase 72-like [Cicer arietinum]
Length=330

 Score =   474 bits (1221),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 254/323 (79%), Positives = 283/323 (88%), Gaps = 0/323 (0%)
 Frame = -1

Query  1270  FMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRL  1091
             F+ +  L  A  CLC K  G YLYPQFYD SCP+AQEIV+S++A AVAKEPR+AASLLRL
Sbjct  7     FLILLCLVFAPFCLCHKKMGSYLYPQFYDYSCPQAQEIVKSILANAVAKEPRIAASLLRL  66

Query  1090  HFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCAD  911
             HFHDCFVKGCDASILLD +G I SEK SNPNRNSARGFEVIDEIK+ALE ECPHTVSCAD
Sbjct  67    HFHDCFVKGCDASILLDGNGGIISEKGSNPNRNSARGFEVIDEIKSALEKECPHTVSCAD  126

Query  910   ILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDL  731
             IL++AARDSTVL GGPNWEVPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKLQGLD+
Sbjct  127   ILSIAARDSTVLTGGPNWEVPLGRRDSLGASLSGSNNNIPAPNNTFQTILTKFKLQGLDI  186

Query  730   VDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFH  551
             VDLVALSGSHTIGN+RC SFRQRLYNQ GN  PD+TLDQ YAAELR  CPKSGGDQ LF+
Sbjct  187   VDLVALSGSHTIGNSRCTSFRQRLYNQNGNGKPDFTLDQYYAAELRNNCPKSGGDQNLFY  246

Query  550   LDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMV  371
             LD+VTPT+FDN+YFKNLLAYKGLL+SD++L+TK+  S +LVK YAE +++FF  FAKSM+
Sbjct  247   LDYVTPTKFDNNYFKNLLAYKGLLSSDEILLTKNEESAELVKLYAERNDIFFDQFAKSMI  306

Query  370   KMGNISPLTGFSGEIRKNCRKIN  302
             KMGNISPLTG  G+IR NCR IN
Sbjct  307   KMGNISPLTGSRGQIRTNCRVIN  329



>ref|XP_004232441.1| PREDICTED: peroxidase 72-like [Solanum lycopersicum]
Length=332

 Score =   473 bits (1217),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 265/331 (80%), Positives = 288/331 (87%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S FF+ IALL  + +C   KS    LYPQ+Y +SCPRA EIV+SVVAKAVAKE R
Sbjct  1     MARSMS-FFIFIALLAFSPICFSFKSNNDKLYPQYYYKSCPRALEIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSS  I +EK SNPNRNSARGFEV+DEIK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSSNGIVTEKGSNPNRNSARGFEVLDEIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF +IL+K
Sbjct  120   PQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNNIPAPNNTFDSILSK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDL+ALSGSHTIGN+RC SFRQRLYNQ+GN+ PD TLD+SYAA+LR RCPKS
Sbjct  180   FKRQGLDLVDLIALSGSHTIGNSRCTSFRQRLYNQSGNNKPDSTLDESYAAQLRNRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS  SL LVK YAEN+ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSRESLALVKQYAENNALFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              HFAKSMVKMGNISPLTG SGEIRK CRKIN
Sbjct  300   DHFAKSMVKMGNISPLTGSSGEIRKTCRKIN  330



>gb|ABZ80408.1| class III peroxidase [Casuarina glauca]
Length=340

 Score =   472 bits (1214),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 256/332 (77%), Positives = 288/332 (87%), Gaps = 1/332 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             M++  S F + ++L   A LCL  K YGGYLYPQFY  SCP+ +EIV SVVAKAVAKE R
Sbjct  1     MSRLTS-FLVVLSLFAFAPLCLAGKKYGGYLYPQFYQHSCPKVEEIVRSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRL FHDCFVKGCDAS LLDSSG + SEKRSNPNRNSARGFEV+DEIK+A+E  C
Sbjct  60    MAASLLRLEFHDCFVKGCDASSLLDSSGVLVSEKRSNPNRNSARGFEVLDEIKSAVEKAC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILALAARDSTVL GGPNWEVPLGRRDSR  SLSGSNN+IPAPNNTFQTILTK
Sbjct  120   PHTVSCADILALAARDSTVLTGGPNWEVPLGRRDSRSASLSGSNNDIPAPNNTFQTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLD+VDLVALSGSHTIG++RC SFRQRLYNQ+GN LPD TLDQSYAA+L+TRCP+S
Sbjct  180   FKRQGLDIVDLVALSGSHTIGSSRCTSFRQRLYNQSGNGLPDMTLDQSYAAQLKTRCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQTLF LD  +PT+FD SYFKNL+AYKGLLNSD+VL T +A S +LVK YAEN ELFF
Sbjct  240   GGDQTLFFLDPPSPTKFDTSYFKNLVAYKGLLNSDEVLFTMNAESRKLVKLYAENQELFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             QHFA+SM+KM +ISPLTG  GEIR+ CR++N+
Sbjct  300   QHFAQSMIKMSSISPLTGSRGEIRRICRRVNN  331



>gb|KHG06184.1| Peroxidase 72 [Gossypium arboreum]
Length=331

 Score =   471 bits (1212),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 261/312 (84%), Positives = 280/312 (90%), Gaps = 1/312 (0%)
 Frame = -1

Query  1234  CLCSKSYGG-YLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             CL SK+ GG YLYPQFY  SCP+AQEIV +VVAKAVAKEPRMAASLLRLHFHDCFVKGCD
Sbjct  19    CLSSKTVGGGYLYPQFYGHSCPKAQEIVRNVVAKAVAKEPRMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             ASILLDSSGSI SEKRSNPNRNSARGFEVIDEIKA +E ECPHTVSCADI+ALAARDSTV
Sbjct  79    ASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKAVMEKECPHTVSCADIMALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRD+RG SLSGSNNNIPAPNNTFQTILTKFKLQGL +VDLVALSGSHT
Sbjct  139   LTGGPSWEVPLGRRDARGASLSGSNNNIPAPNNTFQTILTKFKLQGLGIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN  PD TLDQSYA++LR  CP+SGGDQ LF LDFV+P +FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGQPDNTLDQSYASQLRRNCPRSGGDQNLFFLDFVSPIKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLA KGLLNSDQVL TK+  S +LVK YA N ELFF  FAKSM+KMGNISPLTG+
Sbjct  259   SYFKNLLANKGLLNSDQVLFTKNGESRELVKTYAYNQELFFLQFAKSMIKMGNISPLTGY  318

Query  337   SGEIRKNCRKIN  302
              GEIR+NCRKIN
Sbjct  319   RGEIRQNCRKIN  330



>ref|XP_010924103.1| PREDICTED: peroxidase 72-like [Elaeis guineensis]
Length=331

 Score =   471 bits (1211),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 258/325 (79%), Positives = 285/325 (88%), Gaps = 3/325 (1%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             FF  +AL   + LC       GYLYPQFYD SCPRAQEIV+S+VAKA A+E RMAASLLR
Sbjct  10    FFSVLAL---SPLCFAHPQPNGYLYPQFYDYSCPRAQEIVKSIVAKAFAREARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDS+G+  SEKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCA
Sbjct  67    LHFHDCFVKGCDASVLLDSTGTFLSEKRSNPNRNSARGFEVIDEIKSALEEECPLTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GGP+WEV LGRRDS G SLSGSNNNIPAPNNT  TI+TKFKLQGLD
Sbjct  127   DILALAARDSTVLTGGPSWEVLLGRRDSLGPSLSGSNNNIPAPNNTLPTIITKFKLQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             LVDLVALSGSHTIG +RC SFRQRLYNQTGN LPD TLD +YAA+LRTRCP+SGGDQ LF
Sbjct  187   LVDLVALSGSHTIGQSRCTSFRQRLYNQTGNGLPDGTLDAAYAAQLRTRCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+P +FDN+Y+KNL+A+KGLL+SD+VL T SAA++QLVK YAEN+ELFF+ FAKSM
Sbjct  247   PLDFVSPIKFDNNYYKNLMAWKGLLSSDEVLFTDSAATMQLVKLYAENNELFFEQFAKSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKINH  299
             VKMGNISPLTG  GEIRKNCRKINH
Sbjct  307   VKMGNISPLTGLWGEIRKNCRKINH  331



>ref|XP_006340670.1| PREDICTED: peroxidase 49-like [Solanum tuberosum]
Length=378

 Score =   472 bits (1215),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 267/340 (79%), Positives = 290/340 (85%), Gaps = 1/340 (0%)
 Frame = -1

Query  1321  LILSTTALTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvv  1142
             L LS     MA+ +S FF+ I LL  A +C   K+    LYPQ+Y +SCP+A EIV+SVV
Sbjct  38    LNLSPFNFKMARSMS-FFIFITLLSFAPICFSFKNNNDNLYPQYYYKSCPQALEIVKSVV  96

Query  1141  akavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDE  962
             AKAVAKE RMAASLLRLHFHDCFVKGCDAS+LLDSS  I +EK SNPN+NSARGFEV+DE
Sbjct  97    AKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSNGIVTEKGSNPNKNSARGFEVLDE  156

Query  961   IKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPN  782
             IK+ALE ECP TVSCADILALAARDSTVLAGGPNWEVPLGRRDSR  SLSGSNNNIPAPN
Sbjct  157   IKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRSASLSGSNNNIPAPN  216

Query  781   NTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAA  602
             NTF +IL+KFK QGLDLVDLVALSGSHTIGN+RC SFRQRLYNQ+GN+ PD TLDQSYAA
Sbjct  217   NTFDSILSKFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNNKPDSTLDQSYAA  276

Query  601   ELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKA  422
             +LR RCPKSGGDQ LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS  SL LVK 
Sbjct  277   QLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSEESLALVKQ  336

Query  421   YAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             YAEN+ LFF HFAKSMVKMGNISPLTG SGEIRK CRKIN
Sbjct  337   YAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKTCRKIN  376



>ref|XP_008338047.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   470 bits (1210),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 255/311 (82%), Positives = 282/311 (91%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K+ GGYLY QFYD SCPRA++IV+SVVAKAVA+E RMAASLLRLHFHDCFVKGCDA
Sbjct  20    CFCDKTPGGYLYAQFYDHSCPRAKQIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDA  79

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             SILLDSS +I SEKRS PN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTVL
Sbjct  80    SILLDSSQNIISEKRSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTVL  139

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
              GGP+WEVPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKL+ L+++DLVALSGSHTI
Sbjct  140   TGGPSWEVPLGRRDSIGASLSGSNNNIPAPNNTFQTILTKFKLKKLNIIDLVALSGSHTI  199

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GNARC +FRQRLYNQ+GN L D TLDQSYAA+LRTRCP+SGGDQ LF LDFV+PT+FDNS
Sbjct  200   GNARCTTFRQRLYNQSGNGLADSTLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPTKFDNS  259

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             YFKNLLA KGLLNSD+VLVTKS  S +LV+ YAEN+ELFF+ FAKSMVKMGN+SPLTG +
Sbjct  260   YFKNLLASKGLLNSDEVLVTKSEVSKKLVRQYAENNELFFEQFAKSMVKMGNLSPLTGST  319

Query  334   GEIRKNCRKIN  302
             GEIRK CRK+N
Sbjct  320   GEIRKRCRKVN  330



>ref|XP_006340673.1| PREDICTED: peroxidase 49-like [Solanum tuberosum]
Length=332

 Score =   470 bits (1209),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 264/331 (80%), Positives = 288/331 (87%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S FF+ I LL  A +C   KS    LYPQ+Y +SCP+A EIV+SVVAKAVAKE R
Sbjct  1     MARSMS-FFIFITLLSFAPICFSFKSNNDNLYPQYYYKSCPQALEIVKSVVAKAVAKEAR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSS  I +EK SNPN+NSARGFEV+DEIK+ALE EC
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDSSNGIVTEKGSNPNKNSARGFEVLDEIKSALEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVL+GGPNWEVPLGRRDSR  SLSGSNNNIPAPNNTF +IL+K
Sbjct  120   PQTVSCADILALAARDSTVLSGGPNWEVPLGRRDSRSASLSGSNNNIPAPNNTFDSILSK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSGSHTIGN+RC SFRQRLYNQ+GN+ PD TLDQSYAA+LR RCPKS
Sbjct  180   FKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNNKPDSTLDQSYAAQLRNRCPKS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS ASL LVK YAE++ LFF
Sbjct  240   GGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAEDNALFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              HFAKSMVKMGNISPLTG SGEIRK CRKIN
Sbjct  300   DHFAKSMVKMGNISPLTGSSGEIRKTCRKIN  330



>ref|XP_008352450.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=358

 Score =   471 bits (1212),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 255/311 (82%), Positives = 282/311 (91%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C C K+ GGYLY QFYD SCPRA++IV+SVVAKAVA+E RMAASLLRLHFHDCFVKGCDA
Sbjct  47    CFCDKTPGGYLYAQFYDHSCPRAKQIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDA  106

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             SILLDSS +I SEKRS PN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTVL
Sbjct  107   SILLDSSQNIISEKRSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTVL  166

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
              GGP+WEVPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKL+ L+++DLVALSGSHTI
Sbjct  167   TGGPSWEVPLGRRDSIGASLSGSNNNIPAPNNTFQTILTKFKLKKLNIIDLVALSGSHTI  226

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             GNARC +FRQRLYNQ+GN L D TLDQSYAA+LRTRCP+SGGDQ LF LDFV+PT+FDNS
Sbjct  227   GNARCTTFRQRLYNQSGNGLADSTLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPTKFDNS  286

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             YFKNLLA KGLLNSD+VLVTKS  S +LV+ YAEN+ELFF+ FAKSMVKMGN+SPLTG +
Sbjct  287   YFKNLLASKGLLNSDEVLVTKSEVSKKLVRQYAENNELFFEQFAKSMVKMGNLSPLTGST  346

Query  334   GEIRKNCRKIN  302
             GEIRK CRK+N
Sbjct  347   GEIRKRCRKVN  357



>ref|XP_003629389.1| Peroxidase [Medicago truncatula]
 gb|AET03865.1| peroxidase family protein [Medicago truncatula]
Length=332

 Score =   470 bits (1209),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 255/316 (81%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = -1

Query  1243  AQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKG  1064
             A  CLC K  G YLYPQFYD SCP+AQ IV+S++A AVAKEPR+AASLLRLHFHDCFVKG
Sbjct  17    APFCLCHKKMGSYLYPQFYDYSCPQAQNIVKSILANAVAKEPRIAASLLRLHFHDCFVKG  76

Query  1063  CDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDS  884
             CDASILLD+SGSI SEK SNPNRNSARGFEVIDEIK ALE ECPHTVSCADILA+AARDS
Sbjct  77    CDASILLDNSGSIISEKGSNPNRNSARGFEVIDEIKYALEKECPHTVSCADILAIAARDS  136

Query  883   TVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGS  704
             TVLAGGPNWEVPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKLQGLD+VDLVALSGS
Sbjct  137   TVLAGGPNWEVPLGRRDSLGASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGS  196

Query  703   HTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRF  524
             HTIG +RC SFRQRLYNQTGN   D+TLDQ YAAELRT+CP+SGGDQ LF LD+VTPT+F
Sbjct  197   HTIGKSRCTSFRQRLYNQTGNGKQDFTLDQYYAAELRTQCPRSGGDQNLFFLDYVTPTKF  256

Query  523   DNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLT  344
             DN+YFKNLLAYKGLL+SD++L+TK+  S +LVK YAE ++LFF+ FAKSM+KMGNISPLT
Sbjct  257   DNNYFKNLLAYKGLLSSDEILLTKNQESAELVKLYAERNDLFFEQFAKSMIKMGNISPLT  316

Query  343   GFSGEIRKNCRKINHY  296
             G  G IR NCR IN +
Sbjct  317   GSRGNIRTNCRVINTW  332



>ref|XP_010484652.1| PREDICTED: peroxidase 72 [Camelina sativa]
Length=336

 Score =   470 bits (1209),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 255/334 (76%), Positives = 290/334 (87%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++ F  A++L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A++
Sbjct  1     MAKSLNIFIAALSLIALSPLCLCSKAYGTGGYLFPQFYDHSCPKAQEIVQSIVAKAFAQD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNRNSARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKQALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGLDLVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL Q YA  LR RCP
Sbjct  181   TKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLSQYYATLLRKRCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LDFVTP +FDN YFKNL+ YKGLL+SD++L TK+  S +LVK YAEN E 
Sbjct  241   RSGGDQNLFFLDFVTPFKFDNHYFKNLVMYKGLLSSDEILFTKNRESKELVKLYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAKSMVKMGNISPLTGVKGEIRRICRRVNH  334



>ref|XP_010679791.1| PREDICTED: peroxidase 72-like [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   469 bits (1207),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 252/333 (76%), Positives = 288/333 (86%), Gaps = 0/333 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+F+S F +   L ++  LC   K+  GYLYPQFYD SCP+ Q+IV+SVVAKAVA+E R
Sbjct  1     MAQFMSYFIVLALLAFAPPLCFSHKTKSGYLYPQFYDHSCPQLQQIVKSVVAKAVARERR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLD+ G I SEK SN NRNS RGFEVIDEIKAA+E  C
Sbjct  61    MAASLLRLHFHDCFVKGCDASLLLDNGGGIVSEKGSNTNRNSVRGFEVIDEIKAAVEQAC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILAL ARDSTV+ GGPNWEVPLGR+D+RG SLSGSNN+IPAPNNTF TILTK
Sbjct  121   PHTVSCADILALTARDSTVIVGGPNWEVPLGRKDARGASLSGSNNDIPAPNNTFNTILTK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSG+HTIGNARCVSFRQRLYNQ  N  PD+TL+Q+YA++LR +CP+S
Sbjct  181   FKRQGLDLVDLVALSGAHTIGNARCVSFRQRLYNQNRNGKPDFTLEQAYASQLRNQCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LD+V+P  FDNSY+KN+L+YKGLLNSDQVL+TK+ AS+QLVK YAEN ELFF
Sbjct  241   GGDQNLFFLDYVSPLNFDNSYYKNILSYKGLLNSDQVLLTKNHASMQLVKQYAENMELFF  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
              HFAKS+VKMGNISPLTG  GEIR+NCR+IN Y
Sbjct  301   DHFAKSIVKMGNISPLTGKRGEIRQNCRRINTY  333



>ref|XP_006281424.1| hypothetical protein CARUB_v10027498mg [Capsella rubella]
 gb|EOA14322.1| hypothetical protein CARUB_v10027498mg [Capsella rubella]
Length=336

 Score =   469 bits (1206),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 255/334 (76%), Positives = 288/334 (86%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++ F MA++L+  + LCLCSKSYG  GYL+PQFYD SCP+AQEIV+S+VAKA A +
Sbjct  1     MAKSLNIFVMALSLIALSPLCLCSKSYGTGGYLFPQFYDHSCPKAQEIVQSIVAKAFAND  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNRNSARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKYALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ACPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGLDLVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL Q YA  LR RCP
Sbjct  181   TKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLSQYYATLLRKRCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LDF TP +FDN YFKNL+ YKGLL+SD++L TK+  S +LVK YAEN E 
Sbjct  241   RSGGDQNLFFLDFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVKLYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAKSMVKMGNISPLTGVKGEIRRICRRVNH  334



>ref|XP_004232442.2| PREDICTED: peroxidase 49-like [Solanum lycopersicum]
Length=361

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 283/324 (87%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             FF+ I LL  A +C   KS    LYPQ+Y +SCP+AQ+IV+SVVAKAVAKE RMAASLLR
Sbjct  36    FFIFITLLSFAPICFSFKSNNDNLYPQYYYKSCPQAQQIVKSVVAKAVAKEARMAASLLR  95

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDAS+LLDSS  I +EK SNPN+NSARGFEV+DEIK+ALE ECP TVSCA
Sbjct  96    LHFHDCFVKGCDASLLLDSSRGIVTEKGSNPNKNSARGFEVLDEIKSALEKECPQTVSCA  155

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVLAGGP+WEVPLGRRDSR  SLSGSNNNIPAPNNTF +IL+KFK QGLD
Sbjct  156   DILALAARDSTVLAGGPSWEVPLGRRDSRSASLSGSNNNIPAPNNTFDSILSKFKRQGLD  215

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             LVDLVALSGSHTIGN+RC SFRQRLYNQ+GN+ PD TLDQSYA +LR RCPKSGGDQ LF
Sbjct  216   LVDLVALSGSHTIGNSRCTSFRQRLYNQSGNNKPDSTLDQSYATQLRNRCPKSGGDQNLF  275

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDFV+PT+FDNSYFK LLA KGLLNSDQVL TKS ASL LVK YAE++ LFF HFAKSM
Sbjct  276   FLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAEDNALFFDHFAKSM  335

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNISPLTG SGEIRK CRKIN
Sbjct  336   VKMGNISPLTGSSGEIRKTCRKIN  359



>gb|AAP42507.1| anionic peroxidase swpb2 [Ipomoea batatas]
Length=336

 Score =   468 bits (1204),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 265/335 (79%), Positives = 283/335 (84%), Gaps = 4/335 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG----GYLYPQFYDRSCPRAQEIVESvvakava  1127
             MA  + CFFMAI LL  A L LC K YG      LYPQ+Y++SCPRA EIV   VAKAVA
Sbjct  1     MAVSIRCFFMAITLLAFAPLSLCHKGYGGGGGSSLYPQYYEKSCPRALEIVRFEVAKAVA  60

Query  1126  KEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAAL  947
             KE RMAASLLRL FHDCFV+GCDASILLDS   I+SEK SNPNR SARGF VID+IKAAL
Sbjct  61    KEARMAASLLRLAFHDCFVQGCDASILLDSGNGITSEKNSNPNRKSARGFNVIDDIKAAL  120

Query  946   EAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQT  767
             E ECPHTVSCADI+ LAARDST L+GGP WEVPLGR+DSR  SLSGSNNNIPAPNNTFQT
Sbjct  121   EKECPHTVSCADIMQLAARDSTHLSGGPFWEVPLGRKDSRSASLSGSNNNIPAPNNTFQT  180

Query  766   ILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTR  587
             ILTKFK QGLDLVDLVALSGSHTIGN+RC SFRQRLYNQ+GNS PD TLDQ YAA+LR R
Sbjct  181   ILTKFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNSKPDSTLDQYYAAQLRNR  240

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+SGGDQ LF LDFV+P +FDNSYFK LLA KGLLNSDQVL TKS ASLQLVKAYAEN+
Sbjct  241   CPRSGGDQNLFFLDFVSPKKFDNSYFKLLLANKGLLNSDQVLTTKSEASLQLVKAYAENN  300

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             ELF QHFA SM+KM NISPLTG  GEIRKNCRKIN
Sbjct  301   ELFLQHFASSMIKMANISPLTGSKGEIRKNCRKIN  335



>ref|XP_010444803.1| PREDICTED: peroxidase 72-like [Camelina sativa]
Length=368

 Score =   469 bits (1206),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 254/334 (76%), Positives = 289/334 (87%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++ F  A++L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A++
Sbjct  33    MAKSLNMFIAALSLIALSPLCLCSKAYGTGGYLFPQFYDHSCPKAQEIVQSIVAKAFAQD  92

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNRNSARGFE+I+EIK ALE 
Sbjct  93    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKQALEQ  152

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  153   ECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  212

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGLDLVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL Q YA  LR RCP
Sbjct  213   TKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLSQYYATLLRKRCP  272

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LDFVTP +FDN YFKNL+ YKGLL+SD++L TK+  S +LV  YAEN E 
Sbjct  273   RSGGDQNLFFLDFVTPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVMLYAENQEA  332

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  333   FFEQFAKSMVKMGNISPLTGVKGEIRRICRRVNH  366



>ref|XP_007158602.1| hypothetical protein PHAVU_002G166300g [Phaseolus vulgaris]
 gb|ESW30596.1| hypothetical protein PHAVU_002G166300g [Phaseolus vulgaris]
Length=331

 Score =   466 bits (1198),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 254/312 (81%), Positives = 279/312 (89%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
              C C K   GYLYPQFYD SCPRAQEIV+SVVAKAVAKEPRMAASLLRLHFHDCFVKGCD
Sbjct  19    FCHCEKKNEGYLYPQFYDGSCPRAQEIVQSVVAKAVAKEPRMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSSG+I SEKRSNPNR+SARGFEVIDEIK+A+E EC HTVSCADILALAARDSTV
Sbjct  79    ASVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSAIEKECSHTVSCADILALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             LAGGPNWEVPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSGSHT
Sbjct  139   LAGGPNWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IG++RC SFRQRLYNQTGN   D+TLDQ YAA LRT CP+SGGDQ LF LDFVTP +FDN
Sbjct  199   IGDSRCTSFRQRLYNQTGNGKADFTLDQQYAAVLRTSCPRSGGDQNLFVLDFVTPLKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
              Y+KNLLA KGLL+SD++L+TK+  S  LV+ YAE ++LFF+ FAKSMVKMGNI+PLTG 
Sbjct  259   FYYKNLLANKGLLSSDEILLTKNQESADLVRKYAERNDLFFEQFAKSMVKMGNITPLTGS  318

Query  337   SGEIRKNCRKIN  302
              GEIRKNCRKIN
Sbjct  319   RGEIRKNCRKIN  330



>ref|XP_008452113.1| PREDICTED: peroxidase 72-like [Cucumis melo]
Length=343

 Score =   465 bits (1196),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 252/303 (83%), Positives = 278/303 (92%), Gaps = 0/303 (0%)
 Frame = -1

Query  1207  YLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgs  1028
             YLYPQFYD SCPRAQEIV+S+VAKA AKE R+AASLLRLHFHDCFVKGCD SILLDSSG+
Sbjct  40    YLYPQFYDHSCPRAQEIVKSIVAKAFAKEARIAASLLRLHFHDCFVKGCDGSILLDSSGT  99

Query  1027  isSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVP  848
             I+SEKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCADILA+AARDSTV+ GGP+WEVP
Sbjct  100   IASEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILAIAARDSTVITGGPSWEVP  159

Query  847   lgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFR  668
             LGRRDSRG SLSGSNN+IPAPNNTFQTILTKFK QGLD+VDLVALSGSHTIGN+RC SFR
Sbjct  160   LGRRDSRGASLSGSNNDIPAPNNTFQTILTKFKRQGLDIVDLVALSGSHTIGNSRCTSFR  219

Query  667   QRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYK  488
             QRLYNQ+GN+ PD +LD SYAAELR RCP+SGGDQ LF LDFV+PT+FDN YFKN+LA K
Sbjct  220   QRLYNQSGNAQPDPSLDPSYAAELRKRCPRSGGDQNLFFLDFVSPTKFDNYYFKNILAAK  279

Query  487   GLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             GLLNSD+VL+TK+  S +LV+AYAENSELFF+ FAKSMVKMGNISPLTG  GEIRKNCRK
Sbjct  280   GLLNSDEVLLTKNLQSAELVRAYAENSELFFEQFAKSMVKMGNISPLTGSRGEIRKNCRK  339

Query  307   INH  299
             +N 
Sbjct  340   VNR  342



>ref|NP_201440.1| peroxidase 72 [Arabidopsis thaliana]
 sp|Q9FJZ9.1|PER72_ARATH RecName: Full=Peroxidase 72; Short=Atperox P72; AltName: Full=ATP6a; 
AltName: Full=PRXR8; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10915.1| peroxidase [Arabidopsis thaliana]
 gb|AAP37673.1| At5g66390 [Arabidopsis thaliana]
 dbj|BAE99703.1| peroxidase [Arabidopsis thaliana]
 gb|AED98207.1| peroxidase [Arabidopsis thaliana]
Length=336

 Score =   464 bits (1194),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 251/334 (75%), Positives = 287/334 (86%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++    A++L+  +  CLCSK+YG  GYL+PQFYD+SCP+AQEIV+S+VAKA   +
Sbjct  1     MAKSLNILIAALSLIAFSPFCLCSKAYGSGGYLFPQFYDQSCPKAQEIVQSIVAKAFEHD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNRNSARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGLDLVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL Q YA  LR RCP
Sbjct  181   TKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDMTLSQYYATLLRQRCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQTLF LDF TP +FDN YFKNL+ YKGLL+SD++L TK+  S +LV+ YAEN E 
Sbjct  241   RSGGDQTLFFLDFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNKQSKELVELYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAKSMVKMGNISPLTGAKGEIRRICRRVNH  334



>ref|XP_010679794.1| PREDICTED: peroxidase 72-like [Beta vulgaris subsp. vulgaris]
Length=332

 Score =   464 bits (1194),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 256/333 (77%), Positives = 292/333 (88%), Gaps = 1/333 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MAK++S +F+ +ALL    LC   K+ GGYLYP+FYD SCP+ Q IV+SVVA AVA+E R
Sbjct  1     MAKYMS-YFIVLALLALVPLCFSHKTQGGYLYPRFYDHSCPQVQHIVKSVVANAVARERR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLD+SGSI SEK SN NRNSARGFEVIDEIKAA+E  C
Sbjct  60    MAASLLRLHFHDCFVKGCDASLLLDNSGSIVSEKGSNTNRNSARGFEVIDEIKAAVEKAC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILALAARDSTV+AGGPNWEVPLGR+D+RG SLSGSNN+IPAPNNTF TILTK
Sbjct  120   PHTVSCADILALAARDSTVIAGGPNWEVPLGRKDARGASLSGSNNDIPAPNNTFNTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLDLVDLVALSG+HTIGNARCVSFRQRLYNQ GN  PD TLD++YA++LR +CP+S
Sbjct  180   FKRQGLDLVDLVALSGAHTIGNARCVSFRQRLYNQNGNGQPDLTLDRAYASQLRNQCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LD+V+P  FDN+Y+KN+L+ KGLLNSDQVL+TK+ AS+QLVK YAEN +LFF
Sbjct  240   GGDQNLFFLDYVSPFNFDNNYYKNILSNKGLLNSDQVLLTKNPASMQLVKQYAENMQLFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
              HFAKSMVKMGNISPL G  GEIR+NCR+IN Y
Sbjct  300   DHFAKSMVKMGNISPLLGGKGEIRQNCRRINSY  332



>ref|XP_002275309.1| PREDICTED: peroxidase 72 [Vitis vinifera]
Length=332

 Score =   463 bits (1192),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 247/314 (79%), Positives = 285/314 (91%), Gaps = 0/314 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCL  K+ GGYLYPQFYD SCP+AQ+IV+SV+AKAVA+E RMAAS++RLHFHDCFVKGCD
Sbjct  19    LCLSHKTNGGYLYPQFYDHSCPKAQQIVKSVMAKAVAREVRMAASIMRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             ASILLDSSG I SEK S PNRNSARGFEVID+IK+A+E ECPHTVSC+DILA+AARDS+V
Sbjct  79    ASILLDSSGGIISEKNSVPNRNSARGFEVIDDIKSAVEKECPHTVSCSDILAIAARDSSV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFKL GL++VDLVALSGSHT
Sbjct  139   LTGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLHGLNIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGN+RC SFRQRLYNQ+GN  PDY+LDQSYAA+LRTRCP+SGGDQ LF LDFV+PT+FDN
Sbjct  199   IGNSRCTSFRQRLYNQSGNGRPDYSLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPTKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKN+LA KGLL+SDQ+L TK+ AS+ LVK YA N+++FF+ FA+SM+KM NISPLTG 
Sbjct  259   SYFKNILASKGLLSSDQLLFTKNQASMDLVKQYAANNKIFFEQFAQSMIKMANISPLTGS  318

Query  337   SGEIRKNCRKINHY  296
              GEIRKNCR++N +
Sbjct  319   RGEIRKNCRRVNGH  332



>ref|XP_004512077.1| PREDICTED: peroxidase 72-like [Cicer arietinum]
Length=331

 Score =   462 bits (1188),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 247/314 (79%), Positives = 281/314 (89%), Gaps = 0/314 (0%)
 Frame = -1

Query  1243  AQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKG  1064
             A  C C K  GGYLYPQFYD SCP+ +EIV+S+VAKAV KEPRMAASLLRLHFHDCFVKG
Sbjct  17    APFCHCKKKVGGYLYPQFYDDSCPKVEEIVKSIVAKAVTKEPRMAASLLRLHFHDCFVKG  76

Query  1063  CDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDS  884
             CDAS+LLDSSG+I SEKRSNPNRNSARGFEVIDEIK+ALE ECPHTVSCADIL LAARDS
Sbjct  77    CDASVLLDSSGTIISEKRSNPNRNSARGFEVIDEIKSALEKECPHTVSCADILTLAARDS  136

Query  883   TVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGS  704
             TVL GGP+W VPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKL+GL++VDLVALSGS
Sbjct  137   TVLTGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLNIVDLVALSGS  196

Query  703   HTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRF  524
             HTIG++RC SFRQRLYNQTGN   D+TLDQ+YAA+LRT+CP+SGGDQ LF LDFVTP +F
Sbjct  197   HTIGDSRCTSFRQRLYNQTGNGKSDFTLDQNYAAQLRTQCPRSGGDQNLFVLDFVTPVKF  256

Query  523   DNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLT  344
             DN YF+NLLA KGLL+SD++L+TK+  S  LVK YAE+++LFF+ FAKSMV++GNI+PLT
Sbjct  257   DNYYFQNLLANKGLLSSDEILLTKNQVSAALVKKYAESNDLFFEQFAKSMVRLGNITPLT  316

Query  343   GFSGEIRKNCRKIN  302
             G  GEIRK+CRKIN
Sbjct  317   GSRGEIRKHCRKIN  330



>gb|ADN96690.1| peroxidase 3 [Rubia cordifolia]
Length=331

 Score =   462 bits (1188),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 253/324 (78%), Positives = 285/324 (88%), Gaps = 1/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
              F+  +LL  A LCLC+KS GGYLYPQFYDRSCP+A EIV S+VAKAVA+E RMAASL+R
Sbjct  7     LFVVASLLAFAPLCLCAKSSGGYLYPQFYDRSCPKATEIVRSIVAKAVAEEARMAASLIR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDASILLD S  I++EKRSNPNRNSARGFEVIDEIK+ALE ECPHTVSCA
Sbjct  67    LHFHDCFVKGCDASILLDGSRKITTEKRSNPNRNSARGFEVIDEIKSALEKECPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILAL+A DSTVLAGG +WEVPLGRRDSRG SLSGSNNNIPAPNNTFQTILTKFK+QGLD
Sbjct  127   DILALSAGDSTVLAGGSSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKVQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             LVDLVALSGSHTIG+ARC SFRQRLYNQ GN  PD++L+Q+YA +LR  CP+SGGDQ LF
Sbjct  187   LVDLVALSGSHTIGDARCTSFRQRLYNQNGNGKPDFSLEQNYAGKLRQNCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              +DFV+P +FDNSYFK LLA KGLLNSDQVLVTKSAA+L LVK YA N++LFFQ F  +M
Sbjct  247   VMDFVSPAKFDNSYFKLLLASKGLLNSDQVLVTKSAAALPLVKQYAANNQLFFQCFL-NM  305

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             +KM NISPLTG  GE+R+ CR++N
Sbjct  306   IKMSNISPLTGNKGEVRRICRRVN  329



>gb|ABB45838.1| hypothetical protein [Eutrema halophilum]
Length=336

 Score =   462 bits (1188),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 251/334 (75%), Positives = 289/334 (87%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++   +A++L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A +
Sbjct  1     MAKSLNILIVALSLIAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQSIVAKAFAHD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNR+SARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFELIEEIKQALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ACPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL+Q YA  LR +CP
Sbjct  181   TKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYAYVLRKQCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             KSGGDQ LF LDFVTP +FDN YFKNL+ YKGLL+SD++L TK+  S +LVK YAEN E 
Sbjct  241   KSGGDQNLFSLDFVTPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVKLYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAKSMVKMGNISPLTGMRGEIRRICRRVNH  334



>ref|XP_010679795.1| PREDICTED: peroxidase 72-like [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   462 bits (1188),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 251/335 (75%), Positives = 288/335 (86%), Gaps = 1/335 (0%)
 Frame = -1

Query  1306  TALTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakava  1127
             + L MAK ++   + +  L  A +CL  KS GG LYPQFY  SCP+ +EIV SVVAKAVA
Sbjct  8     STLNMAKSLN-HLIVLCFLVVAPVCLSMKSQGGPLYPQFYGHSCPKVEEIVWSVVAKAVA  66

Query  1126  KEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAAL  947
             KE RMAASLLRLHFHDCFVKGCD  +LLDSSG++ SEKRSNPNRNSARGFEVIDEIKAA+
Sbjct  67    KERRMAASLLRLHFHDCFVKGCDGGVLLDSSGTLVSEKRSNPNRNSARGFEVIDEIKAAV  126

Query  946   EAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQT  767
             E ECP TVSCADILA+ ARD+TVL GGP+W VPLGRRD+   SLSGSN NIPAPNNTFQT
Sbjct  127   EKECPMTVSCADILAITARDATVLTGGPSWVVPLGRRDTLDASLSGSNYNIPAPNNTFQT  186

Query  766   ILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTR  587
             ILTKFKL+GLDLVDLVALSGSHTIG+ARC SFRQRLYNQ+GN  PD TL+Q+YA+ LRTR
Sbjct  187   ILTKFKLKGLDLVDLVALSGSHTIGDARCTSFRQRLYNQSGNGQPDNTLNQAYASVLRTR  246

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+SGGDQTLF+LD+ TP +FDNSY+KNLLAYKGLL+SDQ+LVTK+ AS+ LVK YAEN+
Sbjct  247   CPQSGGDQTLFNLDYATPFKFDNSYYKNLLAYKGLLSSDQILVTKNQASMNLVKQYAENN  306

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              LFFQHFA+SMVKMGNI+PLTG  GEIR+ CR++N
Sbjct  307   ALFFQHFAQSMVKMGNIAPLTGSRGEIRRVCRRVN  341



>ref|XP_010465558.1| PREDICTED: peroxidase 72-like isoform X1 [Camelina sativa]
 ref|XP_010465566.1| PREDICTED: peroxidase 72-like isoform X2 [Camelina sativa]
Length=336

 Score =   461 bits (1185),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 250/334 (75%), Positives = 287/334 (86%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA+ ++ F  A++L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A++
Sbjct  1     MARSLNIFIAALSLIALSPLCLCSKAYGTGGYLFPQFYDHSCPKAQEIVQSIVAKAFAQD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNR+SARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFELIEEIKQALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDST + GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTAITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGLDLVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL Q YA  LR RCP
Sbjct  181   TKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLSQYYATLLRKRCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LD VTP +FDN YFKNL+ YKGLL+SD++L TK+  S +LV  YAEN E 
Sbjct  241   RSGGDQNLFFLDLVTPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVMLYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAKSMVKMGNISPLTGVKGEIRRICRRVNH  334



>ref|XP_006393821.1| hypothetical protein EUTSA_v10004548mg [Eutrema salsugineum]
 gb|ESQ31107.1| hypothetical protein EUTSA_v10004548mg [Eutrema salsugineum]
Length=336

 Score =   461 bits (1185),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 250/334 (75%), Positives = 289/334 (87%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++   +A++L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A +
Sbjct  1     MAKSLNILIVALSLIAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQSIVAKAFAHD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNR+SARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFELIEEIKQALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ACPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL+Q YA  LR +CP
Sbjct  181   TKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYAYVLRKQCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LDFVTP +FDN YFKNL+ YKGLL+SD++L TK+  S +LVK YAEN E 
Sbjct  241   RSGGDQNLFSLDFVTPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVKLYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAKSMVKMGNISPLTGMRGEIRRICRRVNH  334



>ref|XP_003612078.1| Peroxidase [Medicago truncatula]
 gb|AES95036.1| peroxidase family protein [Medicago truncatula]
Length=331

 Score =   459 bits (1182),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 246/315 (78%), Positives = 280/315 (89%), Gaps = 0/315 (0%)
 Frame = -1

Query  1243  AQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKG  1064
             A  C C    G YLYPQFYD SCP+ +EIV+SVVAKAV KEPRMAASLLRLHFHDCFVKG
Sbjct  17    APCCHCKTKLGDYLYPQFYDESCPKVEEIVKSVVAKAVTKEPRMAASLLRLHFHDCFVKG  76

Query  1063  CDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDS  884
             CDAS+LLDSSG+I SEKRSNPNRNSARGFEVI+EIK+A+E ECP TVSCADIL LAARDS
Sbjct  77    CDASVLLDSSGTIISEKRSNPNRNSARGFEVIEEIKSAVEKECPQTVSCADILTLAARDS  136

Query  883   TVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGS  704
             TVL GGP+W+VPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKL+GL++VDLVALSGS
Sbjct  137   TVLTGGPSWDVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLNIVDLVALSGS  196

Query  703   HTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRF  524
             HTIG++RC SFRQRLYNQTGN   D+TLDQ+YAA+LRTRCP+SGGDQ LF LDFVTP +F
Sbjct  197   HTIGDSRCTSFRQRLYNQTGNGKSDFTLDQNYAAQLRTRCPRSGGDQNLFVLDFVTPVKF  256

Query  523   DNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLT  344
             DN+Y+KNLLA KGLL+SD++L+TK+  S  LVK YAE+++LFF+ FAKSMVKMGNI+PLT
Sbjct  257   DNNYYKNLLANKGLLSSDEILLTKNQVSADLVKKYAESNDLFFEQFAKSMVKMGNITPLT  316

Query  343   GFSGEIRKNCRKINH  299
             G  GEIRK CRKIN+
Sbjct  317   GSRGEIRKRCRKINN  331



>ref|XP_004287858.1| PREDICTED: peroxidase 72-like [Fragaria vesca subsp. vesca]
Length=334

 Score =   459 bits (1182),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 246/315 (78%), Positives = 278/315 (88%), Gaps = 3/315 (1%)
 Frame = -1

Query  1237  LCLC---SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVK  1067
             LC C   + ++GGYLYPQFYD SCP+AQ+IV+S+V+KAVA+E RMAASLLRLHFHDCFV+
Sbjct  19    LCFCHTNNYNHGGYLYPQFYDHSCPKAQQIVQSIVSKAVAREARMAASLLRLHFHDCFVQ  78

Query  1066  GCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARD  887
             GCDASILLDSS +I +EK SNPNRNS RG EVIDEIKAA+E ECP TVSCADI+ALAARD
Sbjct  79    GCDASILLDSSKNIITEKTSNPNRNSIRGLEVIDEIKAAIEKECPSTVSCADIVALAARD  138

Query  886   STVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSG  707
             STVLAGGP+WEVPLGRRDS+  SLSGSNN+IPAPNNTFQTILTKFK Q L++VDLVALSG
Sbjct  139   STVLAGGPHWEVPLGRRDSKSASLSGSNNDIPAPNNTFQTILTKFKRQKLNIVDLVALSG  198

Query  706   SHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTR  527
             SHTIGNARC +FRQRLYNQTG  L D+TLDQS AA LR  CP+SGGDQ LF LDFV+PT+
Sbjct  199   SHTIGNARCTTFRQRLYNQTGRGLADFTLDQSLAASLRNNCPRSGGDQNLFFLDFVSPTK  258

Query  526   FDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPL  347
             FDNSYFKNLLAYKGLLNSDQVLVTKS  + QLV+ YAEN++LF + FAKSMVKMGN+SP+
Sbjct  259   FDNSYFKNLLAYKGLLNSDQVLVTKSEVAKQLVQQYAENNQLFLEQFAKSMVKMGNLSPI  318

Query  346   TGFSGEIRKNCRKIN  302
             TG  GEIRKNCR +N
Sbjct  319   TGSRGEIRKNCRMVN  333



>ref|XP_009395537.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   459 bits (1180),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 251/332 (76%), Positives = 285/332 (86%), Gaps = 0/332 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA  +S F + +A L  + LC      G +LYPQFYD SCP+AQEIV+S+VAKAVAKE R
Sbjct  1     MALSISSFLVVLAALALSPLCFAFPYGGPFLYPQFYDHSCPKAQEIVKSIVAKAVAKEAR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDASILLDSSG+I SEK S PNRNS RGFEVIDEIK+ALE EC
Sbjct  61    MAASLLRLHFHDCFVKGCDASILLDSSGTIVSEKGSIPNRNSVRGFEVIDEIKSALEKEC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCAD+LALAARDSTVLAGGP W+VPLGRRDS G S+ GSNNNIPAPNNTFQTILTK
Sbjct  121   PHTVSCADVLALAARDSTVLAGGPYWDVPLGRRDSLGASIQGSNNNIPAPNNTFQTILTK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKL+GLDLVDLVALSGSHTIG +RC SFRQRLYNQTG   PD+TLD +YAA LRTRCP+S
Sbjct  181   FKLKGLDLVDLVALSGSHTIGLSRCTSFRQRLYNQTGKGFPDFTLDPAYAAHLRTRCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYF+NL+A  GLL+SD++L T + A++ LV+ YA ++ELFF
Sbjct  241   GGDQNLFPLDFVSPTKFDNSYFRNLMAKTGLLSSDEILFTNNPATMHLVELYAAHNELFF  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             QHFA+SMVKMGNI+PLTG  GEIR NCRK+NH
Sbjct  301   QHFARSMVKMGNITPLTGNKGEIRMNCRKLNH  332



>ref|XP_010679792.1| PREDICTED: peroxidase 72-like [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 281/314 (89%), Gaps = 1/314 (0%)
 Frame = -1

Query  1234  CLCSKSYGGY-LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             C   K+  GY LYPQFYD SCP+ Q+IV+SVVA+AV+++ RMAASLLRLHFHDCFVKGCD
Sbjct  20    CFSYKTQSGYYLYPQFYDHSCPQVQQIVKSVVAQAVSRDRRMAASLLRLHFHDCFVKGCD  79

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLD+SGSI SEK SN NRNSARGFEVIDEIKAA+E  CPHTVSCADILALAARDSTV
Sbjct  80    ASLLLDNSGSIVSEKGSNTNRNSARGFEVIDEIKAAVEKACPHTVSCADILALAARDSTV  139

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             +AGGPNWEVP+GRRD+RG SL+GSNN+IPAPNNTF TILTKFK QGLDLVDLVALSG+HT
Sbjct  140   IAGGPNWEVPVGRRDARGASLNGSNNDIPAPNNTFNTILTKFKRQGLDLVDLVALSGAHT  199

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGN+RCVSFRQRLYNQ  N  PD+TLDQ+YA++LR +CP+SGGDQ LF LD+V+P  FDN
Sbjct  200   IGNSRCVSFRQRLYNQNRNGQPDFTLDQAYASKLRNQCPRSGGDQNLFFLDYVSPFNFDN  259

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SY+KN+L+YKGLLNSDQVL+TK+ AS+QLVK YAEN ELFF HFAKSMV MGNISPLTG 
Sbjct  260   SYYKNILSYKGLLNSDQVLLTKNHASMQLVKQYAENMELFFDHFAKSMVNMGNISPLTGE  319

Query  337   SGEIRKNCRKINHY  296
              GEIR+NCR+IN+Y
Sbjct  320   RGEIRQNCRRINNY  333



>emb|CAA66964.1| peroxidase [Arabidopsis thaliana]
 emb|CAA67310.1| peroxidase ATP6a [Arabidopsis thaliana]
Length=336

 Score =   457 bits (1177),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 249/334 (75%), Positives = 285/334 (85%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK ++    A++L+  +  CLCSK+YG  GYL+PQFYD+SCP+AQEIV+S+VAKA   +
Sbjct  1     MAKSLNILIAALSLIAFSPFCLCSKAYGSGGYLFPQFYDQSCPKAQEIVQSIVAKAFEHD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLDSSG+I SEKRSNPNRNSARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEV LGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTVITGGPSWEVRLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGLDLVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL Q YA  LR RCP
Sbjct  181   TKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDMTLSQYYATLLRQRCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQTLF LDF TP +FDN YFKNL+ YKGLL+SD++L TK+  S +LV+ YAEN E 
Sbjct  241   RSGGDQTLFFLDFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNKQSKELVELYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FA SMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAISMVKMGNISPLTGAKGEIRRICRRVNH  334



>ref|XP_009112290.1| PREDICTED: peroxidase 72-like [Brassica rapa]
Length=337

 Score =   456 bits (1174),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 249/335 (74%), Positives = 290/335 (87%), Gaps = 3/335 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAI-ALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MA  ++   +A+ +L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+++VAKA A+
Sbjct  1     MAASLNILIVAVVSLIAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQTIVAKAFAQ  60

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             +PRM ASLLRLHFHDCFVKGCDASILLD+SG+I SEKRSNPNRNSARGFE+I+EIK ALE
Sbjct  61    DPRMPASLLRLHFHDCFVKGCDASILLDNSGTIISEKRSNPNRNSARGFELIEEIKRALE  120

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
              ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTI
Sbjct  121   QECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTI  180

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             LTKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL+Q YA+ LR +C
Sbjct  181   LTKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYASMLRKQC  240

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SGGDQ LF LDF TP +FDN YFKNL+ YKGLL+SD+VL TK+  S +LVK YAEN E
Sbjct  241   PRSGGDQNLFFLDFATPFKFDNHYFKNLITYKGLLSSDEVLFTKNRESRELVKLYAENQE  300

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   AFFEQFAKSMVKMGNISPLTGGRGEIRRICRRVNH  335



>ref|XP_006840851.1| hypothetical protein AMTR_s00083p00110830 [Amborella trichopoda]
 gb|ERN02526.1| hypothetical protein AMTR_s00083p00110830 [Amborella trichopoda]
Length=330

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 252/331 (76%), Positives = 285/331 (86%), Gaps = 3/331 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             M   +  F +   +L+   +C C   +GGYLYPQFYD+SCP+A EIV+SVVAKAVA+E R
Sbjct  1     MGATLKAFVILSVMLWG--ICGCF-GHGGYLYPQFYDKSCPKAPEIVKSVVAKAVAREAR  57

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSSGSI SEKRSN NRNSARGFEVIDEIK+ALE EC
Sbjct  58    MAASLLRLHFHDCFVKGCDASLLLDSSGSIISEKRSNANRNSARGFEVIDEIKSALEKEC  117

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVLAGGP+WEVPLGRRDSRG SLSGSN NIPAPN+T QT++TK
Sbjct  118   PLTVSCADILALAARDSTVLAGGPHWEVPLGRRDSRGASLSGSNRNIPAPNSTIQTLITK  177

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLD VDLVALSGSHTIG +RC SFRQRLYNQTGN  PD TLDQ YAA+LRTRCP+S
Sbjct  178   FKLQGLDTVDLVALSGSHTIGQSRCTSFRQRLYNQTGNGRPDLTLDQGYAAQLRTRCPRS  237

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGD  LF LDFV+PT FDN YFKN++A KGLLNSDQVL T+S  ++++V+ YA+N++LF 
Sbjct  238   GGDSNLFPLDFVSPTVFDNWYFKNIVASKGLLNSDQVLFTRSEKTMEIVELYAKNNQLFI  297

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             QHFA SMVKMGNISPLTG  GE+RKNCR+IN
Sbjct  298   QHFANSMVKMGNISPLTGSRGEVRKNCRRIN  328



>ref|XP_010679790.1| PREDICTED: peroxidase 72-like [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 246/333 (74%), Positives = 283/333 (85%), Gaps = 0/333 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+F+S F +   L ++  LC   K+  GYLYPQFYD SCP+ Q+IV+SVVAKAVA+E R
Sbjct  1     MAQFMSYFIVLALLAFAPPLCFSHKTKSGYLYPQFYDHSCPQLQQIVKSVVAKAVARERR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLD+ G I SEK SNPN+NS RGFEVIDEIKAA+E  C
Sbjct  61    MAASLLRLHFHDCFVKGCDASLLLDNGGGIVSEKGSNPNKNSVRGFEVIDEIKAAVEQAC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILAL ARDSTV+ GGPNWEVPLGR+D+RG SLSGSNN+IPAPNNTF TILTK
Sbjct  121   PHTVSCADILALTARDSTVIVGGPNWEVPLGRKDARGASLSGSNNDIPAPNNTFNTILTK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGL+L DLVALSG+HTIGNARCVSFRQRLYNQ  N  PD TL+  YA++LR +CP+S
Sbjct  181   FKRQGLNLGDLVALSGAHTIGNARCVSFRQRLYNQNNNGQPDVTLNHLYASKLRNQCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LD+V+P  FDNSY+KN+L+Y GLLNSDQ+L+TK+ AS++LVK YAEN ELFF
Sbjct  241   GGDQNLFFLDYVSPFNFDNSYYKNILSYNGLLNSDQILLTKNHASMKLVKQYAENMELFF  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
              HFAKSMVKMG ISPLTG  GEIR+NCR+IN Y
Sbjct  301   HHFAKSMVKMGYISPLTGKRGEIRQNCRRINTY  333



>emb|CDX81401.1| BnaC09g08120D [Brassica napus]
Length=337

 Score =   455 bits (1170),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 248/335 (74%), Positives = 290/335 (87%), Gaps = 3/335 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAI-ALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MA  ++   +A+ +L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+++VAKA A+
Sbjct  1     MAASLNILIVAVVSLIAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQTIVAKAFAQ  60

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             +PRM ASLLRLHFHDCFVKGCDASILLD+SG+I SEKRSNPNRNSARGFE+I+EIK ALE
Sbjct  61    DPRMPASLLRLHFHDCFVKGCDASILLDNSGTIISEKRSNPNRNSARGFELIEEIKHALE  120

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
              ECP TVSCADILALAARDSTV+ GGP+W+VPLGRRD+RG SLSGSNN+IPAPNNTFQTI
Sbjct  121   QECPETVSCADILALAARDSTVITGGPSWDVPLGRRDARGASLSGSNNDIPAPNNTFQTI  180

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             LTKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL+Q YA+ LR +C
Sbjct  181   LTKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYASMLRKQC  240

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SGGDQ LF LDF TP +FDN YFKNL+ YKGLL+SD+VL TK+  S +LVK YAEN E
Sbjct  241   PRSGGDQNLFFLDFATPFKFDNHYFKNLITYKGLLSSDEVLFTKNKDSRELVKLYAENQE  300

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   AFFEQFAKSMVKMGNISPLTGARGEIRRICRRVNH  335



>emb|CDY65385.1| BnaCnng46860D [Brassica napus]
Length=337

 Score =   454 bits (1167),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 248/337 (74%), Positives = 289/337 (86%), Gaps = 2/337 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSY--GGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA  ++ F +A++L+  + LCL SK+Y  G YL+PQ+YD SCP+AQEIV+S+VAKA A++
Sbjct  1     MAVSLNIFIVALSLIAFSPLCLSSKAYESGSYLFPQYYDHSCPKAQEIVQSIVAKAFAQD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLD+SG+I SEKRSNPNRNSARGFEVI+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDNSGTIISEKRSNPNRNSARGFEVIEEIKHALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL+Q Y + LR +CP
Sbjct  181   TKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYGSVLRKQCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LD VTP +FDN YFKNL+ YKGLL+SD+VL TK+  S +LV+ YAEN E 
Sbjct  241   RSGGDQNLFFLDLVTPFKFDNHYFKNLIMYKGLLSSDEVLFTKNRESKELVELYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY*Y  290
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH  Y
Sbjct  301   FFEQFAKSMVKMGNISPLTGARGEIRRICRRVNHAAY  337



>ref|XP_003612079.1| Peroxidase [Medicago truncatula]
Length=335

 Score =   453 bits (1166),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 246/319 (77%), Positives = 280/319 (88%), Gaps = 4/319 (1%)
 Frame = -1

Query  1243  AQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVK-  1067
             A  C C    G YLYPQFYD SCP+ +EIV+SVVAKAV KEPRMAASLLRLHFHDCFVK 
Sbjct  17    APCCHCKTKLGDYLYPQFYDESCPKVEEIVKSVVAKAVTKEPRMAASLLRLHFHDCFVKL  76

Query  1066  ---GCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALA  896
                GCDAS+LLDSSG+I SEKRSNPNRNSARGFEVI+EIK+A+E ECP TVSCADIL LA
Sbjct  77    ILQGCDASVLLDSSGTIISEKRSNPNRNSARGFEVIEEIKSAVEKECPQTVSCADILTLA  136

Query  895   ARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVA  716
             ARDSTVL GGP+W+VPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKL+GL++VDLVA
Sbjct  137   ARDSTVLTGGPSWDVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLNIVDLVA  196

Query  715   LSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVT  536
             LSGSHTIG++RC SFRQRLYNQTGN   D+TLDQ+YAA+LRTRCP+SGGDQ LF LDFVT
Sbjct  197   LSGSHTIGDSRCTSFRQRLYNQTGNGKSDFTLDQNYAAQLRTRCPRSGGDQNLFVLDFVT  256

Query  535   PTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNI  356
             P +FDN+Y+KNLLA KGLL+SD++L+TK+  S  LVK YAE+++LFF+ FAKSMVKMGNI
Sbjct  257   PVKFDNNYYKNLLANKGLLSSDEILLTKNQVSADLVKKYAESNDLFFEQFAKSMVKMGNI  316

Query  355   SPLTGFSGEIRKNCRKINH  299
             +PLTG  GEIRK CRKIN+
Sbjct  317   TPLTGSRGEIRKRCRKINN  335



>ref|XP_004146491.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 ref|XP_004167640.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 gb|KGN53286.1| hypothetical protein Csa_4G045010 [Cucumis sativus]
Length=342

 Score =   453 bits (1165),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -1

Query  1198  PQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisS  1019
             PQFYD SCPRAQEIV+ VVAKA AKE R+AASLLRLHFHDCFVKGCD SILLDSSG+++S
Sbjct  42    PQFYDHSCPRAQEIVKYVVAKAFAKEARIAASLLRLHFHDCFVKGCDGSILLDSSGTLAS  101

Query  1018  EKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgr  839
             EKRSNPNRNSARGFEVIDEIK+ALE ECP TVSCADILA+AARDSTV+ GGP+WEVPLGR
Sbjct  102   EKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILAIAARDSTVITGGPSWEVPLGR  161

Query  838   rdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRL  659
             RDSRG SLSGSNN+IPAPNNTFQTILTKFK QGLD+VDLVALSGSHTIGN+RC SFRQRL
Sbjct  162   RDSRGASLSGSNNDIPAPNNTFQTILTKFKRQGLDIVDLVALSGSHTIGNSRCTSFRQRL  221

Query  658   YNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLL  479
             YNQ+GN+ PD +LD SYAAELR RCP+SGGDQ LF LDFV+P +FDN YFKNLLA KGLL
Sbjct  222   YNQSGNAQPDPSLDPSYAAELRKRCPRSGGDQNLFFLDFVSPIKFDNYYFKNLLAAKGLL  281

Query  478   NSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             NSD+VL+TK+  S +LVK YAENSELFF+ FAKSMVKMGNI+PLTG  GEIRKNCRK+N 
Sbjct  282   NSDEVLLTKNLQSAELVKTYAENSELFFEQFAKSMVKMGNITPLTGSRGEIRKNCRKVNR  341



>ref|XP_009103543.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 72 [Brassica rapa]
 emb|CDY45216.1| BnaA07g12740D [Brassica napus]
Length=337

 Score =   452 bits (1164),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 249/337 (74%), Positives = 288/337 (85%), Gaps = 2/337 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA  ++    A++L+  + LCL SK+YG  GYL+PQFYD SCP+AQEIV+ +VAKA A++
Sbjct  1     MAVSLNILIAALSLIAFSPLCLSSKAYGSGGYLFPQFYDHSCPKAQEIVQLIVAKAFAQD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDASILLD+SGSI SEKRSNPNRNSARGFEVI+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASILLDNSGSIISEKRSNPNRNSARGFEVIEEIKHALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ+GN  PD TL+Q YA+ LR +CP
Sbjct  181   TKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYASVLRKQCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LD VTP +FDN YFKNL+ YKGLL+SD+VL TK+  S +LV+ YAEN E 
Sbjct  241   RSGGDQNLFFLDLVTPFKFDNHYFKNLIMYKGLLSSDEVLFTKNRESKELVELYAENQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY*Y  290
             FF+ FA+SMVKMGNISPLTG  GEIR+ CR++NH  Y
Sbjct  301   FFEQFARSMVKMGNISPLTGARGEIRRICRRVNHAAY  337



>gb|KHN00512.1| Peroxidase 72 [Glycine soja]
Length=327

 Score =   452 bits (1163),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 245/312 (79%), Positives = 272/312 (87%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC  +  GYLYPQFYD SCP+AQ IV+SV+AK VA++PR+AAS+LRLHFHDCFVKGCD
Sbjct  15    LCLCHYNQEGYLYPQFYDYSCPQAQHIVKSVLAKYVAEQPRLAASILRLHFHDCFVKGCD  74

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS SI+SEK SNPNRNSARGFEVID IKA LE +CP TVSCADIL LAARDS V
Sbjct  75    ASLLLDSSESINSEKGSNPNRNSARGFEVIDAIKAELERQCPSTVSCADILTLAARDSVV  134

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGPNWEVPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKLQGLDLVDLVALSG HT
Sbjct  135   LTGGPNWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLQGLDLVDLVALSGGHT  194

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC +FRQRLYNQ+GN  PD TLDQ YA+ LRTRCP SGGDQ LF LD+ TP +FDN
Sbjct  195   IGNARCTTFRQRLYNQSGNGEPDSTLDQYYASTLRTRCPSSGGDQNLFFLDYATPYKFDN  254

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLAYKGLL+SDQVL T +  S +LVK YAE +++FF+HFAKSM+KMGNISPLT  
Sbjct  255   SYFKNLLAYKGLLSSDQVLFTMNQESAELVKLYAERNDIFFEHFAKSMIKMGNISPLTNS  314

Query  337   SGEIRKNCRKIN  302
              GEIR+NCR+IN
Sbjct  315   RGEIRENCRRIN  326



>ref|XP_009396319.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=332

 Score =   452 bits (1163),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 245/325 (75%), Positives = 276/325 (85%), Gaps = 0/325 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F M +  L  + LC      G +L+PQFYDRSCP+A EIV+S+VAKAVAKE RMAASLLR
Sbjct  7     FLMLLTALALSPLCFAFPHGGPFLFPQFYDRSCPKAHEIVKSIVAKAVAKEARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCDASILLDSS +I SEK S PNRNS RGFEVIDEIK+ALE  CPHTVSCA
Sbjct  67    LHFHDCFVKGCDASILLDSSKTIVSEKMSVPNRNSVRGFEVIDEIKSALEKACPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GGP WEVPLGRRDS G S+ GSNN+IPAPNNT QTI+TKFKL+GLD
Sbjct  127   DILALAARDSTVLVGGPYWEVPLGRRDSLGASIQGSNNHIPAPNNTLQTIITKFKLKGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             LVDLVALSGSHTIG +RC SFRQRLYNQTGN L D+TLD +YAA LR+RCP+SGGDQ LF
Sbjct  187   LVDLVALSGSHTIGQSRCTSFRQRLYNQTGNGLADFTLDPAYAASLRSRCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LD V+PT+FDN YFKNL+A KGLL+SD++L T S A+ +LV+ YA N ELFFQHFA+SM
Sbjct  247   PLDLVSPTKFDNHYFKNLVAKKGLLSSDEILFTNSPATKKLVELYAANGELFFQHFARSM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKINH  299
             VKMGNI+PLTG  G+IRKNCRK+NH
Sbjct  307   VKMGNIAPLTGSMGQIRKNCRKVNH  331



>ref|XP_003520284.1| PREDICTED: peroxidase 72 [Glycine max]
Length=331

 Score =   452 bits (1163),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 245/312 (79%), Positives = 272/312 (87%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC  +  GYLYPQFYD SCP+AQ IV+SV+AK VA++PR+AAS+LRLHFHDCFVKGCD
Sbjct  19    LCLCHYNQEGYLYPQFYDYSCPQAQHIVKSVLAKYVAEQPRLAASILRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS SI+SEK SNPNRNSARGFEVID IKA LE +CP TVSCADIL LAARDS V
Sbjct  79    ASLLLDSSESINSEKGSNPNRNSARGFEVIDAIKAELERQCPSTVSCADILTLAARDSVV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGPNWEVPLGRRDS G S+SGSNNNIPAPNNTFQTILTKFKLQGLDLVDLVALSG HT
Sbjct  139   LTGGPNWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLQGLDLVDLVALSGGHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC +FRQRLYNQ+GN  PD TLDQ YA+ LRTRCP SGGDQ LF LD+ TP +FDN
Sbjct  199   IGNARCTTFRQRLYNQSGNGEPDSTLDQYYASTLRTRCPSSGGDQNLFFLDYATPYKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNLLAYKGLL+SDQVL T +  S +LVK YAE +++FF+HFAKSM+KMGNISPLT  
Sbjct  259   SYFKNLLAYKGLLSSDQVLFTMNQESAELVKLYAERNDIFFEHFAKSMIKMGNISPLTNS  318

Query  337   SGEIRKNCRKIN  302
              GEIR+NCR+IN
Sbjct  319   RGEIRENCRRIN  330



>ref|XP_008440774.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 49 [Cucumis melo]
Length=333

 Score =   452 bits (1162),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 246/333 (74%), Positives = 283/333 (85%), Gaps = 3/333 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGY--LYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MAK VS F   ++LL  A LC C ++ GG+  LYPQ+YD SCP+A+EIV+S++AKA A+E
Sbjct  1     MAKLVS-FVFVLSLLAFAPLCFCGRNNGGFGSLYPQYYDHSCPKAKEIVKSIMAKAFARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              R+AAS+LRLHFHDCFV+GCDAS+LLDSSG+I +EK SNPNRNSARGFEVIDEIK+ALE 
Sbjct  60    ARIAASILRLHFHDCFVQGCDASLLLDSSGNIRTEKNSNPNRNSARGFEVIDEIKSALEK  119

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP WEVPLGR+DSR  SLSGSNNNIPAPNNTFQTIL
Sbjct  120   ECPQTVSCADILALAARDSTVITGGPYWEVPLGRKDSRTASLSGSNNNIPAPNNTFQTIL  179

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
              +F+ QGLD+VDLVALSG HTIGN+RC SFRQRLYNQ GN  PD TL QS A ELR RCP
Sbjct  180   NRFQNQGLDIVDLVALSGGHTIGNSRCTSFRQRLYNQNGNGQPDKTLPQSLATELRNRCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD+V+PT+FDNSYFKNL+ +KGLLNSDQVL+T + AS  LVK YA++SE 
Sbjct  240   RSGGDNNLFSLDYVSPTKFDNSYFKNLVGFKGLLNSDQVLLTGNDASAALVKKYADDSEE  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FF+ FAKSM+KM NISPLTG SGEIRK CRKIN
Sbjct  300   FFEQFAKSMIKMSNISPLTGSSGEIRKTCRKIN  332



>gb|KFK28312.1| hypothetical protein AALP_AA8G500000 [Arabis alpina]
Length=336

 Score =   450 bits (1158),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 247/334 (74%), Positives = 285/334 (85%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             M K ++    AI+L+    LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A++
Sbjct  1     MVKSLNILIAAISLIALLPLCLCSKAYGTSGYLFPQFYDHSCPQAQEIVQSIVAKAHAQD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASL+RLHFHDCFVKGCDASILLDSSG+I SEKRSNPNR+SARGFE+I+EIK ALE 
Sbjct  61    PRMPASLIRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFELIEEIKHALEH  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDSTV+ GGP+WEVPLGRRDSRG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ACPETVSCADILALAARDSTVITGGPSWEVPLGRRDSRGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK QGL+LVDLV+LSGSHTIGN+RC SFRQRLYNQ GN  PD TL+Q YA+ LR +CP
Sbjct  181   TKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQNGNGKPDLTLNQYYASVLRQQCP  240

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LDF TP +FDN YFKNL+ YKGLL+SD++L TK+  S +LVK YA+N E 
Sbjct  241   RSGGDQNLFFLDFATPFKFDNHYFKNLIIYKGLLSSDEILFTKNRESKELVKLYAKNQEA  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FA SMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  301   FFEQFAISMVKMGNISPLTGAKGEIRRICRRVNH  334



>ref|XP_010936646.1| PREDICTED: peroxidase 72-like [Elaeis guineensis]
Length=330

 Score =   450 bits (1157),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 250/333 (75%), Positives = 283/333 (85%), Gaps = 4/333 (1%)
 Frame = -1

Query  1300  LTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             + M+   +  F  +AL+    LC  + S GGYLYPQ+YD SCP+AQEIV+SVVAKAVAKE
Sbjct  1     MAMSNNFAVIFSVLALV---PLCFAA-SGGGYLYPQYYDHSCPKAQEIVKSVVAKAVAKE  56

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASLLRLHFHDCFVKGCDAS+LLDSSGSI SEKR+NPNRNSARGFEVIDEIKAALE 
Sbjct  57    TRMAASLLRLHFHDCFVKGCDASLLLDSSGSIISEKRANPNRNSARGFEVIDEIKAALEK  116

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTVLAGGP+W VPLGRRDS G SLSGSNNNIPAPNNT  TI+
Sbjct  117   ECPQTVSCADILALAARDSTVLAGGPSWVVPLGRRDSLGASLSGSNNNIPAPNNTLPTII  176

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFKLQGLDL DLVALSG HTIG +RC SFRQRLYNQTGN L D TL+ S+A++LR+RCP
Sbjct  177   TKFKLQGLDLADLVALSGGHTIGQSRCTSFRQRLYNQTGNGLADSTLEVSFASQLRSRCP  236

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD V+PT+FDN Y+KN++A KGLLNSDQVL T++  ++ LVK YAENSEL
Sbjct  237   RSGGDNNLFPLDLVSPTKFDNYYYKNIMASKGLLNSDQVLFTRNPQTMALVKLYAENSEL  296

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F + F KSM+KMGNI+PLTG  GEIRKNCRK+N
Sbjct  297   FMEQFVKSMIKMGNITPLTGVRGEIRKNCRKVN  329



>gb|ADQ43201.1| unknown [Eutrema parvulum]
Length=335

 Score =   448 bits (1152),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 287/334 (86%), Gaps = 3/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG--GYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA  ++    A++L+  + LCLCSK+YG  GYL+PQFYD SCP+AQEIV+S+VAKA A++
Sbjct  1     MAVSLNILIAALSLVAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQSIVAKAFARD  60

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
             PRM ASLLRLHFHDCFVKGCDAS+LLDSSG+I SEKRSNPNRNSARGFE+I+EIK ALE 
Sbjct  61    PRMPASLLRLHFHDCFVKGCDASLLLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQ  120

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP TVSCADILALAARDSTV+ GGP+WEVPLGRRD+RG SLSGSNN+IPAPNNTFQTIL
Sbjct  121   ECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTIL  180

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKF  QGL+LVDLV+LS SHTIGN+RC SFRQRLYNQ+GN  PD TL+Q YA+ LR +CP
Sbjct  181   TKFMRQGLNLVDLVSLS-SHTIGNSRCTSFRQRLYNQSGNGQPDLTLNQYYASVLRKQCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGDQ LF LDFVTP +FDN YFKNL+ YKGLL+SD++L T +  S +LV+ YAEN E 
Sbjct  240   RSGGDQKLFVLDFVTPFKFDNHYFKNLITYKGLLSSDEILFTNNRESKELVELYAENQEA  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  300   FFEQFAKSMVKMGNISPLTGVRGEIRRICRRVNH  333



>ref|XP_009393610.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=330

 Score =   447 bits (1150),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 243/311 (78%), Positives = 272/311 (87%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             C  +   G YLYPQFY  SCPRAQ+IV SVVAKAVA E RMAASLLRLHFHDCFVKGCDA
Sbjct  20    CSGTSGPGAYLYPQFYQHSCPRAQDIVRSVVAKAVAMETRMAASLLRLHFHDCFVKGCDA  79

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             S+LLDSSGSI SEK SNPN+NSARGFEVIDEIK+ALE ECP TVSCADILALAARDSTVL
Sbjct  80    SLLLDSSGSIVSEKGSNPNKNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVL  139

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
              GGPNWEVPLGRRDS G SLSGSN++IPAPNNT QTI TKFK QGLD+VDLVALSGSHTI
Sbjct  140   VGGPNWEVPLGRRDSLGASLSGSNHDIPAPNNTLQTITTKFKRQGLDIVDLVALSGSHTI  199

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             G +RC SFRQRLYNQTGN + D TL+++YA +LR+RCP+SGGD  LF LD V+PT+FDN+
Sbjct  200   GLSRCTSFRQRLYNQTGNGVADSTLEEAYAWQLRSRCPRSGGDDNLFSLDRVSPTKFDNN  259

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             Y+KN++A KGLLNSDQVL+T+S  ++ LVK YAEN++LFF HFAKSMVKMGNISPLTG +
Sbjct  260   YYKNIVAGKGLLNSDQVLLTQSLETMALVKQYAENTDLFFDHFAKSMVKMGNISPLTGAT  319

Query  334   GEIRKNCRKIN  302
             GEIRKNCRK N
Sbjct  320   GEIRKNCRKTN  330



>ref|XP_010550432.1| PREDICTED: peroxidase 72 [Tarenaya hassleriana]
Length=333

 Score =   447 bits (1150),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 259/333 (78%), Positives = 288/333 (86%), Gaps = 2/333 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG-GYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MAK  SC  +    +    LCLCS++YG GYL+PQFYD SCP+AQ+IV+S+V+KA AK+P
Sbjct  1     MAK-SSCSVLFALFIAFFPLCLCSQTYGSGYLFPQFYDHSCPQAQDIVKSIVSKAFAKDP  59

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDAS+LLDSSGSI SEKRSNPNRNSARGFEVIDEIK ALE E
Sbjct  60    RMAASLLRLHFHDCFVKGCDASLLLDSSGSIVSEKRSNPNRNSARGFEVIDEIKYALEKE  119

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCAD LALAARDSTVL GGP+WEVPLGRRDS+G SLSGSNN+IPAPNNTFQTILT
Sbjct  120   CPETVSCADALALAARDSTVLTGGPSWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILT  179

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFK QGLDLVDLVALSGSHTIGN+RC SFRQRLYNQ+GN  PD TLDQSYAA LR RCP+
Sbjct  180   KFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGKPDMTLDQSYAATLRPRCPR  239

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF LDFVTPT+FDN YFKNL+ YKGLL+SD+VL TK+  S +LVK YA N + F
Sbjct  240   SGGDQNLFFLDFVTPTKFDNHYFKNLIMYKGLLSSDEVLFTKNRESKELVKLYAANEDAF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             F+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  300   FEQFAKSMVKMGNISPLTGARGEIRRVCRRVNH  332



>gb|AAF63027.1|AF244924_1 peroxidase prx15 precursor [Spinacia oleracea]
Length=334

 Score =   446 bits (1146),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 283/334 (85%), Gaps = 1/334 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSY-GGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             M K +S   + + LL  + LC C K   GGYLYPQFYD SCP+AQ+IV+SVVA+AV+++ 
Sbjct  1     MVKSMSYCIVLVVLLALSPLCFCHKVVQGGYLYPQFYDHSCPQAQQIVKSVVAQAVSRDR  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDAS+LLD+SGSI SEK S PN+NS RGFEVIDEIKA LE  
Sbjct  61    RMAASLLRLHFHDCFVKGCDASVLLDNSGSIVSEKGSKPNKNSIRGFEVIDEIKAELERA  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CPHTVSCADILA+AARDSTV++GGPNWEVPLGR+DSRG SLSGSNN+IPAPNNTF TILT
Sbjct  121   CPHTVSCADILAIAARDSTVISGGPNWEVPLGRKDSRGASLSGSNNDIPAPNNTFNTILT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFK QGL+LVDLVALSG+HTIGNARCVSF+QRLYNQ  N  PD TL+  YA++LR +CP+
Sbjct  181   KFKRQGLNLVDLVALSGAHTIGNARCVSFKQRLYNQNQNGQPDPTLNALYASQLRNQCPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGDQ LF LD  +P  FDNSY++N+LA KGLLNSDQVL+TK+  S++LVK YAEN ELF
Sbjct  241   SGGDQNLFFLDHESPFNFDNSYYRNILANKGLLNSDQVLLTKNHKSMKLVKQYAENVELF  300

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             F HFAKS+VKMGNISPLTG  GEIR NCR+IN Y
Sbjct  301   FDHFAKSVVKMGNISPLTGMKGEIRANCRRINAY  334



>ref|XP_008784965.1| PREDICTED: peroxidase 72-like [Phoenix dactylifera]
Length=330

 Score =   444 bits (1142),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 247/331 (75%), Positives = 284/331 (86%), Gaps = 2/331 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA F + F +  ++L    LC  + S GGYLYPQFYD SCP+A+EIV+S+VA+AVAKE R
Sbjct  1     MAMFRN-FAVIFSVLALVPLCFAA-SGGGYLYPQFYDHSCPKAKEIVKSIVAEAVAKETR  58

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSSGSI SEK+SNPNRNSARGFEVID+IKAALE EC
Sbjct  59    MAASLLRLHFHDCFVKGCDASLLLDSSGSIISEKQSNPNRNSARGFEVIDQIKAALEKEC  118

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P  VSCADIL LAARDST+LAGGP+W+VPLGRRDS G SLSGSNN+IPAPNNT  TI+TK
Sbjct  119   PQIVSCADILTLAARDSTILAGGPSWDVPLGRRDSLGASLSGSNNDIPAPNNTLPTIITK  178

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLDLVDLVALSG HTIG +RC SFRQRLYNQ+GN L D TL+ SYA++LR+ CP+S
Sbjct  179   FKLQGLDLVDLVALSGGHTIGLSRCTSFRQRLYNQSGNGLADSTLEASYASQLRSGCPRS  238

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGD  LF LD V+PT+FDN YFKN+LA KGLLNSDQVL TKSA ++ LVK YAEN+ELF 
Sbjct  239   GGDNNLFPLDLVSPTKFDNFYFKNILASKGLLNSDQVLFTKSAETMALVKLYAENNELFL  298

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNI+PLTG  G+IRKNCRK+N
Sbjct  299   EQFARSMIKMGNITPLTGSRGQIRKNCRKLN  329



>ref|XP_004149985.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 ref|XP_004158888.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 gb|KGN48875.1| hypothetical protein Csa_6G504560 [Cucumis sativus]
Length=332

 Score =   441 bits (1134),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 240/317 (76%), Positives = 278/317 (88%), Gaps = 3/317 (1%)
 Frame = -1

Query  1243  AQLCLCSKSYGGY--LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFV  1070
             A LCLCS++ GG+  LYPQ+YDRSCP+A+EIV+S+VAKA A+E R+AAS+LRLHFHDCFV
Sbjct  17    APLCLCSRNNGGFGSLYPQYYDRSCPKAKEIVKSIVAKAFAREARIAASILRLHFHDCFV  76

Query  1069  KGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAAR  890
             +GCDAS+LLDSSG+I SEK SNPN+NSARGFEVIDEIK+ALE ECP TVSCADIL+LAAR
Sbjct  77    QGCDASLLLDSSGNIRSEKNSNPNKNSARGFEVIDEIKSALEKECPQTVSCADILSLAAR  136

Query  889   DSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALS  710
             DST + GGP WEVPLGR+DSR  SLSGSNNNIPAPNNTFQTIL +F+ QGLD+VDLVALS
Sbjct  137   DSTFITGGPYWEVPLGRKDSRTASLSGSNNNIPAPNNTFQTILNRFQNQGLDIVDLVALS  196

Query  709   GSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPT  530
             G HTIGN+RC SFRQRLYNQ GN  PD TL QS+A +LR+RCP+SGGD  LF LD+ +PT
Sbjct  197   GGHTIGNSRCTSFRQRLYNQNGNGQPDKTLPQSFATDLRSRCPRSGGDNNLFSLDY-SPT  255

Query  529   RFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISP  350
             +FDNSYFKNL+A+KGLLNSDQVL+T + AS  LVK YA++SE FFQ FAKSM+KM NISP
Sbjct  256   KFDNSYFKNLVAFKGLLNSDQVLLTGNDASAALVKKYADDSEEFFQQFAKSMIKMSNISP  315

Query  349   LTGFSGEIRKNCRKINH  299
             LTG SGEIRK CRKIN+
Sbjct  316   LTGSSGEIRKTCRKINN  332



>ref|XP_008655973.1| PREDICTED: peroxidase 72-like [Zea mays]
 gb|AFW80877.1| hypothetical protein ZEAMMB73_868588 [Zea mays]
Length=341

 Score =   441 bits (1134),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 236/306 (77%), Positives = 267/306 (87%), Gaps = 0/306 (0%)
 Frame = -1

Query  1216  YGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsillds  1037
             +G  L P FYD+SCP AQ IV S+V KA  ++PRMAASLLRLHFHDCFVKGCDAS+LLDS
Sbjct  35    WGKKLDPHFYDQSCPHAQHIVASIVGKAHHQDPRMAASLLRLHFHDCFVKGCDASLLLDS  94

Query  1036  sgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             SGSI SEKRSNPNR+SARGFEVIDEIKAALEA CP TVSCADILALAARDSTV+ GGP W
Sbjct  95    SGSIVSEKRSNPNRDSARGFEVIDEIKAALEAACPATVSCADILALAARDSTVMTGGPGW  154

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
              VPLGRRDSRG S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIG++RC 
Sbjct  155   IVPLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCT  214

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
             SFRQRLYNQTGN LPD+TLD SYAA LR RCP+SGGDQ LF LD VTP +FDN Y+KN+L
Sbjct  215   SFRQRLYNQTGNGLPDFTLDASYAAALRPRCPRSGGDQNLFFLDPVTPFKFDNQYYKNIL  274

Query  496   AYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKN  317
             AY+GLL+SD+VL+T S A+  LVK YA N ++FFQHFA+S+VKMGNISPLTG +GEIRKN
Sbjct  275   AYRGLLSSDEVLLTGSGATADLVKLYAANQDIFFQHFARSIVKMGNISPLTGANGEIRKN  334

Query  316   CRKINH  299
             CR++NH
Sbjct  335   CRRVNH  340



>ref|XP_010548306.1| PREDICTED: peroxidase 49 [Tarenaya hassleriana]
Length=332

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 245/331 (74%), Positives = 280/331 (85%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+F S F + +AL+    L LC++SYGG LYP FYD SCP+A+EIV S+VAKAVA+E R
Sbjct  2     MARF-SGFLIVLALVCFLPLRLCNQSYGGKLYPGFYDHSCPKAEEIVRSIVAKAVARETR  60

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLDSSG I+SEK SNPNR SARGFEV+DEIKAALE EC
Sbjct  61    MAASLMRLHFHDCFVQGCDGSVLLDSSGRITSEKNSNPNRRSARGFEVVDEIKAALEKEC  120

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P+TVSCAD L LAARDS+VL GGP W+VPLGRRDSRG SLSGSNNNIPAPNNTFQTIL+K
Sbjct  121   PNTVSCADALTLAARDSSVLTGGPTWKVPLGRRDSRGASLSGSNNNIPAPNNTFQTILSK  180

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGLD  DLVALSGSHTIG +RC SFRQRLYNQ+GN+ PD TLDQS+AA LR RCP+S
Sbjct  181   FNRQGLDTTDLVALSGSHTIGFSRCTSFRQRLYNQSGNARPDSTLDQSFAASLRPRCPRS  240

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LD ++  +FDNSYFKNL+  KGLLNSDQVL + S  + +LVK YAE+ E FF
Sbjct  241   GGDQNLFVLDIISAAKFDNSYFKNLIDNKGLLNSDQVLFSSSQQARELVKKYAEDQEEFF  300

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SMVKMGNISPLTG +GEIRKNCRKIN
Sbjct  301   EQFAESMVKMGNISPLTGSNGEIRKNCRKIN  331



>gb|AAF63026.1|AF244923_1 peroxidase prx14 precursor [Spinacia oleracea]
Length=337

 Score =   439 bits (1130),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 234/304 (77%), Positives = 268/304 (88%), Gaps = 0/304 (0%)
 Frame = -1

Query  1207  YLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgs  1028
             YL+PQFYD SCP+  +I++SVVA+AV+++ RMAASLLRLHFHDCFVKGCDAS+LLD+ G 
Sbjct  34    YLHPQFYDHSCPQLHQIIKSVVAQAVSRDRRMAASLLRLHFHDCFVKGCDASLLLDNGGG  93

Query  1027  isSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVP  848
             I SEK SNPNRNS RGFEVID IKAA+E  CPHTVSCADI A+ ARDSTV+AGGPNWEVP
Sbjct  94    IVSEKGSNPNRNSVRGFEVIDAIKAAVEKACPHTVSCADIFAVVARDSTVIAGGPNWEVP  153

Query  847   lgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFR  668
             LGRRDSRG +LSGSNN+IPAPNNTF TILTKFK QGLDL+DLVALSG+HTIGNARCVSFR
Sbjct  154   LGRRDSRGATLSGSNNDIPAPNNTFNTILTKFKRQGLDLIDLVALSGAHTIGNARCVSFR  213

Query  667   QRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYK  488
             QRLYNQ  N  PD+TLDQ YA +LR +CP+SGGDQ LF LD+V+P  FDNSY++N+LA K
Sbjct  214   QRLYNQNRNGQPDFTLDQVYAFKLRNQCPRSGGDQNLFFLDYVSPFSFDNSYYRNILANK  273

Query  487   GLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             GLLNSDQVL+TK+ AS+QLVK YAEN ELFF HF+KS+VKMGNISPLTG  GEIR+NCR+
Sbjct  274   GLLNSDQVLLTKNHASMQLVKQYAENMELFFDHFSKSIVKMGNISPLTGMQGEIRQNCRR  333

Query  307   INHY  296
             IN Y
Sbjct  334   INAY  337



>ref|XP_003547959.1| PREDICTED: peroxidase 72-like [Glycine max]
Length=331

 Score =   439 bits (1128),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 237/312 (76%), Positives = 266/312 (85%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC  +  GYLYPQFYD SCP+ Q IV+SV+AK VA++PR+AAS+LRLHFHDCFVKGCD
Sbjct  19    LCLCHYNQEGYLYPQFYDYSCPQVQHIVKSVLAKYVAEQPRLAASILRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS +I SEK SNPNRNSARGFEV+D IKA LE +CP TVSCADIL LAARDS V
Sbjct  79    ASLLLDSSVNIISEKGSNPNRNSARGFEVVDAIKAELERKCPSTVSCADILTLAARDSVV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRDS G S+SGSNNNIPAPNNTFQTILTKF LQGLDLVDLVALSG HT
Sbjct  139   LTGGPSWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFNLQGLDLVDLVALSGGHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC +F+QRLYNQ+GN  PD TLDQ YAA LR RCP SGGDQ LF LD+ TP +FDN
Sbjct  199   IGNARCTTFKQRLYNQSGNGEPDSTLDQYYAATLRNRCPSSGGDQNLFFLDYATPYKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYF NLLAYKGLL+SDQVL T +  S +LVK YAE +++FF+ FAKSM+KMGNISPLT  
Sbjct  259   SYFTNLLAYKGLLSSDQVLFTMNQESAELVKLYAERNDIFFEQFAKSMIKMGNISPLTNS  318

Query  337   SGEIRKNCRKIN  302
              GEIR+NCR+IN
Sbjct  319   KGEIRENCRRIN  330



>gb|KHN27034.1| Peroxidase 72 [Glycine soja]
Length=327

 Score =   438 bits (1127),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 237/312 (76%), Positives = 266/312 (85%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC  +  GYLYPQFYD SCP+ Q IV+SV+AK VA++PR+AAS+LRLHFHDCFVKGCD
Sbjct  15    LCLCHYNQEGYLYPQFYDYSCPQVQHIVKSVLAKYVAEQPRLAASILRLHFHDCFVKGCD  74

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSS +I SEK SNPNRNSARGFEV+D IKA LE +CP TVSCADIL LAARDS V
Sbjct  75    ASLLLDSSVNIISEKGSNPNRNSARGFEVVDAIKAELERKCPSTVSCADILTLAARDSVV  134

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRDS G S+SGSNNNIPAPNNTFQTILTKF LQGLDLVDLVALSG HT
Sbjct  135   LTGGPSWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFNLQGLDLVDLVALSGGHT  194

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC +F+QRLYNQ+GN  PD TLDQ YAA LR RCP SGGDQ LF LD+ TP +FDN
Sbjct  195   IGNARCTTFKQRLYNQSGNGEPDSTLDQYYAATLRNRCPSSGGDQNLFFLDYATPYKFDN  254

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYF NLLAYKGLL+SDQVL T +  S +LVK YAE +++FF+ FAKSM+KMGNISPLT  
Sbjct  255   SYFTNLLAYKGLLSSDQVLFTMNQESAELVKLYAERNDIFFEQFAKSMIKMGNISPLTNS  314

Query  337   SGEIRKNCRKIN  302
              GEIR+NCR+IN
Sbjct  315   KGEIRENCRRIN  326



>ref|XP_002455760.1| hypothetical protein SORBIDRAFT_03g024460 [Sorghum bicolor]
 gb|EES00880.1| hypothetical protein SORBIDRAFT_03g024460 [Sorghum bicolor]
Length=343

 Score =   438 bits (1126),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 235/304 (77%), Positives = 265/304 (87%), Gaps = 0/304 (0%)
 Frame = -1

Query  1210  GYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssg  1031
             G L P FYD+SCP AQ IV S+V KA  ++PRMAASLLRLHFHDCFVKGCDAS+LLDSSG
Sbjct  39    GKLDPHFYDQSCPHAQHIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASLLLDSSG  98

Query  1030  sisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEV  851
             SI SEKRSNPN++SARGFEVIDEIKAALEA CP TVSCADILALAARDSTV+ GGP W V
Sbjct  99    SIVSEKRSNPNKDSARGFEVIDEIKAALEAACPGTVSCADILALAARDSTVMTGGPGWIV  158

Query  850   PlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSF  671
             PLGRRDSRG S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIG++RC SF
Sbjct  159   PLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSF  218

Query  670   RQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAY  491
             RQRLYNQTGN LPD+TLD SYAA LR RCP+SGGDQ LF LD +TP +FDN Y+KN+LAY
Sbjct  219   RQRLYNQTGNGLPDFTLDASYAATLRPRCPRSGGDQNLFFLDPITPFKFDNQYYKNILAY  278

Query  490   KGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
              GLL+SD+VL+T S A+  LVK YA N ++FFQHFA+SMVKMGNISPLTG +GEIRKNCR
Sbjct  279   HGLLSSDEVLLTGSPATADLVKLYAANQDIFFQHFAQSMVKMGNISPLTGANGEIRKNCR  338

Query  310   KINH  299
             ++NH
Sbjct  339   RVNH  342



>gb|KDP37453.1| hypothetical protein JCGZ_08294 [Jatropha curcas]
Length=272

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 232/272 (85%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDASILLD+SGSI SEKRSNPNRNSARGFEVID IK+ALE EC
Sbjct  1     MAASLLRLHFHDCFVKGCDASILLDNSGSIISEKRSNPNRNSARGFEVIDAIKSALEKEC  60

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDSTVL GGP WEVPLGRRDS+G SLSGSNNNIPAPNNTFQTILTK
Sbjct  61    PKTVSCADILALAARDSTVLTGGPTWEVPLGRRDSKGASLSGSNNNIPAPNNTFQTILTK  120

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKLQGLD+VDLVALSGSHTIGNARC SFRQRLYNQ+GN  PDYTL QSYAA+LR RCP+S
Sbjct  121   FKLQGLDIVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYTLAQSYAAQLRARCPRS  180

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFV+PT+FDNSYFKNLLA KGLL+SDQVL+TK+ AS+ LVK YAEN+ELFF
Sbjct  181   GGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLSSDQVLLTKNEASMALVKKYAENNELFF  240

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + FAKSM+KMGNISPLTG  GE+RKNCR+IN+
Sbjct  241   EQFAKSMIKMGNISPLTGSRGEVRKNCRRINY  272



>ref|XP_009417065.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=331

 Score =   434 bits (1116),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 241/320 (75%), Positives = 273/320 (85%), Gaps = 1/320 (0%)
 Frame = -1

Query  1255  LLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDC  1076
             +++S+ + +   S  GYLYPQFY  SCP AQ IV SVVAKAVA+E RMAASLLRLHFHDC
Sbjct  12    IIFSSLVSVAQCSGSGYLYPQFYQHSCPSAQAIVRSVVAKAVAREARMAASLLRLHFHDC  71

Query  1075  FVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALA  896
             FVKGCDAS+LLDSSG+I+SEKRSNPNRNSARGFEV+DEIKAALE ECP TVSCADILALA
Sbjct  72    FVKGCDASLLLDSSGTITSEKRSNPNRNSARGFEVVDEIKAALEKECPRTVSCADILALA  131

Query  895   ARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVA  716
             ARDSTVL GGP+WEVPLGRRDS G S+ GSNNNIPAPNNT +TI+TKF L+GLD VDLVA
Sbjct  132   ARDSTVLTGGPSWEVPLGRRDSIGASIQGSNNNIPAPNNTLRTIITKFNLKGLDPVDLVA  191

Query  715   LSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVT  536
             LSGSHTIG++RC SFRQRLYNQTG+  PD TLD +YAA LR RCP+SGGDQ LF LD ++
Sbjct  192   LSGSHTIGDSRCTSFRQRLYNQTGDGRPDSTLDTTYAALLRRRCPRSGGDQNLFTLDALS  251

Query  535   PTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGN  359
             P RFDN YFKNL+A KGLL SD+VL +  SA +++LVK YAE+ E FF  FAKSMVKMGN
Sbjct  252   PGRFDNQYFKNLVAGKGLLASDEVLFSGGSATTMRLVKWYAESEEAFFAQFAKSMVKMGN  311

Query  358   ISPLTGFSGEIRKNCRKINH  299
             I+PLTG  GEIRKNCR+INH
Sbjct  312   ITPLTGNKGEIRKNCRRINH  331



>ref|XP_004968895.1| PREDICTED: peroxidase 72-like [Setaria italica]
Length=337

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 234/304 (77%), Positives = 265/304 (87%), Gaps = 0/304 (0%)
 Frame = -1

Query  1210  GYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssg  1031
             G L P FYD SCP+AQ+IV S+V KA  ++PRMAASLLRLHFHDCFVKGCDAS+LLDSSG
Sbjct  33    GKLDPHFYDHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASLLLDSSG  92

Query  1030  sisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEV  851
             SI SEKRSNPNR+SARGFEVIDEIKAALEA CP TVSCADILAL+ARDSTV+ GGP W V
Sbjct  93    SIVSEKRSNPNRDSARGFEVIDEIKAALEAACPGTVSCADILALSARDSTVMTGGPGWIV  152

Query  850   PlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSF  671
             PLGRRDSRG S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIG++RC SF
Sbjct  153   PLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSF  212

Query  670   RQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAY  491
             RQRLYNQTGN LPD+TLD SYAA LR RCP+SGGDQ LF LD VTP +FDN Y+KN+LA 
Sbjct  213   RQRLYNQTGNGLPDFTLDASYAAALRPRCPRSGGDQNLFFLDPVTPFKFDNQYYKNILAN  272

Query  490   KGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
             +GLL SD+VL+T S+A+  LVK YA N ++FFQHFA+SMVKMGNISPLTG  GEIRK+CR
Sbjct  273   RGLLASDEVLLTGSSATADLVKLYAANQDIFFQHFAQSMVKMGNISPLTGADGEIRKHCR  332

Query  310   KINH  299
             ++NH
Sbjct  333   RVNH  336



>ref|XP_006343383.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=333

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 239/335 (71%), Positives = 274/335 (82%), Gaps = 6/335 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALL-YSAQLCLCSKS-YG-GYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MAK +S FFM I LL ++  LCL SK+ Y   YLYPQFYD SCP+A+EIV+SVVAKAVAK
Sbjct  1     MAKVLSLFFMIIYLLAFAPILCLSSKTNYNYSYLYPQFYDGSCPKAKEIVKSVVAKAVAK  60

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASLLRLHFHDCFVKGCDAS+LLDSSG++ SEK SN N NSARGFEVIDEIK+ALE
Sbjct  61    EARMAASLLRLHFHDCFVKGCDASVLLDSSGTLKSEKLSNTNMNSARGFEVIDEIKSALE  120

Query  943   AECPHTVSCADILALAARDSTVLAGGPNW-EVPlgrrdsrgnslsgsnnNIPAPNNTFQT  767
              ECP TVSCADIL LAARDSTVL     W ++          S S + NNIPA NNTF  
Sbjct  121   KECPQTVSCADILTLAARDSTVLVSW--WTKLGRRDARDASISGSNNCNNIPAQNNTFSA  178

Query  766   ILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTR  587
             ILTKFKL+GLDLVD V LSGSHTIG ARC SF+QRLYNQ+G +LPDYTLD+ YAA+L T+
Sbjct  179   ILTKFKLKGLDLVDFVTLSGSHTIGKARCTSFKQRLYNQSGKNLPDYTLDKKYAAQLSTK  238

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CPK GGDQ LF LD+V+PT+FDN+Y+KNLLA KGLLNSDQ+LVTK+  SL+LVK YA+N+
Sbjct  239   CPKFGGDQNLFFLDYVSPTKFDNNYYKNLLASKGLLNSDQILVTKNETSLELVKLYAKNN  298

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             E+FF+ FAKSMVK+GNISPL G  GEIRKNCRK+N
Sbjct  299   EIFFKQFAKSMVKLGNISPLMGHKGEIRKNCRKMN  333



>dbj|BAB89258.1| putative peroxidase ATP6a [Oryza sativa Japonica Group]
 tpe|CAH69259.1| TPA: class III peroxidase 17 precursor [Oryza sativa Japonica 
Group]
Length=336

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 238/334 (71%), Positives = 276/334 (83%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGY-LYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MA F     +AI    ++       S+G   L P FYD SCP+AQ+IV S+V KA  ++P
Sbjct  1     MAAFAFLLVIAIVFPLASAFPSPPVSWGQQQLDPHFYDHSCPQAQQIVASIVGKAHYQDP  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDASILLDSS +I SEKRSNPNR+SARGFEVIDEIKAALEA 
Sbjct  61    RMAASLLRLHFHDCFVKGCDASILLDSSATIMSEKRSNPNRDSARGFEVIDEIKAALEAA  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CPHTVSCADILALAARDSTV+ GGP W VPLGRRDSRG S+ GSNN+IPAPNNT  TI+T
Sbjct  121   CPHTVSCADILALAARDSTVMTGGPGWIVPLGRRDSRGASVQGSNNDIPAPNNTLPTIIT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKLQGLD+VDLVAL GSHTIG++RC SFRQRLYNQTGN LPD+TLD SYAA LR RCP+
Sbjct  181   KFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYNQTGNGLPDFTLDASYAAALRPRCPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSEL  401
             SGGDQ LF LD VTP RFDN Y+KNLLA++GLL+SD+VL+T  + A+ +LV+ YA + ++
Sbjct  241   SGGDQNLFFLDPVTPFRFDNQYYKNLLAHRGLLSSDEVLLTGGNPATAELVELYAADQDI  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF HFA+SMVKMGNISPLTG +GE+R NCR++NH
Sbjct  301   FFAHFARSMVKMGNISPLTGGNGEVRTNCRRVNH  334



>ref|XP_006645977.1| PREDICTED: peroxidase 72-like [Oryza brachyantha]
Length=459

 Score =   437 bits (1123),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 233/303 (77%), Positives = 264/303 (87%), Gaps = 0/303 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYDRSCP+AQ+IV S+V K   ++PRMAASLLRLHFHDCFVKGCDASILLDSS +I
Sbjct  157   LDPHFYDRSCPQAQQIVASIVGKVHYQDPRMAASLLRLHFHDCFVKGCDASILLDSSATI  216

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRSNPNR+SARGFEVIDEIKAALEA CPHTVSCADILALAARDSTV+ GGP W VPL
Sbjct  217   VSEKRSNPNRDSARGFEVIDEIKAALEAACPHTVSCADILALAARDSTVMTGGPGWIVPL  276

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDSRG S+ GSNN+IPAPNNT  TI+TKFKLQGLD++DLVAL GSHTIG++RC SFRQ
Sbjct  277   GRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDILDLVALLGSHTIGDSRCTSFRQ  336

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYN+TG  LPD TLD SYAA LR RCP+SGGDQ LF LD VTP +FDN Y+KNLLAY+G
Sbjct  337   RLYNRTGTGLPDLTLDASYAAALRPRCPRSGGDQNLFFLDPVTPFKFDNQYYKNLLAYRG  396

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL+T S A+ +LVK YA + ++FFQHFA+SMVKMGNISPLTG +GEIR NCRK+
Sbjct  397   LLSSDEVLLTASPATAELVKLYAADQDVFFQHFARSMVKMGNISPLTGGNGEIRANCRKV  456

Query  304   NHY  296
             N Y
Sbjct  457   NRY  459



>gb|AAF63025.1|AF244922_1 peroxidase prx13 precursor [Spinacia oleracea]
Length=329

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 236/325 (73%), Positives = 272/325 (84%), Gaps = 1/325 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
              F+++ +L  + LC   KS GG LYPQFYD SCP+ ++IV SV+AK VAKEPRMAASLLR
Sbjct  6     LFLSLLILAISPLCFSEKSQGGNLYPQFYDHSCPKLEDIVWSVLAKVVAKEPRMAASLLR  65

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCD  +LLDSSGSI SEKRSNPNRNSARGFEVIDEIKAA+E  CP TVSCA
Sbjct  66    LHFHDCFVKGCDGGVLLDSSGSIVSEKRSNPNRNSARGFEVIDEIKAAVEKACPETVSCA  125

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILAL ARDST+L GGPNWEVPLGRRDS   SLSGSN NIPAPNNTFQTILTKFKL+GLD
Sbjct  126   DILALTARDSTLLVGGPNWEVPLGRRDSLDASLSGSNYNIPAPNNTFQTILTKFKLKGLD  185

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             LVDLVALSGSHTIG+ARC SF  + Y     +    TL+ + AA LR RCP+SGGDQ LF
Sbjct  186   LVDLVALSGSHTIGDARCTSF-SKGYTTRAETTTRQTLNPAMAAVLRKRCPRSGGDQNLF  244

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
             +LD VTP +FDNSY+KNLLA KGLL+SD++LV+++A S++LVK YAEN+ LFFQHFA+SM
Sbjct  245   NLDHVTPFKFDNSYYKNLLANKGLLSSDEILVSQNADSMKLVKQYAENNHLFFQHFAQSM  304

Query  373   VKMGNISPLTGFSGEIRKNCRKINH  299
             VKMGNI+PLTG  GEIR+ CR++NH
Sbjct  305   VKMGNIAPLTGSRGEIRRVCRRVNH  329



>ref|XP_007156087.1| hypothetical protein PHAVU_003G257400g [Phaseolus vulgaris]
 gb|ESW28081.1| hypothetical protein PHAVU_003G257400g [Phaseolus vulgaris]
Length=331

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 235/313 (75%), Positives = 269/313 (86%), Gaps = 2/313 (1%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC+    GYLYPQFYD SCP+AQ IV+S++A  V ++PR+AAS+LRLHFHDCFVKGCD
Sbjct  19    LCLCNYYQEGYLYPQFYDYSCPQAQHIVKSILATYVEQQPRLAASILRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             AS+LLDSSGSI SEK SNPNRNSARGFEVID IKAALE ECP TVSCADIL LAARDS V
Sbjct  79    ASLLLDSSGSIISEKGSNPNRNSARGFEVIDAIKAALERECPSTVSCADILTLAARDSVV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L+GGP+WEVPLGRRDSR  S+SGSNNNIPAPNNTFQTILTKFKLQGL LVDLVALSGSHT
Sbjct  139   LSGGPSWEVPLGRRDSRDASISGSNNNIPAPNNTFQTILTKFKLQGLHLVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQ-TGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFD  521
             IGNARC +FRQRLY+Q +G+  P+  LDQ YA  LR RCP+SGGDQ LF LD+ TP +FD
Sbjct  199   IGNARCTTFRQRLYSQISGHGKPESALDQYYATALRNRCPRSGGDQNLFFLDYATPYKFD  258

Query  520   NSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTG  341
             N+YFKNLLAYKGLL+SDQ+L+T +  S  LV++YAEN+++F + FAKSM+KMGNISPLT 
Sbjct  259   NTYFKNLLAYKGLLSSDQILLT-TQESAALVQSYAENNDIFLEQFAKSMIKMGNISPLTN  317

Query  340   FSGEIRKNCRKIN  302
               GEIR+NCR IN
Sbjct  318   SRGEIRENCRHIN  330



>ref|XP_010033444.1| PREDICTED: peroxidase 49 [Eucalyptus grandis]
Length=331

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 273/324 (84%), Gaps = 0/324 (0%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F +  ++L  A +C C ++YGGYLYPQ+YD SCP+A++IV SVVAKAVAKE RMAASLLR
Sbjct  7     FLILFSILALAPMCYCRRTYGGYLYPQYYDYSCPQAEDIVRSVVAKAVAKEARMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             +HFHDCFV+GCD SILLDS+G++ SEKRSNPNR SARGFEVI+EIKAALE +CPHTVSCA
Sbjct  67    VHFHDCFVQGCDGSILLDSTGTMPSEKRSNPNRKSARGFEVIEEIKAALEEQCPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDSTVL GG +WEVPLGR+DSRG SL+ SN NIPAPN+TF  +L KF  QGLD
Sbjct  127   DILALAARDSTVLMGGRSWEVPLGRKDSRGASLTLSNLNIPAPNDTFPILLNKFNRQGLD  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             ++DLVALSGSHTIGNARC +FRQRLY+Q+G+      LDQSYA++LR  CP+SGGDQ LF
Sbjct  187   IIDLVALSGSHTIGNARCTAFRQRLYDQSGDDQQGSRLDQSYASQLRATCPRSGGDQNLF  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LD VTPT FDNSYFKNLLAY+GLL+SDQVL T +  S++LVK YA+++E+F Q FA SM
Sbjct  247   VLDNVTPTAFDNSYFKNLLAYRGLLSSDQVLFTSNKESIELVKKYAKDNEVFLQQFAASM  306

Query  373   VKMGNISPLTGFSGEIRKNCRKIN  302
             VKMGNI P TG  GEIRK CRKIN
Sbjct  307   VKMGNILPSTGSRGEIRKICRKIN  330



>ref|NP_001043276.1| Os01g0543100 [Oryza sativa Japonica Group]
 dbj|BAF05190.1| Os01g0543100 [Oryza sativa Japonica Group]
 dbj|BAG97211.1| unnamed protein product [Oryza sativa Japonica Group]
Length=340

 Score =   429 bits (1104),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 231/303 (76%), Positives = 265/303 (87%), Gaps = 1/303 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+AQ+IV S+V KA  ++PRMAASLLRLHFHDCFVKGCDASILLDSS +I
Sbjct  36    LDPHFYDHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASILLDSSATI  95

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRSNPNR+SARGFEVIDEIKAALEA CPHTVSCADILALAARDSTV+ GGP W VPL
Sbjct  96    MSEKRSNPNRDSARGFEVIDEIKAALEAACPHTVSCADILALAARDSTVMTGGPGWIVPL  155

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDSRG S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIG++RC SFRQ
Sbjct  156   GRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQ  215

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQTGN LPD+TLD SYAA LR RCP+SGGDQ LF LD VTP RFDN Y+KNLLA++G
Sbjct  216   RLYNQTGNGLPDFTLDASYAAALRPRCPRSGGDQNLFFLDPVTPFRFDNQYYKNLLAHRG  275

Query  484   LLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             LL+SD+VL+T  + A+ +LV+ YA + ++FF HFA+SMVKMGNISPLTG +GE+R NCR+
Sbjct  276   LLSSDEVLLTGGNPATAELVELYAADQDIFFAHFARSMVKMGNISPLTGGNGEVRTNCRR  335

Query  307   INH  299
             +NH
Sbjct  336   VNH  338



>gb|KFK30268.1| hypothetical protein AALP_AA7G239300 [Arabis alpina]
Length=331

 Score =   428 bits (1100),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 238/331 (72%), Positives = 273/331 (82%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S F + I+LL    LCLC KSYGG L+P +Y  SCP+A EIV SVVAKAVAKE R
Sbjct  1     MARLTS-FLLLISLLCFVPLCLCDKSYGGKLFPGYYAHSCPQAGEIVRSVVAKAVAKETR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLD+SG I SEK SNPN  SARGF+V+D+IKA LE +C
Sbjct  60    MAASLVRLHFHDCFVQGCDGSLLLDTSGRIKSEKSSNPNSKSARGFDVVDQIKAELEKQC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCAD+L LAARDS+VL+GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTILTK
Sbjct  120   PGTVSCADVLTLAARDSSVLSGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFQTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+S
Sbjct  180   FNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDMTLEQSFAANLRQRCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD ++  RFDNSYFKNL+  KGLLNSDQVL + +  S +LVK YAE+ E FF
Sbjct  240   GGDQILSVLDIISAARFDNSYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQEEFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG +GEIRKNCRKIN
Sbjct  300   EQFAESMIKMGNISPLTGSNGEIRKNCRKIN  330



>ref|XP_006644025.1| PREDICTED: peroxidase 72-like [Oryza brachyantha]
Length=334

 Score =   428 bits (1100),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 275/336 (82%), Gaps = 6/336 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGG---YLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MA  + C  M   L   + + L S  +G     L+PQFYD SCP+A+EIV+S+VA+AVA+
Sbjct  1     MATSMGCLLM---LCLVSPILLASTVHGNPWYGLFPQFYDHSCPKAKEIVQSIVAQAVAR  57

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPN NS RGFEV+DEIKAALE
Sbjct  58    ETRMAASLVRLHFHDCFVKGCDASVLLDNSTTIISEKGSNPNMNSLRGFEVVDEIKAALE  117

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
             A CP TVSCADILALAARDSTVL GGP W+VPLGRRDS G S+ GSNN+IPAPNNT  TI
Sbjct  118   ATCPGTVSCADILALAARDSTVLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTI  177

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             +TKFK QGL++VD+VALSGSHTIG +RC SFRQRLYNQTGN + D TLD SYAA+LR  C
Sbjct  178   ITKFKRQGLNIVDVVALSGSHTIGMSRCTSFRQRLYNQTGNGMADSTLDVSYAAQLRQGC  237

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SGGD  LF LDFV+P +FDN YFKNLL  KGLL+SD+VL+TKSA +  LVKAYA++  
Sbjct  238   PRSGGDNNLFPLDFVSPAKFDNFYFKNLLVGKGLLSSDEVLLTKSAETAALVKAYADDVN  297

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             LFFQHFA+SMV MGNISPLTG  GEIRKNCR++N+Y
Sbjct  298   LFFQHFAQSMVNMGNISPLTGLQGEIRKNCRRLNNY  333



>gb|EAY74439.1| hypothetical protein OsI_02330 [Oryza sativa Indica Group]
Length=336

 Score =   428 bits (1100),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 275/334 (82%), Gaps = 2/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGY-LYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MA F     + I    ++       S+G   L P FYD SCP+AQ+IV S+V KA  ++P
Sbjct  1     MAAFAFLLVVTIVFPLASAFPSPPVSWGQQQLDPHFYDHSCPQAQQIVASIVGKAHYQDP  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDASILLDSS +I+SEKRSNPNR+SARGFEVIDEIKA LEA 
Sbjct  61    RMAASLLRLHFHDCFVKGCDASILLDSSATITSEKRSNPNRDSARGFEVIDEIKATLEAA  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CPHTVSCADILALAARDSTV+ GGP W VPLGRRDSRG S+ GSNN+IPAPNNT  TI+T
Sbjct  121   CPHTVSCADILALAARDSTVMTGGPGWIVPLGRRDSRGASVQGSNNDIPAPNNTLPTIIT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKLQGLD+VDLVAL GSHTIG++RC SFRQRLYNQTGN LPD+TLD SYAA LR RCP+
Sbjct  181   KFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYNQTGNGLPDFTLDASYAAALRPRCPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSEL  401
             SGGDQ LF LD VTP +FDN Y++NLLA++GLL+SD+VL+T  + A+ +LV+ YA N ++
Sbjct  241   SGGDQNLFFLDPVTPFKFDNQYYRNLLAHRGLLSSDEVLLTGGNPATAELVELYAANQDI  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF HFA+SMVKMGNISPLTG +GE+R NCR++NH
Sbjct  301   FFAHFAQSMVKMGNISPLTGGNGEVRTNCRRVNH  334



>ref|XP_006343384.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=330

 Score =   427 bits (1097),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 245/336 (73%), Positives = 277/336 (82%), Gaps = 10/336 (3%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCL-CSKSYGGY--LYPQFYDRSCPRAQEIVESvvakavaK  1124
             MAK     F+       A +CL C   Y  Y  L PQFYD SCP+A+EIV+ VV+KAVAK
Sbjct  1     MAKITWTLFLV------AFVCLSCKTKYYVYGCLDPQFYDLSCPKAKEIVKFVVSKAVAK  54

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASLLRLHFHDCFVKGCDAS+LLDSS +I SEK SN NRNSARGFEVIDEIK ALE
Sbjct  55    EARMAASLLRLHFHDCFVKGCDASLLLDSSRTIISEKLSNANRNSARGFEVIDEIKCALE  114

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
              ECP  VSCADILALAARDSTVLAGGP+WEVPLGRRDSR  SLSGSNN+IPAPNNTF TI
Sbjct  115   KECPQIVSCADILALAARDSTVLAGGPSWEVPLGRRDSREASLSGSNNDIPAPNNTFDTI  174

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNS-LPDYTLDQSYAAELRTR  587
              TKF  +GLDLVDLVALSG+HTIG++RC+SF+QRLY Q+GN   PDY+LD+ Y A+L T 
Sbjct  175   FTKFNSRGLDLVDLVALSGAHTIGDSRCISFKQRLYGQSGNYYFPDYSLDRFYGAQLSTM  234

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+ GGDQ LF LD+V+PT+FDN+YFKNLL  +GLLNSDQVLVT++ ASLQLV  YA+N+
Sbjct  235   CPRFGGDQNLFFLDYVSPTKFDNNYFKNLLVLRGLLNSDQVLVTQNMASLQLVTLYAQNN  294

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             E+FFQ FAKSMVKMGNISPLTG  GEIRKNCR IN+
Sbjct  295   EIFFQQFAKSMVKMGNISPLTGLRGEIRKNCRIINN  330



>ref|XP_010231893.1| PREDICTED: peroxidase 72-like [Brachypodium distachyon]
Length=332

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 227/310 (73%), Positives = 260/310 (84%), Gaps = 0/310 (0%)
 Frame = -1

Query  1228  CSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsi  1049
             C  S    L P FY  SCP+AQ+IV S+V KA  ++PRMAASLLRLHFHDCFVKGCDASI
Sbjct  22    CVSSASAQLDPHFYSHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASI  81

Query  1048  lldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAG  869
             LLDS+ S++SEKRS PN++SARGFEV+DEIKAALEA CP TVSCAD+LALAARDSTV+ G
Sbjct  82    LLDSTASLASEKRSVPNKDSARGFEVVDEIKAALEAACPRTVSCADVLALAARDSTVMTG  141

Query  868   GPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGN  689
             GP W VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIG+
Sbjct  142   GPGWIVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGD  201

Query  688   ARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYF  509
             +RC SFRQRLYNQTGN +PD TLD S AA LR RCP+SGGDQ LF LD VTP +FDN Y+
Sbjct  202   SRCTSFRQRLYNQTGNGVPDLTLDASAAAVLRQRCPRSGGDQNLFFLDHVTPFKFDNQYY  261

Query  508   KNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGE  329
             KNLLA KG+L+SDQVL+T S A+  LVK YA N ++FFQHFA+SMVKMGN+SPLTG SGE
Sbjct  262   KNLLANKGVLSSDQVLLTGSPATADLVKLYAANQDIFFQHFAQSMVKMGNVSPLTGASGE  321

Query  328   IRKNCRKINH  299
             +R NCR +NH
Sbjct  322   VRTNCRSVNH  331



>gb|EAY73397.1| hypothetical protein OsI_01277 [Oryza sativa Indica Group]
Length=339

 Score =   426 bits (1094),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 228/307 (74%), Positives = 266/307 (87%), Gaps = 0/307 (0%)
 Frame = -1

Query  1216  YGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsillds  1037
             YG  L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD+
Sbjct  31    YGYGLFPQFYDHSCPKAKEIVQSIVAQAVARETRMAASLVRLHFHDCFVKGCDASVLLDN  90

Query  1036  sgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             S +I SEK SNPN NS RGFEV+DEIKAALEA CP TVSCADILALAARDSTVL GGP W
Sbjct  91    STTIISEKGSNPNMNSLRGFEVVDEIKAALEAACPGTVSCADILALAARDSTVLVGGPYW  150

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
             +VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKFK QGL++VD+VALSG HTIG +RC 
Sbjct  151   DVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNIVDVVALSGGHTIGMSRCT  210

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
             SFRQRLYNQ+GN + DYTLD SYAA+LR  CP+SGGD  LF LDFV+P +FDN YFKN+L
Sbjct  211   SFRQRLYNQSGNGMADYTLDVSYAAQLRQGCPRSGGDNNLFPLDFVSPAKFDNFYFKNIL  270

Query  496   AYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKN  317
             + KGLL+SDQVL+TKSA +  LVKAYA++  LFF+HFA+SMV MGNISPLTG  GEIRKN
Sbjct  271   SGKGLLSSDQVLLTKSAETAALVKAYADDVNLFFKHFAQSMVNMGNISPLTGSQGEIRKN  330

Query  316   CRKINHY  296
             CR++N+Y
Sbjct  331   CRRLNNY  337



>ref|NP_001042657.1| Os01g0263300 [Oryza sativa Japonica Group]
 dbj|BAA92500.1| putative PRX [Oryza sativa Japonica Group]
 tpe|CAH69246.1| TPA: class III peroxidase 3 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF04571.1| Os01g0263300 [Oryza sativa Japonica Group]
 gb|EAZ11330.1| hypothetical protein OsJ_01194 [Oryza sativa Japonica Group]
 dbj|BAG88020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95394.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=335

 Score =   425 bits (1093),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 228/308 (74%), Positives = 266/308 (86%), Gaps = 0/308 (0%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
              YG  L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD
Sbjct  26    GYGYGLFPQFYDHSCPKAKEIVQSIVAQAVARETRMAASLVRLHFHDCFVKGCDASVLLD  85

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
             +S +I SEK SNPN NS RGFEV+DEIKAALEA CP TVSCADILALAARDSTVL GGP 
Sbjct  86    NSTTIISEKGSNPNMNSLRGFEVVDEIKAALEAACPGTVSCADILALAARDSTVLVGGPY  145

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKFK QGL++VD+VALSG HTIG +RC
Sbjct  146   WDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNIVDVVALSGGHTIGMSRC  205

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
              SFRQRLYNQ+GN + DYTLD SYAA+LR  CP+SGGD  LF LDFV+P +FDN YFKN+
Sbjct  206   TSFRQRLYNQSGNGMADYTLDVSYAAQLRQGCPRSGGDNNLFPLDFVSPAKFDNFYFKNI  265

Query  499   LAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRK  320
             L+ KGLL+SDQVL+TKSA +  LVKAYA++  LFF+HFA+SMV MGNISPLTG  GEIRK
Sbjct  266   LSGKGLLSSDQVLLTKSAETAALVKAYADDVNLFFKHFAQSMVNMGNISPLTGSQGEIRK  325

Query  319   NCRKINHY  296
             NCR++N+Y
Sbjct  326   NCRRLNNY  333



>gb|EMT21494.1| Peroxidase 72 [Aegilops tauschii]
Length=334

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 226/302 (75%), Positives = 260/302 (86%), Gaps = 0/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+AQ+IV S+V KA A++PRMAASLLRLHFHDCFVKGCDASILLDSS S+
Sbjct  32    LDPHFYDHSCPQAQQIVASIVGKAHAQDPRMAASLLRLHFHDCFVKGCDASILLDSSASV  91

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRSNPN++SARGFEV+DEIKAALEA CP TVSCAD+LALAARDSTV+ GGP W VPL
Sbjct  92    VSEKRSNPNKDSARGFEVVDEIKAALEAACPRTVSCADVLALAARDSTVMTGGPGWIVPL  151

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS G S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLV L GSHTIG++RC SFRQ
Sbjct  152   GRRDSLGASIQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVTLLGSHTIGDSRCTSFRQ  211

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQTGN LPD TLD + AA LR RCP+SGGDQ LF LD VTP +FDN Y+KNLL ++G
Sbjct  212   RLYNQTGNGLPDLTLDPAAAAVLRPRCPRSGGDQNLFFLDHVTPFKFDNQYYKNLLVHQG  271

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL T S A+ +LVK YA N ++FFQHFA+SMVKMGNISP+TG +GEIR NCR++
Sbjct  272   LLSSDEVLFTGSPATAELVKLYAANQDIFFQHFAQSMVKMGNISPITGRNGEIRSNCRRV  331

Query  304   NH  299
             NH
Sbjct  332   NH  333



>dbj|BAJ98142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 226/302 (75%), Positives = 259/302 (86%), Gaps = 0/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+AQ+IV S+V KA +++PRMAASLLRLHFHDCFVKGCDASILLDSS S+
Sbjct  35    LDPHFYDHSCPQAQQIVASIVGKAHSQDPRMAASLLRLHFHDCFVKGCDASILLDSSASV  94

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRS PN++SARGFEV+DEIKAALEA CP TVSCAD+LALAARDSTV+ GGP W VPL
Sbjct  95    VSEKRSTPNKDSARGFEVVDEIKAALEAACPRTVSCADVLALAARDSTVMTGGPGWIVPL  154

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS G S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIGN+RC SFRQ
Sbjct  155   GRRDSLGASIQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGNSRCTSFRQ  214

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQTG  LPD TLD + AA LR RCP+SGGDQ LF LD VTP +FDN Y+KNLL Y+G
Sbjct  215   RLYNQTGKGLPDSTLDPAAAAVLRPRCPRSGGDQNLFFLDRVTPFKFDNQYYKNLLVYQG  274

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL T S A+ +LVK YA N ++FFQHFA+SMVKMGNISP+TG +GEIR NCR++
Sbjct  275   LLSSDEVLFTGSPATAELVKLYAANQDIFFQHFARSMVKMGNISPITGRNGEIRSNCRRV  334

Query  304   NH  299
             NH
Sbjct  335   NH  336



>dbj|BAA94962.1| peroxidase [Asparagus officinalis]
Length=329

 Score =   424 bits (1090),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 270/325 (83%), Gaps = 4/325 (1%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F + I  L  A LC       G L PQFYD SCPRAQ+IV+ VV KAVAK+ RMAASLLR
Sbjct  9     FLVLIISLSLAHLCFAD----GSLTPQFYDHSCPRAQQIVKGVVEKAVAKDRRMAASLLR  64

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFVKGCD S+LLDSSG+I SEKRSNP R+SARGFEVIDE+K+ALE ECP TVSCA
Sbjct  65    LHFHDCFVKGCDGSVLLDSSGTIVSEKRSNPRRDSARGFEVIDEVKSALEKECPQTVSCA  124

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILA+ ARDSTV+ GGP+WEVPLGRRDS G SLSGSN NIPAPNNT QTI+TKFKL+GLD
Sbjct  125   DILAVVARDSTVITGGPSWEVPLGRRDSLGASLSGSNYNIPAPNNTLQTIITKFKLKGLD  184

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
             +VDLV L GSHTIG+ARC SFRQRLYNQ+GN LPD TLD++YAA+LR RCP+SGGDQ LF
Sbjct  185   IVDLVTLLGSHTIGDARCTSFRQRLYNQSGNGLPDATLDKTYAAQLRQRCPQSGGDQNLF  244

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSM  374
              LDF T  +FDN Y+KNL+A +GLL+SD++L T+S+ ++ LVK YAE++  FF+ FAKSM
Sbjct  245   ALDFNTQFKFDNFYYKNLVASEGLLSSDEILFTQSSTTMALVKKYAEDNGAFFEQFAKSM  304

Query  373   VKMGNISPLTGFSGEIRKNCRKINH  299
             VKMGN+ PLTG  GEIRK CR+INH
Sbjct  305   VKMGNVDPLTGKRGEIRKICRRINH  329



>ref|XP_002455405.1| hypothetical protein SORBIDRAFT_03g010240 [Sorghum bicolor]
 gb|EES00525.1| hypothetical protein SORBIDRAFT_03g010240 [Sorghum bicolor]
Length=336

 Score =   424 bits (1089),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 235/338 (70%), Positives = 273/338 (81%), Gaps = 5/338 (1%)
 Frame = -1

Query  1303  ALTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             A +M+       + + LL  A   +    +GG L+PQFYD SCP+A+EIV SVVA+AVA+
Sbjct  2     AASMSHRCHMLLLCVVLLAGA---VRGHPWGGGLFPQFYDHSCPKAKEIVRSVVAQAVAR  58

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASL+RLHFHDCFVKGCDAS+LLD+S SI SEK SNPN+NS RGFEV+D+IKAALE
Sbjct  59    ETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNKNSLRGFEVVDQIKAALE  118

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
             A CP  VSCADILALAARDSTVL GGP+W+VPLGRRDS G S+ GSNN+IPAPNNT  TI
Sbjct  119   AACPGVVSCADILALAARDSTVLVGGPSWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTI  178

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             +TKF+ QGLD+ D+VALSG HTIG +RC SFRQRLYNQTGN + D TLD SYAA+LR  C
Sbjct  179   VTKFRRQGLDVADVVALSGGHTIGMSRCTSFRQRLYNQTGNGMADATLDVSYAAQLRRGC  238

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SGGD  LF LD  TP RFDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  
Sbjct  239   PRSGGDNNLFPLDLATPARFDNLYFKNILAGRGLLSSDEVLLTKSAETAALVKAYAADVN  298

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI--NHY  296
             LFFQHFA+SMVKMGNISPLTG  GEIRKNCR+I  NHY
Sbjct  299   LFFQHFAQSMVKMGNISPLTGPQGEIRKNCRRINGNHY  336



>ref|XP_004967774.1| PREDICTED: peroxidase 72-like [Setaria italica]
Length=367

 Score =   425 bits (1092),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 231/309 (75%), Positives = 267/309 (86%), Gaps = 1/309 (0%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
             S  +GG L+PQFYD SCP+A+EIV+S+VA+AVAKE RMAASL+RLHFHDCFVKGCDAS+L
Sbjct  58    SHPWGG-LFPQFYDHSCPKAKEIVQSIVAQAVAKETRMAASLVRLHFHDCFVKGCDASVL  116

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LD+S SI SEK SNPNRNS RGFEV+D+IKAALEA CP TVSCADILA+AARDSTVL GG
Sbjct  117   LDNSSSIVSEKGSNPNRNSLRGFEVVDQIKAALEAACPGTVSCADILAIAARDSTVLVGG  176

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKFKLQGL++VD+VALSG HTIG +
Sbjct  177   PYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKLQGLNVVDVVALSGGHTIGMS  236

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RC SFRQRLYNQTGN + D TLD SYAA+LR  CP+SGGD  LF LDFVTP +FDN Y+K
Sbjct  237   RCTSFRQRLYNQTGNGMADSTLDVSYAAQLRQGCPRSGGDNNLFPLDFVTPAKFDNFYYK  296

Query  505   NLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEI  326
             N+LA KGLL+SD+VL+TKSA +  LVKAYA +  LFFQHFA+SMV MGNISPLTG  GEI
Sbjct  297   NILAGKGLLSSDEVLLTKSAETAALVKAYAADVNLFFQHFAQSMVNMGNISPLTGSQGEI  356

Query  325   RKNCRKINH  299
             RKNCR++N+
Sbjct  357   RKNCRRLNN  365



>gb|ABI37011.1| peroxidase [Oryza sativa]
Length=335

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/308 (74%), Positives = 265/308 (86%), Gaps = 0/308 (0%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
              YG  L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD
Sbjct  26    GYGYGLFPQFYDHSCPKAKEIVQSIVAQAVARETRMAASLVRLHFHDCFVKGCDASVLLD  85

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
             +S +I SEK SNPN NS RGFEV+DEIKAALEA CP TVSCADILALAARDSTVL GGP 
Sbjct  86    NSTTIISEKGSNPNMNSLRGFEVVDEIKAALEAACPGTVSCADILALAARDSTVLVGGPY  145

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKFK QGL++ D+VALSG HTIG +RC
Sbjct  146   WDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNIADVVALSGGHTIGMSRC  205

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
              SFRQRLYNQ+GN + DYTLD SYAA+LR  CP+SGGD  LF LDFV+P +FDN YFKN+
Sbjct  206   TSFRQRLYNQSGNGMADYTLDVSYAAQLRQGCPRSGGDNNLFPLDFVSPAKFDNFYFKNI  265

Query  499   LAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRK  320
             L+ KGLL+SDQVL+TKSA +  LVKAYA++  LFF+HFA+SMV MGNISPLTG  GEIRK
Sbjct  266   LSGKGLLSSDQVLLTKSAETAALVKAYADDVNLFFKHFAQSMVNMGNISPLTGSQGEIRK  325

Query  319   NCRKINHY  296
             NCR++N+Y
Sbjct  326   NCRRLNNY  333



>gb|KHN36076.1| Peroxidase 72 [Glycine soja]
Length=272

 Score =   420 bits (1079),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/271 (82%), Positives = 247/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSSG+I SEKRSNPNR+SARGFEVIDEIK+ALE EC
Sbjct  1     MAASLLRLHFHDCFVKGCDASVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSALEKEC  60

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILALAARDSTVL GGP+W VPLGRRDS G S+SGSNNNIPAPNNTFQTILTK
Sbjct  61    PHTVSCADILALAARDSTVLTGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTK  120

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKL+GLD+VDLVALSGSHTIGN+RC SFRQRLYNQTGN   D+TLDQ YAAELRTRCP+S
Sbjct  121   FKLKGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQTGNGKADFTLDQVYAAELRTRCPRS  180

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFVTP +FDN Y+KNLLA KGLL+SD++L+TK+  S  LVK YAEN+++FF
Sbjct  181   GGDQNLFVLDFVTPIKFDNFYYKNLLANKGLLSSDEILLTKNKVSADLVKQYAENNDIFF  240

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FAKSMVKMGNI+PLTG  GEIRKNCR+IN
Sbjct  241   EQFAKSMVKMGNITPLTGSRGEIRKNCRRIN  271



>ref|XP_002455406.1| hypothetical protein SORBIDRAFT_03g010250 [Sorghum bicolor]
 gb|EES00526.1| hypothetical protein SORBIDRAFT_03g010250 [Sorghum bicolor]
Length=334

 Score =   422 bits (1085),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 236/333 (71%), Positives = 273/333 (82%), Gaps = 4/333 (1%)
 Frame = -1

Query  1297  TMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             +M   V    ++  L  SA L      +GG L+PQFYD SCP+A+EIV+S+VA+AVAKE 
Sbjct  4     SMGSLVLLCLVSTLLFPSAVL---GHPWGG-LFPQFYDHSCPKAKEIVQSIVAQAVAKET  59

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASL+RLHFHDCFVKGCDAS+LLD+S SI SEK SNPNRNS RGFEV+D+IKAALEA 
Sbjct  60    RMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSLRGFEVVDQIKAALEAA  119

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILALAARDST L GGP W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+T
Sbjct  120   CPGTVSCADILALAARDSTSLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIIT  179

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFK QGL++VD+VALSG HTIG +RC SFRQRLYNQTGN + D TLD SYAA+LR  CP+
Sbjct  180   KFKRQGLNVVDVVALSGGHTIGMSRCTSFRQRLYNQTGNGMADSTLDVSYAAQLRQGCPR  239

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGD  LF LDFVTP +FDN Y+KNLLA KGLL+SD+VL+TKSA +  LVKAYA +  LF
Sbjct  240   SGGDNNLFPLDFVTPAKFDNFYYKNLLAGKGLLSSDEVLLTKSAETAALVKAYAADVNLF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FQHFA+SMV MGNISPLTG  GEIRKNCR++N+
Sbjct  300   FQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNN  332



>gb|KHN41941.1| Peroxidase 72 [Glycine soja]
Length=272

 Score =   419 bits (1077),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 224/271 (83%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFVKGCDAS+LLDSSG+I SEKRSNPNR+SARGFEVIDEIK+ALE EC
Sbjct  1     MAASLLRLHFHDCFVKGCDASVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSALEKEC  60

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILALAARDSTVL GGP+W VPLGRRDS G S+SGSNNNIPAPNNTFQTILTK
Sbjct  61    PHTVSCADILALAARDSTVLTGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTK  120

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FKL+GLD+VDLVALSGSHTIGN+RC SFRQRLYNQTGN   D+TLDQ YAAELRTRCP+S
Sbjct  121   FKLKGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQTGNGKADFTLDQVYAAELRTRCPRS  180

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ LF LDFVTP +FDN Y+KNLLA KGLL+SD++L+TK+  S  LVK YAEN++LFF
Sbjct  181   GGDQNLFVLDFVTPIKFDNFYYKNLLANKGLLSSDEILLTKNQVSADLVKQYAENNDLFF  240

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FAKSMVKMGNI+PLTG  GEIRKNCR IN
Sbjct  241   EQFAKSMVKMGNITPLTGSRGEIRKNCRGIN  271



>ref|XP_004234603.1| PREDICTED: peroxidase 72-like [Solanum lycopersicum]
Length=330

 Score =   421 bits (1081),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 246/336 (73%), Positives = 278/336 (83%), Gaps = 10/336 (3%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKS---YGGYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MAK +   F      + A +CL SK+     G L PQFYD SCP+A+EIV+  VAKAVAK
Sbjct  1     MAKIIWTLF------FLASICLSSKTKYYVYGCLDPQFYDLSCPKAKEIVKVGVAKAVAK  54

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASLLRLHFHDCFVKGCDAS+LLDSS +I+SEK SN NRNSARGFEVIDEIK ALE
Sbjct  55    EARMAASLLRLHFHDCFVKGCDASLLLDSSRTITSEKLSNANRNSARGFEVIDEIKGALE  114

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
              ECP TVSCADILAL ARDSTVLAGGPNWEVPLGRRDSR  SLS SNNNIP+PNNTF TI
Sbjct  115   KECPQTVSCADILALVARDSTVLAGGPNWEVPLGRRDSREASLSDSNNNIPSPNNTFDTI  174

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGN-SLPDYTLDQSYAAELRTR  587
              TKF L+GLDL DLVALSG+HTIGN+RC+SF+QRLY Q+GN   PDYTLD+ Y A+L T 
Sbjct  175   FTKFNLRGLDLADLVALSGAHTIGNSRCISFKQRLYGQSGNYYFPDYTLDRIYGAQLSTV  234

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+ GGDQ LF+LD+V+PT+FDNSYF NLL ++GLLNSDQVLVT++ ASLQLV  YA+N+
Sbjct  235   CPRYGGDQNLFYLDYVSPTKFDNSYFNNLLVFRGLLNSDQVLVTQNMASLQLVTLYAQNN  294

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             E FF+ FAKSMVKMGNISPLTG  GEIRKNCR IN+
Sbjct  295   EAFFEQFAKSMVKMGNISPLTGQRGEIRKNCRIINN  330



>ref|NP_001148509.1| peroxidase 72 precursor [Zea mays]
 gb|ACG31784.1| peroxidase 72 precursor [Zea mays]
 gb|ACR38009.1| unknown [Zea mays]
 tpg|DAA54091.1| TPA: peroxidase 72 [Zea mays]
Length=333

 Score =   420 bits (1080),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 227/304 (75%), Positives = 262/304 (86%), Gaps = 0/304 (0%)
 Frame = -1

Query  1210  GYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssg  1031
             G L+PQFYD SCP+A+EIV+S+VA+AVAKE RMAASL+RLHFHDCFVKGCDAS+LLD+S 
Sbjct  28    GGLFPQFYDHSCPKAKEIVQSIVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSS  87

Query  1030  sisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEV  851
             SI SEK SNPNRNS RGFEVID+IKAALEA CP TVSCADI+ALAARDST L GGP W+V
Sbjct  88    SIVSEKGSNPNRNSLRGFEVIDQIKAALEAACPGTVSCADIVALAARDSTALVGGPYWDV  147

Query  850   PlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSF  671
             PLGRRDS G S+ GSNN+IPAPNNT  TI+TKFK QGL++VD+VALSG HTIG +RC SF
Sbjct  148   PLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNVVDVVALSGGHTIGMSRCTSF  207

Query  670   RQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAY  491
             RQRLYNQTGN + D TLD SYAA+LR  CP+SGGD  LF LDF+TP +FDN Y+KNLLA 
Sbjct  208   RQRLYNQTGNGMADSTLDVSYAAKLRQGCPRSGGDNNLFPLDFITPAKFDNFYYKNLLAG  267

Query  490   KGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
             KGLL+SD++L+TKSA +  LVKAYA +  LFFQHFA+SMV MGNISPLTG  GEIRKNCR
Sbjct  268   KGLLSSDEILLTKSAETAALVKAYAADVNLFFQHFAQSMVNMGNISPLTGSQGEIRKNCR  327

Query  310   KINH  299
             ++N+
Sbjct  328   RLNN  331



>ref|XP_004967776.1| PREDICTED: peroxidase 72-like [Setaria italica]
Length=338

 Score =   420 bits (1080),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/338 (69%), Positives = 272/338 (80%), Gaps = 5/338 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG---GYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             MA  +    + +  L  A L L    +G   G L+PQFYD SCP+A+EIV+S+VA+AVA+
Sbjct  1     MAASMDGRLVLLTCLLVAPLLLAGGVHGHPWGGLFPQFYDHSCPQAKEIVKSIVAQAVAR  60

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             E RMAASL+RLHFHDCFV+GCDASILLD+S  I SEK SNPNRNSARGFEVIDEIK ALE
Sbjct  61    ETRMAASLVRLHFHDCFVQGCDASILLDNSTGIVSEKGSNPNRNSARGFEVIDEIKVALE  120

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
               CP TVSCADILALAARDST+L GGP W+VPLGRRDS G S+ GSNN+IPAPNNT  TI
Sbjct  121   HACPGTVSCADILALAARDSTLLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTI  180

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             +TKF+ QGLD+VD+VALSG+HTIG +RC SFRQRLYNQTGN + D+TLD SYAA LR  C
Sbjct  181   ITKFRRQGLDVVDVVALSGAHTIGLSRCTSFRQRLYNQTGNGMADFTLDASYAAHLRQGC  240

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SGGD  LF LD  TPT+FDN YFKNLL  KGLL+SD+VL+TKSA +  LVKAYA +  
Sbjct  241   PRSGGDDNLFPLDLATPTKFDNYYFKNLLVGKGLLSSDEVLLTKSAETAALVKAYAADVN  300

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI--NHY  296
              FFQHFA+SMVKMGN+SPLTG  GE+RKNCR++  NHY
Sbjct  301   FFFQHFAQSMVKMGNVSPLTGAQGEVRKNCRRLNGNHY  338



>ref|XP_004967775.1| PREDICTED: peroxidase 72-like [Setaria italica]
Length=338

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 269/327 (82%), Gaps = 3/327 (1%)
 Frame = -1

Query  1261  IALLYSAQLCLCSKSYG---GYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRL  1091
             + L   A L L    +G   G L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RL
Sbjct  12    LCLAVVAPLLLAGGVHGHPWGGLFPQFYDHSCPKAKEIVKSIVAQAVARETRMAASLVRL  71

Query  1090  HFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCAD  911
             HFHDCFVKGCDAS+LLD+S  I SEK SNPN+NS RGFEV+DEIKAALEA CP TVSCAD
Sbjct  72    HFHDCFVKGCDASVLLDNSTGIVSEKGSNPNKNSLRGFEVVDEIKAALEAACPGTVSCAD  131

Query  910   ILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDL  731
             +LALAARDSTVLAGGP W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKF+ QGLD+
Sbjct  132   VLALAARDSTVLAGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIVTKFRRQGLDV  191

Query  730   VDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFH  551
              D+VALSG+HTIG +RC SFRQRLYNQTGN L D TLD S+AA LR  CP+SGGD  LF 
Sbjct  192   ADVVALSGAHTIGLSRCTSFRQRLYNQTGNGLADATLDASFAARLRQGCPRSGGDNNLFP  251

Query  550   LDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMV  371
             LD  TP RFDN YF+N+LA KGLL+SD+VL+TKSA +  LVKAYA + +LFFQHFA+SMV
Sbjct  252   LDLATPARFDNLYFRNILAGKGLLSSDEVLLTKSAETAALVKAYAADVDLFFQHFARSMV  311

Query  370   KMGNISPLTGFSGEIRKNCRKINHY*Y  290
             +MGNISPLTG  GE+RKNCR++N   Y
Sbjct  312   RMGNISPLTGAQGEVRKNCRRLNGNRY  338



>gb|EMS60222.1| Peroxidase 72 [Triticum urartu]
Length=336

 Score =   419 bits (1077),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/302 (74%), Positives = 259/302 (86%), Gaps = 0/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+AQ+IV S+V KA A++PRMAASLLRLHFHDCFVKGCDASILLDSS S+
Sbjct  34    LDPHFYDHSCPQAQQIVASIVGKAHAQDPRMAASLLRLHFHDCFVKGCDASILLDSSASV  93

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRSNPN++SARGFEV+DEIKAALEA CP TVSCAD+LALAARDSTV+ GGP W VPL
Sbjct  94    VSEKRSNPNKDSARGFEVVDEIKAALEAACPRTVSCADVLALAARDSTVMTGGPGWMVPL  153

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS G S+ GSNN+IPAPNNT  TI+TKFKLQGLD+VDLVAL GSHTIG++RC SFRQ
Sbjct  154   GRRDSLGASIQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQ  213

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQTG  LPD TLD + AA LR RCP+SGGDQ LF LD VTP +FDN Y+KNLL ++G
Sbjct  214   RLYNQTGKGLPDSTLDPAAAAVLRPRCPRSGGDQNLFFLDHVTPFKFDNQYYKNLLVHQG  273

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL T S A+ +LVK YA + ++FFQHFA+SMV MGNISP+TG +G+IR NCR++
Sbjct  274   LLSSDEVLFTGSPATAELVKLYAASQDIFFQHFAQSMVNMGNISPITGRNGQIRSNCRRV  333

Query  304   NH  299
             NH
Sbjct  334   NH  335



>ref|NP_179407.1| peroxidase 15 [Arabidopsis thaliana]
 sp|Q9SI16.1|PER15_ARATH RecName: Full=Peroxidase 15; Short=Atperox P15; AltName: Full=ATP36; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD31351.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAL91187.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAO00917.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEC06731.1| peroxidase 15 [Arabidopsis thaliana]
Length=338

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 234/338 (69%), Positives = 272/338 (80%), Gaps = 7/338 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS---KSYGG---YLYPQFYDRSCPRAQEIVESvvaka  1133
             MA+ +  F + + L+Y+  LC+C     +YGG    L+P FY  SCPRA+EIV SVVAKA
Sbjct  1     MAR-IGSFLIILYLIYALTLCICDDDESNYGGDKGNLFPGFYRSSCPRAEEIVRSVVAKA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALENECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TI+T+F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDRTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + E FF+ FA+SM+KMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   DQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINN  337



>ref|NP_195361.1| peroxidase 49 [Arabidopsis thaliana]
 sp|O23237.2|PER49_ARATH RecName: Full=Peroxidase 49; Short=Atperox P49; AltName: Full=ATP31; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL40848.1|AF452384_1 class III peroxidase ATP31 [Arabidopsis thaliana]
 emb|CAB16848.1| peroxidase like protein [Arabidopsis thaliana]
 emb|CAB71009.1| peroxidase [Arabidopsis thaliana]
 emb|CAB80309.1| peroxidase like protein [Arabidopsis thaliana]
 gb|AAL66993.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM51313.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE86655.1| peroxidase 49 [Arabidopsis thaliana]
Length=331

 Score =   416 bits (1070),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 259/312 (83%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC KSYGG L+P +Y  SCP+  EIV SVVAKAVA+E RMAASLLRLHFHDCFV+GCD
Sbjct  19    LCLCDKSYGGKLFPGYYAHSCPQVNEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDSSG +++EK SNPN  SARGF+V+D+IKA LE +CP TVSCAD+L LAARDS+V
Sbjct  79    GSLLLDSSGRVATEKNSNPNSKSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+W VPLGRRDSR  SLS SNNNIPAPNNTFQTIL+KF  QGLD+ DLVALSGSHT
Sbjct  139   LTGGPSWVVPLGRRDSRSASLSQSNNNIPAPNNTFQTILSKFNRQGLDITDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCPKSGGDQ L  LD ++   FDN
Sbjct  199   IGFSRCTSFRQRLYNQSGNGSPDMTLEQSFAANLRQRCPKSGGDQILSVLDIISAASFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNL+  KGLLNSDQVL + +  S +LVK YAE+   FF+ FA+SM+KMGNISPLTG 
Sbjct  259   SYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGS  318

Query  337   SGEIRKNCRKIN  302
             SGEIRKNCRKIN
Sbjct  319   SGEIRKNCRKIN  330



>ref|XP_003566708.1| PREDICTED: peroxidase 72-like [Brachypodium distachyon]
Length=337

 Score =   416 bits (1070),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 261/306 (85%), Gaps = 0/306 (0%)
 Frame = -1

Query  1213  GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldss  1034
             GG L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD+S
Sbjct  31    GGGLFPQFYDHSCPKAKEIVQSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDNS  90

Query  1033  gsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWE  854
              SI SEK SNPNRNS RGFEV+D+IKA LEA CP TVSCADILALAARDST+L GGP W+
Sbjct  91    SSIVSEKGSNPNRNSLRGFEVVDQIKATLEAACPGTVSCADILALAARDSTILVGGPFWD  150

Query  853   VPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVS  674
             VPLGRRDS G S+ GSNN IPAPNNT  TI+TKFK  GL +VD+VALSG+HTIG +RC S
Sbjct  151   VPLGRRDSLGASIQGSNNGIPAPNNTLPTIITKFKRLGLHVVDVVALSGAHTIGLSRCTS  210

Query  673   FRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLA  494
             FRQRLYNQ+GN + D TLD SYAA+LR  CP+SGGD  LF LD VTP +FDN YFKN+LA
Sbjct  211   FRQRLYNQSGNGMADNTLDVSYAAQLRQGCPRSGGDNNLFPLDVVTPAKFDNLYFKNILA  270

Query  493   YKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNC  314
              KGLL+SD+VL+TKSA +  LVKAYA++  LFFQHFA+SMV MGNI PLTG  GE+RKNC
Sbjct  271   GKGLLSSDEVLLTKSAETAALVKAYADDVGLFFQHFAQSMVNMGNIMPLTGSQGEVRKNC  330

Query  313   RKINHY  296
             R++N+Y
Sbjct  331   RRLNNY  336



>gb|AAM61616.1| putative peroxidase [Arabidopsis thaliana]
Length=338

 Score =   416 bits (1070),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 234/338 (69%), Positives = 271/338 (80%), Gaps = 7/338 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS---KSYGG---YLYPQFYDRSCPRAQEIVESvvaka  1133
             MA+ +  F + + L Y+  LC+C     +YGG    L+P FY  SCPRA+EIV SVVAKA
Sbjct  1     MAR-IGSFLIILYLTYALTLCVCDDDESNYGGDKGNLFPGFYRSSCPRAEEIVRSVVAKA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALENECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TI+T+F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDRTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + E FF+ FA+SM+KMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   DQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINN  337



>ref|XP_003566702.1| PREDICTED: peroxidase 72-like [Brachypodium distachyon]
Length=337

 Score =   416 bits (1070),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 261/306 (85%), Gaps = 0/306 (0%)
 Frame = -1

Query  1213  GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldss  1034
             GG L+PQFYD SCP+A+EIV S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD+S
Sbjct  31    GGGLFPQFYDHSCPKAKEIVHSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDNS  90

Query  1033  gsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWE  854
              SI SEK SNPNRNS RGFEV+D+IK ALE  CP  VSCADILALAARDST+L GGP WE
Sbjct  91    SSIVSEKGSNPNRNSIRGFEVVDQIKVALETACPGVVSCADILALAARDSTILVGGPFWE  150

Query  853   VPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVS  674
             VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKFK  GL++VD+VALSG+HTIG +RC S
Sbjct  151   VPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRLGLNIVDVVALSGAHTIGLSRCTS  210

Query  673   FRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLA  494
             FRQRLYNQ+GN + D TLD SYAA+LR  CP+SGGD  LF LDFVTP +FDN YFKN+LA
Sbjct  211   FRQRLYNQSGNGMADNTLDVSYAAQLRQGCPRSGGDDNLFPLDFVTPAKFDNLYFKNILA  270

Query  493   YKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNC  314
              KGLL+SD+VL+TKSA +  LVKAYA++  LFFQHFA+SMV MGNISPL G  GEIRKNC
Sbjct  271   GKGLLSSDEVLLTKSAETAALVKAYADDVGLFFQHFAQSMVNMGNISPLVGAQGEIRKNC  330

Query  313   RKINHY  296
             R++N++
Sbjct  331   RRLNNF  336



>ref|XP_010467620.1| PREDICTED: peroxidase 15-like [Camelina sativa]
Length=338

 Score =   416 bits (1070),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 234/338 (69%), Positives = 270/338 (80%), Gaps = 7/338 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS---KSYGGY---LYPQFYDRSCPRAQEIVESvvaka  1133
             MA+ +  F + + L Y   LC+C     +YGG    L+P FY  SCPRA+EIV SVVA A
Sbjct  1     MAR-IGSFLVLLYLTYPFTLCICDDDESNYGGERGNLFPGFYRSSCPRAEEIVRSVVANA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE+ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALESECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TI+++F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NTIVSRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQILSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + E FF+ FA+SMVKMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   DQEKFFEQFAESMVKMGNISPLTGSSGEIRKNCRKINN  337



>ref|XP_009138426.1| PREDICTED: peroxidase 49 [Brassica rapa]
Length=331

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 272/331 (82%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S F + I+LL    LCLC KSYGG L P FY  SCP+A EIV SVVAKAVA+E R
Sbjct  1     MARLTS-FLLVISLLCFLPLCLCHKSYGGKLSPGFYAHSCPQAGEIVRSVVAKAVARETR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLDSSG I+SEK SNPNR SARGF+V+D+IKA LE EC
Sbjct  60    MAASLIRLHFHDCFVQGCDGSLLLDSSGRITSEKNSNPNRKSARGFDVVDQIKAQLEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCAD L LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTILTK
Sbjct  120   PGTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR +CP+S
Sbjct  180   FKRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQKCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD V+P +FDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+   FF
Sbjct  240   GGDQILSVLDKVSPAKFDNSYFKNLVENMGLLNSDQVLFSSNDKSRELVKKYAEDQGEFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG SGEIRKNCRKIN
Sbjct  300   EQFAESMIKMGNISPLTGSSGEIRKNCRKIN  330



>ref|XP_010437350.1| PREDICTED: peroxidase 49-like [Camelina sativa]
Length=330

 Score =   414 bits (1065),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 269/331 (81%), Gaps = 2/331 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S  F+ ++L+    LCLC KSYGG L+P FY  S P+A EIV SVVAKAVA+E R
Sbjct  1     MARLNS--FLLLSLICFLPLCLCDKSYGGKLFPGFYAHSYPQAGEIVRSVVAKAVARETR  58

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFV+GCD S+LLDS G I SEK SNPN  SARGF+V+D+IKA LE +C
Sbjct  59    MAASLLRLHFHDCFVQGCDGSLLLDSGGRIVSEKSSNPNSKSARGFDVVDQIKADLEKQC  118

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADIL LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL+K
Sbjct  119   PGTVSCADILTLAARDSSVLTGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFSTILSK  178

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR +CP+S
Sbjct  179   FNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQKCPRS  238

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD ++  +FDNSYFKNL+  KGLLNSDQVL + +  S +LVK YAE+ E FF
Sbjct  239   GGDQNLSVLDIISVAKFDNSYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQEEFF  298

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG SGEIRKNCRK+N
Sbjct  299   EQFAESMIKMGNISPLTGSSGEIRKNCRKMN  329



>ref|XP_010413957.1| PREDICTED: peroxidase 15-like [Camelina sativa]
Length=338

 Score =   414 bits (1065),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 233/338 (69%), Positives = 270/338 (80%), Gaps = 7/338 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLC---SKSYG---GYLYPQFYDRSCPRAQEIVESvvaka  1133
             MA+ +  F + + L Y+  LC+C     +YG   G L+P FY  SCPRA+EIV SVVA A
Sbjct  1     MAR-IGSFLVLLYLTYAFTLCICHDDESNYGRERGNLFPGFYRSSCPRAEEIVRSVVANA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE+ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALESECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
               I+++F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NIIVSRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQILSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + E FF+ FA+SMVKMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   DQEEFFEQFAESMVKMGNISPLTGSSGEIRKNCRKINN  337



>ref|XP_006284092.1| hypothetical protein CARUB_v10005221mg [Capsella rubella]
 gb|EOA16990.1| hypothetical protein CARUB_v10005221mg [Capsella rubella]
Length=330

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 228/311 (73%), Positives = 257/311 (83%), Gaps = 0/311 (0%)
 Frame = -1

Query  1234  CLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDA  1055
             CLC KSYGG L+P +Y  SCP+A EIV SVVAKAVA+E RMAASLLRLHFHDCFV+GCD 
Sbjct  19    CLCDKSYGGKLFPGYYSHSCPQASEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDG  78

Query  1054  silldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVL  875
             S+LLDS G I SEK SNPN  SARGF+V+D+IKA LE +CP  VSCAD+L LAARDS+VL
Sbjct  79    SLLLDSGGRIVSEKNSNPNSKSARGFDVVDQIKAELERQCPGIVSCADVLTLAARDSSVL  138

Query  874   AGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTI  695
              GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL+KF  QGLD+ DLVALSGSHTI
Sbjct  139   TGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFSTILSKFNRQGLDVTDLVALSGSHTI  198

Query  694   GNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNS  515
             G +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD V+  RFDNS
Sbjct  199   GFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQILSVLDIVSAARFDNS  258

Query  514   YFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFS  335
             YFKNL+  KGLLNSDQVL + +  S +LVK YAE+   FF+ FA+SM+KMGNISPLTG S
Sbjct  259   YFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGSS  318

Query  334   GEIRKNCRKIN  302
             GEIRKNCRKIN
Sbjct  319   GEIRKNCRKIN  329



>emb|CDM82666.1| unnamed protein product [Triticum aestivum]
Length=335

 Score =   414 bits (1065),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 270/335 (81%), Gaps = 12/335 (4%)
 Frame = -1

Query  1267  MAIALLYSAQLCLCSK-----------SYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA +++    LCL S             YGG L+PQFYD SCP+A+EIV S+VA+AVA+E
Sbjct  1     MATSMVCLVALCLVSPLLLAGAVVGNPGYGG-LFPQFYDHSCPKAKEIVHSMVAQAVARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPNRNS RGFEV+DEIK ALE 
Sbjct  60    TRMAASLVRLHFHDCFVKGCDASVLLDNSTNIVSEKGSNPNRNSIRGFEVVDEIKVALET  119

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDST+L GGP WEVPLGRRDS G S+ GSNN+IPAPNNT  TI+
Sbjct  120   ACPGTVSCADILALAARDSTILVGGPYWEVPLGRRDSLGASIQGSNNDIPAPNNTLPTII  179

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN L D TLD S+AA+LR  CP
Sbjct  180   TKFKRLGLNVVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGLADSTLDVSFAAQLRQGCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD V+ T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  L
Sbjct  240   RSGGDNNLFPLDAVSSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDVHL  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             FFQHFA+SMV MGNISPLTG  GEIRKNCR++N++
Sbjct  300   FFQHFAQSMVNMGNISPLTGSKGEIRKNCRRLNNF  334



>gb|AAM28296.1| peroxidase [Ananas comosus]
Length=329

 Score =   414 bits (1064),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 275/334 (82%), Gaps = 8/334 (2%)
 Frame = -1

Query  1303  ALTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaK  1124
             AL+M+  V+   M ++L   A L L     GGYL P++YD+SCP+ +EIV S+VAKAVAK
Sbjct  2     ALSMSGIVA-VLMVLSL---APLSLG----GGYLCPEYYDKSCPQVKEIVWSMVAKAVAK  53

Query  1123  EPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALE  944
             EPRMAASLLRLHFHDCFVKGCDASILLDSSGSI SEK S PN+NSARGFEVID+IKAA+E
Sbjct  54    EPRMAASLLRLHFHDCFVKGCDASILLDSSGSIVSEKGSKPNKNSARGFEVIDDIKAAVE  113

Query  943   AECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTI  764
               CP TVSCADILAL AR STV+AGGPNWEVPLGRRDS G SLSGSNN+IPAPNNT  TI
Sbjct  114   QACPKTVSCADILALTARYSTVVAGGPNWEVPLGRRDSLGASLSGSNNDIPAPNNTLPTI  173

Query  763   LTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRC  584
             +TKFK QGLD+VD+VAL+G+HTIG +RC SFRQRLYNQ+GN L D TLD+SYA +LR  C
Sbjct  174   ITKFKRQGLDVVDVVALAGAHTIGFSRCTSFRQRLYNQSGNGLADSTLDESYAMQLRWGC  233

Query  583   PKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
             P+SG D  LF LD+V+P +FDN Y+KN+L  KGLLNSDQ+L TKSA + QLV+ YA N  
Sbjct  234   PRSGSDDNLFPLDYVSPAQFDNYYYKNILVGKGLLNSDQILFTKSATTRQLVELYAANIG  293

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             +F+ HFAKSM+KMGNI+PLTG  GE+R NCR+IN
Sbjct  294   IFYDHFAKSMIKMGNITPLTGLEGEVRTNCRRIN  327



>gb|EMT23112.1| Peroxidase 72 [Aegilops tauschii]
Length=335

 Score =   414 bits (1064),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 232/337 (69%), Positives = 271/337 (80%), Gaps = 7/337 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG----GYLYPQFYDRSCPRAQEIVESvvakava  1127
             MA  + C    +AL   + L L    +G    G L+PQFYD SCP+A+EIV S+VA+AVA
Sbjct  1     MATSMGCL---VALCLVSPLLLAGAVHGNPGYGGLFPQFYDHSCPKAKEIVHSIVAQAVA  57

Query  1126  KEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAAL  947
             +E RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPNRNS RGFEV+DEIK AL
Sbjct  58    RETRMAASLVRLHFHDCFVKGCDASVLLDNSTNIVSEKGSNPNRNSIRGFEVVDEIKVAL  117

Query  946   EAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQT  767
             E  CP TVSCADILALAARDST+L GGP WEVPLGRRDS G S+ GSNN+IPAPNNT  T
Sbjct  118   ETACPGTVSCADILALAARDSTILVGGPYWEVPLGRRDSLGASIQGSNNDIPAPNNTLPT  177

Query  766   ILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTR  587
             I+TKFK  GL+LVD+VALSG HTIG +RC SFRQRLYNQ+GN L D TLD S+AA+LR  
Sbjct  178   IITKFKRLGLNLVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGLADGTLDVSFAAQLRQG  237

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+SGGD  LF LD VT T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA + 
Sbjct  238   CPRSGGDNHLFPLDAVTSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDV  297

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
              LFFQHFA+SMV MGNISPLTG  GEIRKNCR++N++
Sbjct  298   HLFFQHFAQSMVNMGNISPLTGSKGEIRKNCRRLNNF  334



>emb|CDM82667.1| unnamed protein product [Triticum aestivum]
Length=335

 Score =   414 bits (1064),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 270/335 (81%), Gaps = 12/335 (4%)
 Frame = -1

Query  1267  MAIALLYSAQLCLCSK-----------SYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA +++  A LCL S             YGG L+P FYD SCP+A+EIV S+VA+AVA+E
Sbjct  1     MATSMVCLAVLCLMSPLLLAGAVLGNPGYGG-LFPHFYDHSCPKAKEIVHSIVAQAVARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPN+NS RGFEV+DEIK ALE 
Sbjct  60    TRMAASLVRLHFHDCFVKGCDASVLLDNSTNIVSEKGSNPNKNSIRGFEVVDEIKVALET  119

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDST+L GGP WEVPLGRRDS G S+ GSNN+IPAPNNT  TI+
Sbjct  120   ACPGTVSCADILALAARDSTILVGGPYWEVPLGRRDSLGASIQGSNNDIPAPNNTLPTII  179

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN + D TLD SYAA+LR  CP
Sbjct  180   TKFKRLGLNIVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGMADNTLDVSYAAQLRQGCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD VT T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  L
Sbjct  240   RSGGDDNLFPLDVVTSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDVHL  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             FFQHFA+SMV MGNISPLTG  GEIRKNCR++N++
Sbjct  300   FFQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNF  334



>emb|CDY64926.1| BnaAnng19770D [Brassica napus]
Length=331

 Score =   414 bits (1063),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 271/331 (82%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+  S F + I+LL    LCLC KSYGG L P FY  SCP+A EIV SVVAKAVA+E R
Sbjct  1     MARLTS-FLLVISLLCFLPLCLCHKSYGGKLSPGFYAHSCPQAGEIVRSVVAKAVARETR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLDS G I+SEK SNPNR SARGF+V+D++KA LE EC
Sbjct  60    MAASLIRLHFHDCFVQGCDGSLLLDSGGRITSEKNSNPNRKSARGFDVVDQVKAQLEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCAD L LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTILTK
Sbjct  120   PGTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILTK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR +CP+S
Sbjct  180   FKRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQKCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD V+P +FDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+   FF
Sbjct  240   GGDQILSVLDKVSPAKFDNSYFKNLVENMGLLNSDQVLFSSNDKSRELVKKYAEDQGEFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG SGEIRKNCRKIN
Sbjct  300   EQFAESMIKMGNISPLTGSSGEIRKNCRKIN  330



>dbj|BAJ94853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 230/337 (68%), Positives = 271/337 (80%), Gaps = 7/337 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG----GYLYPQFYDRSCPRAQEIVESvvakava  1127
             MA  + C    +AL   + L L    +G    G L+PQFYD SCP+A+EIV SVVA+AVA
Sbjct  1     MATSIVCL---VALCLVSPLLLAGAVHGNPGYGGLFPQFYDHSCPKAKEIVHSVVAQAVA  57

Query  1126  KEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAAL  947
             +E RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPN+NS RGFEV+DEIK AL
Sbjct  58    RETRMAASLVRLHFHDCFVKGCDASVLLDNSTNIVSEKGSNPNKNSIRGFEVVDEIKVAL  117

Query  946   EAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQT  767
             E  CP TVSCADILALAARDST+L GGP W+VPLGRRDS G S+ GSNN+IPAPNNT  T
Sbjct  118   ETACPGTVSCADILALAARDSTILVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPT  177

Query  766   ILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTR  587
             I+TKFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN + D TLD SYAA+LR  
Sbjct  178   IITKFKRLGLNVVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGMADNTLDVSYAAQLRQG  237

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+SGGD  LF LD VT T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA + 
Sbjct  238   CPRSGGDDNLFPLDIVTSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDV  297

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
              LFFQHFA+SMV MGNISPLTG  GEIRKNCR++N++
Sbjct  298   HLFFQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNF  334



>ref|XP_010446794.1| PREDICTED: peroxidase 49-like [Camelina sativa]
Length=330

 Score =   413 bits (1061),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 258/312 (83%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
              CLC KSYGG L+P +Y  SCP+A EIV SVVAKAVA+E RMAASLLRLHFHDCFV+GCD
Sbjct  18    FCLCDKSYGGKLFPGYYAHSCPQAGEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCD  77

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDS G I SEK SNPN  SARGF+V+D+IK+ LE +CP TVSCAD+L LAARDS+V
Sbjct  78    GSLLLDSGGRIVSEKSSNPNSKSARGFDVVDQIKSELEKQCPGTVSCADVLTLAARDSSV  137

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL+KF  QGLD+ DLVALSGSHT
Sbjct  138   LTGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFSTILSKFNRQGLDVTDLVALSGSHT  197

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD ++  +FDN
Sbjct  198   IGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQNLSVLDIISAAKFDN  257

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNL+  KGLLNSDQVL + +  S  LVK YAE+ E FF+ FA+SM+KMGNISPLTG 
Sbjct  258   SYFKNLIENKGLLNSDQVLFSSNEKSRDLVKKYAEDQEEFFEQFAESMIKMGNISPLTGS  317

Query  337   SGEIRKNCRKIN  302
             SGEIRKNCRK+N
Sbjct  318   SGEIRKNCRKMN  329



>gb|EMT23111.1| Peroxidase 72 [Aegilops tauschii]
Length=335

 Score =   413 bits (1061),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 228/335 (68%), Positives = 269/335 (80%), Gaps = 12/335 (4%)
 Frame = -1

Query  1267  MAIALLYSAQLCLCSK-----------SYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA +++    LCL S             YGG L+PQFYD SCP+A+EIV S+VA+AVA+E
Sbjct  1     MATSMVCLVALCLVSPLLLAGAVVGNPGYGG-LFPQFYDHSCPKAKEIVHSMVAQAVARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPN+NS RGFEV+DEIK ALE 
Sbjct  60    TRMAASLVRLHFHDCFVKGCDASVLLDNSTNIVSEKGSNPNKNSIRGFEVVDEIKVALET  119

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADIL LAARDST+L GGP W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+
Sbjct  120   ACPGTVSCADILTLAARDSTILVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTII  179

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN + D TLD SYAA+LR  CP
Sbjct  180   TKFKRLGLNIVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGMADNTLDVSYAAQLRQGCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD VT T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  L
Sbjct  240   RSGGDDNLFPLDIVTSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDVHL  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             FFQHFA+SMV MGNISPLTG  GEIRKNCR++N++
Sbjct  300   FFQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNF  334



>emb|CCJ34843.1| horseradish peroxidase isoenzyme HRP_08562.1 [Armoracia rusticana]
Length=331

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 229/312 (73%), Positives = 259/312 (83%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC KSYGG L+P FY  SCP+A EIV SVVAKAVA+E RMAASL+RLHFHDCFV+GCD
Sbjct  19    LCLCDKSYGGKLFPGFYAHSCPQAGEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDSSG I SEK SNPN  SARGF+V+D+IKA LE +CP TVSCAD L LAARDS+V
Sbjct  79    GSLLLDSSGKIVSEKGSNPNSRSARGFDVVDQIKAELEKQCPGTVSCADALTLAARDSSV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+W V LGRRDSR  SLSGSNNNIPAPNNTFQTIL+KF  QGLD+ DLVALSGSHT
Sbjct  139   LTGGPSWVVSLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD ++  +FDN
Sbjct  199   IGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQILSVLDIISAAKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNL+  KGLLNSDQVL + +  S +LVK YAE+   FF+ FA+SM+KMGNISPLTG 
Sbjct  259   SYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGS  318

Query  337   SGEIRKNCRKIN  302
             SGEIRKNCRKIN
Sbjct  319   SGEIRKNCRKIN  330



>gb|EMS54022.1| Peroxidase 72 [Triticum urartu]
Length=335

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 270/335 (81%), Gaps = 12/335 (4%)
 Frame = -1

Query  1267  MAIALLYSAQLCLCSK-----------SYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA +++    LCL S             YGG L+PQFYD SCP+A+E+V S+VA+AVA+E
Sbjct  1     MATSMVCLVALCLVSPLLLAGAVVGNPGYGG-LFPQFYDHSCPKAKEMVHSIVAQAVARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPN+NS RGFEV+D+IKAALEA
Sbjct  60    TRMAASLVRLHFHDCFVKGCDASVLLDNSTNIISEKGSNPNKNSLRGFEVVDQIKAALEA  119

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDST+L GGP W+VPLGRRDS G S+ GSN  IPAPNNT  TI+
Sbjct  120   ACPGTVSCADILALAARDSTILVGGPFWDVPLGRRDSLGASIQGSNQGIPAPNNTLPTII  179

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN L D TLD SYAA+LR  CP
Sbjct  180   TKFKRLGLNVVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGLADGTLDVSYAAQLRQGCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD V+ T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  L
Sbjct  240   RSGGDDNLFPLDIVSSTKFDNYYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDVHL  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             FFQHFA+SMV MGNI+PLTG  GEIRKNCR++N++
Sbjct  300   FFQHFAQSMVNMGNITPLTGSQGEIRKNCRRLNNF  334



>emb|CCJ34840.1| horseradish peroxidase isoenzyme HRP_6117 [Armoracia rusticana]
Length=335

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 234/335 (70%), Positives = 269/335 (80%), Gaps = 5/335 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLC--SKSYGGY--LYPQFYDRSCPRAQEIVESvvakava  1127
             MA+ +  F + I+L     LC+C    +YGG   L+P FY  SCP+A+EIV SVVAKAVA
Sbjct  1     MAR-IGSFLVVISLACVLTLCICDDESNYGGQGKLFPGFYSSSCPKAEEIVRSVVAKAVA  59

Query  1126  KEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAAL  947
             +E RMAASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN  SARGFEV+DEIKAAL
Sbjct  60    RETRMAASLMRLHFHDCFVQGCDGSLLLDSSGSIVTEKNSNPNSRSARGFEVVDEIKAAL  119

Query  946   EAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQT  767
             E ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF T
Sbjct  120   ENECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTFNT  179

Query  766   ILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTR  587
             IL++F  QGLDL ++VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR R
Sbjct  180   ILSRFNSQGLDLTNVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLRHR  239

Query  586   CPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENS  407
             CP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+ 
Sbjct  240   CPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNDESRELVKKYAEDQ  299

Query  406   ELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             E FF+ FA+SMVKMGNISPLTG SG+IRKNCRKIN
Sbjct  300   EEFFEQFAESMVKMGNISPLTGSSGQIRKNCRKIN  334



>ref|XP_002886150.1| hypothetical protein ARALYDRAFT_480719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62409.1| hypothetical protein ARALYDRAFT_480719 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   412 bits (1059),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 234/339 (69%), Positives = 271/339 (80%), Gaps = 8/339 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLC----SKSYGGY---LYPQFYDRSCPRAQEIVESvvak  1136
             MA+ +  F + + L Y+  LC+C    S  YGG    L+P FY  SCPRA+EIV SVVAK
Sbjct  1     MAR-IGSFLIILYLTYALTLCICDDDESMYYGGNKGNLFPGFYRSSCPRAEEIVRSVVAK  59

Query  1135  avaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIK  956
             AVA+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIK
Sbjct  60    AVARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIK  119

Query  955   AALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNT  776
             AALE ECP+TVSCAD L LAARDS++L GGP+W VPLGRRDSR  SLSGSNNNIPAPNNT
Sbjct  120   AALENECPNTVSCADALTLAARDSSILTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNT  179

Query  775   FQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAEL  596
             F TI+++F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ GN  PD TL+QSYAA L
Sbjct  180   FNTIVSRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQFGNGSPDSTLEQSYAANL  239

Query  595   RTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYA  416
             R RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YA
Sbjct  240   RQRCPRSGGDQNLSELDINSAGRFDNSYFKNLIEKMGLLNSDEVLFSSNEQSRELVKKYA  299

Query  415   ENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             E+ E FF+ FA+SM+KMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   EDQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINN  338



>emb|CCJ34844.1| horseradish peroxidase isoenzyme HRP_08562.4 [Armoracia rusticana]
Length=331

 Score =   412 bits (1058),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 229/312 (73%), Positives = 258/312 (83%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC KSYGG L+P FY  SCP+A EIV SVVAKAVA+E RMAASL+RLHFHDCFV+GCD
Sbjct  19    LCLCDKSYGGKLFPGFYAHSCPQAGEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDSSG I SEK SNPN  SARGF+V+D+IKA LE +CP TVSCAD L LAARDS+V
Sbjct  79    GSLLLDSSGRIVSEKGSNPNSRSARGFDVVDQIKAELEKQCPGTVSCADALTLAARDSSV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+W V LGRRDSR  SLSGSNNNIPAPNNTFQTIL+KF  QGLD+ DLVALSGSHT
Sbjct  139   LTGGPSWVVSLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD ++  +FDN
Sbjct  199   IGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQILSVLDIISAAKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNL+  KGLLNSDQVL   +  S +LVK YAE+   FF+ FA+SM+KMGNISPLTG 
Sbjct  259   SYFKNLIENKGLLNSDQVLFNSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGS  318

Query  337   SGEIRKNCRKIN  302
             SGEIRKNCRKIN
Sbjct  319   SGEIRKNCRKIN  330



>emb|CDX75574.1| BnaA01g01280D [Brassica napus]
Length=331

 Score =   411 bits (1056),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 232/331 (70%), Positives = 267/331 (81%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S F   ++LL    + LC +SYGG L P +Y  SCP+A EIV SVVA+AVA+E R
Sbjct  1     MAR-LSSFLFVLSLLCVLPIYLCQQSYGGKLNPGYYAHSCPQAGEIVRSVVAQAVARETR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLDSSG I SEK SNPN  SARGFEV+D+IKA LE +C
Sbjct  60    MAASLMRLHFHDCFVQGCDGSLLLDSSGRIVSEKSSNPNSKSARGFEVVDQIKAQLEKQC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADIL LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTIL+K
Sbjct  120   PGTVSCADILTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+S
Sbjct  180   FNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD V+  +FDNSYFKNL+   GLLNSDQVL + +  S  LVK YAE+   FF
Sbjct  240   GGDQNLSVLDIVSAAKFDNSYFKNLIENMGLLNSDQVLFSSNDKSRDLVKKYAEDQGEFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG SGEIRK+CRKIN
Sbjct  300   EQFAESMIKMGNISPLTGSSGEIRKDCRKIN  330



>emb|CDM82668.1| unnamed protein product [Triticum aestivum]
Length=335

 Score =   411 bits (1056),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 270/335 (81%), Gaps = 12/335 (4%)
 Frame = -1

Query  1267  MAIALLYSAQLCLCSK-----------SYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA +++    LCL S             YGG L+PQFYD SCP+A+EIV S+VA+AVA+E
Sbjct  1     MATSMVCLVALCLVSPLLLAGAVHGNPGYGG-LFPQFYDHSCPKAKEIVHSMVAQAVARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPN+NS RGFEV+D+IKAALEA
Sbjct  60    TRMAASLVRLHFHDCFVKGCDASVLLDNSTNIISEKGSNPNKNSLRGFEVVDQIKAALEA  119

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
              CP TVSCADILALAARDST+L GGP W+VPLGRRDS G S+ GSN  IPAPNNT  TI+
Sbjct  120   ACPGTVSCADILALAARDSTILVGGPFWDVPLGRRDSLGASIQGSNQGIPAPNNTLPTII  179

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             TKFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN L D TLD S+AA+LR  CP
Sbjct  180   TKFKRLGLNVVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGLADGTLDVSFAAQLRQGCP  239

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             +SGGD  LF LD V+ T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  L
Sbjct  240   RSGGDDNLFPLDAVSSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDVHL  299

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             FFQHFA+SMV MGNI+PLTG  GEIRKNCR++N++
Sbjct  300   FFQHFAQSMVNMGNITPLTGSQGEIRKNCRRLNNF  334



>gb|EMT08941.1| Peroxidase 72 [Aegilops tauschii]
Length=335

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
              YGG L+PQFYD SCP+A+EIV S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD
Sbjct  28    GYGG-LFPQFYDHSCPKAKEIVHSIVAQAVARETRMAASLVRLHFHDCFVKGCDASVLLD  86

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
             +S +I SEK SNPN+NS RGFEV+D+IKAALEA CP TVSCADILALAARDST+L GGP 
Sbjct  87    NSTNIISEKGSNPNKNSLRGFEVVDQIKAALEAACPGTVSCADILALAARDSTILVGGPF  146

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             W+VPLGRRDS G S+ GSN  IPAPNNT  TI+TKFK  GL++VD+VALSG HTIG +RC
Sbjct  147   WDVPLGRRDSLGASIQGSNQGIPAPNNTLPTIITKFKRLGLNVVDVVALSGGHTIGLSRC  206

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
              SFRQRLYNQ+GN L D TLD S+AA+LR  CP+SGGD  LF LD VT T+FDN YFKN+
Sbjct  207   TSFRQRLYNQSGNGLADGTLDVSFAAQLRQGCPRSGGDNHLFPLDAVTSTKFDNFYFKNI  266

Query  499   LAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRK  320
             LA +GLL+SD+VL+TKSA +  LVKAYA +  LFFQHFA+SMV MGNI+PLTG  GEIRK
Sbjct  267   LAGRGLLSSDEVLLTKSAETAALVKAYANDVHLFFQHFAQSMVNMGNITPLTGSQGEIRK  326

Query  319   NCRKINHY  296
             NCR++N++
Sbjct  327   NCRRLNNF  334



>ref|XP_006299700.1| hypothetical protein CARUB_v10015891mg [Capsella rubella]
 gb|EOA32598.1| hypothetical protein CARUB_v10015891mg [Capsella rubella]
Length=338

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 232/338 (69%), Positives = 272/338 (80%), Gaps = 7/338 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSK--SYGGY----LYPQFYDRSCPRAQEIVESvvaka  1133
             MA+ +  F + + L Y+  LC+C    +YGG     L+P FY  SCPRA+EIV SVVAKA
Sbjct  1     MAR-IGSFLVLLYLTYALTLCICDDETNYGGSERGNLFPGFYRSSCPRAEEIVRSVVAKA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             V++E RMAASL+RLHFHDCFV+GCD S+LLD+SG+I +EK SNPN  SARG+EV+DEIKA
Sbjct  60    VSRETRMAASLMRLHFHDCFVQGCDGSLLLDTSGNIVTEKNSNPNSRSARGYEVVDEIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE+ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALESECPNTVSCADALTLAARDSSVLTGGPSWTVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TI+++F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NTIVSRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCPKSGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YAE
Sbjct  240   QRCPKSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + E FF+ FA+SMVKMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   DQEEFFEQFAESMVKMGNISPLTGSSGEIRKNCRKINN  337



>ref|XP_009144604.1| PREDICTED: peroxidase 49-like [Brassica rapa]
Length=331

 Score =   410 bits (1054),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 232/331 (70%), Positives = 267/331 (81%), Gaps = 1/331 (0%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S F   ++LL    + LC +SYGG L P +Y  SCP+A EIV SVVA+AVA+E R
Sbjct  1     MAR-LSSFLFVLSLLCVLPIYLCQQSYGGKLNPGYYAHSCPQAGEIVRSVVAQAVARETR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLDSSG I SEK SNPN  SARGFEV+D+IKA LE +C
Sbjct  60    MAASLMRLHFHDCFVQGCDGSLLLDSSGRIVSEKSSNPNSKSARGFEVVDQIKAQLEKQC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVS ADIL LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTIL+K
Sbjct  120   PGTVSGADILTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSK  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+S
Sbjct  180   FNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD V+  +FDNSYFKNL+   GLLNSDQVL + +  S  LVK YAE+ E FF
Sbjct  240   GGDQNLSVLDIVSAAKFDNSYFKNLIENMGLLNSDQVLFSSNDKSRDLVKKYAEDQEEFF  299

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG SGEIRK+CRKIN
Sbjct  300   EQFAESMIKMGNISPLTGSSGEIRKDCRKIN  330



>dbj|BAM05630.1| peroxidase 1, partial [Eucalyptus pilularis]
Length=264

 Score =   407 bits (1045),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 216/263 (82%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -1

Query  1090  HFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCAD  911
             HFHDCFVKGCDAS+LLDSSG+I SEKRS PN NSARGFEV+DEIK+ALE ECP TVSCAD
Sbjct  1     HFHDCFVKGCDASLLLDSSGTIVSEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCAD  60

Query  910   ILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDL  731
             +L LAARDSTVL GGP+W VPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKL+GLD+
Sbjct  61    LLTLAARDSTVLTGGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDI  120

Query  730   VDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFH  551
             VDLVALSGSHTIGNARC +FRQRLYNQTGN  PD+TLDQSYAA+LRTRCP+SGGDQTLF 
Sbjct  121   VDLVALSGSHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQTLFF  180

Query  550   LDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMV  371
             LDFV+P +FDNSYFKNLLA KGLL+SD+VLVT+S A+LQLVK YA N ELFF+ FAKSMV
Sbjct  181   LDFVSPIKFDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMV  240

Query  370   KMGNISPLTGFSGEIRKNCRKIN  302
             KMGNI+PLTG  G+IRK CR++N
Sbjct  241   KMGNITPLTGSKGQIRKRCRQVN  263



>ref|XP_006412001.1| hypothetical protein EUTSA_v10025683mg [Eutrema salsugineum]
 gb|ESQ53454.1| hypothetical protein EUTSA_v10025683mg [Eutrema salsugineum]
Length=330

 Score =   409 bits (1051),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 226/307 (74%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = -1

Query  1222  KSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsill  1043
             K YGG L+P FY RSCP+A+EIV SVVAKAVA+E RMAASLLRLHFHDCFV+GCD S+LL
Sbjct  23    KGYGGKLFPGFYARSCPQAEEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDGSLLL  82

Query  1042  dssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGP  863
             DSSG I SEK SNPN  SARGFEV+D+IKA LE ECP  VSCAD+L LAARDSTV++GGP
Sbjct  83    DSSGGIVSEKSSNPNSKSARGFEVVDQIKAQLEKECPGIVSCADVLTLAARDSTVISGGP  142

Query  862   NWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNAR  683
             +W VPLGRRDSR  SLSGSNNNIPAPNNTFQTIL++F  QGLD+ DLVALSGSHTIG +R
Sbjct  143   SWVVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSRFNRQGLDVTDLVALSGSHTIGFSR  202

Query  682   CVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKN  503
             C SFRQRLYNQ G+  PD TL+QS+AA LR RCP+SGGDQ L  LD V+  RFDNSYF+N
Sbjct  203   CTSFRQRLYNQNGDGRPDMTLEQSFAANLRQRCPRSGGDQILSKLDMVSAARFDNSYFRN  262

Query  502   LLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L+   GLLNSDQVL + +  S +LVK YAE+   FF+ FA+SM+KMGNISPLTG SGEIR
Sbjct  263   LVQNMGLLNSDQVLFSSNDQSRELVKKYAEDQGEFFRQFAQSMIKMGNISPLTGSSGEIR  322

Query  322   KNCRKIN  302
             KNCRKIN
Sbjct  323   KNCRKIN  329



>ref|XP_006296673.1| hypothetical protein CARUB_v10016420mg, partial [Capsella rubella]
 gb|EOA29571.1| hypothetical protein CARUB_v10016420mg, partial [Capsella rubella]
Length=337

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 270/334 (81%), Gaps = 6/334 (2%)
 Frame = -1

Query  1282  VSCFFMAIALLYSAQLCLCSK--SYGG----YLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             +  F + + L Y+  LC+C    +YGG     L+P FY  SCPRA+EIV+SVVAKAVA+E
Sbjct  3     IGSFLVLLYLTYALTLCICDDEDNYGGGERGNLFPGFYRSSCPRAEEIVKSVVAKAVARE  62

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARG+EV+DEIKAALE+
Sbjct  63    TRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGYEVVDEIKAALES  122

Query  940   ECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTIL  761
             ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF TI+
Sbjct  123   ECPNTVSCADALTLAARDSSVLTGGPSWIVPLGRRDSTIASLSGSNNNIPAPNNTFNTIV  182

Query  760   TKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCP  581
             ++F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR RCP
Sbjct  183   SRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLRQRCP  242

Query  580   KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSEL  401
             KSGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YAE+ E 
Sbjct  243   KSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQEE  302

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             FF+ FA+SMVKMGNISPLTG SGEIRKNCRKIN+
Sbjct  303   FFEQFAESMVKMGNISPLTGSSGEIRKNCRKINN  336



>ref|XP_010489511.1| PREDICTED: peroxidase 15 [Camelina sativa]
Length=338

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 234/338 (69%), Positives = 269/338 (80%), Gaps = 7/338 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS---KSYGGY---LYPQFYDRSCPRAQEIVESvvaka  1133
             MA+ +  F + + L Y+  LC+C     +YGG    L+P FY  SCPRA+EIV SVVA A
Sbjct  1     MAR-IGSFLVLLYLTYALTLCICDDDESNYGGERGNLFPGFYRSSCPRAEEIVRSVVANA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE+ECP+TVSCAD L LAARDS VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALESECPNTVSCADALTLAARDSAVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TI+ +F  QGLDL D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NTIVLRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQLLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             + E FF+ FA+SMVKMGNISPLTG SGEIRKNCRKIN+
Sbjct  300   DQEEFFEQFAESMVKMGNISPLTGSSGEIRKNCRKINN  337



>gb|ABD47725.1| peroxidase [Eucalyptus globulus subsp. globulus]
Length=264

 Score =   405 bits (1042),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 216/263 (82%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -1

Query  1090  HFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCAD  911
             HFHDCFVKGCDAS+LLDSSG+I SEKRS PN NSARGFEV+DEIK+ALE ECP TVSCAD
Sbjct  1     HFHDCFVKGCDASLLLDSSGTIISEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCAD  60

Query  910   ILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDL  731
             +LALAARDSTVL GGP+W VPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKL+GLD+
Sbjct  61    LLALAARDSTVLTGGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDI  120

Query  730   VDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFH  551
             VDLVALSGSHTIGNARC +FRQRLYNQTGN  PD+TLDQSYAA+LRTRCP+SGGDQ LF 
Sbjct  121   VDLVALSGSHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNLFF  180

Query  550   LDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMV  371
             LDFV+P +FDNSYFKNLLA KGLL+SD+VLVT+S A+LQLVK YA N ELFF+ FAKSMV
Sbjct  181   LDFVSPIKFDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMV  240

Query  370   KMGNISPLTGFSGEIRKNCRKIN  302
             KMGNI+PLTG  G+IRK CR++N
Sbjct  241   KMGNITPLTGSKGQIRKRCRQVN  263



>emb|CDX69223.1| BnaC01g02300D [Brassica napus]
Length=331

 Score =   408 bits (1049),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 228/312 (73%), Positives = 258/312 (83%), Gaps = 0/312 (0%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             L LC +SYGG L P +Y  SCP+A EIV SVVA+AVA+E RMAASL+RLHFHDCFV+GCD
Sbjct  19    LYLCQQSYGGKLNPGYYAHSCPQAGEIVRSVVAQAVARETRMAASLMRLHFHDCFVQGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDSSG I SEK SNPN  SARGFEV+D+IKA LE +CP TVSCADIL LAARDS+V
Sbjct  79    GSLLLDSSGRIVSEKSSNPNSKSARGFEVVDQIKAQLEKQCPGTVSCADILTLAARDSSV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTIL+KF  QGLD+ DLVALSGSHT
Sbjct  139   LTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD V+P +FDN
Sbjct  199   IGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQILSVLDKVSPAKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGF  338
             SYFKNL+   GLLNSDQVL + +  S  LVK YAE+   FF+ FA+SM+KMGNISPLTG 
Sbjct  259   SYFKNLMENMGLLNSDQVLFSSNDKSRDLVKKYAEDQGEFFEQFAESMIKMGNISPLTGS  318

Query  337   SGEIRKNCRKIN  302
             SGEIRK+CRKIN
Sbjct  319   SGEIRKDCRKIN  330



>ref|XP_010432175.1| PREDICTED: peroxidase 49 [Camelina sativa]
Length=330

 Score =   408 bits (1048),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = -1

Query  1222  KSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsill  1043
             KSYGG L+P +Y  SCP+A EIV SVVAKAVA+E RMAASLLRLHFHDCFV+GCD S+LL
Sbjct  23    KSYGGKLFPGYYAHSCPQAGEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDGSLLL  82

Query  1042  dssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGP  863
             DS G I SEK SNPN  SARGF+V+D+IKA LE +CP TVSCAD+L LAARDS+VL GGP
Sbjct  83    DSGGRIVSEKSSNPNSKSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSVLTGGP  142

Query  862   NWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNAR  683
             +W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL+KF  QGLD+ DLVALSGSHTIG +R
Sbjct  143   SWVVPLGRRDSRSASLSGSNNNIPAPNNTFSTILSKFNRQGLDVTDLVALSGSHTIGFSR  202

Query  682   CVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKN  503
             C SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD ++  +FDNSYFKN
Sbjct  203   CTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQNLSVLDIISAAKFDNSYFKN  262

Query  502   LLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L+  KGLLNSDQVL + +  S +LVK YAE+ E FF+ FA+SM+KMGNISPLTG SGEIR
Sbjct  263   LIENKGLLNSDQVLFSSNEKSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGEIR  322

Query  322   KNCRKIN  302
             KNCRK+N
Sbjct  323   KNCRKMN  329



>ref|XP_009102275.1| PREDICTED: peroxidase 15 [Brassica rapa]
Length=336

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 264/329 (80%), Gaps = 5/329 (2%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLC--SKSYGG---YLYPQFYDRSCPRAQEIVESvvakavaKEPRMA  1109
             F +  +L  S  LC+C    +YGG    L+P FY  SCPRA+EIV SVVA+AVA+E RMA
Sbjct  7     FLVLFSLACSLSLCICDDESNYGGGEGNLFPGFYRSSCPRAEEIVRSVVAQAVAREARMA  66

Query  1108  ASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPH  929
             ASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN NSARGF+V+D+IKAALE ECP 
Sbjct  67    ASLMRLHFHDCFVQGCDGSLLLDSSGSIITEKGSNPNSNSARGFDVVDQIKAALENECPG  126

Query  928   TVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFK  749
             TVSCAD+L LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL++F 
Sbjct  127   TVSCADLLTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFNTILSRFT  186

Query  748   LQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGG  569
              QGLDL DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYA  LR RCP SGG
Sbjct  187   NQGLDLTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDITLEQSYATNLRQRCPPSGG  246

Query  568   DQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQH  389
             DQ L  LD  +  +FDNSYFKNL+   GLLNSDQVL +    S +LVK YAE+ E FF+ 
Sbjct  247   DQNLSELDINSAGKFDNSYFKNLIENMGLLNSDQVLFSSKEESSELVKKYAEDQEEFFEQ  306

Query  388   FAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FA+SM+KMGN+SPLTG SGEIRKNCRKIN
Sbjct  307   FAESMIKMGNLSPLTGSSGEIRKNCRKIN  335



>ref|XP_003566714.1| PREDICTED: peroxidase 72-like [Brachypodium distachyon]
Length=334

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 261/307 (85%), Gaps = 2/307 (1%)
 Frame = -1

Query  1216  YGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsillds  1037
             YG  L+PQFYD+SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD+
Sbjct  29    YG--LFPQFYDQSCPKAKEIVQSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDN  86

Query  1036  sgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             S SI SEK SNPN NS RGFEV+D+IK ALE  CP TVSCADILALAARDSTVL GGP W
Sbjct  87    SSSIVSEKGSNPNLNSLRGFEVVDQIKVALEMACPGTVSCADILALAARDSTVLVGGPYW  146

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
             +VPLGRRDS G S+ GSNN++PAPNNT  TI+TKFK  GL++VD+VALSG HTIG +RC 
Sbjct  147   DVPLGRRDSLGASIQGSNNDLPAPNNTLPTIITKFKRLGLNIVDVVALSGGHTIGMSRCT  206

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
             SFRQRLYNQ+GN   D TLD SYAA+LR  CP+SGGD  LF LD V+P +FDN YFKN+L
Sbjct  207   SFRQRLYNQSGNGRADGTLDVSYAAQLRQGCPRSGGDNNLFPLDVVSPAKFDNLYFKNIL  266

Query  496   AYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKN  317
             A KGLL+SD+VL+TKSA +  LVKAYA++  LFFQHFA+SMV MGNI+PLTG  GEIRKN
Sbjct  267   AGKGLLSSDEVLLTKSAETAALVKAYADDVHLFFQHFAQSMVNMGNITPLTGSQGEIRKN  326

Query  316   CRKINHY  296
             CR++N+Y
Sbjct  327   CRRLNNY  333



>gb|KFK40198.1| hypothetical protein AALP_AA3G342700 [Arabis alpina]
Length=337

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 232/337 (69%), Positives = 266/337 (79%), Gaps = 7/337 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKS---YGGY---LYPQFYDRSCPRAQEIVESvvaka  1133
             MAK  S F + I+L     L +C      YGG    L+P FY RSCP+A+EIV SVVA+A
Sbjct  1     MAKIRS-FLVLISLACFLTLSICDDDENHYGGNTGNLFPSFYSRSCPKAEEIVRSVVAQA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN  SARGFEV+D+IKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDSSGSIVTEKSSNPNSRSARGFEVVDQIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE ECP  VSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF
Sbjct  120   ALENECPGIVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TIL++F  QGLD+ D+VALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR
Sbjct  180   NTILSRFNRQGLDVTDMVALSGSHTIGFSRCTSFRQRLYNQSGNGAPDTTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDEVLFSSNEESRELVKEYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + E FF+ FA+SM+KMGNISPLTG SGEIRKNCRKIN
Sbjct  300   DQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKIN  336



>emb|CDY46313.1| BnaA07g01880D [Brassica napus]
Length=336

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 264/329 (80%), Gaps = 5/329 (2%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLC--SKSYGG---YLYPQFYDRSCPRAQEIVESvvakavaKEPRMA  1109
             F +  +L  S  LC+C    +YGG    L+P FY  SCP+A+EIV SVVA+AVAKE RMA
Sbjct  7     FLVLFSLACSLSLCICDDESNYGGGEGNLFPGFYRSSCPKAEEIVRSVVAQAVAKEARMA  66

Query  1108  ASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPH  929
             ASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN NSARGF+V+D+IKAALE ECP 
Sbjct  67    ASLMRLHFHDCFVQGCDGSLLLDSSGSIITEKGSNPNSNSARGFDVVDQIKAALENECPG  126

Query  928   TVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFK  749
             TVSCAD+L LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL++F 
Sbjct  127   TVSCADLLTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFNTILSRFT  186

Query  748   LQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGG  569
              QGLDL DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYA  LR RCP SGG
Sbjct  187   NQGLDLTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDITLEQSYATNLRQRCPPSGG  246

Query  568   DQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQH  389
             DQ L  LD  +  +FDNSYFKNL+   GLLNSDQVL +    S +LVK YAE+ E FF+ 
Sbjct  247   DQNLSELDINSAGKFDNSYFKNLIENMGLLNSDQVLFSSKEESSELVKKYAEDQEEFFEQ  306

Query  388   FAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FA+SM+KMGN+SPLTG SGEIRKNCRKIN
Sbjct  307   FAESMIKMGNLSPLTGSSGEIRKNCRKIN  335



>gb|EAZ12255.1| hypothetical protein OsJ_02142 [Oryza sativa Japonica Group]
Length=362

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 264/324 (81%), Gaps = 2/324 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGY-LYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MA F     +AI    ++       S+G   L P FYD SCP+AQ+IV S+V KA  ++P
Sbjct  1     MAAFAFLLVIAIVFPLASAFPSPPVSWGQQQLDPHFYDHSCPQAQQIVASIVGKAHYQDP  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFVKGCDASILLDSS +I SEKRSNPNR+SARGFEVIDEIKAALEA 
Sbjct  61    RMAASLLRLHFHDCFVKGCDASILLDSSATIMSEKRSNPNRDSARGFEVIDEIKAALEAA  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CPHTVSCADILALAARDSTV+ GGP W VPLGRRDSRG S+ GSNN+IPAPNNT  TI+T
Sbjct  121   CPHTVSCADILALAARDSTVMTGGPGWIVPLGRRDSRGASVQGSNNDIPAPNNTLPTIIT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFKLQGLD+VDLVAL GSHTIG++RC SFRQRLYNQTGN LPD+TLD SYAA LR RCP+
Sbjct  181   KFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYNQTGNGLPDFTLDASYAAALRPRCPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSEL  401
             SGGDQ LF LD VTP RFDN Y+KNLLA++GLL+SD+VL+T  + A+ +LV+ YA + ++
Sbjct  241   SGGDQNLFFLDPVTPFRFDNQYYKNLLAHRGLLSSDEVLLTGGNPATAELVELYAADQDI  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGE  329
             FF  FA+SMVKMGNISPLTG  G 
Sbjct  301   FFAQFARSMVKMGNISPLTGGKGR  324



>ref|XP_006652285.1| PREDICTED: peroxidase 72-like [Oryza brachyantha]
Length=345

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 260/308 (84%), Gaps = 2/308 (1%)
 Frame = -1

Query  1213  GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsi--lld  1040
             GG+L+PQFY  +CP+ + +V ++VAKA A++PRMAASLLR+HFHDCFV+GCDAS+    D
Sbjct  38    GGFLFPQFYQHTCPQMEAVVGAIVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDAD  97

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
              SG +++EKRSNPNR+S RG+EVIDEIKAALE  CP TVSCADI+A+AARDSTVL GGP 
Sbjct  98    GSGRVATEKRSNPNRDSLRGYEVIDEIKAALEHACPRTVSCADIVAVAARDSTVLTGGPG  157

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WEVPLGRRDS   SLSGSNN IPAPN+T  TI+ KF+ QGLDLVDLVALSGSHTIGN+RC
Sbjct  158   WEVPLGRRDSLTASLSGSNNLIPAPNDTLATIVGKFRNQGLDLVDLVALSGSHTIGNSRC  217

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
             VSFRQRLY+Q  +  PD+TL+ +YAAELR RCP+SGGDQ LF LD V+  RFDN Y++N+
Sbjct  218   VSFRQRLYSQNNDGKPDFTLNPAYAAELRGRCPRSGGDQNLFALDPVSQFRFDNQYYRNI  277

Query  499   LAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRK  320
             LA  GLLNSD+VL+T+S  +++LV  YA ++ELFFQ FAKSMVKMGNISPLTG +GEIR 
Sbjct  278   LAMSGLLNSDEVLLTQSHETMELVHRYAASNELFFQQFAKSMVKMGNISPLTGHNGEIRM  337

Query  319   NCRKINHY  296
             NCR++NH+
Sbjct  338   NCRRVNHF  345



>gb|KFK34345.1| hypothetical protein AALP_AA5G133200 [Arabis alpina]
Length=340

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 255/302 (84%), Gaps = 0/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L PQFYD SCP+AQ IV+S+V KA + +PRMAASLLRLHFHDCFV GCD S+LLD+SG++
Sbjct  36    LSPQFYDNSCPKAQAIVQSIVVKAYSDDPRMAASLLRLHFHDCFVNGCDGSVLLDNSGTM  95

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRS PN+NSARGFEVID+IK+ LE ECP TVSCADILAL ARDSTV+ GGPNWEV L
Sbjct  96    ESEKRSEPNQNSARGFEVIDDIKSTLENECPQTVSCADILALVARDSTVITGGPNWEVYL  155

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRD+R  +L+GSNNNIP+PN+T QT++TKF L GLDL DLVAL GSHTIGN+RC +FRQ
Sbjct  156   GRRDARDANLNGSNNNIPSPNSTIQTLVTKFYLHGLDLTDLVALLGSHTIGNSRCTNFRQ  215

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYN +GNS  D TL+Q+YA+ L+  CP SG DQ LF LD+ TPT+FDN YFKNL++YKG
Sbjct  216   RLYNHSGNSDIDQTLNQNYASMLQQGCPISGDDQNLFALDYATPTKFDNYYFKNLVSYKG  275

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD++L TKS  S++LVK YAEN E FF+ FAKSMVKMGNISPLTG  GEIR+ CR++
Sbjct  276   LLSSDEILYTKSKDSMELVKLYAENEEAFFEQFAKSMVKMGNISPLTGNDGEIRRICRRV  335

Query  304   NH  299
             NH
Sbjct  336   NH  337



>ref|XP_006409192.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
 gb|ESQ50645.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
Length=336

 Score =   406 bits (1043),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 267/336 (79%), Gaps = 6/336 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS--KSYGGY---LYPQFYDRSCPRAQEIVESvvakav  1130
             MA+  S   + ++L  S  LC+     +YGG    L P FY  SCP+A+EIV+SVVA+AV
Sbjct  1     MARIGSLLVL-LSLACSLTLCIGDDESNYGGNRGNLSPGFYSSSCPKAEEIVKSVVAQAV  59

Query  1129  aKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAA  950
             A+E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+D+IKAA
Sbjct  60    ARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKSSNPNSRSARGFEVVDQIKAA  119

Query  949   LEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQ  770
             LE ECP TVSCAD+L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNNTF 
Sbjct  120   LENECPGTVSCADVLTLAARDSSVLTGGPSWMVPLGRRDSTTASLSGSNNNIPAPNNTFN  179

Query  769   TILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRT  590
             TIL++F  QGLDL DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYAA LR 
Sbjct  180   TILSRFTNQGLDLTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDSTLEQSYAANLRQ  239

Query  589   RCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAEN  410
              CP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+
Sbjct  240   MCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEESSELVKKYAED  299

Query  409   SELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              E FF+ FA+SMVKMGNISPLTG SGEIRKNCRK+N
Sbjct  300   QEEFFEQFAESMVKMGNISPLTGSSGEIRKNCRKVN  335



>ref|NP_001136736.1| uncharacterized protein LOC100216875 precursor [Zea mays]
 gb|ACF82499.1| unknown [Zea mays]
 gb|AFW79625.1| peroxidase 72 [Zea mays]
Length=341

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/301 (74%), Positives = 254/301 (84%), Gaps = 0/301 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L PQFYD SCP A++IV+SVVA+AVAKE RMAASL+RLHFHDCFVKGCDAS+LLD+S SI
Sbjct  38    LSPQFYDHSCPMAEKIVQSVVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSSSI  97

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEK SNPNRNS RGFEV+D+IKAALEA CP TVSCADILALAARDST L GGP W+V L
Sbjct  98    VSEKGSNPNRNSIRGFEVVDQIKAALEAACPGTVSCADILALAARDSTALVGGPYWDVAL  157

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS G S+ GSNN+IPAPNNT  TI+TKFK QGL++ D+VALSG HTIG +RC SFRQ
Sbjct  158   GRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNVADVVALSGGHTIGMSRCTSFRQ  217

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQTGN + D TLD SYAA LR  CP+SG D TLF LD V P +FDN Y+KNLLA +G
Sbjct  218   RLYNQTGNGMADSTLDVSYAARLRQSCPRSGADSTLFPLDVVAPAKFDNFYYKNLLAGRG  277

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL+TKSA +  LVKAYA ++ LFF+HFA+SMV MGNISPLTG  GEIRKNCR++
Sbjct  278   LLSSDEVLLTKSAETASLVKAYAADAGLFFRHFAQSMVSMGNISPLTGSQGEIRKNCRRL  337

Query  304   N  302
             N
Sbjct  338   N  338



>emb|CDY25139.1| BnaC07g03680D [Brassica napus]
Length=336

 Score =   405 bits (1040),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 264/329 (80%), Gaps = 5/329 (2%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCS--KSYGG---YLYPQFYDRSCPRAQEIVESvvakavaKEPRMA  1109
             F +  +L  S  LC+C    +YGG    L+P FY  SCP+A+EIV SVVA+AVAKE RMA
Sbjct  7     FLVLFSLACSLTLCICDDESNYGGGEGNLFPGFYRSSCPKAEEIVRSVVAQAVAKEARMA  66

Query  1108  ASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPH  929
             ASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN NSARGF+V+D+IKAALE ECP 
Sbjct  67    ASLMRLHFHDCFVQGCDGSLLLDSSGSIVTEKGSNPNSNSARGFDVVDQIKAALENECPG  126

Query  928   TVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFK  749
             TVSCAD+L LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL++F 
Sbjct  127   TVSCADLLTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFNTILSRFN  186

Query  748   LQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGG  569
              QGLDL DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYA  LR RCP SGG
Sbjct  187   NQGLDLTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDITLEQSYATNLRQRCPPSGG  246

Query  568   DQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQH  389
             DQ L  LD  +  +FDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+ E FF+ 
Sbjct  247   DQNLSELDINSAGKFDNSYFKNLIENMGLLNSDQVLFSSNEESSELVKTYAEDQEEFFEQ  306

Query  388   FAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FA+SM+KMGN+SPLTG S EIRKNCRKIN
Sbjct  307   FAESMIKMGNLSPLTGSSDEIRKNCRKIN  335



>emb|CDY25140.1| BnaC07g03670D [Brassica napus]
Length=336

 Score =   405 bits (1040),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 264/329 (80%), Gaps = 5/329 (2%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCS--KSYGG---YLYPQFYDRSCPRAQEIVESvvakavaKEPRMA  1109
             F +  +L  S  LC+C    +YGG    L+P FY  SCP+A+EIV SVVA+AVAKE RMA
Sbjct  7     FLVLFSLACSLTLCICDDESNYGGGEGNLFPGFYRSSCPKAEEIVRSVVAQAVAKEARMA  66

Query  1108  ASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPH  929
             ASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN NSARGF+V+D+IKAALE ECP 
Sbjct  67    ASLMRLHFHDCFVQGCDGSLLLDSSGSIVTEKGSNPNSNSARGFDVVDQIKAALENECPG  126

Query  928   TVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFK  749
             TVSCAD+L LAARDS+VL GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTF TIL++F 
Sbjct  127   TVSCADLLTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFNTILSRFT  186

Query  748   LQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGG  569
              QGLDL DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QSYA  LR RCP SGG
Sbjct  187   NQGLDLTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDITLEQSYATNLRQRCPPSGG  246

Query  568   DQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQH  389
             DQ L  LD  +  +FDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+ E FF+ 
Sbjct  247   DQNLSELDINSAGKFDNSYFKNLIENMGLLNSDQVLFSSNEESSELVKTYAEDQEEFFEQ  306

Query  388   FAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FA+SM+KMGN+SPLTG S EIRKNCRKIN
Sbjct  307   FAESMIKMGNLSPLTGSSDEIRKNCRKIN  335



>ref|XP_002876063.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52322.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 260/317 (82%), Gaps = 4/317 (1%)
 Frame = -1

Query  1237  LCLCSKSY----GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFV  1070
             LC+C +++       L PQFYD SCP AQ IV+S VAKA + +PRMAAS+LRLHFHDCFV
Sbjct  23    LCICYQTHESTSSASLSPQFYDNSCPNAQAIVQSYVAKAYSNDPRMAASILRLHFHDCFV  82

Query  1069  KGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAAR  890
              GCDAS+LLDSSG++ SEKRSN NR+SARGFEVIDEIK+ALE ECP TVSCAD+LAL AR
Sbjct  83    NGCDASVLLDSSGTMESEKRSNANRDSARGFEVIDEIKSALENECPETVSCADLLALVAR  142

Query  889   DSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALS  710
             DS V+ GGP+WEV LGRRD+R  SLSGS  NIP+P +T QTI+  F LQGLDL DLVAL 
Sbjct  143   DSIVICGGPSWEVNLGRRDAREASLSGSMENIPSPESTLQTIVNMFNLQGLDLTDLVALL  202

Query  709   GSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPT  530
             GSHTIGN+RC+ FRQRLYN TGN+ PD TL+Q YA+ L+  CP SG DQ LF+LD+VTPT
Sbjct  203   GSHTIGNSRCIGFRQRLYNHTGNNDPDQTLNQDYASMLQQGCPISGNDQNLFNLDYVTPT  262

Query  529   RFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISP  350
             +FDN YFKNL+ ++GLL+SD++L T+S+ ++++VK YAEN E FF+ FAKS+VKMGNISP
Sbjct  263   KFDNYYFKNLVNFRGLLSSDEILFTQSSETMEMVKFYAENEEAFFEQFAKSIVKMGNISP  322

Query  349   LTGFSGEIRKNCRKINH  299
             LTG  GEIR+ CR++NH
Sbjct  323   LTGTDGEIRRICRRVNH  339



>emb|CDY59700.1| BnaC07g51170D [Brassica napus]
Length=329

 Score =   403 bits (1036),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 270/331 (82%), Gaps = 3/331 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA+ +S F + I+LL    LCLC KSYGG L P +Y  +CP+A EIV SVVAKAVA+E R
Sbjct  1     MAR-LSSFLLVISLLCFLPLCLCHKSYGGKLSPGYYAHTCPQAGEIVRSVVAKAVARETR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASL+RLHFHDCFV+GCD S+LLDS G I+SEK SNPNR SARGF+V+D+IKA LE EC
Sbjct  60    MAASLIRLHFHDCFVQGCDGSLLLDSRGRITSEKNSNPNRKSARGFDVVDQIKAQLEKEC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCAD L LAARDS+   GGP+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTILTK
Sbjct  120   PGTVSCADALTLAARDSST--GGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILTK  177

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             FK QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+S
Sbjct  178   FKRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRS  237

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFF  395
             GGDQ L  LD V+P +FDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+   FF
Sbjct  238   GGDQILSVLDKVSPAKFDNSYFKNLMENMGLLNSDQVLFSSNDKSRELVKKYAEDQGEFF  297

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + FA+SM+KMGNISPLTG SGEIRK+CRKIN
Sbjct  298   KQFAESMIKMGNISPLTGSSGEIRKSCRKIN  328



>ref|XP_009129875.1| PREDICTED: peroxidase 49-like [Brassica rapa]
Length=338

 Score =   404 bits (1037),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 226/308 (73%), Positives = 255/308 (83%), Gaps = 0/308 (0%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
             S+S GG L P FY  SCP+A EIV SVVA+AVA+E RMAASL+RLHFHDCFV+GCD S+L
Sbjct  30    SQSNGGKLNPGFYAHSCPQAGEIVRSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLL  89

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LDSSG I SEK SNPN  SARGFEV+D+IKA LE +CP TVSCADIL LAARDS+VL GG
Sbjct  90    LDSSGRIVSEKSSNPNSKSARGFEVVDQIKAQLEKQCPGTVSCADILTLAARDSSVLTGG  149

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P+W VPLGRRDSR  SLSGSNNNIPAPNNTFQTIL+KF  QGLD+ DLVALSGSHTIG +
Sbjct  150   PSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHTIGFS  209

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SGGDQ L  LD V+  +FDNSYFK
Sbjct  210   RCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQNLSVLDIVSAAKFDNSYFK  269

Query  505   NLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEI  326
             NL+   GLLNSDQVL + +  S  LVK YAE+ E FF+ FA+SM+KMGNISPLTG SGEI
Sbjct  270   NLIENMGLLNSDQVLFSSNDKSRDLVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGEI  329

Query  325   RKNCRKIN  302
             RK+CRKIN
Sbjct  330   RKDCRKIN  337



>emb|CDM82669.1| unnamed protein product [Triticum aestivum]
Length=333

 Score =   403 bits (1036),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 258/307 (84%), Gaps = 2/307 (1%)
 Frame = -1

Query  1216  YGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsillds  1037
             YG  L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD+
Sbjct  28    YG--LFPQFYDHSCPKAKEIVQSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDN  85

Query  1036  sgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             S SI SEK SNPN NS RGFEV+D+IK ALE  CP TVSCADILALAARDSTVL GGP W
Sbjct  86    SSSIISEKGSNPNLNSLRGFEVVDQIKVALETACPGTVSCADILALAARDSTVLVGGPYW  145

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
             +VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKF   GL++VD+VALSG HTIG +RC 
Sbjct  146   DVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFNRLGLNVVDVVALSGGHTIGLSRCT  205

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
             SFRQRLYNQ+GN L D TLD SYAA+LR  CP+SGGD  LF LD V+ T+FDN YFKN+L
Sbjct  206   SFRQRLYNQSGNGLADSTLDVSYAAQLRQGCPRSGGDNNLFPLDVVSSTKFDNFYFKNIL  265

Query  496   AYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKN  317
             A +GLL+SD+VL+TKSA +  LVKAYA +  LFFQHFA+SMV MGNI PLTG  GEIRK+
Sbjct  266   AGRGLLSSDEVLLTKSAETAALVKAYANDVHLFFQHFAQSMVNMGNIMPLTGSQGEIRKD  325

Query  316   CRKINHY  296
             CR++N+Y
Sbjct  326   CRRLNNY  332



>dbj|BAJ94181.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   403 bits (1035),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 225/334 (67%), Positives = 269/334 (81%), Gaps = 3/334 (1%)
 Frame = -1

Query  1294  MAKFVSCFF-MAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MA  +SC   + +   +   +   +  YG  L+PQFYD SCP+A+EIV+S+VA+AVA+E 
Sbjct  1     MATSMSCLLVLCLVCPFLVGVVRANPWYG--LFPQFYDHSCPKAKEIVQSIVAQAVAQET  58

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASL+RLHFHDCFVKGCDAS+LLD+S SI SEK SNPN NS RGFEV+D+IK ALE  
Sbjct  59    RMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNLNSLRGFEVVDQIKVALETA  118

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CP TVSCADILALAARDSTVL GGP W+VPLGRRDS G S+ GSNN+IPAPNNT  TI+T
Sbjct  119   CPGTVSCADILALAARDSTVLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIIT  178

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
             KFK  GL++VD+VALSG HTIG +RC SFRQRLYNQ+GN L D TLD S+AA+LR  CP+
Sbjct  179   KFKRLGLNVVDVVALSGGHTIGLSRCTSFRQRLYNQSGNGLADSTLDVSFAAQLRQGCPR  238

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELF  398
             SGGD  LF LD V+ T+FDN YFKN+LA +GLL+SD+VL+TKSA +  LVKAYA +  LF
Sbjct  239   SGGDNNLFPLDVVSSTKFDNFYFKNILAGRGLLSSDEVLLTKSAETAALVKAYANDVHLF  298

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             FQHFA+SMV MGNI PLTG  GEIRK+CR++N+Y
Sbjct  299   FQHFAQSMVNMGNIMPLTGSQGEIRKDCRRLNNY  332



>gb|ACG44598.1| peroxidase 72 precursor [Zea mays]
Length=344

 Score =   403 bits (1036),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 253/301 (84%), Gaps = 0/301 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L PQFYD SCP A++IV+SVVA+AVAKE RMAASL+RLHFHDCFVKGCDAS+LLD+S SI
Sbjct  41    LSPQFYDHSCPMAEKIVQSVVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSSSI  100

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEK SNPNRNS RGFEV+D+IKAALEA CP TVSCADILALAARDST L GGP W+V L
Sbjct  101   VSEKGSNPNRNSIRGFEVVDQIKAALEAACPGTVSCADILALAARDSTALVGGPYWDVAL  160

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS G S+ GSNN+IPAPNNT  TI+TKFK QGL++ D+VALSG HTIG +RC SFRQ
Sbjct  161   GRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNVADVVALSGGHTIGMSRCTSFRQ  220

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQTGN + D TLD SYAA  R  CP+SG D TLF LD V P +FDN Y+KNLLA +G
Sbjct  221   RLYNQTGNGMADSTLDVSYAARXRQSCPRSGADSTLFPLDVVAPAKFDNLYYKNLLAGRG  280

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL+TKSA +  LVKAYA ++ LFF+HFA+SMV MGNISPLTG  GEIRKNCR++
Sbjct  281   LLSSDEVLLTKSAETASLVKAYAADAGLFFRHFAQSMVSMGNISPLTGSQGEIRKNCRRL  340

Query  304   N  302
             N
Sbjct  341   N  341



>ref|XP_006403967.1| hypothetical protein EUTSA_v10011077mg [Eutrema salsugineum]
 gb|ESQ45420.1| hypothetical protein EUTSA_v10011077mg [Eutrema salsugineum]
Length=340

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 272/337 (81%), Gaps = 5/337 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMA-IALLYSAQLCLCSKS----YGGYLYPQFYDRSCPRAQEIVESvvakav  1130
             MAK + C  +  I+L+    +C+C ++        L PQFY+ SCP+AQ IV+S VAKA 
Sbjct  1     MAKSIMCIVLTEISLVALFHICICYQTNECTSTPSLSPQFYNSSCPKAQTIVQSFVAKAY  60

Query  1129  aKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAA  950
             + +PRMAASLLRLHFHDCFV GC+AS+LLD+SG++ SEKRS  N++SARGFEVID+IK+A
Sbjct  61    SNDPRMAASLLRLHFHDCFVNGCEASLLLDNSGTMESEKRSVSNQDSARGFEVIDDIKSA  120

Query  949   LEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQ  770
             LE ECP TVSCADILA+ ARD+TV+ GGP+WEV LGRRD+R  +L GSN+NIP  N+TF+
Sbjct  121   LENECPQTVSCADILAIVARDTTVITGGPSWEVYLGRRDAREANLKGSNDNIPLSNSTFE  180

Query  769   TILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRT  590
             +I+T F +QGLDL D+VAL GSHTIGN+RC SFRQRLYNQ+GNS  D TL+Q+YA+ L+ 
Sbjct  181   SIVTMFNVQGLDLTDVVALLGSHTIGNSRCKSFRQRLYNQSGNSDLDQTLNQNYASMLQQ  240

Query  589   RCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAEN  410
              CP SG DQ LF LD+VTPT+FDN YFKNL+ +KGLL+SD+VL TKS  S+QLVK YAEN
Sbjct  241   GCPISGDDQNLFALDYVTPTKFDNYYFKNLMTFKGLLSSDEVLFTKSRVSMQLVKLYAEN  300

Query  409   SELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              E FF+ FAKSMVKMGNISPLTG +GEIR+ CR++NH
Sbjct  301   EEAFFEQFAKSMVKMGNISPLTGTNGEIRRICRRVNH  337



>ref|NP_190668.2| peroxidase 36 [Arabidopsis thaliana]
 sp|Q9SD46.2|PER36_ARATH RecName: Full=Peroxidase 36; Short=Atperox P36; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAF01672.1| peroxidase like protein [Arabidopsis thaliana]
 dbj|BAF01724.1| peroxidase like protein [Arabidopsis thaliana]
 dbj|BAF01814.1| peroxidase like protein [Arabidopsis thaliana]
 dbj|BAF01904.1| peroxidase like protein [Arabidopsis thaliana]
 gb|AEE78735.1| peroxidase 36 [Arabidopsis thaliana]
Length=344

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 264/343 (77%), Gaps = 8/343 (2%)
 Frame = -1

Query  1312  STTALTMAKFVSCFFMAIALLYSAQLCLC-----SKSYGGYLYPQFYDRSCPRAQEIVES  1148
             + T  +MA  V      I+L+    LC+C     S S    L PQFY+ SCP AQ IV+S
Sbjct  3     TKTVKSMAGIV---LSQISLVALFPLCICYQTHQSTSSVASLSPQFYENSCPNAQAIVQS  59

Query  1147  vvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVI  968
              VA A   +PRMAAS+LRLHFHDCFV GCDAS+LLDSSG++ SEKRSN NR+SARGFEVI
Sbjct  60    YVANAYFNDPRMAASILRLHFHDCFVNGCDASVLLDSSGTMESEKRSNANRDSARGFEVI  119

Query  967   DEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPA  788
             DEIK+ALE ECP TVSCAD+LAL ARDS V+ GGP+WEV LGRRD+R  SL GS  NIP+
Sbjct  120   DEIKSALENECPETVSCADLLALVARDSIVICGGPSWEVYLGRRDAREASLIGSMENIPS  179

Query  787   PNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSY  608
             P +T QTILT F  QGLDL DLVAL GSHTIGN+RC+ FRQRLYN TGN+ PD TL+Q Y
Sbjct  180   PESTLQTILTMFNFQGLDLTDLVALLGSHTIGNSRCIGFRQRLYNHTGNNDPDQTLNQDY  239

Query  607   AAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLV  428
             A+ L+  CP SG DQ LF+LD+VTPT+FDN Y+KNL+ ++GLL+SD++L T+S  ++++V
Sbjct  240   ASMLQQGCPISGNDQNLFNLDYVTPTKFDNYYYKNLVNFRGLLSSDEILFTQSIETMEMV  299

Query  427   KAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             K YAEN   FF+ FAKSMVKMGNISPLTG  GEIR+ CR++NH
Sbjct  300   KYYAENEGAFFEQFAKSMVKMGNISPLTGTDGEIRRICRRVNH  342



>emb|CAB62621.1| peroxidase-like protein [Arabidopsis thaliana]
 gb|AAQ65158.1| At3g50990 [Arabidopsis thaliana]
Length=336

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 215/326 (66%), Positives = 258/326 (79%), Gaps = 5/326 (2%)
 Frame = -1

Query  1261  IALLYSAQLCLC-----SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLL  1097
             I+L+    LC+C     S S    L PQFY+ SCP AQ IV+S VA A   +PRMAAS+L
Sbjct  9     ISLVALFPLCICYQTHQSTSSVASLSPQFYENSCPNAQAIVQSYVANAYFNDPRMAASIL  68

Query  1096  RLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSC  917
             RLHFHDCFV GCDAS+LLDSSG++ SEKRSN NR+SARGFEVIDEIK+ALE ECP TVSC
Sbjct  69    RLHFHDCFVNGCDASVLLDSSGTMESEKRSNANRDSARGFEVIDEIKSALENECPETVSC  128

Query  916   ADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGL  737
             AD+LAL ARDS V+ GGP+WEV LGRRD+R  SL GS  NIP+P +T QTILT F  QGL
Sbjct  129   ADLLALVARDSIVICGGPSWEVYLGRRDAREASLIGSMENIPSPESTLQTILTMFNFQGL  188

Query  736   DLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTL  557
             DL DLVAL GSHTIGN+RC+ FRQRLYN TGN+ PD TL+Q YA+ L+  CP SG DQ L
Sbjct  189   DLTDLVALLGSHTIGNSRCIGFRQRLYNHTGNNDPDQTLNQDYASMLQQGCPISGNDQNL  248

Query  556   FHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKS  377
             F+LD+VTPT+FDN Y+KNL+ ++GLL+SD++L T+S  ++++VK YAEN   FF+ FAKS
Sbjct  249   FNLDYVTPTKFDNYYYKNLVNFRGLLSSDEILFTQSIETMEMVKYYAENEGAFFEQFAKS  308

Query  376   MVKMGNISPLTGFSGEIRKNCRKINH  299
             MVKMGNISPLTG  GEIR+ CR++NH
Sbjct  309   MVKMGNISPLTGTDGEIRRICRRVNH  334



>gb|EMS55762.1| Peroxidase 72 [Triticum urartu]
Length=363

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 229/363 (63%), Positives = 271/363 (75%), Gaps = 40/363 (11%)
 Frame = -1

Query  1267  MAIALLYSAQLCLCSK-----------SYGGYLYPQFYDRSCPRAQEIVESvvakavaKE  1121
             MA +++    LCL S             YGG L+PQFYD SCP+A+E+V S+VA+AVA+E
Sbjct  1     MATSMVCLVALCLVSPLLLAGAVVGNPGYGG-LFPQFYDHSCPKAKEMVHSIVAQAVARE  59

Query  1120  PRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEA  941
              RMAASL+RLHFHDCFVKGCDAS+LLD+S +I SEK SNPNRNS RGFEV+D+IK ALE 
Sbjct  60    TRMAASLVRLHFHDCFVKGCDASVLLDNSTNIVSEKGSNPNRNSIRGFEVVDQIKVALET  119

Query  940   ECPHTVSCADILALAARDSTVLA----------------------------GGPNWEVPl  845
              CP TVSCADILALAARDST+L                             GGP WEVPL
Sbjct  120   ACPGTVSCADILALAARDSTILVCSPPFLSSHKSTNPASMCDSLTLIKLQVGGPYWEVPL  179

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS G S+ GSNN+IPAPNNT  TI+TKFK  GL++VD+VALSG HTIG +RC SFRQ
Sbjct  180   GRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRLGLNVVDVVALSGGHTIGLSRCTSFRQ  239

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ+GN L D TLD S+AA+LR  CP+SGGD  LF LD V+ T+FDN YFKN+LA +G
Sbjct  240   RLYNQSGNGLADSTLDVSFAAQLRQGCPRSGGDNNLFPLDAVSSTKFDNFYFKNILAGRG  299

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LL+SD+VL+TKSA +  LVKAYA++  LFFQHFA+SMV MGNISPLTG  GEIRKNCR++
Sbjct  300   LLSSDEVLLTKSAETAALVKAYADDVHLFFQHFAQSMVNMGNISPLTGSKGEIRKNCRRL  359

Query  304   NHY  296
             N+Y
Sbjct  360   NNY  362



>gb|EMT08942.1| Peroxidase 15 [Aegilops tauschii]
Length=333

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 219/306 (72%), Positives = 255/306 (83%), Gaps = 2/306 (1%)
 Frame = -1

Query  1216  YGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsillds  1037
             YG  L+PQFYD SCP+A+EIV+S+VA+AVA+E RMAASL+RLHFHDCFVKGCDAS+LLD+
Sbjct  28    YG--LFPQFYDHSCPKAKEIVQSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDN  85

Query  1036  sgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             S SI SEK SNPN NS RGFEV+D+IK ALE  CP TVSCADILALAARDSTVL GGP W
Sbjct  86    SSSIVSEKGSNPNLNSLRGFEVVDQIKVALETACPGTVSCADILALAARDSTVLVGGPYW  145

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
             +VPLGRRDS G S+ GSNN+IPAPNNT  TI+TKF   GL++VD+VALSG HTIG  RC 
Sbjct  146   DVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFNRLGLNVVDVVALSGGHTIGLPRCT  205

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
             SFRQRLYNQ+GN L D TLD SYAA+LR  CP+SG D  LF LD V+ T+FDN YFKN+L
Sbjct  206   SFRQRLYNQSGNGLADSTLDVSYAAQLRQGCPRSGSDNNLFPLDVVSSTKFDNFYFKNIL  265

Query  496   AYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKN  317
             A +GLL+SD+VL+TKSA +  LVKAYA +  LFFQHFA+SMV MGNI PLTG  GEIRK+
Sbjct  266   AGRGLLSSDEVLLTKSAETAALVKAYANDVHLFFQHFAQSMVNMGNIMPLTGSQGEIRKD  325

Query  316   CRKINH  299
             CR++N+
Sbjct  326   CRRLNN  331



>ref|NP_179406.1| peroxidase 14 [Arabidopsis thaliana]
 sp|Q9SI17.1|PER14_ARATH RecName: Full=Peroxidase 14; Short=Atperox P14; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD31352.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEC06730.1| peroxidase 14 [Arabidopsis thaliana]
Length=337

 Score =   395 bits (1016),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 261/337 (77%), Gaps = 6/337 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLC--SKSYGGY---LYPQFYDRSCPRAQEIVESvvakav  1130
             MA+ +  F + ++L Y+  LC+C  + ++GG    L+P FY  SCPRA+EIV SVVAKA 
Sbjct  1     MAR-IGSFLILLSLTYALTLCICDNASNFGGNKRNLFPDFYRSSCPRAEEIVRSVVAKAF  59

Query  1129  aKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAA  950
              +E RMAASL+RLHFHDCFV+GCD S+LLD+SGSI +EK SNPN  SARGFEV+DEIKAA
Sbjct  60    ERETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKAA  119

Query  949   LEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQ  770
             LE ECP+TVSCAD L LAARDS+VL GGP+W VPLGRRDS   S +  N ++P P+N F 
Sbjct  120   LENECPNTVSCADALTLAARDSSVLTGGPSWTVPLGRRDSATASRAKPNKDLPEPDNLFD  179

Query  769   TILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRT  590
             TI  +F  +GL+L DLVALSGSHTIG +RC SFRQRLYNQ+G+  PD TL++SYAA LR 
Sbjct  180   TIFLRFSNEGLNLTDLVALSGSHTIGFSRCTSFRQRLYNQSGSGSPDTTLEKSYAAILRQ  239

Query  589   RCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAEN  410
             RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSDQVL + +  S +LVK YAE+
Sbjct  240   RCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAED  299

Query  409   SELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              E FF+ FA+SM+KMG ISPLTG SGEIRK CRKIN+
Sbjct  300   QEEFFEQFAESMIKMGKISPLTGSSGEIRKKCRKINN  336



>ref|XP_010426640.1| PREDICTED: peroxidase 36 [Camelina sativa]
Length=338

 Score =   395 bits (1016),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 215/341 (63%), Positives = 267/341 (78%), Gaps = 5/341 (1%)
 Frame = -1

Query  1321  LILSTTALTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvv  1142
             ++ S   + +A+F     + +++ Y    C  +      L P FY+ SCP+AQ IV+  V
Sbjct  1     MVKSIVCIVLAQFSLAALLPLSMCYRTHECTTAS-----LSPWFYENSCPKAQAIVQFFV  55

Query  1141  akavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDE  962
             AKA + +PRMAASLLRLHFHDCFV GCDAS+LLDSSG+I SEKRS  N++SARGFEVIDE
Sbjct  56    AKAYSIDPRMAASLLRLHFHDCFVNGCDASVLLDSSGTIESEKRSTSNQDSARGFEVIDE  115

Query  961   IKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPN  782
             IK+ALE ECP TVSCADILAL ARDS V+  GP WEV LGRRD+R  SLSGS  NIP+P+
Sbjct  116   IKSALENECPETVSCADILALVARDSVVICDGPTWEVYLGRRDAREASLSGSMENIPSPD  175

Query  781   NTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAA  602
             +T QTI+  F LQGLDL DLVAL GSHTIGN+RC++FRQRLYN +GN+ PD TL+Q+YA+
Sbjct  176   STLQTIVNMFNLQGLDLTDLVALLGSHTIGNSRCLNFRQRLYNHSGNNDPDQTLNQNYAS  235

Query  601   ELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKA  422
              L+  CP SG DQ LF+LD+VTPT+FDN YFKNL+ ++GLLNSD++L T+S+ S++LVK 
Sbjct  236   MLQQGCPISGEDQNLFNLDYVTPTKFDNYYFKNLVDFRGLLNSDEILFTQSSESMELVKL  295

Query  421   YAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             YAEN E FF+ FAKS+VKMGNISPLTG  GEIR+ CR++NH
Sbjct  296   YAENEEAFFEQFAKSIVKMGNISPLTGTDGEIRRICRRVNH  336



>ref|XP_009771021.1| PREDICTED: peroxidase 9-like [Nicotiana sylvestris]
 gb|AAK52085.1| peroxidase [Nicotiana tabacum]
Length=329

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 209/307 (68%), Positives = 252/307 (82%), Gaps = 1/307 (0%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
             S+GG L+P+FY  SCP+A EIV SV+ +A+AK+PRMAASLLRLHFHDCFV+GCDASILLD
Sbjct  23    SWGGGLFPEFYQFSCPQANEIVMSVLEEAIAKDPRMAASLLRLHFHDCFVQGCDASILLD  82

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
              + +  SEK + PN+NS RGFEVID+IKA LE  CPHTVSCADILALAARDSTVL+GGP+
Sbjct  83    KTSAFKSEKDAGPNKNSIRGFEVIDQIKARLEQVCPHTVSCADILALAARDSTVLSGGPH  142

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WEVPLGRRDS+  +L  +N NIPAPN+T Q ++T F  QGL   DLVALSG+HTIG ARC
Sbjct  143   WEVPLGRRDSKIANLKKANTNIPAPNSTIQNLITLFARQGLSEQDLVALSGAHTIGMARC  202

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
             VSFRQRLYNQ G++LPD TL+++Y   L+T CP+ GGD  +  LDF +P RFDN+YF+ L
Sbjct  203   VSFRQRLYNQNGDNLPDATLEKTYYTGLKTACPRIGGDNNISPLDFTSPVRFDNTYFQLL  262

Query  499   LAYKGLLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L  KGLLNSD+VL+T K   + +LVK+YAEN  LFF HFAKSMVKMGNI+PLTGF G+IR
Sbjct  263   LWGKGLLNSDEVLLTGKVKKTKELVKSYAENEALFFHHFAKSMVKMGNITPLTGFKGDIR  322

Query  322   KNCRKIN  302
             KNCR++N
Sbjct  323   KNCRRLN  329



>ref|XP_010503773.1| PREDICTED: peroxidase 36-like [Camelina sativa]
Length=339

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 213/302 (71%), Positives = 252/302 (83%), Gaps = 0/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+AQ IV+  VAKA + +PRMAASLLRLHFHDCFV GCDAS+LLDSSG+I
Sbjct  36    LSPWFYDNSCPKAQAIVQFFVAKAYSIDPRMAASLLRLHFHDCFVNGCDASVLLDSSGTI  95

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRS  NR+SARGFEVIDEIK+ALE ECP TVSCADILAL ARDS V++GGP WEV L
Sbjct  96    ESEKRSTSNRDSARGFEVIDEIKSALEYECPETVSCADILALVARDSVVISGGPTWEVYL  155

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRD+R  SLSGS  NIP P++T QTI+  F LQGLDL DLVAL GSHTIGN+RC++FRQ
Sbjct  156   GRRDAREASLSGSMENIPFPDSTLQTIVNMFNLQGLDLTDLVALLGSHTIGNSRCLNFRQ  215

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYN +GN+ PD TL+Q+YA  L+  CP SG DQ LF+LD+VTPT+FDN YFKNL+ ++G
Sbjct  216   RLYNHSGNNDPDQTLNQNYAYMLQQGCPISGEDQKLFNLDYVTPTKFDNYYFKNLVDFRG  275

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LLNSD+VL T+S+ S+++VK YAEN E FF+ FAKS+VKMGNISPL+G  GEIRK CR++
Sbjct  276   LLNSDEVLFTQSSESMEMVKLYAENEEAFFEQFAKSIVKMGNISPLSGTDGEIRKICRRV  335

Query  304   NH  299
             NH
Sbjct  336   NH  337



>ref|XP_006292998.1| hypothetical protein CARUB_v10019275mg [Capsella rubella]
 gb|EOA25896.1| hypothetical protein CARUB_v10019275mg [Capsella rubella]
Length=332

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 213/317 (67%), Positives = 258/317 (81%), Gaps = 4/317 (1%)
 Frame = -1

Query  1237  LCLCSKSY----GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFV  1070
             LC+C +++     G L P FYD SCP AQ IV+S VAKA A +PRMAAS+LRLHFHDCFV
Sbjct  14    LCMCYRTHQSTGAGSLSPWFYDNSCPNAQAIVQSFVAKAYAIDPRMAASMLRLHFHDCFV  73

Query  1069  KGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAAR  890
              GCDAS+LLDSSG+I SEKRS  NR+SARGFEVIDEIK ALE ECP TVSCADILAL AR
Sbjct  74    NGCDASLLLDSSGTIESEKRSISNRDSARGFEVIDEIKFALENECPETVSCADILALVAR  133

Query  889   DSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALS  710
             DS V+ GGP WEV LGRRD+R  SLSGS  NIP P++T QT++  F +QGLDL DLVAL 
Sbjct  134   DSIVICGGPTWEVYLGRRDAREASLSGSMENIPTPDSTLQTLVNMFNVQGLDLTDLVALL  193

Query  709   GSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPT  530
             GSHTIGN+RC++FRQRLYN +GN+ PD TL+Q+YA  L+  CP SG DQ LF+LD+VTP 
Sbjct  194   GSHTIGNSRCLNFRQRLYNHSGNNDPDQTLNQNYAYMLQQGCPISGEDQNLFNLDYVTPN  253

Query  529   RFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISP  350
             +FDN YFKNL+ ++GLLNSD++L T+S+ ++++VK YAEN E FF+ FA+S+VKMGNISP
Sbjct  254   KFDNYYFKNLVNFRGLLNSDEILFTQSSETMEMVKFYAENEEAFFEQFARSIVKMGNISP  313

Query  349   LTGFSGEIRKNCRKINH  299
             LTG SGEIR+ CR++NH
Sbjct  314   LTGTSGEIRRICRRVNH  330



>gb|ABR17480.1| unknown [Picea sitchensis]
Length=344

 Score =   394 bits (1011),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 229/343 (67%), Positives = 265/343 (77%), Gaps = 12/343 (3%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYG-----------GYLYPQFYDRSCPRAQEIVES  1148
             MA  +S     + L+ S Q    S S+G             L P +Y +SCPRA++IV S
Sbjct  1     MANTISRRLTLLQLVCSLQAFFISFSFGHPLPHPGHYPVSSLIPHYYAKSCPRAEQIVAS  60

Query  1147  vvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVI  968
             VV KAV KE RMAASLLRLHFHDCFVKGCDAS+LLD SGSI SEKRSNPNRNSARGFEV+
Sbjct  61    VVQKAVMKETRMAASLLRLHFHDCFVKGCDASLLLDDSGSIVSEKRSNPNRNSARGFEVV  120

Query  967   DEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPA  788
             D+IK+ALE  CP TVSCADILA++ RDS VL GG  WEV LGRRDS+  SLSGSNNNIPA
Sbjct  121   DQIKSALEQACPKTVSCADILAISVRDSVVLRGGLGWEVLLGRRDSKSASLSGSNNNIPA  180

Query  787   PNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSY  608
             PN+T QT+ TKF LQGL+ VDLVALSGSHTIG +RC SFRQRLYNQ+GN  PD+TLD+SY
Sbjct  181   PNSTLQTLTTKFNLQGLNEVDLVALSGSHTIGLSRCTSFRQRLYNQSGNGQPDFTLDKSY  240

Query  607   AAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKS-AASLQL  431
             A +L++ CPKSGGD  LF LDFV+PT+FDN YFKNLL+  GLLN+D+ L +K  A + +L
Sbjct  241   ATQLKSGCPKSGGDNNLFPLDFVSPTKFDNYYFKNLLSGHGLLNTDEELFSKGQAKTRKL  300

Query  430   VKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             VK YAEN ELF + FA SMVKMGNI PLTG +GEIR NCRK+N
Sbjct  301   VKEYAENEELFLKQFALSMVKMGNIKPLTGSNGEIRVNCRKVN  343



>gb|ADP95696.1| class III heme peroxidase [Brassica rapa]
Length=296

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 218/293 (74%), Positives = 246/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1180  SCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNP  1001
             SCP+A EIV SVVA+AVA+E RMAASL+RLHFHDCFV+GCD S+LLDSSG I SEK SNP
Sbjct  3     SCPQAGEIVRSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLLLDSSGRIVSEKSSNP  62

Query  1000  NRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgn  821
             N  SARGFEV+D+IKA LE +CP TVSCADIL LAARDS+VL GGP+W VPLGRRDSR  
Sbjct  63    NSKSARGFEVVDQIKAQLEKQCPGTVSCADILTLAARDSSVLTGGPSWMVPLGRRDSRSA  122

Query  820   slsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGN  641
             SLSGSNNNIPAPNNTFQTIL+KF  QGLD+ DLVALSGSHTIG +RC SFRQRLYNQ+GN
Sbjct  123   SLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGN  182

Query  640   SLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVL  461
               PD TL+QS+AA LR RCPKSGGDQ L  LD V+  +FDNSYFKNL+   GLLNSDQVL
Sbjct  183   GRPDMTLEQSFAANLRQRCPKSGGDQNLSVLDIVSAAKFDNSYFKNLIENMGLLNSDQVL  242

Query  460   VTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
              + +  S  LVK YAE+  +FF+ FA+SM+KMGNISPLTG SGEIRK+CRKIN
Sbjct  243   FSSNDKSRDLVKKYAEDQGVFFEQFAESMIKMGNISPLTGSSGEIRKDCRKIN  295



>ref|XP_008667349.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88307.1| unknown [Zea mays]
 tpg|DAA37837.1| TPA: hypothetical protein ZEAMMB73_314334 [Zea mays]
Length=340

 Score =   391 bits (1005),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 215/325 (66%), Positives = 256/325 (79%), Gaps = 3/325 (1%)
 Frame = -1

Query  1261  IALLYSAQLCLCSKSYGGY-LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHF  1085
             +A+L S  +C      GG  L P FY  +CP+ + IV S+VAKA A++PRMAASLLR+HF
Sbjct  16    LAVLSSVLICSGHPVPGGLPLLPHFYGHACPQMEAIVGSLVAKAHAEDPRMAASLLRMHF  75

Query  1084  HDCFVKGCDAsilldssgsi--sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCAD  911
             HDCFV+GCDAS+LLD+ GS    +EKRSNPN++S RGFEVIDEIKAALE  CPHTVSCAD
Sbjct  76    HDCFVQGCDASVLLDADGSGRFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPHTVSCAD  135

Query  910   ILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDL  731
             I+A+AARDS VL GGP WEVPLGRRDS   SLSGSNN IPAPN++  TI+ KF  QGLD+
Sbjct  136   IVAVAARDSVVLTGGPGWEVPLGRRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDI  195

Query  730   VDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFH  551
             VDLVALSG HTIG++RCVSFRQRLY Q  N   D TL+ +YAAELR RCP+SGGDQ LF 
Sbjct  196   VDLVALSGGHTIGDSRCVSFRQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFA  255

Query  550   LDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMV  371
             LD VT  RFDN Y+ N+LA  GLL+SD++L+T+S  ++ LV  YA +  LFF HFAKSMV
Sbjct  256   LDLVTQFRFDNQYYHNILAMNGLLSSDEILLTQSRETMDLVHRYAADQGLFFDHFAKSMV  315

Query  370   KMGNISPLTGFSGEIRKNCRKINHY  296
             KMGNISPLTG +GEIR NCR++NH+
Sbjct  316   KMGNISPLTGSAGEIRHNCRRVNHF  340



>gb|ABK26974.1| unknown [Picea sitchensis]
Length=344

 Score =   391 bits (1004),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 219/302 (73%), Positives = 252/302 (83%), Gaps = 1/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P +Y +SCPRA++IV SVV KAV KE RMAASLLRLHFHDCFVKGCDAS+LLD SGSI
Sbjct  42    LIPHYYAKSCPRAEQIVASVVQKAVMKETRMAASLLRLHFHDCFVKGCDASLLLDDSGSI  101

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRSNPNRNSARGFEV+D+IK+ALE  CP TVSCADILA++ARDS VL GG  WEV L
Sbjct  102   VSEKRSNPNRNSARGFEVVDQIKSALEQACPKTVSCADILAISARDSVVLRGGLGWEVLL  161

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS+  SLSGSNNNIP PN+T QT+ TKFKLQGL  VDLVALSGSHTIG +RC SFRQ
Sbjct  162   GRRDSKSASLSGSNNNIPQPNSTLQTLTTKFKLQGLHEVDLVALSGSHTIGLSRCTSFRQ  221

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ+GN  PD+TLD+SYA +L++ CPKSGGD  LF LDFV+PT+FDN YFKNLL+  G
Sbjct  222   RLYNQSGNGQPDFTLDKSYATQLKSGCPKSGGDNNLFPLDFVSPTKFDNYYFKNLLSGHG  281

Query  484   LLNSDQVLVTKS-AASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             LLN+D+ L +K  A + +LVK YAEN ELF + +A SMVKMGN+ PLTG +GEIR NCRK
Sbjct  282   LLNTDEELFSKGQAKTRKLVKEYAENKELFLKQYALSMVKMGNMKPLTGSNGEIRVNCRK  341

Query  307   IN  302
             +N
Sbjct  342   VN  343



>ref|XP_010515480.1| PREDICTED: peroxidase 36-like [Camelina sativa]
Length=339

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 248/302 (82%), Gaps = 0/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+AQ IV+  VAKA + +PRMAASLLRLHFHDCFV GCDAS+LLDSSG+I
Sbjct  36    LSPWFYDNSCPKAQAIVQVFVAKAYSIDPRMAASLLRLHFHDCFVNGCDASVLLDSSGTI  95

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEKRS  NR+SARGFEVIDEIK+ALE ECP TVSCADILAL ARDS  + GGP WEV L
Sbjct  96    ESEKRSTSNRDSARGFEVIDEIKSALEYECPETVSCADILALVARDSVAICGGPTWEVYL  155

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRD+R  SLSGS  NIP P++T QTI+  F LQGLDL DLVAL GSHTIGN+RC++FRQ
Sbjct  156   GRRDAREASLSGSMENIPFPDSTLQTIVNMFNLQGLDLTDLVALLGSHTIGNSRCLNFRQ  215

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYN +GN+ PD TL+Q+YA  L+  CP SG DQ LF+LD+VTPT+FDN YFKNL+ ++G
Sbjct  216   RLYNHSGNNDPDQTLNQNYAYMLQQGCPISGEDQKLFNLDYVTPTKFDNYYFKNLVDFRG  275

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
             LLNSD+VL T+S+ S+++VK YAEN E FF+ F KS+VKMGNISPL G  GEIR+ CR++
Sbjct  276   LLNSDEVLFTQSSESMEMVKLYAENDEAFFEQFTKSIVKMGNISPLLGTDGEIRRTCRRV  335

Query  304   NH  299
             NH
Sbjct  336   NH  337



>dbj|BAM05631.1| peroxidase 1, partial [Eucalyptus pilularis]
Length=256

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 208/256 (81%), Positives = 231/256 (90%), Gaps = 0/256 (0%)
 Frame = -1

Query  1066  GCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARD  887
             GCDAS+LLDSSG+I SEKRS PN NSARGFEV+DEIK+ALE ECP TVSCAD+L LAARD
Sbjct  1     GCDASLLLDSSGTIVSEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCADLLTLAARD  60

Query  886   STVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSG  707
             STVL GGP+W VPLGRRDS G SLSGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSG
Sbjct  61    STVLTGGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSG  120

Query  706   SHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTR  527
             SHTIGNARC +FRQRLYNQTGN  PD+TLDQSYAA+LRTRCP+SGGDQTLF LDFV+P +
Sbjct  121   SHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQTLFFLDFVSPIK  180

Query  526   FDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPL  347
             FDNSYFKNLLA KGLL+SD+VLVT+S A+LQLVK YA N ELFF+ FAKSMVKMGNI+PL
Sbjct  181   FDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPL  240

Query  346   TGFSGEIRKNCRKINH  299
             TG  G+IRK CR++N 
Sbjct  241   TGSKGQIRKRCRQVNK  256



>gb|EAY94133.1| hypothetical protein OsI_15906 [Oryza sativa Indica Group]
Length=345

 Score =   389 bits (998),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 255/309 (83%), Gaps = 3/309 (1%)
 Frame = -1

Query  1213  GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldss  1034
             GG+L+PQFY  +CP+ + +V  +VA+A A++PRMAASLLR+HFHDCFV+GCDAS+LLD+ 
Sbjct  37    GGFLFPQFYQHTCPQMEAVVGGIVARAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDAD  96

Query  1033  gsi--sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
             GS   ++EKRSNPNR+S RG+EVIDEIKAALE  CP TVSCADI+A+AARDST L GGP 
Sbjct  97    GSGRFATEKRSNPNRDSLRGYEVIDEIKAALEHACPRTVSCADIVAVAARDSTALTGGPW  156

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WEVPLGRRDS   SLSGSNN IPAPN+T  TI+ KF+ QGLD+VDLVALSG HTIGN+RC
Sbjct  157   WEVPLGRRDSLTASLSGSNNLIPAPNDTLPTIVGKFRNQGLDVVDLVALSGGHTIGNSRC  216

Query  679   VSFRQRLYNQ-TGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKN  503
             VSFRQRLY Q   +  PD+TL+ +YAAELR RCP SGGDQ LF LD  +  RFDN Y++N
Sbjct  217   VSFRQRLYGQLNSDGKPDFTLNPAYAAELRERCPSSGGDQNLFALDPASQFRFDNQYYRN  276

Query  502   LLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             +LA  GLL+SD+VL+TKS  +++LV  YA ++ELFF  FAKSMVKMG+ISPLTG +GEIR
Sbjct  277   ILAMNGLLSSDEVLLTKSQETMELVHRYAASNELFFAQFAKSMVKMGSISPLTGHNGEIR  336

Query  322   KNCRKINHY  296
              NCR++NH+
Sbjct  337   MNCRRVNHF  345



>ref|XP_002446477.1| hypothetical protein SORBIDRAFT_06g016610 [Sorghum bicolor]
 gb|EES10805.1| hypothetical protein SORBIDRAFT_06g016610 [Sorghum bicolor]
Length=349

 Score =   389 bits (998),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 210/305 (69%), Positives = 248/305 (81%), Gaps = 2/305 (1%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD +CP+ Q IV S+VAKA A++PRMAASLLR+HFHDCFV+GCDAS+LLD+ GS 
Sbjct  45    LQPHFYDHACPQMQAIVGSIVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSG  104

Query  1024  --sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEV  851
                +EKRSNPN++S RGFEVIDEIKAALE  CPHTVSCADI+A+AARDS VL GGP WEV
Sbjct  105   RFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPHTVSCADIVAVAARDSVVLTGGPGWEV  164

Query  850   PlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSF  671
             PLGRRDS   SLSGSNN IPAPN++  TI+ KF  QGLD+VDLVALSG HTIG++RCVSF
Sbjct  165   PLGRRDSLTASLSGSNNLIPAPNDSLPTIIVKFANQGLDVVDLVALSGGHTIGDSRCVSF  224

Query  670   RQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAY  491
             RQRLY Q  N   D TL+ +YAAELR RCP+SGGDQ LF LD  T  RFDN Y+ N+LA 
Sbjct  225   RQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDQATQFRFDNLYYHNILAM  284

Query  490   KGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
              GLL+SD++L+T+S  +++LV  YA +  LFF HFAKSMVKMGNISPLTG +GEIR NCR
Sbjct  285   NGLLSSDEILLTQSRETMELVHRYAADQGLFFDHFAKSMVKMGNISPLTGTAGEIRHNCR  344

Query  310   KINHY  296
             ++NH+
Sbjct  345   RVNHF  349



>emb|CDX77970.1| BnaA09g31650D [Brassica napus]
Length=337

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 264/337 (78%), Gaps = 5/337 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMA-IALLYSAQLCLCSKSY----GGYLYPQFYDRSCPRAQEIVESvvakav  1130
             MAK V C  +  I L+    LC+ S++        L PQFYD SCP+AQ IV+S VAKA 
Sbjct  1     MAKPVMCIVLTQIVLVALFHLCMSSQTKECTSTSSLSPQFYDNSCPKAQAIVQSFVAKAH  60

Query  1129  aKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAA  950
             + +PRMAASLLRLHFHDCFV GCD S+LLD+SG+I SEKR+  N +SARGFEVID+IK+A
Sbjct  61    SNDPRMAASLLRLHFHDCFVNGCDGSLLLDNSGTIESEKRAVTNVDSARGFEVIDDIKSA  120

Query  949   LEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQ  770
             LE ECP TVSCADILAL ARD+TV+ GGP+WEV LGRRD+R  SL  SNNNIP  ++TF+
Sbjct  121   LEDECPQTVSCADILALVARDTTVITGGPSWEVYLGRRDAREASLIASNNNIPVVSSTFE  180

Query  769   TILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRT  590
             TI+TKF  QGL L+DLVAL G HTIGN+RC SFR+RLYN +GNS  D TL+Q+YA+ L+ 
Sbjct  181   TIVTKFNDQGLGLIDLVALLGGHTIGNSRCKSFRKRLYNHSGNSDRDQTLNQNYASMLQQ  240

Query  589   RCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAEN  410
              CP SG DQ LF LD++TP +FDN YFKNL+ +KGLL+SD++L TKS  S++LVK Y  N
Sbjct  241   GCPISGDDQNLFALDYMTPNKFDNYYFKNLMTFKGLLSSDEILYTKSRDSMELVKLYGAN  300

Query  409   SELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              ELFF+ +AKSMVKMGNISPLTG +GEIR+ CR++NH
Sbjct  301   EELFFEQYAKSMVKMGNISPLTGRNGEIRRICRRVNH  337



>ref|NP_001052799.1| Os04g0423800 [Oryza sativa Japonica Group]
 emb|CAE05415.1| OSJNBa0035I04.3 [Oryza sativa Japonica Group]
 emb|CAE05954.3| OSJNBb0088C09.13 [Oryza sativa Japonica Group]
 tpe|CAH69296.1| TPA: class III peroxidase 54 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF14713.1| Os04g0423800 [Oryza sativa Japonica Group]
 emb|CAH66486.1| OSIGBa0076I14.7 [Oryza sativa Indica Group]
 dbj|BAG98581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 255/309 (83%), Gaps = 3/309 (1%)
 Frame = -1

Query  1213  GGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldss  1034
             GG+L+PQFY  +CP+ + +V  +VA+A A++PRMAASLLR+HFHDCFV+GCDAS+LLD+ 
Sbjct  37    GGFLFPQFYQHTCPQMEAVVGGIVARAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDAD  96

Query  1033  gsi--sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
             GS   ++EKRSNPNR+S RG+EVIDEIKAALE  CP TVSCADI+A+AARDST L GGP 
Sbjct  97    GSGRFATEKRSNPNRDSLRGYEVIDEIKAALEHACPRTVSCADIVAVAARDSTALTGGPW  156

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WEVPLGRRDS   SLSGSNN IPAPN+T  TI+ KF+ QGLD+VDLVALSG HTIGN+RC
Sbjct  157   WEVPLGRRDSLTASLSGSNNLIPAPNDTLPTIVGKFRNQGLDVVDLVALSGGHTIGNSRC  216

Query  679   VSFRQRLYNQ-TGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKN  503
             VSFRQRLY Q   +  PD+TL+ +YAAELR RCP SGGDQ LF LD  +  RFDN Y++N
Sbjct  217   VSFRQRLYGQLNSDGKPDFTLNPAYAAELRERCPSSGGDQNLFALDPASQFRFDNQYYRN  276

Query  502   LLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             +LA  GLL+SD+VL+TKS  +++LV  YA ++ELFF  FAKSMVKMG+ISPLTG +GEIR
Sbjct  277   ILAMNGLLSSDEVLLTKSRETMELVHRYAASNELFFAQFAKSMVKMGSISPLTGHNGEIR  336

Query  322   KNCRKINHY  296
              NCR++NH+
Sbjct  337   MNCRRVNHF  345



>ref|XP_009115779.1| PREDICTED: peroxidase 36 [Brassica rapa]
Length=337

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 263/337 (78%), Gaps = 5/337 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMA-IALLYSAQLCLCSKSY----GGYLYPQFYDRSCPRAQEIVESvvakav  1130
             MAK V C  +  I L+    LC+ S++        L PQFYD SCP+AQ IV+S VAKA 
Sbjct  1     MAKPVMCIVLTQIVLVALFHLCMSSQTKECTSTSSLSPQFYDNSCPKAQAIVQSFVAKAH  60

Query  1129  aKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAA  950
             + +PRMAASLLRLHFHDCFV GCD S+LLD+SG+I SEKR+  N +SARGFEVID+IK+A
Sbjct  61    SNDPRMAASLLRLHFHDCFVNGCDGSLLLDNSGTIESEKRAVTNVDSARGFEVIDDIKSA  120

Query  949   LEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQ  770
             LE ECP TVSCADILAL ARD+TV+ GGP+WEV LGRRD+R   L  SNNNIP  ++TF+
Sbjct  121   LEDECPQTVSCADILALVARDTTVITGGPSWEVYLGRRDAREACLIASNNNIPVVSSTFE  180

Query  769   TILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRT  590
             TI+TKF  QGL L+DLVAL G HTIGN+RC SFR+RLYN +GNS  D TL+Q+YA+ L+ 
Sbjct  181   TIVTKFNDQGLGLIDLVALLGGHTIGNSRCKSFRKRLYNHSGNSDRDQTLNQNYASMLQQ  240

Query  589   RCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAEN  410
              CP SG DQ LF LD++TP +FDN YFKNL+ +KGLL+SD++L TKS  S++LVK Y  N
Sbjct  241   GCPISGDDQNLFALDYMTPNKFDNYYFKNLMTFKGLLSSDEILYTKSRDSMELVKLYGAN  300

Query  409   SELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              ELFF+ +AKSMVKMGNISPLTG +GEIR+ CR++NH
Sbjct  301   EELFFEQYAKSMVKMGNISPLTGRNGEIRRICRRVNH  337



>dbj|BAM05632.1| peroxidase 1, partial [Eucalyptus pyrocarpa]
Length=254

 Score =   382 bits (982),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -1

Query  1018  EKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgr  839
             EKRS PN NSARGFEV+DEIK+ALE ECP TVSCAD+L LAARDSTVL GGP+W VPLGR
Sbjct  15    EKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCADLLTLAARDSTVLTGGPSWVVPLGR  74

Query  838   rdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRL  659
             RDS G SLSGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSGSHTIGNARC +FRQRL
Sbjct  75    RDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNARCTTFRQRL  134

Query  658   YNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLL  479
             YNQTGN  PD+TLDQSYAA+LRTRCP+SGGDQTLF LDFV+P +FDNSYFKNLLA KGLL
Sbjct  135   YNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQTLFFLDFVSPVKFDNSYFKNLLAKKGLL  194

Query  478   NSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             +SD+VLVT+S A+LQLVK YA N ELFF+ FAKSMVKMGNI+PLTG  G+IRK CR++N 
Sbjct  195   SSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPLTGSKGQIRKRCRQVNK  254



>gb|EMT26481.1| Peroxidase 72 [Aegilops tauschii]
Length=293

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 208/292 (71%), Positives = 248/292 (85%), Gaps = 2/292 (1%)
 Frame = -1

Query  1165  QEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi--sSEKRSNPNRN  992
             Q +V ++VAK  AK+PRMAASLLRLHFHDCFV+GCDAS+LLD+ GS   ++EKRSNPNR+
Sbjct  2     QALVGAIVAKEHAKDPRMAASLLRLHFHDCFVQGCDASVLLDADGSGRFTTEKRSNPNRD  61

Query  991   SARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnsls  812
             S RG+EVIDEIKAALE  CPHTVSCADI A+AARDSTVL GGP WEVPLGRRDS   SLS
Sbjct  62    SLRGYEVIDEIKAALEHACPHTVSCADIAAVAARDSTVLTGGPGWEVPLGRRDSLTASLS  121

Query  811   gsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLP  632
             GSNN IPAPN+T  TI  KF+ QGLD+VDLVALSG+HTIG++RCVSFRQRLY+Q  +  P
Sbjct  122   GSNNLIPAPNDTLPTITAKFRNQGLDVVDLVALSGAHTIGDSRCVSFRQRLYSQNNDGRP  181

Query  631   DYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTK  452
             D TL+ +YAA+LR RCP+SGGDQ LF LD  T  RFDN Y+KN+LA  GLL+SD+VL+T+
Sbjct  182   DPTLNPAYAAKLRGRCPRSGGDQILFALDPATQFRFDNQYYKNILAMNGLLSSDEVLLTQ  241

Query  451   SAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINHY  296
             S  +++LVK+YA ++ELFF HFAKSMVKMGNISPLTG +GEIRKNCR++NH+
Sbjct  242   SHETMELVKSYAASNELFFDHFAKSMVKMGNISPLTGHNGEIRKNCRRVNHF  293



>ref|XP_007017633.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY14858.1| Peroxidase superfamily protein [Theobroma cacao]
Length=348

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 254/307 (83%), Gaps = 3/307 (1%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
             SYG  L+PQFY  SCP+A +IV SV+ KA+A+EPRMAASLLRLHFHDCFV+GCDAS+LLD
Sbjct  44    SYG--LFPQFYQFSCPQADDIVMSVLEKAIAEEPRMAASLLRLHFHDCFVQGCDASVLLD  101

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
              S +I SEK S PN+NS RGFEVIDEIKA LE  CP TVSCAD+LA+AAR STVL+GGP+
Sbjct  102   DSATIVSEKNSLPNKNSIRGFEVIDEIKAKLEEACPQTVSCADVLAMAARGSTVLSGGPS  161

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WE+PLGRRDS+  SLS SNNNIP PN+T Q ++T F+ QGLD VDLVALSG HTIG ARC
Sbjct  162   WELPLGRRDSKTASLSTSNNNIPPPNSTLQNLITLFQRQGLDEVDLVALSGGHTIGVARC  221

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
             V+F+QRLYNQ GN+LPD TL+++Y   L++ CPKSGGD  +  LDF +P +FDN YFK +
Sbjct  222   VTFKQRLYNQNGNNLPDETLEKTYYYGLKSVCPKSGGDNNISPLDFGSPVKFDNLYFKLI  281

Query  499   LAYKGLLNSDQVLVTKSAA-SLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L  KGLLNSD+VL+T +   +++LVKAYAE+  LFF+ FAKSM+KMGNISPLTGF+GE+R
Sbjct  282   LWGKGLLNSDEVLLTGNGGNTMELVKAYAEDENLFFEQFAKSMIKMGNISPLTGFNGEVR  341

Query  322   KNCRKIN  302
             KNCR +N
Sbjct  342   KNCRFVN  348



>ref|XP_009599290.1| PREDICTED: peroxidase 9 [Nicotiana tomentosiformis]
Length=333

 Score =   383 bits (984),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 215/333 (65%), Positives = 261/333 (78%), Gaps = 2/333 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLY-SAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEP  1118
             MA     F +AI + + S+ +     S+GG L+P+FY  SCP+A EIV SV+ +A+AK+P
Sbjct  1     MASLKLVFTLAIMMSFLSSAMSQALSSWGGGLFPEFYQLSCPQANEIVMSVLEEAIAKDP  60

Query  1117  RMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAE  938
             RMAASLLRLHFHDCFV+GCDASILLD + +  SEK + PN+NS RGFEVID+IKA LE  
Sbjct  61    RMAASLLRLHFHDCFVQGCDASILLDKTSAFKSEKDAGPNKNSIRGFEVIDQIKARLEQV  120

Query  937   CPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             CPHTVSCADILALAARDSTVL+GGP+WEVPLGRRDS+  +L  +N NIPAPN+T Q ++T
Sbjct  121   CPHTVSCADILALAARDSTVLSGGPHWEVPLGRRDSKIANLKKANTNIPAPNSTIQNLIT  180

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPK  578
              F  QGL   DLVALSG+HTIG ARCVSFRQRLYNQ G++LPD TL+++Y   L+T CP+
Sbjct  181   LFARQGLSEEDLVALSGAHTIGMARCVSFRQRLYNQNGDNLPDATLEKTYYTGLKTACPR  240

Query  577   SGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSEL  401
              G D  +  LDF +P RFDN+YFK LL  KGLLNSDQVL+T K   + +LVK+YAEN  L
Sbjct  241   RGRDNNISPLDFTSPVRFDNTYFKLLLWGKGLLNSDQVLLTGKVKKTKELVKSYAENEAL  300

Query  400   FFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FF HFAKSMVKMGNI+PLTG  G+IRKNCR++N
Sbjct  301   FFHHFAKSMVKMGNITPLTGLKGDIRKNCRRLN  333



>dbj|BAM05633.1| peroxidase 1, partial [Eucalyptus globulus subsp. globulus]
Length=253

 Score =   380 bits (975),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -1

Query  1018  EKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgr  839
             EKRS PN NSARGFEV+DEIK ALE ECP TVSCAD+LALAARDSTVL GGP+W VPLGR
Sbjct  14    EKRSVPNTNSARGFEVLDEIKFALEKECPQTVSCADLLALAARDSTVLTGGPSWVVPLGR  73

Query  838   rdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRL  659
             RDS G SLSGSNNNIPAPNNTFQTILTKFKL+GLD+VDLVALSGSHTIGNARC +FRQRL
Sbjct  74    RDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNARCTTFRQRL  133

Query  658   YNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLL  479
             YNQTGN  PD+TLDQSYAA+LRTRCP+SGGDQ LF LDFV+P +FDNSYFKNLLA KGLL
Sbjct  134   YNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPIKFDNSYFKNLLAKKGLL  193

Query  478   NSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
             +SD+VLVT+S A+LQLVK YA N ELFF+ FAKSMVKMGNI+PLTG  G+IRK CR++N 
Sbjct  194   SSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPLTGSKGQIRKRCRQVNK  253



>emb|CDX73762.1| BnaC08g22410D [Brassica napus]
Length=337

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 214/337 (64%), Positives = 261/337 (77%), Gaps = 5/337 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMA-IALLYSAQLCLCSKSY----GGYLYPQFYDRSCPRAQEIVESvvakav  1130
             MAK V C  +  I L+    LC+ S++        L PQFYD SCP+AQ IV+S VAKA 
Sbjct  1     MAKPVMCIVLTQIVLVALFHLCMSSQTKECTSTSSLSPQFYDNSCPKAQAIVQSFVAKAH  60

Query  1129  aKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAA  950
             + +PRMAASL RLHFHDCFV GCD S+LLD SG+I SEKR++ N +SARGFEVID+IK+A
Sbjct  61    SNDPRMAASLFRLHFHDCFVNGCDGSLLLDYSGTIESEKRADTNVDSARGFEVIDDIKSA  120

Query  949   LEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQ  770
             LE EC  TVSCADILAL ARD+TV+ GGP+WEV LGRRD+R  SL  SNNNIP  ++TF+
Sbjct  121   LEDECRQTVSCADILALVARDTTVITGGPSWEVYLGRRDAREASLIASNNNIPVASSTFE  180

Query  769   TILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRT  590
             TI+TKF  QGL L+DLVAL G HTIGN+RC SFRQRLYN +GNS  D TL+Q+YA+ L+ 
Sbjct  181   TIVTKFNDQGLGLIDLVALLGRHTIGNSRCKSFRQRLYNHSGNSDLDQTLNQNYASMLQQ  240

Query  589   RCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAEN  410
              CP SG DQ LF LD++TP +FDN YFKNL+ +KGLL+SD++L TKS  S++LVK Y  N
Sbjct  241   GCPISGDDQNLFALDYMTPNKFDNYYFKNLMTFKGLLSSDEILYTKSGDSMELVKLYGAN  300

Query  409   SELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              ELFF+ +AKS VKMGNISPLTG +GEIR+ CR++NH
Sbjct  301   EELFFEQYAKSKVKMGNISPLTGRNGEIRRICRRVNH  337



>ref|XP_003579740.2| PREDICTED: peroxidase 72-like [Brachypodium distachyon]
Length=294

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/288 (72%), Positives = 242/288 (84%), Gaps = 1/288 (0%)
 Frame = -1

Query  1165  QEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi-sSEKRSNPNRNS  989
             Q +V  +VAK  AK+PRMAASL+RLHFHDCFV+GCDAS+LLD +    ++EKRSNPNR+S
Sbjct  2     QAVVGGIVAKEHAKDPRMAASLVRLHFHDCFVQGCDASVLLDDAHGRFTTEKRSNPNRDS  61

Query  988   ARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsg  809
              RG+EVIDEIKAALE  CP TVSCADI+A+AARDSTVL GGP WEVPLGRRDS   SLSG
Sbjct  62    LRGYEVIDEIKAALEHACPGTVSCADIVAVAARDSTVLTGGPGWEVPLGRRDSLTASLSG  121

Query  808   snnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPD  629
             SNN IPAPN+T  TI  KF  QGLD+VDLVALSG+HTIG++RCVSFRQRLYNQ  +  PD
Sbjct  122   SNNLIPAPNDTLPTIAAKFHNQGLDIVDLVALSGAHTIGDSRCVSFRQRLYNQNNDGRPD  181

Query  628   YTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKS  449
              TL+ +YAAELR RCPKSGGDQTLF LD  T  RFDN Y+KN+LA  GLLNSD+VL+T+S
Sbjct  182   PTLNPAYAAELRGRCPKSGGDQTLFALDPATQFRFDNQYYKNILAMNGLLNSDEVLLTQS  241

Query  448   AASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKI  305
               +++LVK+YA ++ LFF+HFA+SMVKMGNISPLTG SGEIRKNCR+I
Sbjct  242   HETMELVKSYAASNALFFEHFARSMVKMGNISPLTGHSGEIRKNCRRI  289



>ref|XP_010110020.1| Peroxidase 9 [Morus notabilis]
 gb|EXC25038.1| Peroxidase 9 [Morus notabilis]
Length=345

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 252/307 (82%), Gaps = 3/307 (1%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
             S+G  L+P+FY  SCP+  +IV SV+ KA+AKEPRMAASLLRLHFHDCFV+GCDAS+LLD
Sbjct  41    SFG--LFPEFYQSSCPQVDDIVMSVLEKAIAKEPRMAASLLRLHFHDCFVQGCDASVLLD  98

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
                +I+SEKR+ PN NS RGFEVIDEIKA LEA CPHTVSCADILALAAR STVL+GGPN
Sbjct  99    DRATIASEKRAGPNSNSIRGFEVIDEIKAKLEAACPHTVSCADILALAARGSTVLSGGPN  158

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             W +PLGRRDSR  SLSG+NNNIPAPN+T Q ++T FK QGL+  DLVALSG HTIG ARC
Sbjct  159   WVLPLGRRDSRSASLSGANNNIPAPNSTIQILVTFFKRQGLNKADLVALSGGHTIGVARC  218

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
             V+F+QRLYNQ GN+ PD TLD++Y   L++ CP+SGGD  +  LDF +P RFDN+YF+ +
Sbjct  219   VTFKQRLYNQNGNNQPDSTLDRTYYYGLKSVCPRSGGDNNISPLDFASPARFDNTYFRLI  278

Query  499   LAYKGLLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L  KGLL SD+VL T     +++L+K+YAEN  LFF  FAKSMVKMGNISPLTGF+GE+R
Sbjct  279   LWGKGLLTSDEVLWTGNDRKTMELIKSYAENESLFFDQFAKSMVKMGNISPLTGFNGEVR  338

Query  322   KNCRKIN  302
             KNCR++N
Sbjct  339   KNCRRVN  345



>ref|NP_001168269.1| uncharacterized protein LOC100382033 precursor [Zea mays]
 gb|ACN27649.1| unknown [Zea mays]
 gb|AFW58241.1| hypothetical protein ZEAMMB73_453603 [Zea mays]
Length=348

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 245/304 (81%), Gaps = 2/304 (1%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD +CP+ Q IV SVVAKA A++PRMAASLLR+HFHDCFV+GCDAS+LLD+ GS 
Sbjct  45    LQPHFYDHACPQMQAIVGSVVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSG  104

Query  1024  --sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEV  851
                +EKRSNPN++S RGFEVIDEIKAALE  CP TVSCADI+A+AARDS VL GGP WEV
Sbjct  105   RFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPRTVSCADIVAVAARDSVVLTGGPGWEV  164

Query  850   PlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSF  671
             PLGRRDS   SLSGSNN IPAPN++  TI+ KF  QGLD+VDLVALSG HTIG++RCVSF
Sbjct  165   PLGRRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDIVDLVALSGGHTIGDSRCVSF  224

Query  670   RQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAY  491
             RQRLY Q  N   D TL+ +YAAELR RCP+SGGDQ LF LD  +  RFDN Y+ N+LA 
Sbjct  225   RQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDPASQFRFDNQYYHNILAM  284

Query  490   KGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
              GLL+SD++L+T+S  ++ LV  YA +  LFF HFAKSMVKMGNISPLTG +GEIR NCR
Sbjct  285   DGLLSSDEILLTQSRQTMGLVHRYAADQGLFFDHFAKSMVKMGNISPLTGSAGEIRHNCR  344

Query  310   KINH  299
             ++NH
Sbjct  345   RVNH  348



>gb|KHG27001.1| Peroxidase 9 -like protein [Gossypium arboreum]
Length=349

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 211/307 (69%), Positives = 254/307 (83%), Gaps = 3/307 (1%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
             SYG  L+PQFY  SCP+A++IV SV+ KA+AKEPRMAASLLRLHFHDCFV+GCDASILLD
Sbjct  45    SYG--LFPQFYQFSCPQAEDIVISVLEKAIAKEPRMAASLLRLHFHDCFVQGCDASILLD  102

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
             +S +I SEK S PNRNS RGFEVIDEIKA LE  CP TVSCADILA+AAR STVL+GGP+
Sbjct  103   NSATIVSEKNSLPNRNSVRGFEVIDEIKAKLEEACPQTVSCADILAMAARGSTVLSGGPS  162

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WE+PLGRRDS+  SLS SNNNIP PN+T Q ++T F+ QGLD VDLVALSG HTIG ARC
Sbjct  163   WELPLGRRDSKTASLSTSNNNIPPPNSTLQNLITLFQRQGLDEVDLVALSGGHTIGVARC  222

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
              +F+QRLYNQ GN+LPD TL+++Y   L++ CPKSGGD  +  LDF +P +FDN YFK +
Sbjct  223   ATFKQRLYNQNGNNLPDQTLERTYYYGLKSVCPKSGGDNNISPLDFGSPVKFDNLYFKLI  282

Query  499   LAYKGLLNSDQVLVTKSAA-SLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L  KGLLNSD+VL+T +   +++LVKAYA++  LFF+ FAKSM+KMGNISPLT F+GE+R
Sbjct  283   LWGKGLLNSDEVLLTGNVGNTMELVKAYAKDENLFFKQFAKSMIKMGNISPLTAFNGEVR  342

Query  322   KNCRKIN  302
             KNCR +N
Sbjct  343   KNCRLVN  349



>gb|KFK40197.1| hypothetical protein AALP_AA3G342600 [Arabis alpina]
Length=337

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 228/337 (68%), Positives = 264/337 (78%), Gaps = 7/337 (2%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCS---KSYGG---YLYPQFYDRSCPRAQEIVESvvaka  1133
             MAK +  F + I+L     L +C     +YGG    L+P FY RSCP+A+EIV SVVA+A
Sbjct  1     MAK-IGSFLVLISLACFLTLSICDDDENNYGGGRGNLFPGFYSRSCPKAEEIVRSVVAQA  59

Query  1132  vaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKA  953
             VA+E RMAASL+RLHFHDCFV+GCD S+LLDSSGSI +EK SNPN  SARGFEV+D+IKA
Sbjct  60    VARETRMAASLMRLHFHDCFVQGCDGSLLLDSSGSIVTEKGSNPNNGSARGFEVVDQIKA  119

Query  952   ALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTF  773
             ALE ECP  VSCAD L LAARDS+VL GGP+W VPLGRRDS   SLSGSNNNIPAPNN F
Sbjct  120   ALENECPGIVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNPF  179

Query  772   QTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELR  593
              TIL++F  QGLD+ D+VALSGSHTIG + C SFRQRLYNQ+GN   D TL+QSYAA LR
Sbjct  180   NTILSRFNRQGLDVTDMVALSGSHTIGFSSCTSFRQRLYNQSGNGTLDTTLEQSYAANLR  239

Query  592   TRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAE  413
              RCP+SGGDQ L  LD  +  RFDNSYFKNL+   GLLNSD+VL + +  S +LVK YAE
Sbjct  240   QRCPRSGGDQNLSELDINSAGRFDNSYFKNLIKNMGLLNSDEVLFSSNEESRELVKKYAE  299

Query  412   NSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             + E FF+ FA+SM+KMGNISPLTG SGEIRKNCRKIN
Sbjct  300   DQEDFFEQFAESMIKMGNISPLTGSSGEIRKNCRKIN  336



>gb|EYU32893.1| hypothetical protein MIMGU_mgv1a009418mg [Erythranthe guttata]
Length=342

 Score =   378 bits (970),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 244/303 (81%), Gaps = 1/303 (0%)
 Frame = -1

Query  1207  YLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgs  1028
             +L P++Y  SCP+A EI+ SV+  A+A++ RMAASLLRLHFHDCFV+GCDAS+LLD S +
Sbjct  40    HLVPEYYRFSCPQANEIIMSVLENAIARDSRMAASLLRLHFHDCFVQGCDASVLLDDSAN  99

Query  1027  isSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVP  848
             I+SEK S PN+NS RGFEVIDEIKA +E  CPHTVSC+DILALAARDS VL+GGP+WEVP
Sbjct  100   IASEKNSGPNKNSLRGFEVIDEIKAKIEQVCPHTVSCSDILALAARDSIVLSGGPHWEVP  159

Query  847   lgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFR  668
             LGRRDS+  SLS SN +IPAPN+T QT++ +F   GLD  DLVALSG HTIG ARCV+FR
Sbjct  160   LGRRDSKTASLSKSNTDIPAPNSTIQTLINQFSKHGLDEQDLVALSGGHTIGVARCVTFR  219

Query  667   QRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYK  488
             QRLYNQ GN+ PD TL+++Y   L+T CPKSGGD  +  LDF +P +FDN YFK +L  K
Sbjct  220   QRLYNQNGNNQPDVTLERNYYNGLKTVCPKSGGDNNISPLDFSSPVKFDNRYFKLILWGK  279

Query  487   GLLNSDQVLVTKSA-ASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
             GLLNSD+VL T S   +L+LV++YAEN ELFF  FA SMVKMGNISPL G  GEIRKNCR
Sbjct  280   GLLNSDEVLATGSVRKTLELVRSYAENEELFFHQFASSMVKMGNISPLVGLQGEIRKNCR  339

Query  310   KIN  302
             ++N
Sbjct  340   RLN  342



>ref|XP_004968729.1| PREDICTED: peroxidase 72-like [Setaria italica]
Length=344

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 245/304 (81%), Gaps = 2/304 (1%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L P FYD SCP+ Q IV ++VAKA A++PRMAASLLR+HFHDCFV+GCDAS+LLD+ GS 
Sbjct  41    LQPHFYDHSCPQMQAIVGAIVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSG  100

Query  1024  --sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEV  851
                +EKRSNPN++S RG+EVIDEIKAA+E  CPH VSCADI+A+AARDS VL GGP WEV
Sbjct  101   RFVTEKRSNPNKDSLRGYEVIDEIKAAVEHACPHVVSCADIVAVAARDSVVLTGGPGWEV  160

Query  850   PlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSF  671
             PLGRRDS   SLSGSNN IPAPN++  TI+ KF  QGLD+VDLVALSG HTIG++RCVSF
Sbjct  161   PLGRRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDVVDLVALSGGHTIGDSRCVSF  220

Query  670   RQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAY  491
             RQRLY Q  N   D TL+ +YAAELR RCP+SGGDQ LF LD  +  RFDN Y+ N+LA 
Sbjct  221   RQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDPASQFRFDNQYYHNILAM  280

Query  490   KGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCR  311
              GLL+SD++L+T+   +++LV  +A N  LFF+ FAKSMVKMGNISPLTG +GEIR NCR
Sbjct  281   NGLLSSDEILLTQGRETMELVHRFAANQGLFFEQFAKSMVKMGNISPLTGHAGEIRMNCR  340

Query  310   KINH  299
             ++NH
Sbjct  341   RVNH  344



>emb|CDX75576.1| BnaA01g01260D [Brassica napus]
Length=835

 Score =   392 bits (1008),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 251/308 (81%), Gaps = 0/308 (0%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
             S+S GG L P FY  SCP+A EIV SVVA+AVA+E RMAASL+RLHFHDCFV+GCD S+L
Sbjct  527   SQSNGGKLNPGFYAHSCPQAGEIVRSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLL  586

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LDSSG I SEK SNPN  SARGFEV+D+IKA LE +CP TVSCADIL+LAA+DS+VL GG
Sbjct  587   LDSSGRIVSEKSSNPNSKSARGFEVVDQIKAHLEKQCPGTVSCADILSLAAKDSSVLTGG  646

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P+W VPLGRRDSR  SLSGSNNN+PAPNNTFQTIL+ F  QGLD+ DLVALSGSHTIG +
Sbjct  647   PSWMVPLGRRDSRSASLSGSNNNLPAPNNTFQTILSMFNRQGLDVTDLVALSGSHTIGFS  706

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RC SFRQRLYNQ+GN  PD TL+QS+AA LR RCP+SG DQ L  LD V+  +FDNSYFK
Sbjct  707   RCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGSDQNLSVLDIVSAAKFDNSYFK  766

Query  505   NLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEI  326
             N +   GLLNSDQVL +    S  LVK YAE+   FF+ FA+SM+KMGNISPLTG SGEI
Sbjct  767   NFIENMGLLNSDQVLFSSDDKSRDLVKKYAEDQGEFFEQFAESMIKMGNISPLTGSSGEI  826

Query  325   RKNCRKIN  302
             RK+CRKIN
Sbjct  827   RKDCRKIN  834



>ref|XP_007226292.1| hypothetical protein PRUPE_ppa020321mg [Prunus persica]
 gb|EMJ27491.1| hypothetical protein PRUPE_ppa020321mg [Prunus persica]
Length=368

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 211/325 (65%), Positives = 254/325 (78%), Gaps = 17/325 (5%)
 Frame = -1

Query  1225  SKSYGGY--------LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFV  1070
             S+ +GGY        L+PQFY  SCP+A +IV SV+ +A+A+EPR AASLLRLHFHDCFV
Sbjct  44    SRGHGGYAPAGGSFGLFPQFYQFSCPQANDIVISVLQQAIAREPRAAASLLRLHFHDCFV  103

Query  1069  KGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAAR  890
             +GCDAS+LLD S +I+SEKRS PNRNS RGFEVIDEIKA LE  CP TVSCADILALAAR
Sbjct  104   QGCDASVLLDDSTTIASEKRSGPNRNSLRGFEVIDEIKAKLEEACPQTVSCADILALAAR  163

Query  889   DSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALS  710
              S VL+GGPNW++PLGRRDSR  SLSGSN+NIPAPN+T  T+LT FK QGLD VDLVALS
Sbjct  164   GSIVLSGGPNWDLPLGRRDSRTASLSGSNSNIPAPNSTLSTLLTFFKRQGLDEVDLVALS  223

Query  709   GSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPT  530
             G HTIG ARCV+F+QRLYNQ GN+ PD TL+++Y   L++ CP+SGGD  +  LDF +P 
Sbjct  224   GGHTIGVARCVTFKQRLYNQKGNNQPDETLERNYYFGLKSVCPRSGGDNNISPLDFASPA  283

Query  529   RFDNSYFKNLLAYKGLLNSDQVLVTKSAA---------SLQLVKAYAENSELFFQHFAKS  377
             +FDN+YFK +L  KGLL SDQVL+T +           +++LVK YA++  LFFQ FAKS
Sbjct  284   KFDNAYFKLILFGKGLLTSDQVLLTGNGNGNGIGNAGKTMELVKTYADDESLFFQQFAKS  343

Query  376   MVKMGNISPLTGFSGEIRKNCRKIN  302
             MVKMGNI PLTG  GE+R NCR++N
Sbjct  344   MVKMGNIRPLTGSKGEVRNNCRRLN  368



>gb|KHN27032.1| Peroxidase 72 [Glycine soja]
Length=322

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 246/313 (79%), Gaps = 7/313 (2%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC+      L PQFYD SCP+AQ+I +S++      +P  AA +LRLHFHDCFV GCD
Sbjct  15    LCLCN------LNPQFYDNSCPQAQQIAKSILTSYFVIQPGYAAQILRLHFHDCFVMGCD  68

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDSS SI SEK S+PNR+SARGF VID IK A+E  CP TVSCADIL +AARDS V
Sbjct  69    GSLLLDSSESIVSEKESDPNRDSARGFIVIDAIKLAIERACPSTVSCADILTIAARDSVV  128

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRDSR  S+SGSNNNIPAPN+ F T+ TKF+ QGL+L DLV LSG+HT
Sbjct  129   LTGGPSWEVPLGRRDSRDASISGSNNNIPAPNSIFPTLQTKFEQQGLNLTDLVTLSGAHT  188

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSG-GDQTLFHLDFVTPTRFD  521
             +G ARC +FRQRLYNQ+GN  PD TLDQ+YAA LR  CP++  GDQ  F LD+ TP +FD
Sbjct  189   LGVARCTNFRQRLYNQSGNGQPDPTLDQNYAAFLRVTCPRTTLGDQNPFFLDYATPLKFD  248

Query  520   NSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTG  341
             NSYFKNL+  KGLLNSDQ+L T +  S +LV+ YAE ++LFF+ F+KSM+KMGNISPLT 
Sbjct  249   NSYFKNLMENKGLLNSDQILFTMNQESAELVRLYAERNDLFFEQFSKSMIKMGNISPLTN  308

Query  340   FSGEIRKNCRKIN  302
              SGEIR+NCR++N
Sbjct  309   SSGEIRQNCRRVN  321



>ref|XP_003547960.2| PREDICTED: peroxidase 72-like [Glycine max]
Length=351

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 246/313 (79%), Gaps = 7/313 (2%)
 Frame = -1

Query  1237  LCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             LCLC+      L PQFYD SCP+AQ+I +S++      +P  AA +LRLHFHDCFV GCD
Sbjct  44    LCLCN------LNPQFYDNSCPQAQQIAKSILTSYFVIQPGYAAQILRLHFHDCFVMGCD  97

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
              S+LLDSS SI SEK S+PNR+SARGF VID IK A+E  CP TVSCADIL +AARDS V
Sbjct  98    GSLLLDSSESIVSEKESDPNRDSARGFIVIDAIKLAIERACPSTVSCADILTIAARDSVV  157

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRDSR  S+SGSNNNIPAPN+ F T+ TKF+ QGL+L DLV LSG+HT
Sbjct  158   LTGGPSWEVPLGRRDSRDASISGSNNNIPAPNSIFPTLQTKFEQQGLNLTDLVTLSGAHT  217

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSG-GDQTLFHLDFVTPTRFD  521
             +G ARC +FRQRLYNQ+GN  PD TLDQ+YAA LR  CP++  GDQ  F LD+ TP +FD
Sbjct  218   LGVARCTNFRQRLYNQSGNGQPDPTLDQNYAAFLRVTCPRTTLGDQNPFFLDYATPLKFD  277

Query  520   NSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTG  341
             NSYFKNL+  KGLLNSDQ+L T +  S +LV+ YAE ++LFF+ F+KSM+KMGNISPLT 
Sbjct  278   NSYFKNLMENKGLLNSDQILFTMNQESAELVRLYAERNDLFFEQFSKSMIKMGNISPLTN  337

Query  340   FSGEIRKNCRKIN  302
              SGEIR+NCR++N
Sbjct  338   SSGEIRQNCRRVN  350



>ref|XP_011074620.1| PREDICTED: peroxidase 9 [Sesamum indicum]
Length=340

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 216/331 (65%), Positives = 256/331 (77%), Gaps = 8/331 (2%)
 Frame = -1

Query  1270  FMAIALLYSAQL-----CLCSKSYGGY--LYPQFYDRSCPRAQEIVESvvakavaKEPRM  1112
              +A+ALL  +Q          ++ GGY  L P FY  SCP+A EI+ SV+  A+ K+PRM
Sbjct  10    LLAVALLSCSQPQAFPGSSFGRAAGGYTGLTPDFYRFSCPQANEIIMSVLENAITKDPRM  69

Query  1111  AASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECP  932
             AASLLRLHFHDCFV+GCDAS+LLD S +  SEK S PN+NS RGFEVIDEIKA LE  CP
Sbjct  70    AASLLRLHFHDCFVQGCDASVLLDDSTATRSEKNSGPNKNSLRGFEVIDEIKAKLEQVCP  129

Query  931   HTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKF  752
             HTVSCADILALAARDSTVL+GGP+WEVPLGRRDSR  SLS SN NIPAPN+T QT++TKF
Sbjct  130   HTVSCADILALAARDSTVLSGGPHWEVPLGRRDSRTASLSQSNTNIPAPNSTIQTLITKF  189

Query  751   KLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSG  572
             + QGLD+ DLVALSG HTIG ARCV+FRQRLYNQ GN+ PD TL+++Y   L+  CPK G
Sbjct  190   RAQGLDVEDLVALSGGHTIGAARCVTFRQRLYNQNGNNQPDVTLEKNYYNGLKVACPKVG  249

Query  571   GDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAA-SLQLVKAYAENSELFF  395
             GD  +  LD  +P RFDN+YFK LL  KGLL+SD+VL T +   +++LV++YAE+  LFF
Sbjct  250   GDNNISPLDVSSPVRFDNTYFKLLLWGKGLLSSDEVLFTGNVGKTVELVRSYAESEALFF  309

Query  394   QHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
               FAKSMVKMGNISPL G  GEIRKNCRK+N
Sbjct  310   HQFAKSMVKMGNISPLIGSKGEIRKNCRKVN  340



>ref|XP_008221352.1| PREDICTED: peroxidase 9 [Prunus mume]
Length=364

 Score =   374 bits (960),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 249/308 (81%), Gaps = 7/308 (2%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L+PQFY  SCP+A +IV SV+ +A+A+EPR+AASLLRLHFHDCFV+GCDAS+LLD S +I
Sbjct  57    LFPQFYQFSCPQANDIVISVLQQAIAREPRVAASLLRLHFHDCFVQGCDASVLLDDSTTI  116

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
             +SEKRS PNRNS RGFEVIDEIKA LE  CP TVSCADILALAAR S VL+GGPNW++PL
Sbjct  117   ASEKRSGPNRNSLRGFEVIDEIKAKLEEACPQTVSCADILALAARGSIVLSGGPNWDLPL  176

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDSR  SLSGSN+NIPAPN+T  T+LT FK QGLD VDLVALSG HTIG ARCV+F+Q
Sbjct  177   GRRDSRTASLSGSNSNIPAPNSTLSTLLTFFKRQGLDDVDLVALSGGHTIGVARCVTFKQ  236

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ GN+ PD TL++SY   L++ CP+SGGD  +  +DF +P +FDN+YFK +L  KG
Sbjct  237   RLYNQKGNNQPDETLERSYYFGLKSVCPRSGGDNNISPMDFASPAKFDNAYFKLILFGKG  296

Query  484   LLNSDQVLVTKSAA-------SLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEI  326
             LL SDQVL+T +         +++LVK YA++  LFFQ FAKSMV MGNI PLTG+ GE+
Sbjct  297   LLTSDQVLLTGNGNGIGNAGKTVELVKTYADDESLFFQQFAKSMVNMGNIRPLTGYKGEV  356

Query  325   RKNCRKIN  302
             R NCR++N
Sbjct  357   RNNCRRLN  364



>gb|EMS61935.1| Peroxidase 72 [Triticum urartu]
Length=331

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 249/307 (81%), Gaps = 12/307 (4%)
 Frame = -1

Query  1210  GYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssg  1031
             G L PQFY+ +CP+ Q +V ++VAK  AK+PRMAASLLRLHFHDCFV+GCDAS+LLD+ G
Sbjct  35    GPLVPQFYEHTCPQMQALVGAIVAKEHAKDPRMAASLLRLHFHDCFVQGCDASVLLDADG  94

Query  1030  si--sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             S   ++EKRSNPNR+S RG+EVIDEIKAALE  CPHTVSCADI A+AARDSTVL GGP W
Sbjct  95    SGRFTTEKRSNPNRDSLRGYEVIDEIKAALEHACPHTVSCADIAAVAARDSTVLTGGPGW  154

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
             EVPLGRRDS   SLSGSNN IPAPN+T  TI  KF+ QGLD+VDLVALSG+HTIG++RC 
Sbjct  155   EVPLGRRDSLTASLSGSNNLIPAPNDTLPTITAKFRNQGLDVVDLVALSGAHTIGDSRC-  213

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
                    N  G   P  TL+ +YAA+LR RCP+SGGDQ LF LD  T  RFDN Y+KN+L
Sbjct  214   -------NTDGRPAP--TLNPAYAAKLRGRCPRSGGDQILFALDPATQFRFDNQYYKNIL  264

Query  496   AYKGLLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKN  317
             A  GLL+SD+VL+T+S  +++LVK+YA ++ELFF HFAKSMVKMGNISPLTG +GEIRKN
Sbjct  265   AMNGLLSSDEVLLTQSHETMELVKSYAASNELFFDHFAKSMVKMGNISPLTGHNGEIRKN  324

Query  316   CRKINHY  296
             CR++NH+
Sbjct  325   CRRVNHF  331



>emb|CDP07473.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 246/306 (80%), Gaps = 3/306 (1%)
 Frame = -1

Query  1210  GY--LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsillds  1037
             GY  L+P+FY  SCP+A EIV SV+ +A+A++PRM ASLLRLHFHDCFV+GCDASILLD 
Sbjct  32    GYPGLFPEFYQFSCPQANEIVMSVLERAIAQDPRMPASLLRLHFHDCFVQGCDASILLDD  91

Query  1036  sgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNW  857
             S +I SEK S PN+NS RGFEVIDEIKA LE  CPHTVSCAD+LALAARDSTVL+GGP+W
Sbjct  92    SATIQSEKNSGPNKNSIRGFEVIDEIKARLEQVCPHTVSCADVLALAARDSTVLSGGPHW  151

Query  856   EVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCV  677
             EVPLGRRDSR  SLS SN++IPAPN+T Q ++T F+ QGL+  DLVALSG HTIG ARCV
Sbjct  152   EVPLGRRDSRTASLSKSNSDIPAPNSTIQNLITFFQRQGLNEQDLVALSGGHTIGVARCV  211

Query  676   SFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLL  497
             +FRQRLYNQ GN+ PD TL+++Y   L+  CP SGGD  +  LD  +P +FDN+Y+K +L
Sbjct  212   TFRQRLYNQNGNNQPDMTLERTYYNGLKAVCPNSGGDNNISPLDIASPVKFDNTYYKLIL  271

Query  496   AYKGLLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRK  320
               KGLLNSD+VL+T K A +++LVK+YA +  LFF  FA SM+KMGNI PLTG  GEIR 
Sbjct  272   YGKGLLNSDEVLLTGKVARTMELVKSYAADESLFFHQFANSMIKMGNIKPLTGSKGEIRN  331

Query  319   NCRKIN  302
             NCR+IN
Sbjct  332   NCRRIN  337



>ref|XP_010531058.1| PREDICTED: peroxidase 49 [Tarenaya hassleriana]
Length=341

 Score =   370 bits (950),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 228/335 (68%), Positives = 262/335 (78%), Gaps = 10/335 (3%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
             F +  AL+    LCL   S+   LYP FYD SCP+AQEIV SVVAKAVA+E RMA SL+R
Sbjct  7     FLLLFALVCFVPLCLFIPSFVWKLYPDFYDNSCPKAQEIVRSVVAKAVARETRMAVSLMR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHF DCFV+GCD S+LLDSSG I SEK SN NR SARGFEVIDEIK+ALE ECP TVSCA
Sbjct  67    LHFLDCFVQGCDGSVLLDSSGDIVSEKNSNYNRRSARGFEVIDEIKSALEKECPSTVSCA  126

Query  913   DILALAARDSTVLA--------GGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILT  758
             D LALAARDS+VL         GGP+WEVPLGRRDSRG SL  SN+NIPAPNNTFQTIL+
Sbjct  127   DALALAARDSSVLVSTSFFFLTGGPSWEVPLGRRDSRGASLRSSNDNIPAPNNTFQTILS  186

Query  757   KFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTG-NSLPDYTLDQSYAAELRTRCP  581
              F +  LDL DLVALSGSHTIG +RC SFRQRL+NQ+G N     TL+ SYAA LR RCP
Sbjct  187   AFNIHSLDLTDLVALSGSHTIGFSRCTSFRQRLFNQSGINGQASETLNSSYAAWLRPRCP  246

Query  580   -KSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSAASLQLVKAYAENSE  404
              +SGGDQ LF LDF++ ++FDNSYFKNL+  KGLLNSDQVL + +  +  LV+ YAE+ +
Sbjct  247   TRSGGDQNLFALDFMSASKFDNSYFKNLIKNKGLLNSDQVLFSSNRQARDLVEKYAEDQD  306

Query  403   LFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKINH  299
              FF+ FAKSM+KMGNISPLTGFSGE+RKNCR IN+
Sbjct  307   EFFEQFAKSMIKMGNISPLTGFSGEVRKNCRDINY  341



>ref|XP_010061268.1| PREDICTED: peroxidase 9 [Eucalyptus grandis]
Length=346

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 244/302 (81%), Gaps = 1/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L+P++Y  SCP+  +IV SV+ +A+ +EPRMAASLLRLHFHDCFV+GCDAS+LLD S +I
Sbjct  45    LFPEYYLYSCPQVNDIVVSVLEQAIEREPRMAASLLRLHFHDCFVQGCDASVLLDDSATI  104

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
             +SEKRS PN NS RGFEVIDEIKA LE  CP  VSCADI+ALAAR STVL+GGP+WE+PL
Sbjct  105   ASEKRSLPNANSLRGFEVIDEIKAKLEEVCPGVVSCADIVALAARGSTVLSGGPDWELPL  164

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GR DSR  SL+GSNNNIP PN+T Q ++T F+ QGL+  DLVALSG HTIG ARC SF+Q
Sbjct  165   GRGDSRTASLTGSNNNIPPPNSTIQNLITLFQRQGLNEADLVALSGGHTIGVARCTSFKQ  224

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ GN+ PD TL+++Y  +L+T CP+SGGD  +  LD  +P +FDNSYFK +L  KG
Sbjct  225   RLYNQNGNNQPDATLERTYYQDLKTVCPQSGGDNNISPLDIASPVKFDNSYFKLILWGKG  284

Query  484   LLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             LLNSD+VL+T K   ++ LVKAYAE+  LF Q FAKSM+KMGNISPL GF+GE+RKNCR 
Sbjct  285   LLNSDEVLLTGKVGKTMNLVKAYAEDESLFLQQFAKSMIKMGNISPLIGFNGEVRKNCRH  344

Query  307   IN  302
             +N
Sbjct  345   VN  346



>ref|XP_006364989.1| PREDICTED: peroxidase 9-like [Solanum tuberosum]
Length=331

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 209/325 (64%), Positives = 250/325 (77%), Gaps = 4/325 (1%)
 Frame = -1

Query  1273  FFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLR  1094
              F++ A+    Q  L S S  G L+P  Y  SCP A EI+ SV+ +A+AK+PRMAASLLR
Sbjct  10    LFLSCAIF---QAFLVSSSNNGGLFPDLYQFSCPEANEIIMSVLEEAIAKDPRMAASLLR  66

Query  1093  LHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCA  914
             LHFHDCFV+GCDAS+LLD+S +  SEK + PN+NS RGFEVID+IKA LE  CPHTVSCA
Sbjct  67    LHFHDCFVQGCDASVLLDNSSAFKSEKEAGPNKNSLRGFEVIDQIKAKLEQVCPHTVSCA  126

Query  913   DILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLD  734
             DILALAARDS VL+GGP WEVPLGRRDS+    + +N NIPAPN+T QT+++ F  QGL+
Sbjct  127   DILALAARDSVVLSGGPYWEVPLGRRDSKRAYFNKANANIPAPNSTIQTLISLFNRQGLN  186

Query  733   LVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLF  554
               DLVALSG+HTIG ARCVSFRQRLYNQ GN LPD TL+++Y  +L++ CP SGGD  + 
Sbjct  187   EKDLVALSGAHTIGVARCVSFRQRLYNQKGNHLPDATLEKTYYNDLKSICPTSGGDNNIT  246

Query  553   HLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKS  377
              LD  +P RFDNSYFK LL  KGLLNSD+VL+T K   + QLVK YAEN  +FF  F+KS
Sbjct  247   PLDIASPNRFDNSYFKLLLLGKGLLNSDEVLLTGKVKKTKQLVKIYAENEAIFFHQFSKS  306

Query  376   MVKMGNISPLTGFSGEIRKNCRKIN  302
             MVKMGNISPLT   GEIRKNCR++N
Sbjct  307   MVKMGNISPLTELKGEIRKNCRRVN  331



>gb|KHG06183.1| hypothetical protein F383_31802 [Gossypium arboreum]
Length=1220

 Score =   392 bits (1006),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 222/271 (82%), Positives = 239/271 (88%), Gaps = 1/271 (0%)
 Frame = -1

Query  1234  CLCSKSYGG-YLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCD  1058
             CL SK+ GG YLYPQFY  SCP+AQEIV +VVAKAVAKEPRMAASLLRLHFHDCFVKGCD
Sbjct  19    CLSSKTVGGGYLYPQFYGHSCPKAQEIVRNVVAKAVAKEPRMAASLLRLHFHDCFVKGCD  78

Query  1057  AsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTV  878
             ASILLDSSGSI SEKRSNPNRNSARGFEVIDEIKA +E ECPHTVSCADI+ALAARDSTV
Sbjct  79    ASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKAVMEKECPHTVSCADIMALAARDSTV  138

Query  877   LAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHT  698
             L GGP+WEVPLGRRD+RG SLSGSNNNIPAPNNTFQTILTKFKLQGL +VDLVALSGSHT
Sbjct  139   LTGGPSWEVPLGRRDARGASLSGSNNNIPAPNNTFQTILTKFKLQGLGIVDLVALSGSHT  198

Query  697   IGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDN  518
             IGNARC SFRQRLYNQ+GN  PD TLDQSYA++LR  CP+SGGDQ LF LDFV+P +FDN
Sbjct  199   IGNARCTSFRQRLYNQSGNGQPDNTLDQSYASQLRRNCPRSGGDQNLFFLDFVSPIKFDN  258

Query  517   SYFKNLLAYKGLLNSDQVLVTKSAASLQLVK  425
             SYFKNLLA KGLLNSDQ  +       ++ K
Sbjct  259   SYFKNLLANKGLLNSDQKTIMAIGGKSRVAK  289



>ref|XP_004238287.1| PREDICTED: peroxidase 9 [Solanum lycopersicum]
Length=331

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 257/339 (76%), Gaps = 9/339 (3%)
 Frame = -1

Query  1315  LSTTALTMAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvak  1136
             +++  L M      FF A A+         S  YGG L+P+ Y  SCP+A EIV SV+ +
Sbjct  1     MASLGLVMFILSCAFFQAFAVS-------SSNDYGG-LFPELYQFSCPQANEIVMSVLEE  52

Query  1135  avaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIK  956
             A+AK+PRMAASLLRLHFHDCFV+GCDASILLD + +  SEK + PN+NS RG+EVIDEIK
Sbjct  53    AIAKDPRMAASLLRLHFHDCFVQGCDASILLDKNSAFKSEKEAGPNKNSLRGYEVIDEIK  112

Query  955   AALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNT  776
             A LE  CPHTVSCADILALAARDS VL+GGP WEVPLGRRDS+  S + +N NIPAPN+T
Sbjct  113   AKLEQVCPHTVSCADILALAARDSVVLSGGPYWEVPLGRRDSKTASFNKANVNIPAPNST  172

Query  775   FQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAEL  596
              Q ++  F  QGL++ DLVALSG HTIG ARCVSF+QRLYNQ G++LPD TL+++Y   L
Sbjct  173   IQNLINLFNKQGLNVQDLVALSGGHTIGMARCVSFKQRLYNQKGDNLPDVTLEKTYYNGL  232

Query  595   RTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSA-ASLQLVKAY  419
             ++ CP SGGD  +  LD  +P RFDN+YFK LL  KGLLNSD+VL+T +   + +LVK+Y
Sbjct  233   KSICPTSGGDNNISPLDVASPIRFDNTYFKLLLWGKGLLNSDEVLLTGNVKKTKELVKSY  292

Query  418   AENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             AEN  +FF+HFAKSMVKMGNI+PLT   GEIRKNCR+IN
Sbjct  293   AENEAIFFRHFAKSMVKMGNINPLTELKGEIRKNCRRIN  331



>emb|CDY12580.1| BnaC06g01060D [Brassica napus]
Length=347

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 244/309 (79%), Gaps = 1/309 (0%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
              +++   L+PQFY  SCP+A EIV +V+ KA+A+ PRMAASLLRLHFHDCFV+GCDASIL
Sbjct  39    GRTFSSGLFPQFYQFSCPQADEIVMTVLEKAIARNPRMAASLLRLHFHDCFVQGCDASIL  98

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LD S +I SEK + PN+NS +GFEVIDEIKA LE  CP  VSCADILALAAR ST+L+GG
Sbjct  99    LDDSATIRSEKNAGPNKNSIKGFEVIDEIKAKLEQVCPQIVSCADILALAARGSTILSGG  158

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P+WE+PLGRRDS   SL+G+N NIPAPN+T Q +LT F+ +GL+  DLV+LSG HTIG A
Sbjct  159   PSWELPLGRRDSTTASLNGANTNIPAPNSTIQNLLTMFQRKGLNQEDLVSLSGGHTIGVA  218

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RC +F+QRLYNQ GN+ PD TL++SY   LR+ CP +GGD  +  LD  +P RFDN+YFK
Sbjct  219   RCTTFKQRLYNQNGNNQPDETLERSYYYGLRSICPPTGGDNNISPLDLASPARFDNTYFK  278

Query  505   NLLAYKGLLNSDQVLVTKSAASL-QLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGE  329
              +L  KGLL SDQVL+T +A ++ +LVKAYAE+  LFF+ FAKSMV MGNI PLTG SGE
Sbjct  279   LILWGKGLLTSDQVLLTGNAGNIVELVKAYAEDESLFFEQFAKSMVNMGNIQPLTGISGE  338

Query  328   IRKNCRKIN  302
             IRKNC  IN
Sbjct  339   IRKNCHVIN  347



>ref|XP_011028910.1| PREDICTED: peroxidase 9 [Populus euphratica]
Length=345

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 206/302 (68%), Positives = 249/302 (82%), Gaps = 1/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L+P+FY  SCP+A +IV  V+ KA+AK+ RMAASLLRLHFHDCFV+GCDAS+LLD S  I
Sbjct  44    LFPEFYQYSCPQANDIVMLVLRKAIAKDSRMAASLLRLHFHDCFVQGCDASLLLDDSAKI  103

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEK S PN+NS RGFEV+DEIKA LE  CP TVSCADILALAAR STVL+GGPNWE+PL
Sbjct  104   VSEKNSGPNKNSLRGFEVVDEIKAKLEEACPQTVSCADILALAARGSTVLSGGPNWELPL  163

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS+  SLSGSNNNIPAPN+T Q +++ FK QGL+ +DLVALSG HTIG ARCV+F+Q
Sbjct  164   GRRDSKTASLSGSNNNIPAPNSTIQNLISLFKRQGLNDIDLVALSGGHTIGVARCVTFKQ  223

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ GN+ PD+T++++Y  +L++ CPKSGGD  +  LD  +P +FDN+YFK LL  KG
Sbjct  224   RLYNQNGNNQPDHTIEKNYFLDLKSVCPKSGGDNNISPLDLASPAKFDNTYFKLLLWGKG  283

Query  484   LLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             LL SD+VL T K   ++QLVK YAE+  LFF+HFAKSMVKMGNISPLTGF+GE+RKNCR 
Sbjct  284   LLTSDEVLYTGKVGTTIQLVKRYAEDEGLFFEHFAKSMVKMGNISPLTGFNGEVRKNCRL  343

Query  307   IN  302
             +N
Sbjct  344   VN  345



>ref|XP_009129550.1| PREDICTED: peroxidase 9 [Brassica rapa]
 emb|CDY47953.1| BnaA10g28250D [Brassica napus]
Length=347

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 243/309 (79%), Gaps = 1/309 (0%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
              ++Y   L+PQFY  SCP+A EIV +V+ KA+A+ PRMAASLLRLHFHDCFV+GCDASIL
Sbjct  39    GRTYSSGLFPQFYQFSCPQADEIVMTVLEKAIARNPRMAASLLRLHFHDCFVQGCDASIL  98

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LD S +I SE+ + PN+NS +GFEVIDEIKA LE  CP  VSCADILALAAR ST+L+GG
Sbjct  99    LDDSATIKSERNAGPNKNSIKGFEVIDEIKAKLEQVCPQIVSCADILALAARGSTILSGG  158

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P+WE+PLGRRDS   SL+G+N NIPAPN+T Q +LT F+ +GL+  DLV+LSG HTIG A
Sbjct  159   PSWELPLGRRDSTTASLNGANTNIPAPNSTIQNLLTMFQRKGLNQEDLVSLSGGHTIGVA  218

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RC +F+QRLYNQ GN+ PD TL++SY   LR+ CP +GGD  +  LD  +P RFDN+YFK
Sbjct  219   RCTTFKQRLYNQNGNNQPDETLERSYYYGLRSICPPTGGDNNISPLDLASPARFDNTYFK  278

Query  505   NLLAYKGLLNSDQVLVTKSAASL-QLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGE  329
              +L  KGLL SDQVL+T +  ++ +LVKAYAE+  LFF+ FAKSMV MGNI PLTG SGE
Sbjct  279   LILWGKGLLTSDQVLLTGNVGNIVELVKAYAEDESLFFEQFAKSMVNMGNIQPLTGISGE  338

Query  328   IRKNCRKIN  302
             IRKNC  IN
Sbjct  339   IRKNCHVIN  347



>ref|XP_002281048.1| PREDICTED: peroxidase 9 [Vitis vinifera]
Length=346

 Score =   360 bits (924),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 256/343 (75%), Gaps = 15/343 (4%)
 Frame = -1

Query  1288  KFVSCFFMAIALLYSAQLCLCSKSY-----------GGY--LYPQFYDRSCPRAQEIVES  1148
             K +S FFM  A  +S+   L                GG+  L+P FY  SCP+A +IV S
Sbjct  5     KVLSSFFMLTAF-HSSTFSLAHPGVDFGWDGSFHPGGGFSGLFPGFYQCSCPQANDIVLS  63

Query  1147  vvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVI  968
             V+ KA+AKEPRMAASLLRLHFHDCFV+GCDASILLD S SI SEK S PN+NS RGFEVI
Sbjct  64    VLEKAIAKEPRMAASLLRLHFHDCFVQGCDASILLDDSASIVSEKGSGPNKNSIRGFEVI  123

Query  967   DEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPA  788
             DEIKA LE  CP TVSCADILALAAR STVL+GGP WE+PLGRRDS+  SL+GSNNNIPA
Sbjct  124   DEIKAKLEEACPQTVSCADILALAARGSTVLSGGPFWELPLGRRDSKTASLTGSNNNIPA  183

Query  787   PNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSY  608
             PN+T Q ++T FK QGLD VDLVALSG HTIG ARCV+F+QRLYNQ G++ PD TL+++Y
Sbjct  184   PNSTLQNLITLFKRQGLDEVDLVALSGGHTIGMARCVTFKQRLYNQNGDNQPDETLEKAY  243

Query  607   AAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSA-ASLQL  431
                L++ CPKSGGD  +  LDF +P +FDN+YFK +L  +GLL SD+VL+T +   + +L
Sbjct  244   YNGLKSVCPKSGGDNNISPLDFASPAKFDNTYFKLILWGRGLLTSDEVLLTGNVDKTEEL  303

Query  430   VKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             V+ +AE+  LF   FA SMVKMGNISPLT  +GEIR NC +IN
Sbjct  304   VRRFAEDEALFLNQFATSMVKMGNISPLTALNGEIRTNCHRIN  346



>ref|XP_009785386.1| PREDICTED: peroxidase 9-like [Nicotiana sylvestris]
Length=337

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 198/329 (60%), Positives = 242/329 (74%), Gaps = 2/329 (1%)
 Frame = -1

Query  1285  FVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAA  1106
              V  FF++I   +SA        Y   LYPQFY  +CP+A EIV SV+ +A+AK+ RMAA
Sbjct  10    LVIMFFLSIFQAFSASTSHFGGEYAN-LYPQFYQFTCPQADEIVMSVLEEAIAKDSRMAA  68

Query  1105  SLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHT  926
             SLLRLHFHDCFV+GCDASILLD +    SEK ++PN+NSA+GFEVIDEIKA LE  CPHT
Sbjct  69    SLLRLHFHDCFVQGCDASILLDGNSEFKSEKDASPNKNSAKGFEVIDEIKAKLEHVCPHT  128

Query  925   VSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKL  746
             VSCADILAL ARD+ +L+GGP WEVPLGR+DS+    + +N +IP PN+T Q ++  F  
Sbjct  129   VSCADILALVARDAVLLSGGPFWEVPLGRKDSKIADFNRANVDIPGPNSTIQNLINLFNN  188

Query  745   QGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGD  566
             QGL   DLV+LSG HTIG ARCVSFRQRLYNQ G++LPD TL+++Y   L++ CP  GGD
Sbjct  189   QGLKEEDLVSLSGGHTIGMARCVSFRQRLYNQNGDNLPDATLERNYYYGLKSICPTKGGD  248

Query  565   QTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSA-ASLQLVKAYAENSELFFQH  389
               +  LD  +P +FDNSYFK+LL  KGLLNSD+VL   +   + +LVK YAEN  LFFQ 
Sbjct  249   NNISPLDVASPVKFDNSYFKHLLNGKGLLNSDEVLFAGNVQKTTELVKNYAENEGLFFQQ  308

Query  388   FAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FAKSMVKMGNI+ L    GEIRKNCR +N
Sbjct  309   FAKSMVKMGNINTLNELKGEIRKNCRIVN  337



>ref|XP_006341976.1| PREDICTED: peroxidase 9-like [Solanum tuberosum]
Length=331

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 246/309 (80%), Gaps = 2/309 (1%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
             S +YGG L+P+ Y  SCP+A EIV SV+ +A++K+PRMAASLLRLHFHDCFV+GCDASIL
Sbjct  24    SNNYGG-LFPELYQISCPQANEIVMSVLEEAISKDPRMAASLLRLHFHDCFVQGCDASIL  82

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LD + +  SEK + PN+NS RG+EVIDEIKA LE  CPHTVSCADILALAARDS VL+GG
Sbjct  83    LDKNSAFKSEKEAGPNKNSLRGYEVIDEIKAKLEQVCPHTVSCADILALAARDSVVLSGG  142

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P WEVPLGRRDS+  + + +N NIPAPN+T Q ++  F  QGL+  DLVALSG HTIG A
Sbjct  143   PYWEVPLGRRDSKTANFNKANINIPAPNSTIQNLINLFNKQGLNEQDLVALSGGHTIGMA  202

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RCVSF+QRLYNQ G++LPD TL+++Y   L++ CP SGGD  +  LD  +P RFDN+YFK
Sbjct  203   RCVSFKQRLYNQKGDNLPDVTLEKTYYNGLKSICPTSGGDNNISPLDVASPIRFDNTYFK  262

Query  505   NLLAYKGLLNSDQVLVTKSA-ASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGE  329
              LL  KGLLNSD+VL+T +   + +LVK+YAEN  +FF+HFAKSMVKMGNI+PLT   GE
Sbjct  263   LLLWGKGLLNSDEVLLTGNVKKTKELVKSYAENEAIFFRHFAKSMVKMGNINPLTELKGE  322

Query  328   IRKNCRKIN  302
             IR +CR+IN
Sbjct  323   IRNSCRRIN  331



>ref|XP_006601328.1| PREDICTED: peroxidase 9-like [Glycine max]
Length=343

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/307 (65%), Positives = 245/307 (80%), Gaps = 3/307 (1%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
             S+G  L PQFY  SCP+A +IV SV+ KA+AK+ R+AASLLRLHFHDCFV+GCDASILL+
Sbjct  39    SFG--LSPQFYQFSCPQANDIVMSVLEKAIAKDMRIAASLLRLHFHDCFVQGCDASILLE  96

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
              S  I SEK S PN+NS RGFEVID+IK+ LE  CP TVSCADILALAAR STVL+GGPN
Sbjct  97    DSARIVSEKNSGPNKNSVRGFEVIDKIKSKLEEACPQTVSCADILALAARGSTVLSGGPN  156

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WE+PLGRRDS+  SLS SN NIP PN T + ++T FK QGLD VDLVALSG+HTIG ARC
Sbjct  157   WELPLGRRDSKTASLSDSNKNIPPPNATIENLVTFFKRQGLDEVDLVALSGAHTIGVARC  216

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
             V+F+QRLYNQ GN+ PD  L++S+  +L+T CPKSGGD  +  LDF +P  FDN+YFK +
Sbjct  217   VTFKQRLYNQKGNNQPDENLEKSFYFDLKTMCPKSGGDNFISPLDFGSPRMFDNTYFKLI  276

Query  499   LAYKGLLNSDQVLVTKSAA-SLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L  KGLLNSD+VL+  +   + +LVK YA++  LFF+ FA SM+KMGN+ PLTGF+GE+R
Sbjct  277   LRGKGLLNSDEVLLMGNVKETRELVKKYAQDESLFFEQFAMSMIKMGNLRPLTGFNGEVR  336

Query  322   KNCRKIN  302
             KNCR++N
Sbjct  337   KNCRRVN  343



>ref|XP_006393684.1| hypothetical protein EUTSA_v10011616mg [Eutrema salsugineum]
 gb|ESQ30970.1| hypothetical protein EUTSA_v10011616mg [Eutrema salsugineum]
Length=352

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/309 (64%), Positives = 242/309 (78%), Gaps = 1/309 (0%)
 Frame = -1

Query  1225  SKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsil  1046
              +++   L+PQFY  SCP+A EIV +V+ K +A+ PRMAASLLRLHFHDCFV+GCDASIL
Sbjct  44    GRTFSSGLFPQFYQFSCPQADEIVMTVLEKTIARNPRMAASLLRLHFHDCFVQGCDASIL  103

Query  1045  ldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGG  866
             LD S +I SEK + PN+NS +GFEVIDEIKA LE  CP  VSCADILALAAR ST+L+GG
Sbjct  104   LDDSATIRSEKNAGPNKNSIKGFEVIDEIKAKLEQVCPQVVSCADILALAARGSTMLSGG  163

Query  865   PNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNA  686
             P+WE+PLGRRDSR  SL+G+N NIPAPN+T Q +LT F+ +GL+  DLV+LSG HTIG A
Sbjct  164   PSWELPLGRRDSRSASLNGANTNIPAPNSTIQNLLTMFQRKGLNQEDLVSLSGGHTIGVA  223

Query  685   RCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFK  506
             RC +F+QRLYNQ GN+ PD TL++SY   LR+ CP +GGD  +  LD  +P RFDN+YFK
Sbjct  224   RCTTFKQRLYNQNGNNQPDSTLERSYYYGLRSICPPTGGDNNISPLDLASPARFDNTYFK  283

Query  505   NLLAYKGLLNSDQVLVTKSAA-SLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGE  329
              +L  KGLL SDQVL+T +   + +LVKAYAE+  +FF+ FAKSMV MGNI PLTG +GE
Sbjct  284   LILWGKGLLTSDQVLLTGNVGKTTELVKAYAEDESVFFEQFAKSMVNMGNIQPLTGINGE  343

Query  328   IRKNCRKIN  302
             IRKNC  IN
Sbjct  344   IRKNCHVIN  352



>emb|CAA62615.1| PRX [Mercurialis annua]
Length=325

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 237/297 (80%), Gaps = 0/297 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L+P FY+ SCP+A +IV SV+ +A+++EPRMAASLLRLHFHDCFV+GCDAS+LLD S ++
Sbjct  26    LFPAFYEFSCPQANDIVMSVLQEAISREPRMAASLLRLHFHDCFVQGCDASVLLDDSATV  85

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEK S PN+NS RGF+VIDE+K  LE  CP TVSCADILALAAR ST+L+GGPNWE+PL
Sbjct  86    VSEKNSGPNKNSLRGFDVIDEMKNKLEEVCPQTVSCADILALAARGSTLLSGGPNWELPL  145

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS+  SLSGSN  IP PN+T   ++  FK QGL++VDLVALSG+HTIG ARCV+F+Q
Sbjct  146   GRRDSKTASLSGSNKLIPPPNSTIGNLIAFFKRQGLNVVDLVALSGAHTIGVARCVTFKQ  205

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ GN+ PD TL+++Y   L++ CPKSGGD  +  LDF +P RFDN+YFK +L  KG
Sbjct  206   RLYNQNGNNEPDETLEKTYYRGLKSACPKSGGDNNISPLDFGSPVRFDNTYFKLILWGKG  265

Query  484   LLNSDQVLVTKSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNC  314
             LL SD+VL T +     LVK YAE+ +LFF  FAKSM+KM NI PLTG+SGE+R+ C
Sbjct  266   LLTSDEVLYTGTPTDYDLVKTYAEDEQLFFDQFAKSMIKMSNIRPLTGYSGEVRRLC  322



>ref|XP_009592461.1| PREDICTED: peroxidase 9-like [Nicotiana tomentosiformis]
Length=337

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 246/332 (74%), Gaps = 8/332 (2%)
 Frame = -1

Query  1285  FVSCFFMAIALLYSAQLCLCSKSYGG---YLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
              V  FF++I   +SA     + ++GG    LYPQFY  +CP+A EIV SV+ +A+AK+ R
Sbjct  10    LVVMFFLSIFQAFSAS----TSNFGGDYANLYPQFYQFTCPQANEIVMSVLEEAIAKDSR  65

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRL+FHDCFV+GCDASILLD +    SEK + PN+NSARGFEVIDEIK  LE  C
Sbjct  66    MAASLLRLYFHDCFVQGCDASILLDGNSEFRSEKDAAPNKNSARGFEVIDEIKDKLEHVC  125

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             PHTVSCADILAL AR++ +L+GGP WEVPLGR+DS+    + +N  IP PN+T Q ++  
Sbjct  126   PHTVSCADILALVARNAVLLSGGPFWEVPLGRKDSKIADFNKANVAIPGPNSTIQNLMNL  185

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGL   DLV+LSG HTIG ARCVSFRQRLYNQ G++LPD TL+++Y   L++ CP  
Sbjct  186   FNKQGLKEEDLVSLSGGHTIGMARCVSFRQRLYNQNGDNLPDATLERNYYYGLKSICPTK  245

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVTKSA-ASLQLVKAYAENSELF  398
             GGD  +  LD  +P +FDNSYFK+LL  KGLLNSD+VL T +   +++LVK++AEN  LF
Sbjct  246   GGDNNISPLDVASPVKFDNSYFKHLLNGKGLLNSDEVLFTGNVQKTMELVKSFAENEGLF  305

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             FQ FAKSMVKMGNI+ L    GEIRKNCR +N
Sbjct  306   FQQFAKSMVKMGNINTLNELKGEIRKNCRIVN  337



>ref|XP_002300745.2| hypothetical protein POPTR_0002s03260g [Populus trichocarpa]
 gb|EEE80018.2| hypothetical protein POPTR_0002s03260g [Populus trichocarpa]
 gb|AHL39120.1| class III peroxidase [Populus trichocarpa]
Length=345

 Score =   358 bits (918),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 203/302 (67%), Positives = 246/302 (81%), Gaps = 1/302 (0%)
 Frame = -1

Query  1204  LYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilldssgsi  1025
             L+P FY  SCP+A +IV SV+ KA+AK+ RM ASLLRLHFHDCFV+GCDAS+LLD S  I
Sbjct  44    LFPGFYQYSCPQANDIVMSVLRKAIAKDSRMPASLLRLHFHDCFVQGCDASVLLDDSAKI  103

Query  1024  sSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPNWEVPl  845
              SEK S PN+NS RGFEV+DEIKA LE  CP TVSCADILALAAR STVL+GGPNWE+PL
Sbjct  104   VSEKNSGPNKNSLRGFEVVDEIKAKLEEACPQTVSCADILALAARGSTVLSGGPNWELPL  163

Query  844   grrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARCVSFRQ  665
             GRRDS+  SLSGSNN+IPAPN+T Q +++ FK QGL+ +DLVALSG HTIG ARCV+F+Q
Sbjct  164   GRRDSKTASLSGSNNSIPAPNSTIQNLISLFKRQGLNDIDLVALSGGHTIGVARCVTFKQ  223

Query  664   RLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNLLAYKG  485
             RLYNQ GN+ PD+T++++Y  +L++ CPKSGGD  +  LD  +P +FDN+YFK LL  KG
Sbjct  224   RLYNQNGNNQPDHTIEKNYFLDLKSVCPKSGGDNNISPLDLASPAKFDNTYFKLLLWGKG  283

Query  484   LLNSDQVLVT-KSAASLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIRKNCRK  308
             LL SD+VL T K   + QLVK YAE+   FF+HFAKSMVKMG+ISPLTGF+GE+RKNCR 
Sbjct  284   LLTSDEVLYTGKVGKTTQLVKRYAEDEGRFFEHFAKSMVKMGSISPLTGFNGEVRKNCRL  343

Query  307   IN  302
             +N
Sbjct  344   VN  345



>ref|XP_004238027.1| PREDICTED: peroxidase 9 [Solanum lycopersicum]
Length=331

 Score =   357 bits (917),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 250/332 (75%), Gaps = 2/332 (1%)
 Frame = -1

Query  1294  MAKFVSCFFMAIALLYSAQLCLCSKSYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPR  1115
             MA  +    + ++   S    + S +YGG L+P  Y  SCP+A +I+ S + +A+AK+PR
Sbjct  1     MASSLGLVMLFLSCAISQAFLVSSSNYGG-LFPDLYQFSCPQANDIIWSFLEEAIAKDPR  59

Query  1114  MAASLLRLHFHDCFVKGCDAsilldssgsisSEKRSNPNRNSARGFEVIDEIKAALEAEC  935
             MAASLLRLHFHDCFV+GCDAS+LLD+S    SEK + PN+NS RGFEVID++KA LE  C
Sbjct  60    MAASLLRLHFHDCFVQGCDASVLLDNSSEFKSEKEAGPNKNSLRGFEVIDQVKAKLEQVC  119

Query  934   PHTVSCADILALAARDSTVLAGGPNWEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTK  755
             P TVSCADILALAARDS VL+GGP WEVPLGRRDS+    + +N NIPAPN+  QT+++ 
Sbjct  120   PCTVSCADILALAARDSVVLSGGPYWEVPLGRRDSKRAYFNKANVNIPAPNSKIQTLISL  179

Query  754   FKLQGLDLVDLVALSGSHTIGNARCVSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKS  575
             F  QGLD  DLVALSG+HTIG ARCVSFRQRLYNQTG+ LPD  L+++Y  +L++ CP S
Sbjct  180   FNRQGLDEKDLVALSGAHTIGVARCVSFRQRLYNQTGDHLPDAILEKNYYNDLKSICPTS  239

Query  574   GGDQTLFHLDFVTPTRFDNSYFKNLLAYKGLLNSDQVLVT-KSAASLQLVKAYAENSELF  398
             GG+  +  LD  +P RFDNSYFK LL  KGLLNSD+VL+T K   + QLVK YAEN  +F
Sbjct  240   GGNNNISPLDIASPNRFDNSYFKLLLLGKGLLNSDEVLLTGKVKKTQQLVKIYAENEAIF  299

Query  397   FQHFAKSMVKMGNISPLTGFSGEIRKNCRKIN  302
             F  F+KSMVKMGNISPLT   GEIRKNCR++N
Sbjct  300   FHQFSKSMVKMGNISPLTELKGEIRKNCRRVN  331



>ref|XP_007160719.1| hypothetical protein PHAVU_001G011300g [Phaseolus vulgaris]
 gb|ESW32713.1| hypothetical protein PHAVU_001G011300g [Phaseolus vulgaris]
Length=343

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 244/307 (79%), Gaps = 3/307 (1%)
 Frame = -1

Query  1219  SYGGYLYPQFYDRSCPRAQEIVESvvakavaKEPRMAASLLRLHFHDCFVKGCDAsilld  1040
             S+G  L PQFY  SCP+A +IV SV+ KA+AK+ RMAASLLRLHFHDCFV+GCDASILLD
Sbjct  39    SFG--LSPQFYQFSCPQANDIVMSVLEKAIAKDMRMAASLLRLHFHDCFVQGCDASILLD  96

Query  1039  ssgsisSEKRSNPNRNSARGFEVIDEIKAALEAECPHTVSCADILALAARDSTVLAGGPN  860
              S  I SEK S PN+NS RGFEVIDEIK+ LE  CP TVSCADILALAAR STVL+GGPN
Sbjct  97    DSTRIVSEKNSGPNKNSVRGFEVIDEIKSRLEEACPQTVSCADILALAARGSTVLSGGPN  156

Query  859   WEVPlgrrdsrgnslsgsnnNIPAPNNTFQTILTKFKLQGLDLVDLVALSGSHTIGNARC  680
             WE+PLGRRDS+  SL GSN NIP PN T ++++T FK QGLD  DLVALSG+HTIG ARC
Sbjct  157   WELPLGRRDSKTASLRGSNKNIPPPNATIESLITFFKRQGLDEADLVALSGAHTIGVARC  216

Query  679   VSFRQRLYNQTGNSLPDYTLDQSYAAELRTRCPKSGGDQTLFHLDFVTPTRFDNSYFKNL  500
              +F+QRLYNQ GN+ PD  L++S+  +L+T CPKSGGD  +  LDF +P  FDN+YFK +
Sbjct  217   ATFKQRLYNQKGNNQPDENLEKSFYFDLKTMCPKSGGDNFISPLDFGSPRMFDNTYFKLI  276

Query  499   LAYKGLLNSDQVLVTKSAA-SLQLVKAYAENSELFFQHFAKSMVKMGNISPLTGFSGEIR  323
             L  KGLLNSD+VL+  +A  + +LVK YA++  LFF+ F+ SM+KMGN+ PLTGF+GE+R
Sbjct  277   LRGKGLLNSDEVLLVGNAKETRRLVKKYAQDESLFFEQFSMSMIKMGNLRPLTGFNGEVR  336

Query  322   KNCRKIN  302
             KNCR +N
Sbjct  337   KNCRILN  343



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3440634590592