BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31712_g1_i1 len=872 path=[850:0-871]

Length=872
                                                                      Score     E

ref|XP_002297996.1|  pathogenesis-related family protein                304   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_004298854.1|  PREDICTED: disease resistance response prote...    303   4e-100   
ref|XP_002276430.1|  PREDICTED: disease resistance response prote...    302   1e-99    Vitis vinifera
ref|XP_011026952.1|  PREDICTED: disease resistance response prote...    301   2e-99    
ref|XP_002276448.1|  PREDICTED: disease resistance response prote...    301   2e-99    Vitis vinifera
ref|XP_006439431.1|  hypothetical protein CICLE_v10023550mg             296   2e-97    
ref|XP_007040398.1|  Disease resistance-responsive family protein       296   2e-97    
ref|XP_006476461.1|  PREDICTED: disease resistance response prote...    293   3e-96    
ref|XP_002297995.2|  pathogenesis-related family protein                293   4e-96    Populus trichocarpa [western balsam poplar]
gb|KDO76393.1|  hypothetical protein CISIN_1g038284mg                   291   2e-95    
ref|XP_008451985.1|  PREDICTED: disease resistance response prote...    290   5e-95    
ref|XP_011022578.1|  PREDICTED: disease resistance response prote...    289   1e-94    
ref|XP_008238999.1|  PREDICTED: disease resistance response prote...    287   1e-93    
ref|XP_009334474.1|  PREDICTED: disease resistance response prote...    285   4e-93    
gb|AFZ84548.1|  plant disease resistance response protein               285   4e-93    
gb|AFZ84547.1|  plant disease resistance response protein               283   2e-92    
gb|ACZ67171.1|  plant disease resistance response protein               283   2e-92    Populus deltoides
gb|ACZ67169.1|  plant disease resistance response protein               283   2e-92    Populus balsamifera [balsam poplar]
ref|XP_004503651.1|  PREDICTED: disease resistance response prote...    283   3e-92    
ref|XP_010106579.1|  hypothetical protein L484_003077                   283   4e-92    
ref|XP_008388884.1|  PREDICTED: disease resistance response prote...    282   7e-92    
ref|XP_004146540.1|  PREDICTED: disease resistance response prote...    282   9e-92    
ref|XP_003532426.1|  PREDICTED: disease resistance response prote...    284   3e-91    
gb|AFK48955.1|  unknown                                                 281   3e-91    
gb|ACZ67170.1|  plant disease resistance response protein               280   3e-91    Populus nigra [black poplar]
gb|AFK40037.1|  unknown                                                 280   4e-91    
gb|AEX34707.2|  plant disease resistance response protein               279   7e-91    
ref|XP_007160128.1|  hypothetical protein PHAVU_002G294900g             279   9e-91    
gb|AFZ84545.1|  plant disease resistance response protein               278   2e-90    
ref|XP_010251577.1|  PREDICTED: disease resistance response prote...    278   3e-90    
ref|XP_002509892.1|  Disease resistance response protein, putative      277   1e-89    Ricinus communis
ref|XP_002297997.1|  pathogenesis-related family protein                276   2e-89    Populus trichocarpa [western balsam poplar]
gb|AFZ84546.1|  plant disease resistance response protein               275   5e-89    
ref|XP_010106578.1|  hypothetical protein L484_003076                   275   6e-89    
ref|XP_011022577.1|  PREDICTED: disease resistance response prote...    275   1e-88    
ref|XP_002304536.2|  pathogenesis-related family protein                274   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006439432.1|  hypothetical protein CICLE_v10022439mg             272   8e-88    
ref|XP_011026953.1|  PREDICTED: disease resistance response prote...    271   2e-87    
ref|XP_002272144.1|  PREDICTED: disease resistance response prote...    270   5e-87    Vitis vinifera
dbj|BAP91518.1|  dirigent-like protein                                  269   1e-86    
ref|XP_002509891.1|  Disease resistance response protein, putative      269   1e-86    Ricinus communis
ref|XP_004298853.1|  PREDICTED: disease resistance response prote...    268   2e-86    
ref|XP_010055805.1|  PREDICTED: disease resistance response prote...    268   3e-86    
gb|KCW72356.1|  hypothetical protein EUGRSUZ_E00810                     267   3e-86    
ref|XP_008239000.1|  PREDICTED: disease resistance response prote...    267   5e-86    
gb|KDP25355.1|  hypothetical protein JCGZ_20511                         267   8e-86    
ref|XP_009780976.1|  PREDICTED: disease resistance response prote...    266   1e-85    
emb|CDP12104.1|  unnamed protein product                                266   1e-85    
ref|XP_007156024.1|  hypothetical protein PHAVU_003G252100g             266   2e-85    
ref|XP_004146539.1|  PREDICTED: disease resistance response prote...    265   3e-85    
ref|XP_004503652.1|  PREDICTED: disease resistance response prote...    266   4e-85    
ref|XP_010055804.1|  PREDICTED: disease resistance response prote...    265   5e-85    
ref|XP_002276477.1|  PREDICTED: disease resistance response prote...    265   6e-85    Vitis vinifera
emb|CBI34419.3|  unnamed protein product                                266   1e-84    
gb|KEH21169.1|  disease resistance response protein                     264   1e-84    
ref|XP_006343908.1|  PREDICTED: disease resistance response prote...    263   2e-84    
ref|XP_009586865.1|  PREDICTED: disease resistance response prote...    263   2e-84    
ref|XP_007209654.1|  hypothetical protein PRUPE_ppa012062mg             263   2e-84    
ref|XP_011080885.1|  PREDICTED: disease resistance response prote...    263   3e-84    
gb|ACJ84156.1|  unknown                                                 263   3e-84    Medicago truncatula
emb|CAN72051.1|  hypothetical protein VITISV_013188                     261   4e-84    Vitis vinifera
ref|XP_008794746.1|  PREDICTED: disease resistance response prote...    262   6e-84    
ref|XP_004245553.1|  PREDICTED: disease resistance response prote...    262   8e-84    
gb|KHN16770.1|  Disease resistance response protein 206                 261   1e-83    
ref|XP_008451991.1|  PREDICTED: disease resistance response prote...    261   1e-83    
gb|ADR30610.1|  (+)-pinoresinol-forming dirigent protein                261   2e-83    
gb|AAF25357.1|AF210061_1  dirigent protein                              261   2e-83    Forsythia x intermedia [cultivated forsythia]
ref|XP_007211042.1|  hypothetical protein PRUPE_ppa019022mg             259   2e-83    
ref|XP_007160127.1|  hypothetical protein PHAVU_002G294800g             261   3e-83    
gb|KDP25354.1|  hypothetical protein JCGZ_20510                         260   3e-83    
ref|XP_003525358.1|  PREDICTED: disease resistance response prote...    260   5e-83    
ref|XP_007040397.1|  Disease resistance-responsive family protein       265   5e-83    
ref|NP_001238065.1|  uncharacterized protein LOC100500692 precursor     257   4e-82    
gb|AAD25355.1|AF115574_1  pathogenesis-related protein                  255   3e-81    Pisum sativum [garden pea]
ref|XP_009762730.1|  PREDICTED: disease resistance response prote...    255   3e-81    
ref|XP_010676381.1|  PREDICTED: disease resistance response prote...    255   4e-81    
gb|KHN16769.1|  Disease resistance response protein 206                 253   8e-81    
ref|XP_007209632.1|  hypothetical protein PRUPE_ppa011846mg             254   1e-80    
sp|P13240.2|DR206_PEA  RecName: Full=Disease resistance response ...    253   1e-80    Pisum sativum [garden pea]
gb|AAA33662.1|  disease resistance response protein                     253   1e-80    Pisum sativum [garden pea]
ref|XP_009610713.1|  PREDICTED: disease resistance response prote...    253   2e-80    
pdb|4REV|A  Chain A, Structure Of The Dirigent Protein Drr206           251   4e-80    
gb|AAK38666.1|  rhizome dirigent protein                                252   6e-80    Podophyllum peltatum
gb|ABD52130.1|  dirigent protein pDIR19                                 249   4e-79    Picea sitchensis
ref|XP_006343909.1|  PREDICTED: disease resistance response prote...    249   5e-79    
ref|XP_004245554.1|  PREDICTED: disease resistance response prote...    249   6e-79    
ref|XP_008452163.1|  PREDICTED: disease resistance response prote...    247   3e-78    
gb|AAT11124.1|  dirigent protein                                        247   4e-78    Sesamum indicum [beniseed]
ref|XP_006826467.1|  hypothetical protein AMTR_s00004p00226930          247   5e-78    
gb|AAF25363.1|AF210067_1  dirigent-like protein                         246   9e-78    Thuja plicata [giant arborvitae]
gb|ADD70247.1|  dirigent protein                                        246   1e-77    
ref|XP_011080883.1|  PREDICTED: disease resistance response prote...    245   2e-77    
gb|AAF25361.1|AF210065_1  dirigent-like protein                         245   3e-77    Thuja plicata [giant arborvitae]
gb|AAF25366.1|AF210070_1  dirigent-like protein                         243   1e-76    Thuja plicata [giant arborvitae]
ref|XP_004300276.1|  PREDICTED: disease resistance response prote...    243   1e-76    
gb|AIA24413.1|  dirigent protein oxidase                                243   2e-76    
gb|AAF25365.1|AF210069_1  dirigent protein                              243   2e-76    Thuja plicata [giant arborvitae]
gb|AAF25358.1|AF210062_1  dirigent protein                              242   3e-76    Forsythia x intermedia [cultivated forsythia]
ref|XP_011073494.1|  PREDICTED: disease resistance response prote...    242   3e-76    
gb|AAF25364.1|AF210068_1  dirigent-like protein                         242   4e-76    Thuja plicata [giant arborvitae]
gb|ABD52117.1|  dirigent protein pDIR6                                  242   6e-76    Picea engelmannii x Picea glauca
gb|AAF25360.1|AF210064_1  dirigent protein                              241   9e-76    Thuja plicata [giant arborvitae]
gb|ABD52116.1|  dirigent protein pDIR5                                  239   5e-75    Picea engelmannii x Picea glauca
gb|ABD52126.1|  dirigent protein pDIR15                                 239   6e-75    Picea sitchensis
ref|XP_011022581.1|  PREDICTED: disease resistance response prote...    237   2e-74    
gb|ABD52113.1|  dirigent protein pDIR2                                  237   3e-74    Picea engelmannii x Picea glauca
gb|AAF25367.1|AF210071_1  dirigent-like protein                         237   4e-74    Tsuga heterophylla
gb|AAF25362.1|AF210066_1  dirigent-like protein                         237   4e-74    Thuja plicata [giant arborvitae]
gb|ABD52129.1|  dirigent protein pDIR18                                 238   4e-74    Picea glauca
ref|XP_010685205.1|  PREDICTED: disease resistance response prote...    236   9e-74    
gb|AAL92120.1|AF487405_1  dirigent-like protein                         236   1e-73    Thuja plicata [giant arborvitae]
gb|ABR27728.1|  dirigent-like protein                                   236   1e-73    Picea sitchensis
gb|ABD52119.1|  dirigent protein pDIR8                                  236   1e-73    Picea engelmannii x Picea glauca
gb|AAF25368.1|AF210072_1  dirigent-like protein                         235   2e-73    Tsuga heterophylla
ref|XP_002304532.1|  pathogenesis-related family protein                235   2e-73    Populus trichocarpa [western balsam poplar]
gb|ABR27729.1|  dirigent-like protein                                   235   3e-73    Picea sitchensis
gb|EPS69503.1|  hypothetical protein M569_05266                         234   3e-73    
gb|ACN41005.1|  unknown                                                 234   7e-73    Picea sitchensis
gb|ABR27730.1|  dirigent-like protein                                   232   3e-72    Picea sitchensis
gb|ACN40439.1|  unknown                                                 233   4e-72    Picea sitchensis
gb|ABD52124.1|  dirigent protein pDIR13                                 231   8e-72    Picea engelmannii x Picea glauca
ref|XP_007208851.1|  hypothetical protein PRUPE_ppa025746mg             229   1e-71    
gb|KHN44502.1|  Disease resistance response protein 206                 229   1e-71    
gb|ABD52127.1|  dirigent protein pDIR16                                 231   1e-71    Picea sitchensis
ref|XP_002304534.2|  hypothetical protein POPTR_0003s13450g             227   9e-71    Populus trichocarpa [western balsam poplar]
gb|EYU23399.1|  hypothetical protein MIMGU_mgv1a014140mg                224   6e-69    
gb|AAF25359.1|AF210063_1  dirigent-like protein                         220   2e-67    Thuja plicata [giant arborvitae]
emb|CDP15166.1|  unnamed protein product                                218   7e-67    
ref|XP_009762732.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    205   8e-62    
gb|AFG47371.1|  hypothetical protein 0_1145_01                          196   5e-59    
gb|AFG47372.1|  hypothetical protein 0_1145_01                          196   9e-59    
gb|AEW07420.1|  hypothetical protein 0_1145_01                          194   2e-58    
ref|XP_006387569.1|  hypothetical protein POPTR_0832s002001g            194   1e-57    
ref|XP_011022579.1|  PREDICTED: dirigent protein 5-like                 195   1e-57    
ref|XP_010541338.1|  PREDICTED: dirigent protein 6                      194   2e-57    
gb|AFG50970.1|  hypothetical protein 0_9449_02                          191   7e-57    
gb|AFG50969.1|  hypothetical protein 0_9449_02                          191   1e-56    
ref|XP_011073507.1|  PREDICTED: dirigent protein 5-like                 191   3e-56    
gb|KFK28929.1|  hypothetical protein AALP_AA7G066700                    190   8e-56    
ref|XP_004300845.1|  PREDICTED: disease resistance response prote...    189   1e-55    
gb|AFG50974.1|  hypothetical protein 0_9449_02                          187   2e-55    
ref|XP_006391662.1|  hypothetical protein EUTSA_v10024130mg             188   3e-55    
ref|XP_009586870.1|  PREDICTED: dirigent protein 5-like                 187   6e-55    
emb|CDY25563.1|  BnaC09g11880D                                          187   9e-55    
emb|CDY34400.1|  BnaA09g11420D                                          187   9e-55    
gb|AAF25369.2|AF210073_1  dirigent-like protein                         185   9e-55    Fraxinus mandshurica [Manchurian ash]
ref|XP_006413528.1|  hypothetical protein EUTSA_v10026947mg             187   1e-54    
ref|XP_009112896.1|  PREDICTED: dirigent protein 5                      186   1e-54    
ref|XP_006302880.1|  hypothetical protein CARUB_v10021010mg             186   1e-54    
ref|XP_010439143.1|  PREDICTED: dirigent protein 6                      186   3e-54    
ref|XP_010430535.1|  PREDICTED: dirigent protein 5                      186   3e-54    
ref|XP_010448670.1|  PREDICTED: dirigent protein 6-like                 186   4e-54    
ref|XP_010433875.1|  PREDICTED: dirigent protein 6-like                 186   4e-54    
ref|XP_006284582.1|  hypothetical protein CARUB_v10005816mg             185   4e-54    
ref|NP_176598.1|  dirigent-like protein DIR5                            185   5e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137381.1|  PREDICTED: dirigent protein 6                      185   5e-54    
gb|ABV89607.1|  disease resistance response protein                     185   5e-54    Brassica rapa
ref|XP_010473670.1|  PREDICTED: dirigent protein 5                      185   6e-54    
emb|CDY03531.1|  BnaC01g15510D                                          185   6e-54    
ref|XP_002867693.1|  disease resistance-responsive family protein       185   7e-54    
emb|CDX94207.1|  BnaC07g38410D                                          185   7e-54    
ref|XP_009137314.1|  PREDICTED: dirigent protein 6-like                 185   7e-54    
ref|XP_010533614.1|  PREDICTED: dirigent protein 5                      184   8e-54    
ref|XP_010418469.1|  PREDICTED: dirigent protein 5-like                 184   8e-54    
ref|XP_002887917.1|  disease resistance-responsive family protein       184   1e-53    
ref|XP_007210844.1|  hypothetical protein PRUPE_ppa016381mg             183   2e-53    
ref|NP_194100.1|  dirigent protein 6                                    183   3e-53    Arabidopsis thaliana [mouse-ear cress]
gb|AAF25371.2|AF210075_1  dirigent-like protein                         181   3e-53    Populus tremuloides
ref|XP_011026950.1|  PREDICTED: dirigent protein 5-like                 183   3e-53    
gb|ACC91237.1|  putative disease resistance protein                     183   4e-53    Arabidopsis halleri
ref|XP_010055810.1|  PREDICTED: dirigent protein 5-like                 182   5e-53    
ref|XP_010041232.1|  PREDICTED: dirigent protein 5-like                 182   5e-53    
gb|KCW72360.1|  hypothetical protein EUGRSUZ_E00815                     181   9e-53    
emb|CDY24804.1|  BnaA08g15060D                                          181   1e-52    
ref|XP_006368774.1|  hypothetical protein POPTR_0001s10160g             181   1e-52    
ref|XP_002463249.1|  hypothetical protein SORBIDRAFT_02g040570          181   2e-52    Sorghum bicolor [broomcorn]
emb|CDY35446.1|  BnaC03g62140D                                          180   4e-52    
ref|XP_009109298.1|  PREDICTED: dirigent protein 6-like                 180   5e-52    
ref|XP_010925804.1|  PREDICTED: dirigent protein 5-like                 179   8e-52    
ref|XP_010053186.1|  PREDICTED: dirigent protein 5-like                 179   1e-51    
gb|KCW77449.1|  hypothetical protein EUGRSUZ_D01787                     179   1e-51    
gb|KDP25353.1|  hypothetical protein JCGZ_20509                         179   2e-51    
ref|XP_010055809.1|  PREDICTED: dirigent protein 5-like                 178   3e-51    
ref|XP_010055807.1|  PREDICTED: dirigent protein 5-like                 176   1e-50    
ref|XP_008239094.1|  PREDICTED: dirigent protein 5-like                 176   2e-50    
ref|XP_009136269.1|  PREDICTED: dirigent protein 6-like                 175   4e-50    
ref|XP_006658012.1|  PREDICTED: dirigent protein 5-like                 176   4e-50    
ref|XP_010055806.1|  PREDICTED: dirigent protein 5-like                 174   1e-49    
emb|CDX89657.1|  BnaC03g45710D                                          174   1e-49    
ref|XP_009128680.1|  PREDICTED: dirigent protein 6-like                 173   2e-49    
gb|AAY45735.1|  putative dirigent protein 7.5                           170   2e-49    Quercus suber [cork oak]
emb|CDX93160.1|  BnaA03g38820D                                          173   3e-49    
ref|XP_010273520.1|  PREDICTED: dirigent protein 5-like                 172   3e-49    
ref|XP_004300844.1|  PREDICTED: disease resistance response prote...    172   4e-49    
ref|XP_010041233.1|  PREDICTED: dirigent protein 5-like                 171   1e-48    
gb|KCW44516.1|  hypothetical protein EUGRSUZ_L01976                     171   1e-48    
ref|XP_004958454.1|  PREDICTED: disease resistance response prote...    171   2e-48    
gb|EMT21148.1|  hypothetical protein F775_05542                         170   5e-48    
ref|XP_006396936.1|  hypothetical protein EUTSA_v10028996mg             169   1e-47    
gb|EMT02295.1|  hypothetical protein F775_18233                         169   2e-47    
gb|EMT21147.1|  hypothetical protein F775_05541                         168   2e-47    
ref|XP_008653393.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    168   3e-47    
gb|EAZ04892.1|  hypothetical protein OsI_27074                          167   5e-47    Oryza sativa Indica Group [Indian rice]
gb|AAY45736.1|  putative dirigent protein 9.21                          162   2e-46    Quercus suber [cork oak]
gb|KCW75894.1|  hypothetical protein EUGRSUZ_D00276                     165   3e-46    
ref|XP_010052039.1|  PREDICTED: dirigent protein 5-like                 165   3e-46    
gb|KCW77450.1|  hypothetical protein EUGRSUZ_D01788                     165   4e-46    
ref|XP_010054766.1|  PREDICTED: dirigent protein 5-like                 165   4e-46    
ref|XP_006476460.1|  PREDICTED: dirigent protein 5-like                 164   4e-46    
gb|EMS55049.1|  hypothetical protein TRIUR3_07796                       164   5e-46    
emb|CDP18855.1|  unnamed protein product                                164   7e-46    
ref|NP_192860.1|  disease resistance-responsive, dirigent domain-...    164   8e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004959849.1|  PREDICTED: disease resistance response prote...    164   1e-45    
ref|XP_004958453.1|  PREDICTED: disease resistance response prote...    163   2e-45    
ref|XP_010435306.1|  PREDICTED: dirigent protein 13-like                161   7e-45    
ref|XP_010455526.1|  PREDICTED: dirigent protein 13-like                161   9e-45    
ref|XP_006286574.1|  hypothetical protein CARUB_v10002055mg             161   9e-45    
ref|XP_010435284.1|  PREDICTED: dirigent protein 13                     160   2e-44    
ref|XP_007040401.1|  Disease resistance-responsive (dirigent-like...    159   3e-44    
ref|XP_010422064.1|  PREDICTED: dirigent protein 13-like                159   4e-44    
ref|XP_008341336.1|  PREDICTED: dirigent protein 5-like                 158   6e-44    
ref|XP_010435272.1|  PREDICTED: dirigent protein 13-like                159   8e-44    
ref|XP_006396935.1|  hypothetical protein EUTSA_v10028997mg             159   9e-44    
ref|XP_006289266.1|  hypothetical protein CARUB_v10002732mg             158   1e-43    
ref|XP_009108189.1|  PREDICTED: dirigent protein 12-like                158   1e-43    
ref|XP_009134230.1|  PREDICTED: dirigent protein 6-like                 158   2e-43    
ref|XP_010455525.1|  PREDICTED: dirigent protein 13-like                158   2e-43    
gb|KCW77452.1|  hypothetical protein EUGRSUZ_D01790                     156   4e-43    
dbj|BAC19943.1|  putative disease resistance response protein           157   4e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002872559.1|  disease resistance-responsive family protein       156   6e-43    
ref|XP_010054768.1|  PREDICTED: dirigent protein 5-like                 156   7e-43    
ref|NP_192858.1|  disease resistance-responsive, dirigent domain-...    156   8e-43    Arabidopsis thaliana [mouse-ear cress]
emb|CDY13238.1|  BnaC09g24180D                                          155   9e-43    
gb|AFK46449.1|  unknown                                                 154   1e-42    
gb|EMT00410.1|  hypothetical protein F775_16017                         155   1e-42    
ref|XP_010435326.1|  PREDICTED: dirigent protein 12-like                155   2e-42    
gb|EAZ40801.1|  hypothetical protein OsJ_25279                          155   3e-42    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ40847.1|  hypothetical protein OsJ_25326                          155   3e-42    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04848.1|  hypothetical protein OsI_27026                          155   4e-42    Oryza sativa Indica Group [Indian rice]
ref|NP_001060395.1|  Os07g0636600                                       155   5e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658874.1|  PREDICTED: dirigent protein 5-like                 154   7e-42    
gb|EMT04615.1|  hypothetical protein F775_16948                         154   8e-42    
gb|EAZ04838.1|  hypothetical protein OsI_27016                          154   9e-42    Oryza sativa Indica Group [Indian rice]
gb|EMS58222.1|  hypothetical protein TRIUR3_30180                       153   2e-41    
dbj|BAC45193.1|  putative disease resistance response protein           153   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562603.1|  PREDICTED: dirigent protein 5-like                 152   3e-41    
ref|XP_006658873.1|  PREDICTED: dirigent protein 5-like                 151   1e-40    
gb|EAZ04891.1|  hypothetical protein OsI_27073                          150   1e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_006658879.1|  PREDICTED: dirigent protein 6-like                 150   2e-40    
gb|EMS55048.1|  hypothetical protein TRIUR3_07795                       148   7e-40    
gb|EAZ40816.1|  hypothetical protein OsJ_25293                          148   1e-39    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA63818.1|  TPA: hypothetical protein ZEAMMB73_569446              147   2e-39    
ref|XP_006658037.1|  PREDICTED: dirigent protein 5-like                 147   4e-39    
gb|EAZ04840.1|  hypothetical protein OsI_27018                          147   4e-39    Oryza sativa Indica Group [Indian rice]
gb|AGT16320.1|  hypothetical protein SHCRBa_044_M03_R_90                145   8e-39    
ref|XP_006658875.1|  PREDICTED: dirigent protein 6-like                 145   2e-38    
ref|NP_001060396.1|  Os07g0636800                                       145   3e-38    Oryza sativa Japonica Group [Japonica rice]
emb|CDP11570.1|  unnamed protein product                                145   5e-38    
ref|XP_006439430.1|  hypothetical protein CICLE_v10023858mg             141   2e-37    
gb|EMT13497.1|  Zinc finger Ran-binding domain-containing protein 3     150   9e-37    
gb|EMS53742.1|  hypothetical protein TRIUR3_35085                       137   5e-36    
ref|NP_001060409.1|  Os07g0638500                                       138   1e-35    Oryza sativa Japonica Group [Japonica rice]
gb|EMT21146.1|  hypothetical protein F775_11443                         134   2e-35    
ref|NP_001060404.2|  Os07g0637700                                       135   1e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002872556.1|  disease resistance-responsive family protein       133   4e-34    
ref|NP_192857.1|  dirigent protein 1                                    133   4e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008780221.1|  PREDICTED: disease resistance response prote...    129   1e-33    
gb|EMS58110.1|  hypothetical protein TRIUR3_25223                       129   2e-33    
gb|EAZ40803.1|  hypothetical protein OsJ_25281                          131   3e-33    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455523.1|  PREDICTED: dirigent protein 12-like                130   3e-33    
dbj|BAC16397.1|  putative dirigent protein                              129   9e-33    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060444.1|  Os07g0643800                                       130   2e-32    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006476462.1|  PREDICTED: disease resistance response prote...    126   4e-32    
ref|XP_006387568.1|  hypothetical protein POPTR_0832s002002g            123   1e-31    
ref|XP_002303617.1|  hypothetical protein POPTR_0003s13430g             122   7e-31    Populus trichocarpa [western balsam poplar]
gb|EMT04616.1|  hypothetical protein F775_16949                         122   8e-31    
gb|EMT07233.1|  hypothetical protein F775_21693                         124   8e-30    
ref|XP_006826466.1|  hypothetical protein AMTR_s00004p00225050          120   1e-29    
ref|XP_010229599.1|  PREDICTED: dirigent protein 5-like                 116   7e-28    
ref|XP_002981853.1|  hypothetical protein SELMODRAFT_115653             116   8e-28    
gb|EMT16399.1|  Disease resistance response protein 206                 120   9e-28    
gb|EMT02296.1|  hypothetical protein F775_18234                         114   2e-27    
gb|KCW72361.1|  hypothetical protein EUGRSUZ_E00817                     113   6e-27    
ref|XP_002982822.1|  hypothetical protein SELMODRAFT_117307             114   7e-27    
ref|XP_006368775.1|  hypothetical protein POPTR_0001s10165g             111   1e-26    
gb|EAZ04839.1|  hypothetical protein OsI_27017                          111   3e-26    
dbj|BAK02050.1|  predicted protein                                      104   2e-23    
gb|AFG48640.1|  hypothetical protein CL170Contig1_03                  96.7    1e-21    
ref|XP_002976809.1|  hypothetical protein SELMODRAFT_443317             106   1e-21    
ref|XP_002991608.1|  hypothetical protein SELMODRAFT_133806           96.7    1e-20    
ref|XP_002971526.1|  hypothetical protein SELMODRAFT_95506            96.7    1e-20    
ref|XP_010261651.1|  PREDICTED: disease resistance response prote...  94.4    1e-20    
ref|XP_002980538.1|  hypothetical protein SELMODRAFT_6079             94.7    3e-20    
ref|XP_007040399.1|  Disease resistance-responsive (dirigent-like...  91.7    3e-19    
ref|XP_002872560.1|  hypothetical protein ARALYDRAFT_911446           93.6    1e-18    
ref|XP_002509893.1|  hypothetical protein RCOM_1689530                85.5    2e-17    
gb|KCW77451.1|  hypothetical protein EUGRSUZ_D01789                   77.0    2e-14    
ref|XP_009138983.1|  PREDICTED: dirigent protein 21-like              78.6    3e-14    
emb|CDY04773.1|  BnaC05g18160D                                        77.8    6e-14    
ref|XP_009115582.1|  PREDICTED: dirigent protein 2                    77.8    6e-14    
ref|XP_002993354.1|  hypothetical protein SELMODRAFT_136995           77.0    9e-14    
ref|NP_001065888.1|  Os11g0178800                                     77.0    9e-14    
ref|XP_006829600.1|  hypothetical protein AMTR_s01147p00007290        76.6    1e-13    
ref|XP_006837280.1|  hypothetical protein AMTR_s02003p00008260        76.6    1e-13    
ref|XP_006841401.1|  hypothetical protein AMTR_s00901p00009100        76.3    2e-13    
ref|XP_010257547.1|  PREDICTED: dirigent protein 21-like              76.3    2e-13    
ref|XP_002974933.1|  hypothetical protein SELMODRAFT_59090            75.1    2e-13    
ref|XP_002960287.1|  hypothetical protein SELMODRAFT_74313            75.5    3e-13    
gb|EEC82520.1|  hypothetical protein OsI_27027                        74.3    5e-13    
ref|XP_002299656.2|  hypothetical protein POPTR_0001s22170g           74.7    6e-13    
ref|XP_006851957.1|  hypothetical protein AMTR_s00041p00187460        74.7    7e-13    
emb|CDP15163.1|  unnamed protein product                              74.7    8e-13    
ref|XP_002981879.1|  hypothetical protein SELMODRAFT_115256           74.3    9e-13    
ref|XP_002967426.1|  hypothetical protein SELMODRAFT_87848            73.9    1e-12    
emb|CDY21398.1|  BnaA09g30290D                                        73.9    1e-12    
gb|AFG54174.1|  hypothetical protein CL3051Contig1_01                 71.6    1e-12    
gb|AEW08514.1|  hypothetical protein CL170Contig1_04                  71.6    1e-12    
ref|XP_002972740.1|  hypothetical protein SELMODRAFT_37680            72.4    2e-12    
ref|XP_002313728.1|  disease resistance-responsive family protein     73.6    2e-12    
ref|XP_004978854.1|  PREDICTED: disease resistance response prote...  73.2    2e-12    
gb|KDO83225.1|  hypothetical protein CISIN_1g047858mg                 73.6    2e-12    
ref|XP_006833077.1|  hypothetical protein AMTR_s00995p00008650        73.6    2e-12    
gb|AFG54404.1|  hypothetical protein CL170Contig1_04                  70.9    3e-12    
ref|XP_011046627.1|  PREDICTED: dirigent protein 23                   73.2    3e-12    
gb|EYU40047.1|  hypothetical protein MIMGU_mgv11b016570mg             72.0    3e-12    
ref|XP_007029061.1|  Disease resistance-responsive (dirigent-like...  72.8    4e-12    
ref|XP_002985997.1|  hypothetical protein SELMODRAFT_123398           72.8    4e-12    
ref|XP_007041903.1|  Disease resistance-responsive family protein...  72.8    4e-12    
ref|XP_010504752.1|  PREDICTED: dirigent protein 21-like              72.8    4e-12    
ref|XP_010516455.1|  PREDICTED: dirigent protein 21-like              72.4    4e-12    
gb|AFK35849.1|  unknown                                               72.4    6e-12    
gb|ABD52128.1|  dirigent-like protein pDIR17                          72.0    6e-12    
ref|XP_004292161.1|  PREDICTED: disease resistance response prote...  72.4    6e-12    
ref|XP_011037299.1|  PREDICTED: dirigent protein 23-like              72.0    6e-12    
ref|XP_006851956.1|  hypothetical protein AMTR_s00041p00187220        72.4    6e-12    
ref|XP_006402810.1|  hypothetical protein EUTSA_v10006492mg           72.8    1e-11    
ref|XP_007037651.1|  Disease resistance response protein, putative    71.2    1e-11    
ref|XP_010427710.1|  PREDICTED: dirigent protein 21-like              71.2    1e-11    
gb|KEH15438.1|  disease resistance response protein, putative         69.7    1e-11    
ref|XP_006843315.1|  hypothetical protein AMTR_s00913p00008360        70.9    2e-11    
gb|AAB72169.1|  hypothetical protein                                  70.9    2e-11    
ref|NP_173703.2|  disease resistance-responsive, dirigent domain-...  70.9    2e-11    
dbj|BAJ93815.1|  predicted protein                                    71.6    2e-11    
ref|XP_002882837.1|  hypothetical protein ARALYDRAFT_318143           70.1    2e-11    
dbj|BAJ99603.1|  predicted protein                                    70.5    2e-11    
ref|XP_006366618.1|  PREDICTED: dirigent protein 21-like              70.5    2e-11    
ref|XP_002978209.1|  hypothetical protein SELMODRAFT_6231             69.7    2e-11    
ref|XP_002966352.1|  hypothetical protein SELMODRAFT_6118             69.7    2e-11    
gb|KEH30526.1|  disease resistance-responsive, dirigent domain pr...  70.5    2e-11    
ref|XP_002988690.1|  hypothetical protein SELMODRAFT_184063           70.1    2e-11    
ref|XP_002986379.1|  hypothetical protein SELMODRAFT_124022           70.1    3e-11    
gb|KCW90339.1|  hypothetical protein EUGRSUZ_A02485                   70.1    3e-11    
ref|XP_008241179.1|  PREDICTED: dirigent protein 21-like              70.5    3e-11    
gb|EMS46182.1|  hypothetical protein TRIUR3_05228                     69.7    4e-11    
gb|ABD52112.1|  dirigent-like protein pDIR1                           70.1    4e-11    
ref|XP_004248664.1|  PREDICTED: dirigent protein 22-like              69.7    4e-11    
gb|ABD52123.1|  dirigent-like protein pDIR12                          69.7    4e-11    
ref|XP_010024264.1|  PREDICTED: dirigent protein 21-like              69.7    4e-11    
ref|XP_006851934.1|  hypothetical protein AMTR_s00041p00176950        69.7    5e-11    
ref|XP_004978849.1|  PREDICTED: disease resistance response prote...  69.7    5e-11    
gb|ADP55101.1|  dirigent-like protein                                 69.7    5e-11    
ref|XP_010427714.1|  PREDICTED: dirigent protein 21-like              69.7    5e-11    
ref|XP_006366619.1|  PREDICTED: dirigent protein 21-like              69.7    5e-11    
gb|ACU55136.1|  dirigent-like protein 2                               69.7    5e-11    
gb|ADP55098.1|  dirigent-like protein                                 69.3    5e-11    
ref|NP_001168549.1|  disease resistance response protein 206 prec...  69.3    6e-11    
gb|AFK39378.1|  unknown                                               69.7    6e-11    
ref|XP_004289850.1|  PREDICTED: disease resistance response prote...  69.3    6e-11    
ref|XP_009791435.1|  PREDICTED: dirigent protein 11-like              69.7    6e-11    
gb|AFW56216.1|  disease resistance response protein 206               68.9    7e-11    
ref|NP_001149569.1|  disease resistance response protein 206 prec...  68.9    7e-11    
ref|XP_006292940.1|  hypothetical protein CARUB_v10019211mg           69.3    7e-11    
gb|AFG54168.1|  hypothetical protein CL3051Contig1_01                 67.0    7e-11    
ref|XP_009601144.1|  PREDICTED: dirigent protein 11-like              69.3    7e-11    
emb|CDP13135.1|  unnamed protein product                              68.6    8e-11    
ref|XP_002987900.1|  hypothetical protein SELMODRAFT_27549            68.2    8e-11    
ref|XP_006482976.1|  PREDICTED: dirigent protein 7-like               68.9    8e-11    
gb|ADP55095.1|  dirigent-like protein                                 68.9    8e-11    
ref|XP_004505770.1|  PREDICTED: disease resistance response prote...  68.9    8e-11    
gb|EMS46181.1|  hypothetical protein TRIUR3_05227                     68.9    8e-11    
gb|AFG54173.1|  hypothetical protein CL3051Contig1_01                 66.6    9e-11    
gb|AEW08998.1|  hypothetical protein CL3051Contig1_01                 66.6    9e-11    
ref|XP_002878187.1|  hypothetical protein ARALYDRAFT_348875           70.9    1e-10    
ref|NP_001151025.1|  disease resistance response protein 206 prec...  68.6    1e-10    
gb|AFG54164.1|  hypothetical protein CL3051Contig1_01                 66.6    1e-10    
ref|XP_002967407.1|  hypothetical protein SELMODRAFT_87141            68.6    1e-10    
ref|XP_007204144.1|  hypothetical protein PRUPE_ppa021998mg           68.9    1e-10    
ref|XP_002960306.1|  hypothetical protein SELMODRAFT_139600           68.2    1e-10    
ref|XP_002991298.1|  hypothetical protein SELMODRAFT_27548            67.8    1e-10    
gb|EMS59320.1|  hypothetical protein TRIUR3_30230                     69.3    1e-10    
ref|XP_011037132.1|  PREDICTED: dirigent protein 4-like               68.6    1e-10    
gb|EYU31698.1|  hypothetical protein MIMGU_mgv1a026952mg              67.8    1e-10    
ref|XP_006851933.1|  hypothetical protein AMTR_s00041p00176840        68.2    1e-10    
ref|XP_010504753.1|  PREDICTED: dirigent protein 21-like              68.6    1e-10    
gb|ADP55097.1|  dirigent-like protein                                 68.2    1e-10    
ref|XP_008789330.1|  PREDICTED: dirigent protein 22-like              68.6    1e-10    
ref|XP_003572563.1|  PREDICTED: dirigent protein 22-like              68.2    1e-10    
ref|XP_004168161.1|  PREDICTED: uncharacterized LOC101212940          68.2    2e-10    
ref|XP_006366608.1|  PREDICTED: dirigent protein 21-like              68.6    2e-10    
dbj|BAJ89677.1|  predicted protein                                    68.2    2e-10    
gb|ABR27716.1|  dirigent-like protein                                 68.2    2e-10    
ref|XP_006829350.1|  hypothetical protein AMTR_s01736p00007740        68.2    2e-10    
ref|XP_009388280.1|  PREDICTED: dirigent protein 22-like              68.2    2e-10    
ref|XP_010238661.1|  PREDICTED: dirigent protein 21-like              67.8    2e-10    
ref|XP_006851946.1|  hypothetical protein AMTR_s00041p00182080        68.2    2e-10    
ref|XP_009601995.1|  PREDICTED: dirigent protein 21-like              68.2    2e-10    
ref|XP_010024793.1|  PREDICTED: dirigent protein 11-like              67.8    2e-10    
ref|XP_010101145.1|  hypothetical protein L484_016709                 68.2    2e-10    
ref|XP_006366617.1|  PREDICTED: dirigent protein 21-like              68.2    2e-10    
ref|XP_002312128.2|  disease resistance-responsive family protein     67.8    2e-10    
gb|AFK42454.1|  unknown                                               68.2    2e-10    
ref|XP_010531503.1|  PREDICTED: dirigent protein 23                   67.8    2e-10    
ref|XP_007029062.1|  Disease resistance-responsive family protein     67.8    2e-10    
gb|KDO70858.1|  hypothetical protein CISIN_1g043227mg                 67.8    2e-10    
gb|ABR27717.1|  dirigent-like protein                                 67.8    2e-10    
gb|KCW61289.1|  hypothetical protein EUGRSUZ_H04044                   67.4    3e-10    
ref|XP_002441906.1|  hypothetical protein SORBIDRAFT_08g004670        67.4    3e-10    
ref|XP_008669799.1|  PREDICTED: dirigent protein 22-like              67.4    3e-10    
emb|CDX88970.1|  BnaA04g02160D                                        69.3    3e-10    
ref|XP_008438952.1|  PREDICTED: dirigent protein 11-like              67.4    3e-10    
ref|XP_002964150.1|  hypothetical protein SELMODRAFT_6134             66.2    3e-10    
ref|XP_004138215.1|  PREDICTED: uncharacterized protein LOC101212940  67.4    3e-10    
ref|XP_002450420.1|  hypothetical protein SORBIDRAFT_05g005150        67.0    3e-10    
ref|XP_006851930.1|  hypothetical protein AMTR_s00041p00175670        67.4    3e-10    
ref|XP_004296168.1|  PREDICTED: disease resistance response prote...  67.4    4e-10    
ref|XP_011094443.1|  PREDICTED: dirigent protein 1-like               67.0    4e-10    
ref|XP_002977365.1|  hypothetical protein SELMODRAFT_37655            66.2    4e-10    
ref|XP_004978853.1|  PREDICTED: disease resistance response prote...  67.0    4e-10    
ref|XP_002297761.2|  hypothetical protein POPTR_0001s06120g           67.0    4e-10    
gb|ABD52118.1|  dirigent-like protein pDIR7                           67.0    4e-10    
ref|XP_006851942.1|  hypothetical protein AMTR_s00041p00180140        67.0    4e-10    
ref|XP_009799585.1|  PREDICTED: dirigent protein 11-like              67.0    4e-10    
ref|XP_010527557.1|  PREDICTED: dirigent protein 21-like              67.0    4e-10    
gb|ABD52114.1|  dirigent-like protein pDIR3                           67.0    5e-10    
ref|XP_009759252.1|  PREDICTED: dirigent protein 21-like              67.0    5e-10    
ref|XP_010477562.1|  PREDICTED: dirigent protein 11                   67.0    5e-10    
ref|XP_004142155.1|  PREDICTED: uncharacterized protein LOC101214318  66.6    5e-10    
ref|NP_001148909.1|  LOC100282529 precursor                           66.2    6e-10    
gb|KDP31386.1|  hypothetical protein JCGZ_11762                       66.6    6e-10    
ref|XP_006366620.1|  PREDICTED: dirigent protein 7-like               66.6    6e-10    
ref|XP_004309140.1|  PREDICTED: disease resistance response prote...  66.6    6e-10    
ref|NP_187976.4|  Disease resistance-responsive (dirigent-like pr...  66.2    6e-10    
gb|EAY80163.1|  hypothetical protein OsI_35334                        66.2    7e-10    
gb|KDO35808.1|  hypothetical protein CISIN_1g029442mg                 66.6    7e-10    
ref|XP_006366615.1|  PREDICTED: dirigent protein 20-like              66.2    7e-10    
ref|XP_010260988.1|  PREDICTED: dirigent protein 22-like              66.2    7e-10    
ref|XP_009409210.1|  PREDICTED: dirigent protein 4-like               66.2    7e-10    
ref|XP_010520657.1|  PREDICTED: dirigent protein 22-like              66.6    7e-10    
ref|NP_001065890.1|  Os11g0179100                                     66.2    8e-10    
ref|XP_004492507.1|  PREDICTED: disease resistance response prote...  66.2    8e-10    
ref|XP_006851937.1|  hypothetical protein AMTR_s00041p00178500        66.2    8e-10    
ref|XP_004153955.1|  PREDICTED: disease resistance response prote...  66.2    8e-10    
ref|XP_006492824.1|  PREDICTED: dirigent protein 23-like              66.2    8e-10    
ref|NP_199065.1|  disease resistance-responsive (dirigent-like pr...  66.2    8e-10    
ref|XP_006281178.1|  hypothetical protein CARUB_v10027213mg           66.2    8e-10    
gb|AFG45326.1|  hypothetical protein 2_9838_01                        65.5    8e-10    
ref|XP_008449786.1|  PREDICTED: dirigent protein 22-like              66.2    9e-10    
gb|KEH28822.1|  disease resistance-responsive, dirigent domain pr...  66.2    9e-10    
emb|CDP16946.1|  unnamed protein product                              66.6    9e-10    
ref|XP_010090301.1|  hypothetical protein L484_024966                 65.9    9e-10    
ref|XP_007008799.1|  Disease resistance-responsive family protein     66.2    9e-10    
ref|XP_010494187.1|  PREDICTED: dirigent protein 2-like               65.9    1e-09    
dbj|BAB01913.1|  unnamed protein product                              65.9    1e-09    
gb|KEH20016.1|  hypothetical protein MTR_8g064660                     65.5    1e-09    
ref|XP_002266452.2|  PREDICTED: dirigent protein 22                   65.9    1e-09    
ref|XP_010048806.1|  PREDICTED: dirigent protein 21-like              65.9    1e-09    
ref|XP_010912515.1|  PREDICTED: dirigent protein 19-like              65.9    1e-09    
ref|XP_004505769.1|  PREDICTED: disease resistance response prote...  65.9    1e-09    
ref|XP_004292159.1|  PREDICTED: uncharacterized protein LOC101303009  65.9    1e-09    
ref|XP_004977239.1|  PREDICTED: disease resistance response prote...  65.9    1e-09    
ref|XP_006366583.1|  PREDICTED: dirigent protein 1-like               65.9    1e-09    
ref|XP_009117615.1|  PREDICTED: dirigent protein 22-like              65.9    1e-09    
ref|XP_006836063.1|  hypothetical protein AMTR_s00114p00093910        66.6    1e-09    
ref|NP_176762.1|  dirigent protein 21                                 65.9    1e-09    
ref|XP_002513105.1|  Disease resistance response protein, putative    65.9    1e-09    
ref|XP_010429184.1|  PREDICTED: dirigent protein 4-like               65.9    1e-09    
ref|XP_006366609.1|  PREDICTED: dirigent protein 21-like              65.9    1e-09    
emb|CDO98764.1|  unnamed protein product                              65.5    1e-09    
ref|XP_006416145.1|  hypothetical protein EUTSA_v10008857mg           65.9    1e-09    
gb|KEH41749.1|  disease resistance response protein                   65.9    1e-09    
ref|XP_007134635.1|  hypothetical protein PHAVU_010G063600g           65.5    1e-09    
ref|XP_004977240.1|  PREDICTED: disease resistance response prote...  65.5    1e-09    
ref|XP_008235983.1|  PREDICTED: dirigent protein 21-like              65.5    1e-09    
emb|CDP16948.1|  unnamed protein product                              65.9    1e-09    
ref|XP_010442171.1|  PREDICTED: dirigent protein 2-like               65.5    1e-09    
ref|XP_010542445.1|  PREDICTED: dirigent protein 20-like              65.5    1e-09    
ref|XP_006281166.1|  hypothetical protein CARUB_v10027200mg           65.5    2e-09    
ref|XP_010273310.1|  PREDICTED: dirigent protein 22-like              65.9    2e-09    
ref|XP_006492823.1|  PREDICTED: dirigent protein 11-like              65.5    2e-09    
ref|XP_009596486.1|  PREDICTED: dirigent protein 22-like              65.1    2e-09    
ref|XP_010048736.1|  PREDICTED: dirigent protein 22-like              65.5    2e-09    
ref|NP_199715.1|  disease resistance-responsive (dirigent-like pr...  65.5    2e-09    
ref|XP_003529182.1|  PREDICTED: dirigent protein 19-like              65.5    2e-09    
ref|XP_002974944.1|  hypothetical protein SELMODRAFT_37613            64.3    2e-09    
ref|XP_011075257.1|  PREDICTED: dirigent protein 21-like              65.5    2e-09    
gb|KFK44377.1|  hypothetical protein AALP_AA1G249600                  65.1    2e-09    
ref|XP_002528277.1|  Disease resistance response protein, putative    65.1    2e-09    
gb|EYU37927.1|  hypothetical protein MIMGU_mgv1a018617mg              65.1    2e-09    
ref|XP_002276722.1|  PREDICTED: dirigent protein 23-like              65.1    2e-09    
ref|XP_009117440.1|  PREDICTED: dirigent protein 23                   65.1    2e-09    



>ref|XP_002297996.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE82801.1| pathogenesis-related family protein [Populus trichocarpa]
Length=183

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +  SS HP G+KK YKPCK LVLYFHD+IYNGQNAANATS IV AP+  N TILA+QFHF
Sbjct  14   LVASSAHP-GKKKQYKPCKELVLYFHDIIYNGQNAANATSAIVAAPEGANLTILASQFHF  72

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNN HS PVGRAQGMY+YDTKNT+TAWLGFSF LN+TD QGSINFIGA
Sbjct  73   GNIAVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTAWLGFSFALNSTDHQGSINFIGA  132

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+M KTRDISVVGGTGDFFMHRG+AT+ TDAFEGEVYFRLRVDIKFYECW
Sbjct  133  DPIMIKTRDISVVGGTGDFFMHRGIATIATDAFEGEVYFRLRVDIKFYECW  183



>ref|XP_004298854.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=186

 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +S+SS +P  RK+ YKPCK+LVL+FHD+IYNG+NAANATS IV APQ  N TILA+QFHF
Sbjct  17   LSLSSAYPKPRKQ-YKPCKHLVLFFHDIIYNGKNAANATSAIVAAPQGANLTILASQFHF  75

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNN HS PVGRAQGMY+YDTKNTYTAWLGFSF LNTT  QGSINFIGA
Sbjct  76   GNIAVFDDPITLDNNLHSKPVGRAQGMYLYDTKNTYTAWLGFSFSLNTTAYQGSINFIGA  135

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLMNKTRDISVVGGTGDFFMHRGVAT+MTDA+EGEVYFRLRVDI FYECW
Sbjct  136  DPLMNKTRDISVVGGTGDFFMHRGVATIMTDAYEGEVYFRLRVDINFYECW  186



>ref|XP_002276430.1| PREDICTED: disease resistance response protein 206 [Vitis vinifera]
Length=185

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +S SS +  G+KK YKPCK +VLYFHDV+YNGQNAANATS IVGAPQWGN TILA +FHF
Sbjct  16   LSFSSAYQ-GKKKQYKPCKQMVLYFHDVLYNGQNAANATSAIVGAPQWGNLTILADKFHF  74

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GNVVVFDDPITLDNNFHS PVGRAQGMY+YDTKNT+T+WLGF+FVLN+TD QG++NF+GA
Sbjct  75   GNVVVFDDPITLDNNFHSKPVGRAQGMYIYDTKNTFTSWLGFTFVLNSTDFQGTLNFMGA  134

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+M KTRDI+VV GTGDFFMHRG+AT+MTDAFEG+VYFRLRVDIK YECW
Sbjct  135  DPIMVKTRDITVVSGTGDFFMHRGIATIMTDAFEGDVYFRLRVDIKLYECW  185



>ref|XP_011026952.1| PREDICTED: disease resistance response protein 206-like [Populus 
euphratica]
Length=183

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGN  301
            VSS HP G+KK YKPCK LVLYFHD+IYNG+NAANATS IV AP+  N TILA+QFHFGN
Sbjct  16   VSSAHP-GKKKQYKPCKELVLYFHDIIYNGKNAANATSAIVAAPEGANLTILASQFHFGN  74

Query  302  VVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADP  481
            +VVFDDPITLDNN HS PVGRAQGMY+YDTKNT+TAWLGFSFVLN+TD  GSINFIGADP
Sbjct  75   IVVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTAWLGFSFVLNSTDHHGSINFIGADP  134

Query  482  LMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +M KTRDISVVGGTGDFFMHRG+AT+ T AFEGEVYFRLRVDIKFYECW
Sbjct  135  IMVKTRDISVVGGTGDFFMHRGIATIATGAFEGEVYFRLRVDIKFYECW  183



>ref|XP_002276448.1| PREDICTED: disease resistance response protein 206 [Vitis vinifera]
Length=185

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +S SS +  G+KK YKPCK +VLYFHDV+YNGQNAANATS IVGAPQWGN TILA +FHF
Sbjct  16   LSFSSAYQ-GKKKQYKPCKQMVLYFHDVLYNGQNAANATSAIVGAPQWGNLTILADKFHF  74

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G+VVVFDDPITLDNNFHS PVGRAQGMY+YDTKNT+TAWLGF+FVLN+TD QG++NF+GA
Sbjct  75   GDVVVFDDPITLDNNFHSKPVGRAQGMYIYDTKNTFTAWLGFTFVLNSTDFQGTLNFMGA  134

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ KTRDI+VV GTGDFFMHRG+AT+MTDAFEGEVYFRLRVDIK YECW
Sbjct  135  DPIIVKTRDITVVSGTGDFFMHRGIATIMTDAFEGEVYFRLRVDIKLYECW  185



>ref|XP_006439431.1| hypothetical protein CICLE_v10023550mg [Citrus clementina]
 gb|ESR52671.1| hypothetical protein CICLE_v10023550mg [Citrus clementina]
Length=184

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +  +S+  MGRKK YKPCK L+LYFHDVIYNG+N  NATS IV AP+  N TILA  FHF
Sbjct  14   VLATSSPSMGRKKQYKPCKELLLYFHDVIYNGKNKENATSAIVAAPEGANLTILAGNFHF  73

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNNFHS PVGRAQGMY+YDTKNTYT+WLGF+FVLN+TD QG+INFIGA
Sbjct  74   GNIAVFDDPITLDNNFHSKPVGRAQGMYIYDTKNTYTSWLGFTFVLNSTDYQGTINFIGA  133

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+M KTRDISVVGGTGDFFMHRGVAT+MTDAFEG+VYFRLRVDIKFYECW
Sbjct  134  DPIMIKTRDISVVGGTGDFFMHRGVATLMTDAFEGDVYFRLRVDIKFYECW  184



>ref|XP_007040398.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY24899.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=184

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P  + K YKPCK+LVLYFHD+IYNGQN  NATS IV APQ  N TILA QFHF
Sbjct  15   LAVSSAYPF-KNKQYKPCKHLVLYFHDIIYNGQNRENATSAIVAAPQGANLTILAGQFHF  73

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+VVFDDPITLDNN HS PVGRAQGMY+YDTKNT+TAWLGFSFVLN+T+ QG++NFIGA
Sbjct  74   GNIVVFDDPITLDNNLHSKPVGRAQGMYIYDTKNTFTAWLGFSFVLNSTNYQGTVNFIGA  133

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLM KTRDISVVGGTGDFFMHRGVAT+ TDAFEGEVYFRL+VDIKFYECW
Sbjct  134  DPLMQKTRDISVVGGTGDFFMHRGVATLTTDAFEGEVYFRLKVDIKFYECW  184



>ref|XP_006476461.1| PREDICTED: disease resistance response protein 206-like isoform 
X1 [Citrus sinensis]
Length=184

 Score =   293 bits (750),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +  +S+   GRKK YK CK L+LYFHDVIYNG+N  NATS IV AP+  N TILA  FHF
Sbjct  14   VLATSSPSTGRKKQYKSCKELLLYFHDVIYNGKNKENATSAIVAAPEGANLTILAGNFHF  73

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNNFHS PVGRAQGMY+YDTKNTYT+WLGF+FVLN+TD QG+INFIGA
Sbjct  74   GNIAVFDDPITLDNNFHSKPVGRAQGMYIYDTKNTYTSWLGFTFVLNSTDYQGTINFIGA  133

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+M KTRDISVVGGTGDFFMHRGVAT+MTDAFEGEVYFRLRVDIKFYECW
Sbjct  134  DPIMIKTRDISVVGGTGDFFMHRGVATLMTDAFEGEVYFRLRVDIKFYECW  184



>ref|XP_002297995.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE82800.2| pathogenesis-related family protein [Populus trichocarpa]
Length=183

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +  SS HP G+KK YKPCK LVLYFHD+IYNGQNAANATS IV AP+  N TILA+QFHF
Sbjct  14   LVASSAHP-GKKKQYKPCKELVLYFHDIIYNGQNAANATSAIVAAPEGANLTILASQFHF  72

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNN HS PVGRAQGMY+YDTKNT+TAWLGFSFVLN+TD  G++NF+GA
Sbjct  73   GNIAVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTAWLGFSFVLNSTDHHGTVNFMGA  132

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP   KTRDISVVGGTGDFFMHRG+AT+ TDA+EG+VYFRLRVDIKFYECW
Sbjct  133  DPTTLKTRDISVVGGTGDFFMHRGIATIATDAYEGDVYFRLRVDIKFYECW  183



>gb|KDO76393.1| hypothetical protein CISIN_1g038284mg [Citrus sinensis]
Length=184

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +  +S+   GRKK YK CK L+LYFHDVIYNG+N  NATS IV AP+  N TILA  FHF
Sbjct  14   VLATSSPSTGRKKQYKSCKELLLYFHDVIYNGKNKENATSAIVAAPEGANLTILAGNFHF  73

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNNFHS PVGRAQGMY+YDTKNTYT+WLGF+FVLN+TD QG+INFIGA
Sbjct  74   GNIAVFDDPITLDNNFHSKPVGRAQGMYIYDTKNTYTSWLGFTFVLNSTDYQGTINFIGA  133

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+M KTRDISVVGGTGDFFMHRGVAT+MTDAFEG+VYFRLRVDIKFYECW
Sbjct  134  DPIMIKTRDISVVGGTGDFFMHRGVATLMTDAFEGDVYFRLRVDIKFYECW  184



>ref|XP_008451985.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
melo]
Length=192

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  137  PMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFD  316
            PMG+K+ +KPCK LVLYFHD+IYNG+NAANATS IV AP+  N TILA QFHFGN+ VFD
Sbjct  29   PMGKKQKHKPCKQLVLYFHDIIYNGKNAANATSAIVAAPEGANLTILAPQFHFGNIAVFD  88

Query  317  DPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKT  496
            DPITLDNN HS PVGRAQGMY+YDTKNT+T+WL FSF LN T  +G+INF+GADP+M KT
Sbjct  89   DPITLDNNLHSKPVGRAQGMYIYDTKNTFTSWLAFSFSLNYTAYEGTINFVGADPIMVKT  148

Query  497  RDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RDISVVGGTGDFFMHRGVAT+MTDAFEGEVYFRLRVDIKFYECW
Sbjct  149  RDISVVGGTGDFFMHRGVATIMTDAFEGEVYFRLRVDIKFYECW  192



>ref|XP_011022578.1| PREDICTED: disease resistance response protein 206-like [Populus 
euphratica]
Length=183

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK LVLYFHD++YNGQNAANATS IV AP+  N TILA QFHF
Sbjct  14   LAVSSAYP-GKKKQYKPCKELVLYFHDILYNGQNAANATSAIVAAPEGANLTILAGQFHF  72

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WL F+FVLN+T+ QG+I+FIGA
Sbjct  73   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLSFTFVLNSTEHQGTISFIGA  132

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDIS+VGGTGDFFMHRG+AT+ TDAFEG+VYFRL VDIKFYECW
Sbjct  133  DPILVKSRDISIVGGTGDFFMHRGIATIATDAFEGDVYFRLHVDIKFYECW  183



>ref|XP_008238999.1| PREDICTED: disease resistance response protein 206-like [Prunus 
mume]
Length=185

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            SS  P  + K YKPCK+LVL+FHD+IYNG+NAANATS IV APQ  N TILA QFHFGN+
Sbjct  19   SSAFPRNKNK-YKPCKHLVLFFHDIIYNGKNAANATSAIVAAPQGANLTILAPQFHFGNI  77

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
             VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WLGFSF LN+TD QGSINFIGADP+
Sbjct  78   AVFDDPITLDNNLHSKPVGRAQGMYIYDTKNTFTSWLGFSFALNSTDYQGSINFIGADPI  137

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            + KTRDISVVGGTGDFFMHRG+AT+ TDA+EGEVYFRL+VDIKFYECW
Sbjct  138  LIKTRDISVVGGTGDFFMHRGIATINTDAYEGEVYFRLKVDIKFYECW  185



>ref|XP_009334474.1| PREDICTED: disease resistance response protein 206-like [Pyrus 
x bretschneideri]
Length=185

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +++SS  P  + K YKPCK+LVL+FHD+IYNG+NAANATS IV APQ  N TILA  FHF
Sbjct  16   LAISSAFPKHKDK-YKPCKHLVLFFHDIIYNGKNAANATSAIVAAPQGSNLTILAPNFHF  74

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNN HS PVGRAQGMYMYDTKNT+TAWLGFSF LN+TD QG+INFIGA
Sbjct  75   GNIAVFDDPITLDNNLHSKPVGRAQGMYMYDTKNTFTAWLGFSFYLNSTDYQGTINFIGA  134

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K RDISVVGGTGDFFMHRGVAT+ TD+FEGEVYFRL+VDIKFYECW
Sbjct  135  DPILIKYRDISVVGGTGDFFMHRGVATIHTDSFEGEVYFRLKVDIKFYECW  185



>gb|AFZ84548.1| plant disease resistance response protein, partial [Populus tremula]
Length=179

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK LVLYFHD++YNGQNAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAYP-GKKKQYKPCKELVLYFHDILYNGQNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQG+Y+YDTKNT+T+WL F+F LN+T+ QG+++FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGLYIYDTKNTFTSWLSFTFALNSTEHQGTVSFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+MTD+FEG+VYFRLRVD+KFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIMTDSFEGDVYFRLRVDVKFYECW  179



>gb|AFZ84547.1| plant disease resistance response protein, partial [Populus alba]
Length=179

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK LVLYFHD++YNGQNAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAYP-GKKKQYKPCKELVLYFHDILYNGQNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQG+Y+YD KNT+T+WL F+F LN+T+ QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGLYIYDNKNTFTSWLSFTFALNSTEHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+MTD+FEG+VYFRLRVD+KFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIMTDSFEGDVYFRLRVDVKFYECW  179



>gb|ACZ67171.1| plant disease resistance response protein, partial [Populus deltoides]
Length=179

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK  VLYFHD++YNGQNAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAYP-GKKKQYKPCKEFVLYFHDILYNGQNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WLGF+F LN+T+ QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLGFTFALNSTEHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+ TDAFEG+VYFRL VDIKFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIATDAFEGDVYFRLHVDIKFYECW  179



>gb|ACZ67169.1| plant disease resistance response protein, partial [Populus balsamifera]
Length=179

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G++K YKPCK  VLYFHD++YNG+NAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAYP-GKRKQYKPCKEFVLYFHDILYNGKNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WLGF+F LN+T+ QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLGFTFALNSTEHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+ TDAFEG+VYFRLRVDIKFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIXTDAFEGDVYFRLRVDIKFYECW  179



>ref|XP_004503651.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=185

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGN  301
             S+ +P  ++K YKPCKN+VLYFHD+IYNG N ANATS+IV APQ  N T LATQFHFGN
Sbjct  17   CSAINPSKQRKQYKPCKNMVLYFHDIIYNGMNEANATSSIVAAPQGANLTKLATQFHFGN  76

Query  302  VVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADP  481
            + VFDDPITLDNN HS P+GRAQG Y+YDTKNTYT+WLGF+FVLN+T  +G+I F GADP
Sbjct  77   IAVFDDPITLDNNLHSKPIGRAQGFYIYDTKNTYTSWLGFTFVLNSTQYEGTITFAGADP  136

Query  482  LMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ++ KTRDISV GGTGDFFMHRG+AT+MTDAFEGEVYFRLRVDI F+ECW
Sbjct  137  ILKKTRDISVTGGTGDFFMHRGIATIMTDAFEGEVYFRLRVDINFFECW  185



>ref|XP_010106579.1| hypothetical protein L484_003077 [Morus notabilis]
 gb|EXC10833.1| hypothetical protein L484_003077 [Morus notabilis]
Length=189

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = +2

Query  116  ISVSSTHPMGR--KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQF  289
            +S S++ P G+  K+  +PCK +V YFHD+IYNG+NA NATS+IVGAP WGN TILA Q 
Sbjct  17   VSCSNSRPAGKGIKRRIEPCKRMVFYFHDIIYNGKNAKNATSSIVGAPAWGNRTILAGQS  76

Query  290  HFGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFI  469
            HFG+VVVFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAWLGFSFV N+T+  GSINF+
Sbjct  77   HFGDVVVFDDPITLDNNLHSTPVGRAQGFYIYDKKDIFTAWLGFSFVFNSTEHNGSINFV  136

Query  470  GADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GADPLMNKTRDISV+GGTGDFFM RG+AT+MTDAFEGEVYFRLRVDIK YECW
Sbjct  137  GADPLMNKTRDISVIGGTGDFFMARGIATLMTDAFEGEVYFRLRVDIKLYECW  189



>ref|XP_008388884.1| PREDICTED: disease resistance response protein 206-like [Malus 
domestica]
Length=185

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +++SS  P  + K YKPCK+LVL+FHD+IYNG+NAANATS IV APQ  N TILA  FHF
Sbjct  16   LAISSAFPKHKDK-YKPCKHLVLFFHDIIYNGKNAANATSAIVAAPQGSNLTILAPNFHF  74

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNN HS PVGRAQGMYMYDTKNT+TAWLGFSF LN+TD QG+INFIGA
Sbjct  75   GNIAVFDDPITLDNNLHSKPVGRAQGMYMYDTKNTFTAWLGFSFYLNSTDYQGTINFIGA  134

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K R+ISVVGGTGDFFMHRGVAT+ TD++EGEVYFRL+VDIKFYECW
Sbjct  135  DPILIKYREISVVGGTGDFFMHRGVATIDTDSYEGEVYFRLKVDIKFYECW  185



>ref|XP_004146540.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
sativus]
 gb|KGN53369.1| hypothetical protein Csa_4G050240 [Cucumis sativus]
 gb|KGN53370.1| hypothetical protein Csa_4G050250 [Cucumis sativus]
Length=191

 Score =   282 bits (721),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  137  PMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFD  316
            PM +K+ +KPCK LVLYFHDV+YNG+NA NATS IV AP+  N TILA QF FGN+VVFD
Sbjct  28   PMVKKQKHKPCKQLVLYFHDVLYNGKNAKNATSAIVAAPEGANLTILAPQFRFGNIVVFD  87

Query  317  DPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKT  496
            DPITLDNN HS PVGRAQGMY+YDTKNT+T WL FSF LN T  +G+INF+GADP++ KT
Sbjct  88   DPITLDNNLHSNPVGRAQGMYIYDTKNTFTVWLAFSFSLNYTAYKGTINFVGADPILVKT  147

Query  497  RDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RDISVVGGTGDFFMHRGVAT+MTDAFEGEVYFRLRVDIKFYECW
Sbjct  148  RDISVVGGTGDFFMHRGVATIMTDAFEGEVYFRLRVDIKFYECW  191



>ref|XP_003532426.1| PREDICTED: disease resistance response protein 206-like [Glycine 
max]
Length=281

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            SS  P  RK+ + PCK+LVL+FHD+IYNG NAANATS IVGAP+  N TILA QFHFGN+
Sbjct  114  SSAVPGKRKQYHTPCKHLVLFFHDIIYNGNNAANATSAIVGAPEGANLTILANQFHFGNI  173

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            VVFDDPITLDNN HS PVGRAQG Y+Y+TKNTYT+WLGF+FVLN TD  G+I F GADP+
Sbjct  174  VVFDDPITLDNNLHSKPVGRAQGFYIYNTKNTYTSWLGFTFVLNNTDHDGTITFAGADPI  233

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            M KTRDISV GGTGDFFMHRG+AT+MTDAFEGEVYFRLRVDIKFYECW
Sbjct  234  MQKTRDISVTGGTGDFFMHRGIATIMTDAFEGEVYFRLRVDIKFYECW  281



>gb|AFK48955.1| unknown [Medicago truncatula]
 gb|KEH21170.1| disease resistance response protein [Medicago truncatula]
Length=185

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            ++SS  P  ++K Y PCKN+VLYFHD+IYNG NAANATS+IV APQ  N TILA QFHFG
Sbjct  17   ALSSAIP-SKRKSYTPCKNMVLYFHDIIYNGMNAANATSSIVAAPQGANLTILAPQFHFG  75

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            N+ VFDDPITLDNN HS P+GRAQG Y+YDTKNTYT+WLGF+FVLN+T  +G+I F GAD
Sbjct  76   NIAVFDDPITLDNNLHSKPIGRAQGFYVYDTKNTYTSWLGFTFVLNSTYHEGTITFAGAD  135

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            P+M K+RDISV GGTGDFFMHRG+AT+MTDAFEGEVYFRLRV+IKF+ECW
Sbjct  136  PIMQKSRDISVTGGTGDFFMHRGIATIMTDAFEGEVYFRLRVEIKFFECW  185



>gb|ACZ67170.1| plant disease resistance response protein, partial [Populus nigra]
Length=179

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +  G+KK YKPCK  VLYFHD++YNGQNAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAY-RGKKKQYKPCKEFVLYFHDILYNGQNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WLGF+F LN+T+ QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLGFTFALNSTEHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+M K+RDISVVGGTGDFFMHRG+AT+ TD+FEG+VYFRL VDIKFYECW
Sbjct  129  DPIMVKSRDISVVGGTGDFFMHRGIATIATDSFEGDVYFRLHVDIKFYECW  179



>gb|AFK40037.1| unknown [Lotus japonicus]
Length=181

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            +KPY PCKNLVLYFHDVIYNG+NAANATS IV APQ  N T LA QFHFGN+ VFDDPIT
Sbjct  22   RKPYAPCKNLVLYFHDVIYNGENAANATSAIVAAPQGANLTKLAPQFHFGNIAVFDDPIT  81

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LDNNFHS PVGRAQG Y+YDTKNT+T+W GF+FVLN+T+ QG+I F G DP++ K+RD+S
Sbjct  82   LDNNFHSKPVGRAQGFYIYDTKNTFTSWFGFTFVLNSTEHQGTITFAGTDPILQKSRDVS  141

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            V GGTGDFFMHRG+AT+MTDAFE EVYFRLRVDIKFYECW
Sbjct  142  VTGGTGDFFMHRGIATLMTDAFESEVYFRLRVDIKFYECW  181



>gb|AEX34707.2| plant disease resistance response protein, partial [Populus laurifolia]
Length=179

 Score =   279 bits (714),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK  VLYFHD++YNG+NAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAYP-GKKKQYKPCKEFVLYFHDILYNGKNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WL F+F LN+T  QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLSFTFALNSTQHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+ TDAFEG+VYFRL VDIKFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIATDAFEGDVYFRLHVDIKFYECW  179



>ref|XP_007160128.1| hypothetical protein PHAVU_002G294900g, partial [Phaseolus vulgaris]
 gb|ESW32122.1| hypothetical protein PHAVU_002G294900g, partial [Phaseolus vulgaris]
Length=176

 Score =   279 bits (713),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            ++K + PCKNLVL+FHD+IYNG NA NATS IVGAP+ GN T LA+ FHFGN+VVFDDPI
Sbjct  16   KRKQFAPCKNLVLFFHDIIYNGNNAGNATSAIVGAPEGGNLTKLASMFHFGNIVVFDDPI  75

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS  VGRAQG Y+YDTKNTYT+WLGF+FVLN+T+ QG+I F GADP+M KTRDI
Sbjct  76   TLDNNLHSKAVGRAQGFYIYDTKNTYTSWLGFTFVLNSTEHQGTITFAGADPIMQKTRDI  135

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV GGTGDFFMHRG+AT+MTDAFEGEVYFRL VDIKFYECW
Sbjct  136  SVTGGTGDFFMHRGIATIMTDAFEGEVYFRLHVDIKFYECW  176



>gb|AFZ84545.1| plant disease resistance response protein, partial [Populus trichocarpa]
Length=179

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK  VLYFHD++YNG+NAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAYP-GKKKQYKPCKEFVLYFHDILYNGKNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WL F+F LN+T  QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLXFTFALNSTQHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+ TDAFEG+VYFRL VDIKFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIXTDAFEGDVYFRLHVDIKFYECW  179



>ref|XP_010251577.1| PREDICTED: disease resistance response protein 206-like [Nelumbo 
nucifera]
Length=188

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            +S  P  R +  +PCK LVLYFHD+IYNG+NA NATS IVGAP WGN TILA Q HFG++
Sbjct  21   TSAAPGRRMRGRQPCKQLVLYFHDIIYNGKNAKNATSAIVGAPAWGNKTILAGQNHFGDL  80

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            V+FDDPITLDNN HS PVGRAQG Y+YD K  +TAWL FSFVLNTTD +G++NF GADPL
Sbjct  81   VIFDDPITLDNNLHSQPVGRAQGFYLYDKKEIFTAWLAFSFVLNTTDYKGTLNFAGADPL  140

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            MNKTRDISV+GGTGDFFM RG+ATVMTDAFEGEVYFRLRVD+K YECW
Sbjct  141  MNKTRDISVIGGTGDFFMARGIATVMTDAFEGEVYFRLRVDVKLYECW  188



>ref|XP_002509892.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF51279.1| Disease resistance response protein, putative [Ricinus communis]
Length=190

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS HP  + K YKPCK LVLYFHD+IYNG+NAANATS IV AP   N TILA QFHF
Sbjct  19   LAVSSAHPSKKMKQYKPCKELVLYFHDIIYNGKNAANATSAIVAAPHGANLTILAGQFHF  78

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+VVFDDPITLDNN HS  VGRAQG+Y+YDTKNT+TAWL F+FVLN+T +QG+INF+GA
Sbjct  79   GNIVVFDDPITLDNNLHSPAVGRAQGIYIYDTKNTFTAWLAFTFVLNSTHNQGTINFVGA  138

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVD  607
            DP++ KTRDISV GGTGDFFMHRG+AT++TDAFEGEVYFRLRVD
Sbjct  139  DPILMKTRDISVAGGTGDFFMHRGIATILTDAFEGEVYFRLRVD  182



>ref|XP_002297997.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE82802.1| pathogenesis-related family protein [Populus trichocarpa]
Length=186

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            S SS  P  + + +KPCK LV YFHD+IYNG+N+ NAT+ IVGAP WGN TILA Q HFG
Sbjct  17   SKSSAFPSRKSRVHKPCKRLVFYFHDIIYNGKNSKNATAAIVGAPAWGNKTILANQNHFG  76

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            ++VVFDDPITLDNN HS PVGRAQG+Y+YD K  +TAWLGFSFV N+T+ +GSINF GAD
Sbjct  77   DLVVFDDPITLDNNLHSAPVGRAQGIYVYDKKEIFTAWLGFSFVFNSTEHKGSINFAGAD  136

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRD+SV+GGTGDF M RG+AT+MTDAFEGEVYFRLRVDI+ YECW
Sbjct  137  PLMNKTRDVSVIGGTGDFIMARGIATLMTDAFEGEVYFRLRVDIQLYECW  186



>gb|AFZ84546.1| plant disease resistance response protein, partial [Populus maximowiczii]
Length=179

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +  G+KK YKPCK  VLYFHD++YNG NAANATS IV AP+  N TILA Q HF
Sbjct  10   LAVSSAY-XGKKKQYKPCKEFVLYFHDILYNGXNAANATSAIVAAPEGANLTILAGQNHF  68

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WL F+F LN+T  QG+I+FIGA
Sbjct  69   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLXFTFALNSTQHQGTISFIGA  128

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K+RDISVVGGTGDFFMHRG+AT+ TDAFEG+VYFRL VDIKFYECW
Sbjct  129  DPILVKSRDISVVGGTGDFFMHRGIATIATDAFEGDVYFRLHVDIKFYECW  179



>ref|XP_010106578.1| hypothetical protein L484_003076 [Morus notabilis]
 gb|EXC10832.1| hypothetical protein L484_003076 [Morus notabilis]
Length=191

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            IS S+  P  + K YKPCK LV YFHD++Y+G+NA NAT+ IVGAP+W N T +A   HF
Sbjct  21   ISSSAPTPAKKIKSYKPCKRLVFYFHDIVYDGENANNATAAIVGAPRWANTTKMAGLNHF  80

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G+VVVFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAWLGFSFV N+T+ +GS+NF GA
Sbjct  81   GDVVVFDDPITLDNNLHSTPVGRAQGFYLYDKKDIFTAWLGFSFVFNSTEHKGSLNFAGA  140

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLMNKTRDISV+GGTGDFFM RG+AT+MTDAFEGEVYFRLRVDIK YECW
Sbjct  141  DPLMNKTRDISVIGGTGDFFMARGIATLMTDAFEGEVYFRLRVDIKLYECW  191



>ref|XP_011022577.1| PREDICTED: disease resistance response protein 206-like [Populus 
euphratica]
Length=198

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 165/201 (82%), Gaps = 7/201 (3%)
 Frame = +2

Query  29   FIPF-LFSAKKMTTSRNPNIftlfclffflISVSSTHPMGRKKPYKPCKNLVLYFHDVIY  205
            F P  + S KKM TS    IF L       +SVSS +P G KK Y PCK LVLYFHD+IY
Sbjct  4    FFPLEIISRKKMRTSGFVAIFFLIF-----LSVSSAYP-GWKKQYNPCKQLVLYFHDIIY  57

Query  206  NGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVGRAQGMYMY  385
            NGQNAANAT+ IV AP+  N TILA QFHFGN+ VFDDPITLDNN HS PVGRAQGMY+Y
Sbjct  58   NGQNAANATAAIVAAPEGANLTILAGQFHFGNIAVFDDPITLDNNLHSPPVGRAQGMYIY  117

Query  386  DTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMT  565
            DTKNT+TAWLGF+FVLN+T  QG+INFIGADP+M K+RDISVVGGTGDFFMHRG+ATVMT
Sbjct  118  DTKNTFTAWLGFTFVLNSTKHQGTINFIGADPIMVKSRDISVVGGTGDFFMHRGIATVMT  177

Query  566  DAFEGEVYFRLRVDIKFYECW  628
            D+FEG+VYFRLRVD+KFYECW
Sbjct  178  DSFEGDVYFRLRVDVKFYECW  198



>ref|XP_002304536.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE79515.2| pathogenesis-related family protein [Populus trichocarpa]
Length=198

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 165/201 (82%), Gaps = 7/201 (3%)
 Frame = +2

Query  29   FIPF-LFSAKKMTTSRNPNIftlfclffflISVSSTHPMGRKKPYKPCKNLVLYFHDVIY  205
            F P  + S KKM TS    IF +       +SVSS +P G KK YKPCK LVLYFHD+IY
Sbjct  4    FFPLEIISRKKMRTSGFVAIFFMIF-----LSVSSAYP-GWKKQYKPCKQLVLYFHDIIY  57

Query  206  NGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVGRAQGMYMY  385
            NGQNAANAT+ IV AP+  N TILA QFHFGN+ VFDDPITLDNN  S PVGRAQGMY+Y
Sbjct  58   NGQNAANATAAIVAAPEGANLTILAGQFHFGNIAVFDDPITLDNNLQSPPVGRAQGMYIY  117

Query  386  DTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMT  565
            DTKNT+TAWLGF+FVLN+T  QG+INFIGADP+M K+RDISVVGGTGDFFMHRG+AT+MT
Sbjct  118  DTKNTFTAWLGFTFVLNSTKHQGTINFIGADPIMVKSRDISVVGGTGDFFMHRGIATIMT  177

Query  566  DAFEGEVYFRLRVDIKFYECW  628
            D+FEG+VYFRLRVD+KFYECW
Sbjct  178  DSFEGDVYFRLRVDVKFYECW  198



>ref|XP_006439432.1| hypothetical protein CICLE_v10022439mg [Citrus clementina]
 ref|XP_006476463.1| PREDICTED: disease resistance response protein 206-like [Citrus 
sinensis]
 gb|ESR52672.1| hypothetical protein CICLE_v10022439mg [Citrus clementina]
 gb|KDO76392.1| hypothetical protein CISIN_1g038627mg [Citrus sinensis]
Length=186

 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            IS SS     + +  KPCK+LV YFHDVIYNG+N+ NATS IVG+P WGN T LA Q HF
Sbjct  16   ISASSDAHTQKIRARKPCKHLVFYFHDVIYNGKNSRNATSAIVGSPVWGNKTTLAGQSHF  75

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G++VVFDDPITLDNN HSTPVGRAQG Y+YD K  +TAWLGFSFV N+T+ +GSINF GA
Sbjct  76   GDLVVFDDPITLDNNLHSTPVGRAQGFYIYDKKEIFTAWLGFSFVFNSTEHKGSINFAGA  135

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLMNKTRD+SV+GGTGDF M RG+AT+MTDAFEGEVYFRLR DIK YECW
Sbjct  136  DPLMNKTRDVSVIGGTGDFLMARGIATLMTDAFEGEVYFRLRTDIKLYECW  186



>ref|XP_011026953.1| PREDICTED: disease resistance response protein 206-like [Populus 
euphratica]
Length=186

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + + +KPCK LV YFHD+IYNG+N+ NAT+ IVGAP WGN TILA Q HFG++VVFDDPI
Sbjct  26   KSRVHKPCKRLVFYFHDIIYNGKNSKNATAAIVGAPAWGNKTILANQNHFGDLVVFDDPI  85

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDN+ HS P+GRAQG+Y+YD K  +TAWLGFSFV N+T+ +GSINF GADPLMNKTRD+
Sbjct  86   TLDNDLHSAPIGRAQGIYVYDKKEIFTAWLGFSFVFNSTEHKGSINFAGADPLMNKTRDV  145

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV+GGTGDFFM RG+AT+MTDAFEGEVYFRLRVDI+ YECW
Sbjct  146  SVIGGTGDFFMARGIATLMTDAFEGEVYFRLRVDIQLYECW  186



>ref|XP_002272144.1| PREDICTED: disease resistance response protein 206-like [Vitis 
vinifera]
Length=192

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            IS S+  P    K  +PCK LV YFHD+IYNGQN+ NAT+ IVGAP W N TILA + HF
Sbjct  22   ISTSTATPSLGIKHRRPCKRLVFYFHDIIYNGQNSHNATAAIVGAPAWANTTILAGKNHF  81

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G++VVFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAW+GFSFV N+T  +GSINF GA
Sbjct  82   GDLVVFDDPITLDNNLHSTPVGRAQGFYIYDKKDIFTAWIGFSFVFNSTYHKGSINFAGA  141

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLMNKTRDISV+GGTGDFFM RG+AT+MTDAFEGEVYFRLRVD+K YECW
Sbjct  142  DPLMNKTRDISVIGGTGDFFMARGIATLMTDAFEGEVYFRLRVDVKLYECW  192



>dbj|BAP91518.1| dirigent-like protein [Glycine max]
 dbj|BAP91519.1| dirigent-like protein [Glycine max]
 dbj|BAP91522.1| dirigent-like protein [Glycine max]
Length=183

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  137  PMGRKKP-YKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVF  313
            P   K+P + PCK+LVL+FHD+IYNG NAANATS IV AP+  N T LA+QFHFGN+VVF
Sbjct  19   PFPVKRPQHAPCKHLVLFFHDIIYNGSNAANATSAIVAAPEGANLTKLASQFHFGNIVVF  78

Query  314  DDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNK  493
            DDP+TLDNN HS  VGRAQG Y+YDTKNT+TAWLGF+FVLN+TD +G+I   GADP + K
Sbjct  79   DDPVTLDNNLHSNQVGRAQGSYIYDTKNTFTAWLGFTFVLNSTDHRGTITLAGADPTLKK  138

Query  494  TRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TRD+SV+GGTGDFFMHRG+AT+MTDAFEG+VYFRLRVD+KFYECW
Sbjct  139  TRDVSVIGGTGDFFMHRGIATIMTDAFEGQVYFRLRVDVKFYECW  183



>ref|XP_002509891.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF51278.1| Disease resistance response protein, putative [Ricinus communis]
Length=186

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  RKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDP  322
            RK P  KPCK L+ YFHD+IYNG+N+ NATS I GAP W N TILA Q HFG++VVFDDP
Sbjct  25   RKIPSPKPCKRLIFYFHDIIYNGKNSKNATSAIAGAPAWANKTILAKQDHFGDIVVFDDP  84

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            ITLDNN HSTPVGRAQG+Y+YD K  +TAW+GFSFV N+T  +GSI F GADPLMNKTRD
Sbjct  85   ITLDNNLHSTPVGRAQGIYIYDKKEIFTAWMGFSFVFNSTQHKGSITFAGADPLMNKTRD  144

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +SV+GGTGDFFM RG+AT+MTDAFEGEVYFRLRVDIK YECW
Sbjct  145  VSVIGGTGDFFMARGIATLMTDAFEGEVYFRLRVDIKLYECW  186



>ref|XP_004298853.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=191

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            S  HP   ++P  PCK LV YFHD+IYNG+N+ NAT+ IVGAP WGN TIL  + HFGN+
Sbjct  28   SRPHP---RRPL-PCKRLVFYFHDIIYNGRNSKNATAAIVGAPAWGNKTILTGKNHFGNM  83

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            VVFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAWLGFSFV N+T  +GSINF GADPL
Sbjct  84   VVFDDPITLDNNLHSTPVGRAQGFYLYDKKDIFTAWLGFSFVFNSTQHRGSINFAGADPL  143

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            MNKTRDISV+GGTGDFFM RG+AT+MTDAFEGEVYFRL+VDIK YECW
Sbjct  144  MNKTRDISVIGGTGDFFMTRGIATLMTDAFEGEVYFRLKVDIKLYECW  191



>ref|XP_010055805.1| PREDICTED: disease resistance response protein 206-like [Eucalyptus 
grandis]
Length=185

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + K +KPCK LVLYFHD+IYNG+N ANATS IV AP   N TILA  FH GN+ V DDPI
Sbjct  25   KTKHHKPCKTLVLYFHDIIYNGKNTANATSAIVTAPPGYNLTILAGNFHLGNIAVLDDPI  84

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVG+AQG++MYDTKNT+TAWLGFSFVLNTT+ +GSINFIGADP + + RDI
Sbjct  85   TLDNNLHSKPVGQAQGLHMYDTKNTFTAWLGFSFVLNTTEYKGSINFIGADPTLVEERDI  144

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTG+FFMHRG+AT+MTD FEGEVYFRLRVDIKFYECW
Sbjct  145  SVVGGTGEFFMHRGIATIMTDTFEGEVYFRLRVDIKFYECW  185



>gb|KCW72356.1| hypothetical protein EUGRSUZ_E00810, partial [Eucalyptus grandis]
Length=165

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + K +KPCK LVLYFHD+IYNG+N ANATS IV AP   N TILA  FH GN+ V DDPI
Sbjct  5    KTKHHKPCKTLVLYFHDIIYNGKNTANATSAIVTAPPGYNLTILAGNFHLGNIAVLDDPI  64

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVG+AQG++MYDTKNT+TAWLGFSFVLNTT+ +GSINFIGADP + + RDI
Sbjct  65   TLDNNLHSKPVGQAQGLHMYDTKNTFTAWLGFSFVLNTTEYKGSINFIGADPTLVEERDI  124

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTG+FFMHRG+AT+MTD FEGEVYFRLRVDIKFYECW
Sbjct  125  SVVGGTGEFFMHRGIATIMTDTFEGEVYFRLRVDIKFYECW  165



>ref|XP_008239000.1| PREDICTED: disease resistance response protein 206-like [Prunus 
mume]
Length=193

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  134  HPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVF  313
            H   R  P+ PC++L  YFHD+I+NG+N+ NAT+ IVG+P WGN TILA Q HFGN+VVF
Sbjct  29   HIKPRSPPHHPCRHLTFYFHDIIFNGKNSKNATAAIVGSPPWGNRTILAGQSHFGNLVVF  88

Query  314  DDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNK  493
            DDPITLDNN HS PVGRAQG Y+YD K+ +TAWLGFSFV N+T  +GSINF GADPLMNK
Sbjct  89   DDPITLDNNLHSAPVGRAQGFYIYDRKDIFTAWLGFSFVFNSTQHRGSINFAGADPLMNK  148

Query  494  TRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TRDISV+GGTGDFFM RGVAT+ TDAFEGEVYFRLRVDIK YECW
Sbjct  149  TRDISVIGGTGDFFMTRGVATLETDAFEGEVYFRLRVDIKLYECW  193



>gb|KDP25355.1| hypothetical protein JCGZ_20511 [Jatropha curcas]
Length=194

 Score =   267 bits (682),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQF-HFGNVVVFDDP  322
            +KK YKPCK LVLYFHD++YNG+NAANATS IV AP+  N TILA    HFGN++VFDDP
Sbjct  33   KKKQYKPCKELVLYFHDILYNGKNAANATSAIVAAPEGANLTILAPHNNHFGNIIVFDDP  92

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            +TLDNN HS+P+GRAQG+Y+YDTKNT+TAWLGF+F LN+T  +G+INF+GADP++  TRD
Sbjct  93   VTLDNNLHSSPIGRAQGLYIYDTKNTFTAWLGFTFSLNSTQHRGTINFMGADPILINTRD  152

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            I +VGGTGDFFMHRG+AT+MTDAFEG VYFRLRVDIKFYECW
Sbjct  153  IPIVGGTGDFFMHRGIATIMTDAFEGLVYFRLRVDIKFYECW  194



>ref|XP_009780976.1| PREDICTED: disease resistance response protein 206-like [Nicotiana 
sylvestris]
Length=191

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            I+ S      + +   PCK L+ YFHD+IYNG+NA NATS IVGAP WGN+T L  Q HF
Sbjct  21   INFSIVESANKIRARHPCKTLMFYFHDIIYNGENAKNATSAIVGAPAWGNFTKLGGQNHF  80

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G++V+FDDPITLDNN HSTPVGRAQG Y YD K  +T+WLGFSFV N+T+ +GSINF GA
Sbjct  81   GDLVIFDDPITLDNNLHSTPVGRAQGFYFYDKKEIFTSWLGFSFVFNSTEHKGSINFAGA  140

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLMNKTRDISV+GGTGDFFM RG+AT+ TDAFEGEVYFRLRVDIK YECW
Sbjct  141  DPLMNKTRDISVIGGTGDFFMTRGIATLRTDAFEGEVYFRLRVDIKLYECW  191



>emb|CDP12104.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  122  VSSTHPMGRKKPYK-PCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
             ++  P G++   + PCK LV YFHD+IYNG N+ NAT+ I+GAP WGN TIL  Q HFG
Sbjct  22   ATAATPSGKRILGRTPCKRLVFYFHDIIYNGHNSRNATAAIIGAPAWGNRTILGGQNHFG  81

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            ++VVFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAWLGFSFVLN+T+ +GSINF GAD
Sbjct  82   DLVVFDDPITLDNNLHSTPVGRAQGFYIYDKKDIFTAWLGFSFVLNSTEHKGSINFAGAD  141

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRDISV+GGTGDFFM RGVAT+ TD+FEGEVYFRLRVDIK YECW
Sbjct  142  PLMNKTRDISVIGGTGDFFMTRGVATLETDSFEGEVYFRLRVDIKLYECW  191



>ref|XP_007156024.1| hypothetical protein PHAVU_003G252100g [Phaseolus vulgaris]
 gb|ESW28018.1| hypothetical protein PHAVU_003G252100g [Phaseolus vulgaris]
Length=183

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            ++ ST P+ RK+ Y PCK+LVL+FHD+IYNG+NA NATS I+ APQ  N T L   FHFG
Sbjct  15   ALCSTFPLQRKQ-YAPCKHLVLFFHDIIYNGRNALNATSAIIAAPQGANLTKLTNNFHFG  73

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            N+VVFDDP+TLDNN HS PVGRAQG Y+YDTKNTYTA+LGF+F LN+ + QG+I   GAD
Sbjct  74   NLVVFDDPVTLDNNLHSEPVGRAQGFYIYDTKNTYTAYLGFNFALNSANHQGTITVAGAD  133

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            P + KTRDISV GGTGDFFMHRG+AT+MTDAFEG+VYFRLRV+IKFYECW
Sbjct  134  PTLKKTRDISVTGGTGDFFMHRGIATIMTDAFEGDVYFRLRVEIKFYECW  183



>ref|XP_004146539.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
sativus]
 ref|XP_004172508.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
sativus]
 gb|KGN53367.1| hypothetical protein Csa_4G050220 [Cucumis sativus]
Length=186

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 5/170 (3%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            SV+S H   R     PC++LV YFHD+I+NG NA NATS IVGAP WGN T+LA Q HFG
Sbjct  22   SVASKHRFRR-----PCRHLVFYFHDIIFNGHNAKNATSAIVGAPAWGNLTVLAAQNHFG  76

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            NVVVFDDPITLDNN HS PVGRAQG Y+YD K+ +TAWLGFSFV N+T+ +GS+NF GAD
Sbjct  77   NVVVFDDPITLDNNLHSPPVGRAQGFYIYDKKDIFTAWLGFSFVFNSTEHRGSLNFAGAD  136

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRDISV+GGTGDFFM RG+AT+ TD+ EGEVYFRLR DIK YECW
Sbjct  137  PLMNKTRDISVIGGTGDFFMARGIATLSTDSLEGEVYFRLRTDIKLYECW  186



>ref|XP_004503652.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=220

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKK--PYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQF  289
            I  S+T    RKK   ++PCK LV YFHD+IYNGQN+ NATS IVG P WGN TILA   
Sbjct  48   IGTSATPTRWRKKTRSHEPCKTLVFYFHDIIYNGQNSKNATSAIVGTPAWGNRTILAGHN  107

Query  290  HFGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFI  469
            HFG++VVFDDPITLDNN HS P+GRAQG Y+YD KN +T+WLGFSFV N+T+ +GSINF 
Sbjct  108  HFGDLVVFDDPITLDNNLHSHPIGRAQGFYIYDNKNIFTSWLGFSFVFNSTNHKGSINFA  167

Query  470  GADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GADPLMNKTRDISV+GGTGDFFM RGVAT+ TDAFEGEVYFRLRVDI  YECW
Sbjct  168  GADPLMNKTRDISVIGGTGDFFMTRGVATLSTDAFEGEVYFRLRVDINLYECW  220



>ref|XP_010055804.1| PREDICTED: disease resistance response protein 206-like [Eucalyptus 
grandis]
 gb|KCW72355.1| hypothetical protein EUGRSUZ_E00809 [Eucalyptus grandis]
Length=186

 Score =   265 bits (676),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            R +  +PCK LV +FHDV+YNG NA NATS I+GAP W N TILA Q HFG++VVFDDPI
Sbjct  26   RIRNRRPCKRLVFFFHDVLYNGNNAKNATSAIIGAPAWANQTILAGQSHFGDLVVFDDPI  85

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG Y+YD K+ +TAWLGFSFV N+T   GS+NF GADPLMNKTRDI
Sbjct  86   TLDNNLHSKPVGRAQGFYIYDKKDIFTAWLGFSFVFNSTQHTGSLNFAGADPLMNKTRDI  145

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV+GGTGDFFM RGVAT+MTD+FEGEVYFRLR DIK YECW
Sbjct  146  SVIGGTGDFFMARGVATLMTDSFEGEVYFRLRTDIKLYECW  186



>ref|XP_002276477.1| PREDICTED: disease resistance response protein 206 [Vitis vinifera]
Length=186

 Score =   265 bits (676),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            SS    G  +  +PC++LV YFHD+IYNG+N+ NAT+ IVGAP WGN TIL  + HFG++
Sbjct  19   SSAMGKGPVRGRRPCRSLVFYFHDIIYNGKNSKNATAAIVGAPAWGNKTILGGKNHFGDL  78

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            VVFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAWLGFSFV N+T+ +GSINF GADPL
Sbjct  79   VVFDDPITLDNNLHSTPVGRAQGFYIYDKKDVFTAWLGFSFVFNSTEHKGSINFAGADPL  138

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            MNKTRDISVVGGTGDFFM RG+AT+ TDAFEGEVYFRL VDIK YECW
Sbjct  139  MNKTRDISVVGGTGDFFMARGIATLTTDAFEGEVYFRLCVDIKLYECW  186



>emb|CBI34419.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            R    +PCK LV YFHD+IYNGQN+ NAT+ IVGAP W N TILA + HFG++VVFDDPI
Sbjct  79   RSLHRRPCKRLVFYFHDIIYNGQNSHNATAAIVGAPAWANTTILAGKNHFGDLVVFDDPI  138

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HSTPVGRAQG Y+YD K+ +TAW+GFSFV N+T  +GSINF GADPLMNKTRDI
Sbjct  139  TLDNNLHSTPVGRAQGFYIYDKKDIFTAWIGFSFVFNSTYHKGSINFAGADPLMNKTRDI  198

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV+GGTGDFFM RG+AT+MTDAFEGEVYFRLRVD+K YECW
Sbjct  199  SVIGGTGDFFMARGIATLMTDAFEGEVYFRLRVDVKLYECW  239



>gb|KEH21169.1| disease resistance response protein [Medicago truncatula]
Length=189

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            S + T    R + ++PCK LV YFHD+IYNG N+ NATS IVG P WGN TILA Q HFG
Sbjct  20   SATPTRSRKRDRVHEPCKRLVFYFHDIIYNGHNSKNATSAIVGTPAWGNRTILANQNHFG  79

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            ++VVFDDPITLDNN HS P+GRAQG Y+YD K  +TAWLGFSFV N+T  +GSINF GAD
Sbjct  80   DLVVFDDPITLDNNLHSRPIGRAQGFYIYDKKEIFTAWLGFSFVFNSTQHKGSINFAGAD  139

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRDISV+GGTGDFFM RGVAT+ TD+FEGEVYFRLR +I  YECW
Sbjct  140  PLMNKTRDISVIGGTGDFFMTRGVATLSTDSFEGEVYFRLRAEINLYECW  189



>ref|XP_006343908.1| PREDICTED: disease resistance response protein 206-like [Solanum 
tuberosum]
Length=189

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            I+ S      + + ++PCK L+ YFHD++YNG+NA NATS IVGAP WGN T LA Q +F
Sbjct  19   INFSIVESSNKIRAHRPCKTLIFYFHDILYNGENAKNATSAIVGAPAWGNLTKLAGQNNF  78

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G+++VFDDPITLDNN HS P+GRAQG Y+YD K  +T+WLGFSFV N+T  +GSINF GA
Sbjct  79   GDLIVFDDPITLDNNIHSNPIGRAQGFYVYDKKEIFTSWLGFSFVFNSTQHKGSINFAGA  138

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+MNKTRDISV+GGTGDFFM RG+AT+MTD+FEG+VYFRLRVDIK YECW
Sbjct  139  DPIMNKTRDISVIGGTGDFFMARGIATIMTDSFEGDVYFRLRVDIKLYECW  189



>ref|XP_009586865.1| PREDICTED: disease resistance response protein 206-like [Nicotiana 
tomentosiformis]
Length=191

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +2

Query  167  CKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFH  346
            CK L+ YFHD+IYNG+NA NATS IVGAP WGN+T L  + HFG++V+FDDPITLDNN H
Sbjct  38   CKTLMFYFHDIIYNGENAKNATSAIVGAPAWGNFTKLGGKNHFGDLVIFDDPITLDNNLH  97

Query  347  STPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTG  526
            STPVGRAQG Y YD K  +T+WLGFSFV N+T+ +GSINF GADPLMNKTRDISV+GGTG
Sbjct  98   STPVGRAQGFYFYDKKEIFTSWLGFSFVFNSTEHKGSINFAGADPLMNKTRDISVIGGTG  157

Query  527  DFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DFFM RG+AT+MTDAFEGEVYFRLRVDIK YECW
Sbjct  158  DFFMTRGIATLMTDAFEGEVYFRLRVDIKLYECW  191



>ref|XP_007209654.1| hypothetical protein PRUPE_ppa012062mg [Prunus persica]
 gb|EMJ10853.1| hypothetical protein PRUPE_ppa012062mg [Prunus persica]
Length=185

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            K  YKPCK+LVL+FHD+IYNG+NAANAT+ IV APQ  N TILA QFHFGN+ VFDDPIT
Sbjct  26   KNKYKPCKHLVLFFHDIIYNGKNAANATAAIVAAPQGANLTILAPQFHFGNIAVFDDPIT  85

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LDNN HS PVGRAQGMY+YDTKNT+T+WLGFSF LN+TD QGSINFIG DP++ KTRDIS
Sbjct  86   LDNNLHSKPVGRAQGMYIYDTKNTFTSWLGFSFALNSTDYQGSINFIGVDPILIKTRDIS  145

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VVGGTGDFFMHRG+AT+ TDA+EGEVYFRL+VDIKFYECW
Sbjct  146  VVGGTGDFFMHRGIATINTDAYEGEVYFRLKVDIKFYECW  185



>ref|XP_011080885.1| PREDICTED: disease resistance response protein 206-like [Sesamum 
indicum]
Length=191

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +2

Query  125  SSTHPMGR-KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGN  301
            S+T  + R +  ++PCK +V YFHD++YN  NA NAT+ IVGAP WGN TILA Q HFGN
Sbjct  23   SATPTVARVRNRHRPCKRMVFYFHDILYNEHNAKNATAAIVGAPAWGNTTILAGQNHFGN  82

Query  302  VVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADP  481
            VVVFDDPITLDNN HS  VGRAQG Y+YD K+ +TAWLGFSFV N+++ +GSINF GADP
Sbjct  83   VVVFDDPITLDNNLHSPAVGRAQGFYLYDKKDVFTAWLGFSFVFNSSEHKGSINFAGADP  142

Query  482  LMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            LMNKTR+ISV+GGTG+FFM RGVAT+MTDAFEGEVYFRLR DI+ YECW
Sbjct  143  LMNKTREISVIGGTGEFFMARGVATLMTDAFEGEVYFRLRADIRLYECW  191



>gb|ACJ84156.1| unknown [Medicago truncatula]
 gb|AFK34256.1| unknown [Medicago truncatula]
Length=189

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            S + T    R + ++PCK LV YFHD+IYNG N+ NATS IVG P WGN TILA Q HFG
Sbjct  20   SATPTRSGKRDRVHEPCKRLVFYFHDIIYNGHNSKNATSAIVGTPAWGNRTILANQNHFG  79

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            ++VVFDDPITLDNN HS P+GRAQG Y+YD K  +TAWLGFSFV N+T  +GSINF GAD
Sbjct  80   DLVVFDDPITLDNNLHSRPIGRAQGFYIYDKKEIFTAWLGFSFVFNSTQHKGSINFAGAD  139

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRDISV+GGTGDFFM RGVAT+ TD+FEGEVYFRLR +I  YECW
Sbjct  140  PLMNKTRDISVIGGTGDFFMTRGVATLSTDSFEGEVYFRLRAEINLYECW  189



>emb|CAN72051.1| hypothetical protein VITISV_013188 [Vitis vinifera]
Length=165

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  143  GRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDP  322
            G  +  +PC++LV YFHD+IYNG+N+ NAT+ IVGAP WGN TIL  + HFG++VVFDDP
Sbjct  4    GPVRGRRPCRSLVFYFHDIIYNGKNSKNATAAIVGAPAWGNKTILGGKNHFGDLVVFDDP  63

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            ITLDNN HSTPVGRAQG Y+YD K+ +TAWLGFSFV N+T+ +GSINF GADPLMNKTRD
Sbjct  64   ITLDNNLHSTPVGRAQGFYIYDKKDVFTAWLGFSFVFNSTEHKGSINFAGADPLMNKTRD  123

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ISVVGGTGDFFM RG+AT+ TDAFEGEVYFRL VDIK YECW
Sbjct  124  ISVVGGTGDFFMARGIATLTTDAFEGEVYFRLCVDIKLYECW  165



>ref|XP_008794746.1| PREDICTED: disease resistance response protein 206 [Phoenix dactylifera]
Length=187

 Score =   262 bits (669),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            S      +    +PCKNL  YFHD++YNGQNAANATS IVGAP W N T  A   HFG+V
Sbjct  20   SVVESQKKLSALQPCKNLAFYFHDILYNGQNAANATSAIVGAPAWANLTTPAAFMHFGDV  79

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            VVFDDPITLDNN HS PVGRAQG Y+YD K  YTAWLGF+FV N+T+ +G+INF+ ADPL
Sbjct  80   VVFDDPITLDNNLHSKPVGRAQGFYLYDKKEVYTAWLGFTFVFNSTEIKGTINFLAADPL  139

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            MNKTRDISVVGGTGDFFM RG+AT+MTDA+EG+VYFRLRVDIK YEC+
Sbjct  140  MNKTRDISVVGGTGDFFMTRGIATLMTDAYEGDVYFRLRVDIKLYECY  187



>ref|XP_004245553.1| PREDICTED: disease resistance response protein 206-like [Solanum 
lycopersicum]
Length=189

 Score =   262 bits (669),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            I++S      + + ++PCK L+ YFHD++YNG+N  NATS IVGAP WGN T LA Q HF
Sbjct  19   INLSIVESSNKIRAHRPCKTLIFYFHDILYNGENGKNATSAIVGAPSWGNLTKLAGQNHF  78

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G+++VFDDPITLDNN HS P+GRAQG Y YD K  +T+WLGFSFV N+T  +GSINF GA
Sbjct  79   GDLIVFDDPITLDNNIHSNPIGRAQGFYFYDKKEIFTSWLGFSFVFNSTQHKGSINFAGA  138

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP+MNKTRDISV+GGTGDFFM RG+AT+MTD+ EGEVYFRL+VDIK YECW
Sbjct  139  DPIMNKTRDISVIGGTGDFFMTRGIATLMTDSVEGEVYFRLQVDIKLYECW  189



>gb|KHN16770.1| Disease resistance response protein 206 [Glycine soja]
Length=189

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            S +S     +K+  +PCK LV YFHD+IYNG N+ NATS IVG P WGN TILA Q HFG
Sbjct  20   SSASPQHWRKKRVREPCKKLVFYFHDIIYNGHNSKNATSAIVGTPAWGNRTILAGQNHFG  79

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            ++VVFDDPITLDNN HS PVGRAQG Y+YD K  +TAWLGFSFV N+T  +GSINF GAD
Sbjct  80   DLVVFDDPITLDNNLHSPPVGRAQGFYVYDKKEIFTAWLGFSFVFNSTHHRGSINFAGAD  139

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRDISV+GGTGDFFM RGVAT+ TDAFEGEVYFRLR DI  +ECW
Sbjct  140  PLMNKTRDISVIGGTGDFFMTRGVATLSTDAFEGEVYFRLRADINLFECW  189



>ref|XP_008451991.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
melo]
Length=187

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  143  GRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDP  322
            G+ +  +PC++LV YFHD+++NG NA NATS IVGAP  GN T LA Q HFGNVVVFDDP
Sbjct  26   GKHRSRRPCRHLVFYFHDILFNGHNAKNATSAIVGAPAGGNLTTLAGQNHFGNVVVFDDP  85

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            ITLDNN HS PVGRAQG Y YD K  +TAWLGFSFV N+T+ +GS+NF GADPLMNKTRD
Sbjct  86   ITLDNNLHSPPVGRAQGFYFYDKKEIFTAWLGFSFVFNSTEHRGSLNFAGADPLMNKTRD  145

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ISVVGGTGDFFM RG+AT+ TD+FEGEVYFRLR DIK YECW
Sbjct  146  ISVVGGTGDFFMARGIATLSTDSFEGEVYFRLRTDIKLYECW  187



>gb|ADR30610.1| (+)-pinoresinol-forming dirigent protein [Schisandra chinensis]
Length=195

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  MGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDD  319
            + RK+  +PC NLV YFHD++YNG+NAANATS IVG+P WGN TILA Q +FG++VVFDD
Sbjct  33   LPRKRMPQPCMNLVFYFHDILYNGKNAANATSAIVGSPAWGNRTILAGQSNFGDMVVFDD  92

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNN HS PVGRAQG Y YD K+ +TAWLGFSFV N +D +GSINF GADPL+ KTR
Sbjct  93   PITLDNNLHSPPVGRAQGFYFYDRKDVFTAWLGFSFVFNNSDYRGSINFAGADPLLIKTR  152

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISV+GGTGDFFM RG+AT+MTDAFEGEVYFRLR DIK YEC+
Sbjct  153  DISVIGGTGDFFMARGIATLMTDAFEGEVYFRLRTDIKLYECY  195



>gb|AAF25357.1|AF210061_1 dirigent protein [Forsythia x intermedia]
Length=186

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRK-KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFH  292
            ++ +S+   GRK +P +PCK LV YFHDV++ G N  NATS IVG+PQWGN T +A  F+
Sbjct  15   LTSTSSATYGRKPRPRRPCKELVFYFHDVLFKGNNYHNATSAIVGSPQWGNKTAMAVPFN  74

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            +G++VVFDDPITLDNN HS PVGRAQGMY YD KNTY AWLGFSF+ N+T   G++NF G
Sbjct  75   YGDLVVFDDPITLDNNLHSPPVGRAQGMYFYDQKNTYNAWLGFSFLFNSTKYVGTLNFAG  134

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ADPL+NKTRDISV+GGTGDFFM RGVAT+MTDAFEG+VYFRLRVDI  YECW
Sbjct  135  ADPLLNKTRDISVIGGTGDFFMARGVATLMTDAFEGDVYFRLRVDINLYECW  186



>ref|XP_007211042.1| hypothetical protein PRUPE_ppa019022mg, partial [Prunus persica]
 gb|EMJ12241.1| hypothetical protein PRUPE_ppa019022mg, partial [Prunus persica]
Length=165

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  137  PMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFD  316
            P  R + +KPCK LV YFHD+IYNG+NA NATS IVGAP WGN TILA + +FGN+VV D
Sbjct  2    PGKRVRAHKPCKKLVFYFHDIIYNGKNAKNATSAIVGAPAWGNRTILAGKSYFGNMVVLD  61

Query  317  DPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKT  496
            DPITLDNN HSTPVG AQG Y+YD K+ +TAWLGFSFV N++  +GSINF GADPLMNKT
Sbjct  62   DPITLDNNLHSTPVGCAQGFYLYDKKDIFTAWLGFSFVFNSSKHKGSINFAGADPLMNKT  121

Query  497  RDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RDISV+G TG+FFM RG+AT+MTDAF+GEVYFRLR +I  YECW
Sbjct  122  RDISVIGSTGNFFMARGIATLMTDAFKGEVYFRLRAEINLYECW  165



>ref|XP_007160127.1| hypothetical protein PHAVU_002G294800g [Phaseolus vulgaris]
 gb|ESW32121.1| hypothetical protein PHAVU_002G294800g [Phaseolus vulgaris]
Length=213

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
             K+  +PCK LV YFHD+IYNG N+ NATS IVG P WGN TILA Q HFG+VVVFDDPI
Sbjct  53   EKRVREPCKKLVFYFHDIIYNGHNSKNATSAIVGTPAWGNRTILAGQNHFGDVVVFDDPI  112

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG Y+YD K  +TAWLGFSFV N+T  +GSINF GADPLMNKTRDI
Sbjct  113  TLDNNLHSPPVGRAQGFYIYDKKEIFTAWLGFSFVFNSTQHKGSINFAGADPLMNKTRDI  172

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV+GGTGDFFM RGVAT+ TDAFEGEVYFRLR DI  +ECW
Sbjct  173  SVIGGTGDFFMTRGVATLSTDAFEGEVYFRLRADINLFECW  213



>gb|KDP25354.1| hypothetical protein JCGZ_20510 [Jatropha curcas]
Length=190

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILA--TQFHFGNVVVFDDP  322
            KK +KPCK LVLYFH ++YNG+NAANATS IV AP+  N TILA     HFGN++VFDDP
Sbjct  29   KKQHKPCKELVLYFHGILYNGKNAANATSGIVAAPEGANLTILAPLKSSHFGNIIVFDDP  88

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            +TLDNN HS+P+GRA G Y+YDTKNT +AWLGF+F LN+T  +G+INFIGADP++  TRD
Sbjct  89   VTLDNNLHSSPIGRAHGSYIYDTKNTLSAWLGFTFSLNSTQLRGTINFIGADPILINTRD  148

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            IS+VGGTGDFFMHRG+AT+MTDAFEG VYFRLRVDIKFYECW
Sbjct  149  ISIVGGTGDFFMHRGIATIMTDAFEGLVYFRLRVDIKFYECW  190



>ref|XP_003525358.1| PREDICTED: disease resistance response protein 206-like [Glycine 
max]
 gb|KHM99931.1| Disease resistance response protein 206 [Glycine soja]
Length=190

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            +S H   +K+  +PCK LV YFHD+IYNG N  NATS IVG P WGN TILA   HFG+V
Sbjct  23   ASPHHWRKKRVGEPCKKLVFYFHDIIYNGHNGKNATSAIVGTPAWGNRTILAGHNHFGDV  82

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            VVFDDPITLDNN HS PVGRAQG Y+YD K+ +TAWLGFSFV N+T  +G+INF GADPL
Sbjct  83   VVFDDPITLDNNLHSPPVGRAQGFYIYDKKDIFTAWLGFSFVFNSTQLRGTINFAGADPL  142

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            MNKTRDISV+GGTGDFFM RGVAT+ TDAFEGEVYFRLR DI  +ECW
Sbjct  143  MNKTRDISVIGGTGDFFMTRGVATLSTDAFEGEVYFRLRADINLFECW  190



>ref|XP_007040397.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY24898.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=334

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  128  STHPMGRK-KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            ST    RK +  KPCK++VLYFHD+IYNG+NA NATS IVGAPQW N T+LA Q HFG++
Sbjct  21   STAATTRKIRARKPCKSMVLYFHDIIYNGKNAKNATSAIVGAPQWANRTLLAGQNHFGDL  80

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
             VFDDPITLDNN HSTPVGRAQG Y YD K  +TAWLGFSFV N+T+ +GSINF GADPL
Sbjct  81   AVFDDPITLDNNLHSTPVGRAQGFYFYDKKEIFTAWLGFSFVFNSTEHKGSINFAGADPL  140

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKF  616
            MNKTRDISV+GGTGDFFM RGVAT+MTDAFEGEVYFRLR DIKF
Sbjct  141  MNKTRDISVIGGTGDFFMARGVATLMTDAFEGEVYFRLRTDIKF  184


 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 2/110 (2%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            +  +PCK +V YFHD++YNG+NA NATS IVGAP WGN TILA Q HFGN+VVFDDPITL
Sbjct  225  RSRRPCKQMVFYFHDILYNGKNAKNATSAIVGAPAWGNRTILAGQNHFGNLVVFDDPITL  284

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDS--QGSINFIGA  475
            DNN HST VGRAQG Y+YD K+ +TAWLGFS V N+T    Q   N  GA
Sbjct  285  DNNPHSTRVGRAQGFYLYDRKDYFTAWLGFSLVFNSTQHRPQRKDNICGA  334



>ref|NP_001238065.1| uncharacterized protein LOC100500692 precursor [Glycine max]
 gb|ACU15842.1| unknown [Glycine max]
Length=189

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            S +S     +K+  +PCK LV YF D+IYNG N+ NATS IVG P WGN TILA Q HFG
Sbjct  20   SSASPQHWRKKRVREPCKKLVFYFRDIIYNGHNSKNATSAIVGTPAWGNRTILAGQNHFG  79

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            ++VVFDDPITLDNN HS PVGRAQG Y+YD K  +TAWLGFSFV N+T  +GSINF GAD
Sbjct  80   DLVVFDDPITLDNNLHSPPVGRAQGFYVYDKKEIFTAWLGFSFVFNSTHHRGSINFAGAD  139

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            PLMNKTRDISV+GGTGDFFM RGVAT+ TDAFEG+VYFRLR DI  +ECW
Sbjct  140  PLMNKTRDISVIGGTGDFFMARGVATLSTDAFEGKVYFRLRADINLFECW  189



>gb|AAD25355.1|AF115574_1 pathogenesis-related protein [Pisum sativum]
Length=184

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            ++SS  P  ++KPYKPCKNLVLYFHD++YNG+NAANATS IV AP+  + T LA Q HFG
Sbjct  16   ALSSAIP-NKRKPYKPCKNLVLYFHDILYNGKNAANATSAIVAAPEGVSLTKLAPQSHFG  74

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            N++VFDDPITL ++  S  VGRAQG Y+YDTKNTYT+WL F+FVLN+T  QG+I F GAD
Sbjct  75   NIIVFDDPITLSHSLSSKQVGRAQGFYIYDTKNTYTSWLSFTFVLNSTHHQGTITFAGAD  134

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            P++ KTRDISV GGTGDFFMHRG+AT+ TDAFEGE YFRL V IKF+ECW
Sbjct  135  PIVAKTRDISVTGGTGDFFMHRGIATITTDAFEGEAYFRLGVYIKFFECW  184



>ref|XP_009762730.1| PREDICTED: disease resistance response protein 206-like [Nicotiana 
sylvestris]
Length=186

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            ++   PCK +V YFHD++YNG+N  NATSTI+GAP+WGN TI+A+  +FG+++VFDDPIT
Sbjct  24   RRVRAPCKEMVFYFHDIVYNGENYKNATSTIIGAPEWGNRTIMASPNNFGDLIVFDDPIT  83

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LDNN HSTPVGRAQGMY YD  +T+++WLGFSFV N TD +GS+NF G DPLMNKTRDIS
Sbjct  84   LDNNLHSTPVGRAQGMYFYDQMDTFSSWLGFSFVFNNTDYKGSLNFAGHDPLMNKTRDIS  143

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ++GGTGDFFM RG+AT+ TDAFEG VYFRLRV IK YECW
Sbjct  144  IIGGTGDFFMARGIATLSTDAFEGSVYFRLRVHIKLYECW  183



>ref|XP_010676381.1| PREDICTED: disease resistance response protein 206 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +K   KPCK++  YFHDV+YNG+N+ NATS IVGAP W N TI+A Q HFG++++FDDPI
Sbjct  34   QKSLIKPCKSMSFYFHDVLYNGKNSKNATSAIVGAPAWANTTIIAGQSHFGDLIIFDDPI  93

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            T+ N+FHS  VGRAQG+Y YD K  +TAWLGFSFV N+T+ +G++NF GADPLMNKTRDI
Sbjct  94   TMTNDFHSKAVGRAQGLYFYDKKEVFTAWLGFSFVFNSTEHKGTLNFAGADPLMNKTRDI  153

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            S++GGTGDFFM RGVAT+MTDA+EG+VYFRLR DIK YECW
Sbjct  154  SIIGGTGDFFMARGVATLMTDAYEGDVYFRLRADIKLYECW  194



>gb|KHN16769.1| Disease resistance response protein 206 [Glycine soja]
Length=161

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGN  301
             SS  P  RK+ + PCK+LVL+FHD+IYNG NAANATS IVGAP+  N TILA QFHFGN
Sbjct  6    CSSAVPGKRKQYHTPCKHLVLFFHDIIYNGNNAANATSAIVGAPEGANLTILANQFHFGN  65

Query  302  VVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADP  481
            +VVFDDPITLDNN HS PVGRAQG Y+Y+TKNTYT+WLGF+FVLN TD  G+I F GADP
Sbjct  66   IVVFDDPITLDNNLHSKPVGRAQGFYIYNTKNTYTSWLGFTFVLNNTDHDGTITFAGADP  125

Query  482  LMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVY  589
            +M KTRDISV GGTGDFFMHRG+AT+MTDAFEGEVY
Sbjct  126  IMQKTRDISVTGGTGDFFMHRGIATIMTDAFEGEVY  161



>ref|XP_007209632.1| hypothetical protein PRUPE_ppa011846mg [Prunus persica]
 gb|EMJ10831.1| hypothetical protein PRUPE_ppa011846mg [Prunus persica]
Length=193

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  176  LVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTP  355
            L  YFHD+I+NG+N+ NAT+ IVG+P WGN TILA Q HFGN+VVFDDPITLDNN HS P
Sbjct  43   LTFYFHDIIFNGKNSKNATAAIVGSPPWGNRTILAGQSHFGNIVVFDDPITLDNNLHSAP  102

Query  356  VGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFF  535
            VGRAQG Y+YD K+ +TAWLGFSFV N+T  +GSINF GADPLMNKTRD+SV+GGTGDFF
Sbjct  103  VGRAQGFYIYDRKDIFTAWLGFSFVFNSTQHRGSINFAGADPLMNKTRDVSVIGGTGDFF  162

Query  536  MHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            M RGVAT+ TDAFEGEVYFRLRVDIK YECW
Sbjct  163  MTRGVATLETDAFEGEVYFRLRVDIKLYECW  193



>sp|P13240.2|DR206_PEA RecName: Full=Disease resistance response protein 206; AltName: 
Full=Dirigent protein PI206; Flags: Precursor [Pisum sativum]
 gb|AAB18669.1| disease resistance response protein 206-d [Pisum sativum]
Length=184

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            ++SS  P  ++KPYKPCKNLV YFHD++YNG+NAANATS IV AP+  + T LA Q HFG
Sbjct  16   ALSSAIP-NKRKPYKPCKNLVFYFHDILYNGKNAANATSAIVAAPEGVSLTKLAPQSHFG  74

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            N++VFDDPITL ++  S  VGRAQG Y+YDTKNTYT+WL F+FVLN+T  QG+I F GAD
Sbjct  75   NIIVFDDPITLSHSLSSKQVGRAQGFYIYDTKNTYTSWLSFTFVLNSTHHQGTITFAGAD  134

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            P++ KTRDISV GGTGDFFMHRG+AT+ TDAFEGE YFRL V IKF+ECW
Sbjct  135  PIVAKTRDISVTGGTGDFFMHRGIATITTDAFEGEAYFRLGVYIKFFECW  184



>gb|AAA33662.1| disease resistance response protein, partial [Pisum sativum]
 prf||1604467C disease response resistance gene
Length=175

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            ++SS  P  ++KPYKPCKNLV YFHD++YNG+NAANATS IV AP+  + T LA Q HFG
Sbjct  7    ALSSAIP-NKRKPYKPCKNLVFYFHDILYNGKNAANATSAIVAAPEGVSLTKLAPQSHFG  65

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            N++VFDDPITL ++  S  VGRAQG Y+YDTKNTYT+WL F+FVLN+T  QG+I F GAD
Sbjct  66   NIIVFDDPITLSHSLSSKQVGRAQGFYIYDTKNTYTSWLSFTFVLNSTHHQGTITFAGAD  125

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            P++ KTRDISV GGTGDFFMHRG+AT+ TDAFEGE YFRL V IKF+ECW
Sbjct  126  PIVAKTRDISVTGGTGDFFMHRGIATITTDAFEGEAYFRLGVYIKFFECW  175



>ref|XP_009610713.1| PREDICTED: disease resistance response protein 206-like [Nicotiana 
tomentosiformis]
Length=186

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            ++ + PCK +V YFHD++YNG+N  NATS I+GAP+WGN TI+A+  +FG+++VFDDPIT
Sbjct  24   RRAHTPCKEMVFYFHDIVYNGENYKNATSAIIGAPEWGNRTIMASPNNFGDLIVFDDPIT  83

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LDNN HSTPVGRAQGMY YD  +T+++WLGFSFV N TD +GS+NF G DPLMNKTRDIS
Sbjct  84   LDNNLHSTPVGRAQGMYFYDQMDTFSSWLGFSFVFNNTDYKGSLNFAGHDPLMNKTRDIS  143

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            V+GGTGDFFM RG+AT+ TDAFEG VYFRL V IK YECW
Sbjct  144  VIGGTGDFFMARGIATLSTDAFEGSVYFRLHVHIKLYECW  183



>pdb|4REV|A Chain A, Structure Of The Dirigent Protein Drr206
 pdb|4REV|B Chain B, Structure Of The Dirigent Protein Drr206
Length=164

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            ++KPYKPCKNLV YFHD++YNG+NAANATS IV AP+  + T LA Q HFGN++VFDDPI
Sbjct  4    KRKPYKPCKNLVFYFHDILYNGKNAANATSAIVAAPEGVSLTKLAPQSHFGNIIVFDDPI  63

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TL ++  S  VGRAQG Y+YDTKNTYT+WL F+FVLN+T  QG+I F GADP++ KTRDI
Sbjct  64   TLSHSLSSKQVGRAQGFYIYDTKNTYTSWLSFTFVLNSTHHQGTITFAGADPIVAKTRDI  123

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV GGTGDFFMHRG+AT+ TDAFEGE YFRL V IKF+ECW
Sbjct  124  SVTGGTGDFFMHRGIATITTDAFEGEAYFRLGVYIKFFECW  164



>gb|AAK38666.1| rhizome dirigent protein [Podophyllum peltatum]
 gb|ABD66756.1| dirigent protein oxidase [Sinopodophyllum hexandrum]
 gb|ABD78858.1| dirigent protein oxidase [Dysosma tsayuensis]
Length=193

 Score =   252 bits (643),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  119  SVSSTHPMGRK-KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            S SS HP  +K K   PCK LVLYFHDV+YNG N ANAT++IVGAPQ  +   LA + HF
Sbjct  23   SASSAHPPRQKLKQRIPCKQLVLYFHDVVYNGHNKANATASIVGAPQGADLVKLAGENHF  82

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GNVVVFDDPITLDNNFHS PVGRAQG+Y+YD K+T+ +WL FSF LNTT  QG++ F+GA
Sbjct  83   GNVVVFDDPITLDNNFHSPPVGRAQGLYVYDKKDTFHSWLSFSFTLNTTMHQGTLIFMGA  142

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K RDI+VVGGTGDFFM RG+AT+ TD++EGEVYFRL+VDIK YECW
Sbjct  143  DPILIKNRDITVVGGTGDFFMARGIATIATDSYEGEVYFRLKVDIKLYECW  193



>gb|ABD52130.1| dirigent protein pDIR19, partial [Picea sitchensis]
Length=159

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  155  PYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLD  334
            P KPC+NLVLYFHD++YNG+NA NATS IVGAPQWGN T L    HFG++ VFDDPITLD
Sbjct  2    PLKPCRNLVLYFHDILYNGKNAKNATSAIVGAPQWGNLTTLTVNNHFGDLAVFDDPITLD  61

Query  335  NNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVV  514
            NN HS PVGRAQG Y+YD KNT+++WLGF+FVLN+TD +G+I F GADP++ K R+ISVV
Sbjct  62   NNLHSRPVGRAQGFYLYDMKNTFSSWLGFTFVLNSTDYRGTITFGGADPILTKYREISVV  121

Query  515  GGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GGTGDF M RG+A V TDAFEG+VYFRLRV+I  YEC+
Sbjct  122  GGTGDFLMARGIANVSTDAFEGDVYFRLRVNITLYECY  159



>ref|XP_006343909.1| PREDICTED: disease resistance response protein 206-like [Solanum 
tuberosum]
Length=189

 Score =   249 bits (637),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            + + PCK +V +FHD++YNG+N  NATS IVGAP WGN TI+++  +FG+++VFDDPITL
Sbjct  28   RAHAPCKEMVFFFHDIVYNGENYKNATSAIVGAPDWGNRTIMSSPNNFGDMIVFDDPITL  87

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            DNN HS P+GRAQGMY YD K+T+++WLGFSFV N TD +GS+NF G DPLMNKTRDISV
Sbjct  88   DNNLHSPPIGRAQGMYFYDQKDTFSSWLGFSFVFNNTDYKGSLNFAGHDPLMNKTRDISV  147

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +GGTGDFFM RG+AT+ TDAFEG VYFRLRV +K YECW
Sbjct  148  IGGTGDFFMTRGIATLSTDAFEGSVYFRLRVHVKLYECW  186



>ref|XP_004245554.1| PREDICTED: disease resistance response protein 206-like [Solanum 
lycopersicum]
Length=189

 Score =   249 bits (636),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +S+S+     R +   PCK ++ +FHD++YNG+N  NATS IVGAP+WGN TI+++  +F
Sbjct  18   LSISAHSYTHRAR--APCKEMIFFFHDIVYNGENYKNATSAIVGAPEWGNRTIMSSPNNF  75

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G+++VFDDPITLDNN HS P+GRAQGMY YD K+T+++WLGFSFV N TD +GS+NF G 
Sbjct  76   GDMIVFDDPITLDNNLHSPPIGRAQGMYFYDQKDTFSSWLGFSFVFNNTDYKGSLNFAGH  135

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DPLMNKTRDISV+GGTGDFFM RG+AT+ TDAFEG VYFRLRV +K YECW
Sbjct  136  DPLMNKTRDISVIGGTGDFFMTRGIATLSTDAFEGSVYFRLRVHVKLYECW  186



>ref|XP_008452163.1| PREDICTED: disease resistance response protein 206-like, partial 
[Cucumis melo]
Length=169

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  167  CKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFH  346
            C +LV YFHD+I+NG NA NATS IVGAP WGN T LA Q HFGNVVVFDDPITLDNN H
Sbjct  16   CHHLVFYFHDIIFNGHNAKNATSAIVGAPAWGNLTTLAGQNHFGNVVVFDDPITLDNNLH  75

Query  347  STPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTG  526
            S PVGRAQG Y YD K  +TAWLGFSFV N+T+ +GS+NF GADP + KTRDISV+GGTG
Sbjct  76   SPPVGRAQGFYFYDKKEIFTAWLGFSFVFNSTEHKGSLNFAGADPALEKTRDISVIGGTG  135

Query  527  DFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DFFM RG+AT+ TD+FEG  YFRLR DIK YECW
Sbjct  136  DFFMARGIATLSTDSFEGNDYFRLRTDIKLYECW  169



>gb|AAT11124.1| dirigent protein [Sesamum indicum]
Length=187

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRK-KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFH  292
            IS SS     RK +   PC+ L  +FHDV++NG N  NATS IVG+PQWGN T +A  ++
Sbjct  16   ISTSSPTAYSRKPRRRSPCRELTFFFHDVLFNGHNYHNATSAIVGSPQWGNKTAVAKPYN  75

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG+VVVFDDPIT+DNNFH  PVGRAQGMY+YD  +TY AWLGFSF+ N+T+  G++NF G
Sbjct  76   FGDVVVFDDPITVDNNFHGAPVGRAQGMYLYDQWSTYGAWLGFSFLFNSTEYVGTLNFAG  135

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ADPLMNKTRDISV+GGTG+FFM RG+AT+ TDA+EG+VYFRLRVDI+ YECW
Sbjct  136  ADPLMNKTRDISVIGGTGEFFMARGIATLSTDAYEGDVYFRLRVDIQLYECW  187



>ref|XP_006826467.1| hypothetical protein AMTR_s00004p00226930 [Amborella trichopoda]
 gb|ERM93704.1| hypothetical protein AMTR_s00004p00226930 [Amborella trichopoda]
Length=186

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            R   +KPCK L+ YFHD+IY+G NA NAT+T+VGAPQ  N T L    HFG++ VFDDPI
Sbjct  26   RHSVHKPCKRLIFYFHDIIYDGTNAQNATATLVGAPQGANLTKLTGNNHFGDLAVFDDPI  85

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQGMY YD K  YTAWLGFSFVLN+T+  G++NFIGADPL+  TRDI
Sbjct  86   TLDNNLHSPPVGRAQGMYFYDKKEFYTAWLGFSFVLNSTNYLGTLNFIGADPLLQTTRDI  145

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDFFM RGVAT+ TDA+EGEVYFRL+V+IK YEC+
Sbjct  146  SVVGGTGDFFMARGVATISTDAYEGEVYFRLKVNIKLYECY  186



>gb|AAF25363.1|AF210067_1 dirigent-like protein [Thuja plicata]
Length=190

 Score =   246 bits (629),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +KK  KPCKNLVLYFHD+IYNG+NA NATS +V AP+  N TI+    HFGN+ VFDDPI
Sbjct  30   KKKLPKPCKNLVLYFHDIIYNGKNAENATSALVAAPEGANLTIMTGNNHFGNLAVFDDPI  89

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K RDI
Sbjct  90   TLDNNLHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHKGTITFNGADPILTKYRDI  149

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDF M RG+AT+ TD++EGEVYFRLRV+I  YEC+
Sbjct  150  SVVGGTGDFLMARGIATISTDSYEGEVYFRLRVNITLYECY  190



>gb|ADD70247.1| dirigent protein [Dysosma tsayuensis]
Length=193

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +2

Query  119  SVSSTHPMGRK-KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            S SS HP   K K   PCK LVLYFHDV+YNG N ANAT++IVGAPQ  +   LA + HF
Sbjct  23   SGSSAHPPRHKLKQRIPCKQLVLYFHDVVYNGHNKANATASIVGAPQGADLVKLAGENHF  82

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GNVVVFDDPITLDNNFHS PVGRAQG+Y+YD K+T+ +WL FSF LNTT  QG++ F+GA
Sbjct  83   GNVVVFDDPITLDNNFHSPPVGRAQGLYVYDKKDTFHSWLSFSFTLNTTMHQGTLIFMGA  142

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K RDI+VVGGTGDF M RG+AT+ TD++E EVYFRL+VDIK YECW
Sbjct  143  DPILIKNRDITVVGGTGDFLMARGIATIATDSYEAEVYFRLKVDIKLYECW  193



>ref|XP_011080883.1| PREDICTED: disease resistance response protein 206-like [Sesamum 
indicum]
Length=175

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  137  PMGRK-KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVF  313
            P  RK +   PC+ L  +FHDV++NG N  NATS IVG+PQWGN T +A  ++FG+VVVF
Sbjct  11   PFSRKPRRRSPCRELTFFFHDVLFNGHNYHNATSAIVGSPQWGNKTAVAKPYNFGDVVVF  70

Query  314  DDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNK  493
            DDPIT+DNNFH  PVGRAQGMY+YD  +TY AWLGFSF+ N+T+  G++NF GADPLMNK
Sbjct  71   DDPITVDNNFHGAPVGRAQGMYLYDQWSTYGAWLGFSFLFNSTEYVGTLNFAGADPLMNK  130

Query  494  TRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TRDISV+GGTG+FFM RG+AT+ TDA+EG+VYFRLRVDI+ YECW
Sbjct  131  TRDISVIGGTGEFFMARGIATLSTDAYEGDVYFRLRVDIQLYECW  175



>gb|AAF25361.1|AF210065_1 dirigent-like protein [Thuja plicata]
Length=192

 Score =   245 bits (625),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +KK  KPC+NLVLYFHD+IYNG+NA NATS +V APQ  N TI+    HFGN+ VFDDPI
Sbjct  32   KKKLPKPCRNLVLYFHDIIYNGKNAENATSALVSAPQGANLTIMTGNNHFGNLAVFDDPI  91

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +GSI F GADP++ K RDI
Sbjct  92   TLDNNLHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHKGSITFNGADPILTKYRDI  151

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDF M RG+AT+ TD++EG+VYFRLRV+I  YEC+
Sbjct  152  SVVGGTGDFLMARGIATISTDSYEGDVYFRLRVNITLYECY  192



>gb|AAF25366.1|AF210070_1 dirigent-like protein [Thuja plicata]
Length=192

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +KK  KPC+NLVLYFHD+IYNG+NA NATST+V APQ  N TI+   +HFG++ VFDDPI
Sbjct  32   KKKLPKPCRNLVLYFHDIIYNGKNAGNATSTLVAAPQGANLTIMTGNYHFGDLAVFDDPI  91

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            T+DNN HS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K RDI
Sbjct  92   TVDNNLHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDYKGTITFGGADPILAKYRDI  151

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDF M RG+AT+ TDA+EG+VYFRLRV+I  YEC+
Sbjct  152  SVVGGTGDFLMARGIATIDTDAYEGDVYFRLRVNITLYECY  192



>ref|XP_004300276.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=189

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query  125  SSTHPMGRKKPYKP--CKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            S+  P  + KP+ P  CK LV Y HD++YNG+N+ NATS IVGAP WGN TILA   HFG
Sbjct  20   SAASPTLKSKPHHPLPCKRLVFYLHDIVYNGKNSKNATSAIVGAPAWGNKTILAKDNHFG  79

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
            +VVVFDDPIT DNN HSTPVGRAQG Y+YD K  +TA+ G SFV N+T  +GSIN +GAD
Sbjct  80   DVVVFDDPITSDNNLHSTPVGRAQGFYLYDRKVAFTAFFGISFVFNSTQHKGSINCVGAD  139

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            P   KTRDISVVGGTGDFFM RG+AT+M D  EG+VYFRL+VD+K YECW
Sbjct  140  PTAAKTRDISVVGGTGDFFMARGIATLMGDDVEGDVYFRLKVDVKLYECW  189



>gb|AIA24413.1| dirigent protein oxidase [Sinopodophyllum hexandrum]
Length=193

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            S+  P  + K + PCK LVLYFHDV+YNG N  NAT++IV APQ  +   LA + HFGNV
Sbjct  26   SARPPRHKLKQHIPCKQLVLYFHDVVYNGHNKDNATASIVAAPQGSDLVKLAGENHFGNV  85

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
            VVFDDPITLDNNFHS PVGRAQG+Y+YD ++T+ +WL FSF LN+T  QG++ F+GADP+
Sbjct  86   VVFDDPITLDNNFHSPPVGRAQGLYVYDKRDTFHSWLSFSFTLNSTMHQGTLIFMGADPI  145

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            + K RDI+VVGGTGDFFM RG+AT+ TDA+EGEVYFRL+VDIK YECW
Sbjct  146  LIKNRDITVVGGTGDFFMARGIATIATDAYEGEVYFRLKVDIKLYECW  193



>gb|AAF25365.1|AF210069_1 dirigent protein [Thuja plicata]
Length=192

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +KK  KPC+NLVLYFHD+IYNG+NA NATST+V APQ  N TI+   +HFG++ VFDDPI
Sbjct  32   KKKLPKPCRNLVLYFHDIIYNGKNAGNATSTLVAAPQGANLTIMTGNYHFGDLSVFDDPI  91

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            T+DNN HS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K RDI
Sbjct  92   TVDNNLHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDYKGTITFGGADPILAKYRDI  151

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDF M RG+AT+ TDA+EG+VYFRLRV+I  YEC+
Sbjct  152  SVVGGTGDFLMARGIATIDTDAYEGDVYFRLRVNITLYECY  192



>gb|AAF25358.1|AF210062_1 dirigent protein [Forsythia x intermedia]
Length=185

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + +  +PCK LV +FHD++Y G N  NAT+ IV +PQWGN T +A  F+FG++VVFDDPI
Sbjct  25   KTRSRRPCKELVFFFHDILYLGYNRNNATAVIVASPQWGNKTAMAKPFNFGDLVVFDDPI  84

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG Y YD  + Y AWLGFSF+ N+TD  G++NF GADPL+NKTRDI
Sbjct  85   TLDNNLHSPPVGRAQGTYFYDQWSIYGAWLGFSFLFNSTDYVGTLNFAGADPLINKTRDI  144

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SV+GGTGDFFM RGVATV TDAFEG+VYFRLRVDI+ YECW
Sbjct  145  SVIGGTGDFFMARGVATVSTDAFEGDVYFRLRVDIRLYECW  185



>ref|XP_011073494.1| PREDICTED: disease resistance response protein 206-like [Sesamum 
indicum]
Length=187

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            +PCK LV YFHD++YNG NA N+TS IVGAP WGN T L +  HFG++V+FDDPITLDNN
Sbjct  32   RPCKRLVFYFHDILYNGYNAKNSTSAIVGAPTWGNTTKLTSNNHFGDMVIFDDPITLDNN  91

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
             HS  VGRAQG Y+YD K T+T+W+  SFV N+T  +G+INF+GADP+++KTRDISV+GG
Sbjct  92   LHSPRVGRAQGFYIYDKKETFTSWIAMSFVFNSTQHKGTINFVGADPILSKTRDISVIGG  151

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RGVAT+ TD++EGEVYFRLR DIK YECW
Sbjct  152  TGDFHMSRGVATIATDSYEGEVYFRLRCDIKLYECW  187



>gb|AAF25364.1|AF210068_1 dirigent-like protein [Thuja plicata]
Length=190

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            +  +  H   +K P KPCKNLVLYFHD+IYNG+NA NATS +V AP+  N TI+    HF
Sbjct  21   LKSADCHSWKKKLP-KPCKNLVLYFHDIIYNGKNAENATSALVAAPEGANLTIMTGNNHF  79

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN+ VFDDPITLDNN HS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GA
Sbjct  80   GNLAVFDDPITLDNNLHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHKGTITFNGA  139

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DP++ K RDISVVGGTGDF M RG+AT+ TD++EG+VYFRLRV+I  Y+C+
Sbjct  140  DPILTKYRDISVVGGTGDFLMARGIATISTDSYEGDVYFRLRVNITLYKCY  190



>gb|ABD52117.1| dirigent protein pDIR6 [Picea engelmannii x Picea glauca]
Length=195

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FH  292
            +  S  H   ++   +PC+NLVLYFHDVIYNG+NA NATST+VGAPQ GN T+LA +  H
Sbjct  24   LQTSDGHSRKKRSLPQPCRNLVLYFHDVIYNGKNADNATSTLVGAPQGGNLTLLAGKDNH  83

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG++ VFDDPIT+DNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F G
Sbjct  84   FGDLAVFDDPITVDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDYKGTITFSG  143

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ADP++ K RDISVVGGTGDF M RG+AT+ TDA+EG+VYFRL V+I  YEC+
Sbjct  144  ADPILTKHRDISVVGGTGDFLMTRGIATISTDAYEGDVYFRLCVNITLYECY  195



>gb|AAF25360.1|AF210064_1 dirigent protein [Thuja plicata]
Length=192

 Score =   241 bits (615),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +KK  +PCKNLVLYFHD++YNG N  NATS IVGAP+  N TIL    HFG+VVVFDDPI
Sbjct  32   KKKIPEPCKNLVLYFHDILYNGSNKHNATSAIVGAPKGANLTILTGNNHFGDVVVFDDPI  91

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HSTPVGRAQG Y YD KNT+ +WLGF+FVLN+T+ +G+I F GADP++ K RDI
Sbjct  92   TLDNNLHSTPVGRAQGFYFYDMKNTFNSWLGFTFVLNSTNYKGTITFNGADPILTKYRDI  151

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDF M RG+AT+ TDA+EG+VYFRLRV+I  YEC+
Sbjct  152  SVVGGTGDFLMARGIATISTDAYEGDVYFRLRVNITLYECY  192



>gb|ABD52116.1| dirigent protein pDIR5 [Picea engelmannii x Picea glauca]
Length=196

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = +2

Query  146  RKKPYK-PCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDD  319
            +K+P + PC+NLVLYFHDV+YNG+NA NATST+VGAPQ  N T+L+ +   FG++ VFDD
Sbjct  34   KKRPLRQPCRNLVLYFHDVLYNGKNAGNATSTLVGAPQGANLTLLSGKDNQFGDLAVFDD  93

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNNFHS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  94   PITLDNNFHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHKGTITFGGADPILTKYR  153

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+ATV TD++EG+VYFRLRV+I  YEC+
Sbjct  154  DISVVGGTGDFLMTRGIATVNTDSYEGDVYFRLRVNITLYECY  196



>gb|ABD52126.1| dirigent protein pDIR15 [Picea sitchensis]
Length=196

 Score =   239 bits (610),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = +2

Query  146  RKKPYK-PCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTIL-ATQFHFGNVVVFDD  319
            +K+P + PC+N+VLYFHDVIYNG+NA NATST+VGAP+  N T+L     HFG++ VFDD
Sbjct  34   KKRPLRQPCRNMVLYFHDVIYNGKNAMNATSTLVGAPRGANLTLLYGKDNHFGDLAVFDD  93

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNNFHS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  94   PITLDNNFHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHKGTITFGGADPILTKYR  153

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+ATV TD++EG+VYFRLRV+I  YEC+
Sbjct  154  DISVVGGTGDFLMTRGIATVNTDSYEGDVYFRLRVNITLYECY  196



>ref|XP_011022581.1| PREDICTED: disease resistance response protein 206-like [Populus 
euphratica]
Length=186

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            ++P KPC+ LVLYFHD+IYNG+NA NATS IVG+P WGN T LA    FG+VV+FDDPIT
Sbjct  28   RRP-KPCRRLVLYFHDIIYNGKNAKNATSAIVGSPAWGNKTNLAIPNRFGDVVIFDDPIT  86

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LD+N  STP+GRAQG+Y+YD K   TAW GFSFV N+T  +G+INF GAD +M  TRD+S
Sbjct  87   LDSNLRSTPIGRAQGLYLYDKKEILTAWFGFSFVFNSTQLKGTINFAGADDIMKTTRDLS  146

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VVGGTGDFFM RG+AT+MTDA+E + YFRLRVD++ YEC+
Sbjct  147  VVGGTGDFFMTRGIATLMTDAYEDDRYFRLRVDVQLYECF  186



>gb|ABD52113.1| dirigent protein pDIR2 [Picea engelmannii x Picea glauca]
Length=195

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +2

Query  146  RKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDD  319
            +K P  KPC+NLVLYFHDVIYNG NA NATST+VGAPQ  N T+L+ +  HFG++ VFDD
Sbjct  33   KKHPLPKPCRNLVLYFHDVIYNGLNADNATSTLVGAPQGANLTLLSGKDNHFGDLAVFDD  92

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  93   PITLDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDYKGTITFSGADPILTKYR  152

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+AT+ TDA+EG+VYFRL V+I  YEC+
Sbjct  153  DISVVGGTGDFLMARGIATISTDAYEGDVYFRLCVNITLYECY  195



>gb|AAF25367.1|AF210071_1 dirigent-like protein [Tsuga heterophylla]
Length=195

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDDP  322
            + +  KPC+NLVLYFHDVIYNG NA NATST+VGAP   N T+LA +  HFG++ VFDDP
Sbjct  34   KHRLRKPCRNLVLYFHDVIYNGSNAKNATSTLVGAPHGSNLTLLAGKDNHFGDLAVFDDP  93

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            ITLDNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F GADP++ K RD
Sbjct  94   ITLDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDYKGTITFSGADPILTKYRD  153

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ISVVGGTGDF M RG+AT+ TDA+EG+VYFRL V+I  YEC+
Sbjct  154  ISVVGGTGDFIMARGIATISTDAYEGDVYFRLCVNITLYECY  195



>gb|AAF25362.1|AF210066_1 dirigent-like protein [Thuja plicata]
Length=192

 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  143  GRKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDD  319
            GRKK   KPCK+LVLYFHD++YNG+NA NATS +V AP+  N TI+    HFGN+ VFDD
Sbjct  30   GRKKRLPKPCKHLVLYFHDILYNGKNAHNATSALVAAPEGANLTIMTGNNHFGNIAVFDD  89

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNN HS  VGRAQG Y YD K+T+ AWLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  90   PITLDNNLHSPSVGRAQGFYFYDMKDTFNAWLGFTFVLNSTDHKGTITFNGADPILTKYR  149

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+AT+ TD++EG+VYFRLRV+I  YEC+
Sbjct  150  DISVVGGTGDFLMARGIATISTDSYEGDVYFRLRVNITLYECY  192



>gb|ABD52129.1| dirigent protein pDIR18 [Picea glauca]
Length=224

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  140  MGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDD  319
            M  K P KPC N VLYFHD++YNG+NA NATS IV APQ  N TIL    HFG++VVFDD
Sbjct  39   MKPKHP-KPCWNKVLYFHDILYNGKNAKNATSAIVAAPQGANLTILTGNNHFGDLVVFDD  97

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNN HS PVGRAQG Y YD K T++AWLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  98   PITLDNNLHSPPVGRAQGFYFYDMKKTFSAWLGFTFVLNSTDHRGTITFTGADPILTKYR  157

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYE  622
            DISVVGGTGDF M RG+AT+ TDAFEGEVYFRLRV+I  YE
Sbjct  158  DISVVGGTGDFLMARGIATISTDAFEGEVYFRLRVNITLYE  198



>ref|XP_010685205.1| PREDICTED: disease resistance response protein 206-like [Beta 
vulgaris subsp. vulgaris]
Length=195

 Score =   236 bits (602),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +2

Query  137  PMGRKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQF-HFGNVVV  310
            P   +KP  KPCK++  YFHDV+YNG+N+ NATS IVGAP W N T LA Q  HFG+++V
Sbjct  30   PKHTQKPLRKPCKSMTFYFHDVLYNGKNSKNATSAIVGAPAWANKTSLAGQSSHFGDLIV  89

Query  311  FDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMN  490
            FDDPIT  NNFHS  VGRAQG Y YD K  +TAW  FSFV N+T+ +G++NF GADP  +
Sbjct  90   FDDPITTTNNFHSKAVGRAQGFYFYDKKEIFTAWFAFSFVFNSTEHKGTLNFAGADPTTS  149

Query  491  KTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            KTRDIS++GGTGDFFM RGVAT+MTD ++G  YFRLRVDIK YECW
Sbjct  150  KTRDISIIGGTGDFFMARGVATLMTDTYQGNAYFRLRVDIKLYECW  195



>gb|AAL92120.1|AF487405_1 dirigent-like protein [Thuja plicata]
Length=193

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 132/168 (79%), Gaps = 1/168 (1%)
 Frame = +2

Query  125  SSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNV  304
            +  H   +K P KP KNLVLYFHD+IYNGQNA NATSTIV AP+  N TIL    HFGN+
Sbjct  26   ADCHSWKKKLP-KPRKNLVLYFHDIIYNGQNAENATSTIVAAPEGANLTILTGNNHFGNI  84

Query  305  VVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL  484
             VFDDPITLDNN HS PVGR QG Y YD KNT+++WLGF+FVLN+TD +G+I F GADP+
Sbjct  85   AVFDDPITLDNNLHSPPVGRPQGFYFYDMKNTFSSWLGFTFVLNSTDYKGTITFNGADPI  144

Query  485  MNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            + K RDISVVGGTGD  M RG+A + TDA+EG+VYFRLRV+I  YEC+
Sbjct  145  LVKYRDISVVGGTGDLLMARGIAAINTDAYEGDVYFRLRVNITLYECY  192



>gb|ABR27728.1| dirigent-like protein [Picea sitchensis]
 gb|ACN41129.1| unknown [Picea sitchensis]
Length=195

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = +2

Query  146  RKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDD  319
            +K P  KPC+NLVLYFHDVIYNG NA NATST+VGAPQ  N T+L+ +  HFG++ VFDD
Sbjct  33   KKHPLPKPCRNLVLYFHDVIYNGLNADNATSTLVGAPQGANLTLLSGKDNHFGDLAVFDD  92

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+ D +G+I F GADP++ K R
Sbjct  93   PITLDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSADYKGTITFSGADPILKKYR  152

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+AT+ TDA+EG+VYFRL V+I  YEC+
Sbjct  153  DISVVGGTGDFLMARGIATISTDAYEGDVYFRLCVNITLYECY  195



>gb|ABD52119.1| dirigent protein pDIR8 [Picea engelmannii x Picea glauca]
Length=196

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  146  RKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDD  319
            +K P  KPC+NLV YFHDVIYNG NA NATST+VGAP   N T+LA +  HFG++ VFDD
Sbjct  34   KKYPLPKPCRNLVFYFHDVIYNGLNAENATSTLVGAPHGANLTLLAGKDNHFGDMAVFDD  93

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNNFHS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  94   PITLDNNFHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHRGTITFGGADPILTKHR  153

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+ATV TDA+EG+VYFRL V+I  YEC+
Sbjct  154  DISVVGGTGDFLMSRGIATVSTDAYEGDVYFRLCVNITLYECY  196



>gb|AAF25368.1|AF210072_1 dirigent-like protein [Tsuga heterophylla]
Length=185

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDDPITLDN  337
            +PC+NLVLYFHDV+YNG NA NATST+VGAPQ  N T+LA +  HFG++ VFDDPITLDN
Sbjct  29   QPCRNLVLYFHDVLYNGFNAHNATSTLVGAPQGANLTLLAGKDNHFGDLAVFDDPITLDN  88

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            NF S PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F GADP++ K RDISVVG
Sbjct  89   NFQSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDYKGTITFSGADPILTKYRDISVVG  148

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDF M RG+AT+ TDA+EG+VYFRLRV+I  YEC+
Sbjct  149  GTGDFIMARGIATISTDAYEGDVYFRLRVNITLYECY  185



>ref|XP_002304532.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE79511.1| pathogenesis-related family protein [Populus trichocarpa]
Length=186

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            ++P KPC+ LVLYFHD+IYNG+NA NATS IVG+P WGN T LA    FG+VV+FDDPIT
Sbjct  28   RRP-KPCRRLVLYFHDIIYNGKNAKNATSAIVGSPAWGNKTNLAIPNRFGDVVIFDDPIT  86

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LD++  STP+GRAQG+Y+YD K   TAW GFSFV N+T  +G+INF GAD +M  TRD+S
Sbjct  87   LDSDLRSTPIGRAQGLYLYDKKEILTAWFGFSFVFNSTQLKGTINFAGADDIMKTTRDLS  146

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VVGGTGDFFM RG+AT+MTDA+E + YFRLRVD++ YEC+
Sbjct  147  VVGGTGDFFMTRGIATLMTDAYEDDRYFRLRVDVQLYECF  186



>gb|ABR27729.1| dirigent-like protein [Picea sitchensis]
Length=196

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  146  RKKPY-KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDD  319
            +K P  KPC+NLV YFHDVIYNG NA NATST+VGAP   N T+LA +  HFG++ VFDD
Sbjct  34   KKYPLPKPCRNLVFYFHDVIYNGLNAENATSTLVGAPHGANLTLLAGKDNHFGDMAVFDD  93

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            PITLDNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F GADP++ K R
Sbjct  94   PITLDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDHRGTITFGGADPILTKHR  153

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDF M RG+ATV TDA+EG+VYFRL V+I  YEC+
Sbjct  154  DISVVGGTGDFLMSRGIATVSTDAYEGDVYFRLCVNITLYECY  196



>gb|EPS69503.1| hypothetical protein M569_05266, partial [Genlisea aurea]
Length=166

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 129/160 (81%), Gaps = 4/160 (3%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            +  ++PC+ L  +FHD++Y+G+N+ NATS IV AP WGN T+LA + HFG+VV+FDDPIT
Sbjct  11   QNRHRPCRTLNFFFHDILYDGRNSDNATSAIVAAPAWGNRTVLAGRKHFGDVVIFDDPIT  70

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LD +  S PVGRAQGMY+YD K  +TAWLGFSFV  +    GSI F G+DPLM++ RDIS
Sbjct  71   LDGDLRSAPVGRAQGMYLYDRKEVFTAWLGFSFVFES----GSITFSGSDPLMDRRRDIS  126

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            V+GGTGDFFM RGVAT+MTDA EG+VYFRLRVD+K YECW
Sbjct  127  VIGGTGDFFMARGVATLMTDAIEGDVYFRLRVDVKLYECW  166



>gb|ACN41005.1| unknown [Picea sitchensis]
Length=196

 Score =   234 bits (596),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 134/172 (78%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FH  292
            +  S  H   +    KPC+NLV YFHDVIYNG NA NATST+VGAP   N T+L  +  H
Sbjct  25   LQTSDGHSWKKHSLPKPCRNLVFYFHDVIYNGLNAKNATSTLVGAPHGANLTLLTGKDNH  84

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG++ VFDDPITLDNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F G
Sbjct  85   FGDLAVFDDPITLDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDHRGTITFGG  144

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ADP++ K RDISVVGGTGDF M RG+AT+ TDA+EG+VYFRL V+I  YEC+
Sbjct  145  ADPILAKHRDISVVGGTGDFLMARGIATISTDAYEGDVYFRLCVNITLYECY  196



>gb|ABR27730.1| dirigent-like protein [Picea sitchensis]
Length=194

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDDPITLDN  337
            KPC+NLV YFHDVIYNG NA NATST+VGAP   N T+L+ +  HFG++ VFDDPITLDN
Sbjct  38   KPCRNLVFYFHDVIYNGLNAKNATSTLVGAPHGANLTLLSGKDNHFGDMAVFDDPITLDN  97

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            NFHS PVGRAQG Y YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K RDISVVG
Sbjct  98   NFHSPPVGRAQGFYFYDMKNTFSAWLGFTFVLNSTDHRGTITFGGADPILTKHRDISVVG  157

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDF M RG+A V TDA+EG+VYFRL V+I  YEC+
Sbjct  158  GTGDFLMSRGIARVSTDAYEGDVYFRLCVNITLYECY  194



>gb|ACN40439.1| unknown [Picea sitchensis]
Length=212

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +2

Query  149  KKPY--KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDP  322
            KKP   KP    VLYFHD++YNG+NA NATSTIV APQ  N T L    HFG++ VFDDP
Sbjct  38   KKPKYPKPHWKKVLYFHDILYNGKNAKNATSTIVAAPQGANLTSLTDDNHFGDLAVFDDP  97

Query  323  ITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
            ITLDNN HS PVGRAQG Y+YD KNT++AWLGF+FVLN+TD +G+I F GADP++ K RD
Sbjct  98   ITLDNNMHSPPVGRAQGFYLYDMKNTFSAWLGFTFVLNSTDHRGTITFAGADPILTKYRD  157

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ISVVGGTGDF M RG+AT+ TDA+EG+VYFRLRV+I  YEC+
Sbjct  158  ISVVGGTGDFLMARGIATISTDAYEGDVYFRLRVNITLYECY  199



>gb|ABD52124.1| dirigent protein pDIR13 [Picea engelmannii x Picea glauca]
Length=195

 Score =   231 bits (589),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FH  292
            +  S  H   +    KP +NLVLYFHDVIY+G NA NATST+VGAP   N T+L  +  H
Sbjct  24   LQTSDGHRWKKYPLRKPTRNLVLYFHDVIYDGTNAKNATSTLVGAPHGANLTLLTGKDNH  83

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG++ VFDDPITLDNNFHS PVGRAQG Y+YD KNT+++WLGF+FVLN+TD +G+I F G
Sbjct  84   FGDLAVFDDPITLDNNFHSPPVGRAQGFYLYDMKNTFSSWLGFTFVLNSTDYKGTITFAG  143

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ADP++ K RDISVVGGTGDF M RG+AT+ TDA+EG+VYFRLRV+I  YE +
Sbjct  144  ADPILTKYRDISVVGGTGDFLMARGIATISTDAYEGDVYFRLRVNISLYEWY  195



>ref|XP_007208851.1| hypothetical protein PRUPE_ppa025746mg, partial [Prunus persica]
 gb|EMJ10050.1| hypothetical protein PRUPE_ppa025746mg, partial [Prunus persica]
Length=149

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  182  LYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVG  361
            LYFH+ +YNG NAA+ATS IV APQ  N TILA Q +FGN+V+F+D ITLDNN HS PVG
Sbjct  1    LYFHETVYNGTNAADATSAIVAAPQGANLTILAPQNYFGNIVIFNDLITLDNNIHSKPVG  60

Query  362  RAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMH  541
            R QG Y+YDTK+T TAW GFSF+LN+TD QGSINFIG +P+  KTRDISVVGG+GDFFMH
Sbjct  61   RTQGFYLYDTKDTITAWFGFSFILNSTDYQGSINFIGPNPVFVKTRDISVVGGSGDFFMH  120

Query  542  RGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RGVAT+ TD FEG+ +F LRVDIKFYECW
Sbjct  121  RGVATLRTDGFEGKYFFGLRVDIKFYECW  149



>gb|KHN44502.1| Disease resistance response protein 206 [Glycine soja]
Length=147

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 121/138 (88%), Gaps = 3/138 (2%)
 Frame = +2

Query  215  NAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTK  394
            NAANATS IVGA    N T LA+QFHFGN+VVFDDP+TLDNN HS  VGRAQG Y+YDTK
Sbjct  13   NAANATSAIVGAA---NLTKLASQFHFGNIVVFDDPVTLDNNLHSNQVGRAQGSYIYDTK  69

Query  395  NTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAF  574
            NT+TAWLGF+FVLN+TD +G+I   GADP + KTRD+SV+GGTGDFFMHRG+AT+MTDAF
Sbjct  70   NTFTAWLGFTFVLNSTDHRGTITLAGADPTLKKTRDVSVIGGTGDFFMHRGIATIMTDAF  129

Query  575  EGEVYFRLRVDIKFYECW  628
            EG+VYFRLRVD+KFYECW
Sbjct  130  EGQVYFRLRVDVKFYECW  147



>gb|ABD52127.1| dirigent protein pDIR16 [Picea sitchensis]
Length=196

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FH  292
            +  S  H   +    KPC+NLV YFHDVIYN  NA NATST+VGAP   N T+L  +  H
Sbjct  25   LQTSDGHSWKKHSLPKPCRNLVFYFHDVIYNVLNAKNATSTLVGAPHGANLTLLTGKDNH  84

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG++ VFDDPITLDNNFHS PVGRAQG Y YD KNT+++WLGF+FVLN+TD +G+I F G
Sbjct  85   FGDLAVFDDPITLDNNFHSPPVGRAQGFYFYDMKNTFSSWLGFTFVLNSTDHRGTITFGG  144

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ADP++ K RDISVVGGTGDF M RG+AT+ TDA+EG+VYFRL V+I  YEC+
Sbjct  145  ADPILAKHRDISVVGGTGDFLMARGIATISTDAYEGDVYFRLCVNITLYECY  196



>ref|XP_002304534.2| hypothetical protein POPTR_0003s13450g [Populus trichocarpa]
 gb|EEE79513.2| hypothetical protein POPTR_0003s13450g [Populus trichocarpa]
Length=155

 Score =   227 bits (579),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
            ++VSS +P G+KK YKPCK  VLYFHD++YNG+NAANATS IV AP+  N TILA Q HF
Sbjct  14   LAVSSAYP-GKKKQYKPCKEFVLYFHDILYNGKNAANATSAIVAAPEGANLTILAGQNHF  72

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            GN++VFDDPITLDNN HS PVGRAQGMY+YDTKNT+T+WLGF+F LN+T  QG+I+FIGA
Sbjct  73   GNIIVFDDPITLDNNLHSPPVGRAQGMYIYDTKNTFTSWLGFTFALNSTQHQGTISFIGA  132

Query  476  DPLMNKTRDISVVGGTGDFFMH  541
            DP++ K+RDISVVGGTGDFFMH
Sbjct  133  DPILVKSRDISVVGGTGDFFMH  154



>gb|EYU23399.1| hypothetical protein MIMGU_mgv1a014140mg [Erythranthe guttata]
Length=199

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 1/157 (1%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWG-NYTILATQFHFGNVVVFDDPITLDN  337
             PCK L  YFHD++YNG N+ NAT+ IV AP W  N T L+ + HFGNVVVFDDPIT+DN
Sbjct  43   SPCKTLAFYFHDILYNGHNSKNATAAIVAAPAWAANTTTLSNRDHFGNVVVFDDPITIDN  102

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N  STPVGRAQG Y+YD K+ +TAWLGFSFV N+T+ +GSINF GADPLMNKTRDISV+G
Sbjct  103  NLRSTPVGRAQGFYLYDRKDVFTAWLGFSFVFNSTEHKGSINFAGADPLMNKTRDISVIG  162

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RGVAT+ TDA EG+VYFRL  DI+ YECW
Sbjct  163  GTGDFFMTRGVATLTTDALEGDVYFRLHADIRLYECW  199



>gb|AAF25359.1|AF210063_1 dirigent-like protein [Thuja plicata]
Length=189

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  134  HPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVF  313
            H   R+ P  PCKNLVLYFHD++YNG+N  NAT+ +V AP WGN T  A  F FG+VVVF
Sbjct  26   HAWKRQLP-MPCKNLVLYFHDILYNGKNIHNATAALVAAPAWGNLTTFAEPFKFGDVVVF  84

Query  314  DDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNK  493
            DDPITLDNN HS PVGRAQG Y+Y+ K TY AWLGF+FVLN+TD +G+I F GADP + K
Sbjct  85   DDPITLDNNLHSPPVGRAQGFYLYNMKTTYNAWLGFTFVLNSTDYKGTITFNGADPPLVK  144

Query  494  TRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             RDISVVGGTGDF M RG+AT+ TDA EG VYFRLRV+I  YEC+
Sbjct  145  YRDISVVGGTGDFLMARGIATLSTDAIEGNVYFRLRVNITLYECY  189



>emb|CDP15166.1| unnamed protein product [Coffea canephora]
Length=188

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = +2

Query  131  THPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVV  310
            TH  GR     PCK L  YFHD++Y G N  NATS IV AP WGN    +  F FG +VV
Sbjct  27   THRRGR-----PCKELSFYFHDILYKGHNRDNATSAIVAAPDWGNRAEFSGPFDFGYLVV  81

Query  311  FDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMN  490
            FDDPITLDNN HSTPVGRAQGMY+YD  + ++AWL FSFV N+T+ +G++NF G DP+++
Sbjct  82   FDDPITLDNNLHSTPVGRAQGMYVYDQLSAFSAWLSFSFVFNSTEHKGTLNFAGPDPIVD  141

Query  491  KTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +TR +S+  GTGDFFM RG+A + TDA+EG  +FRLRVDIK +ECW
Sbjct  142  QTRIVSITSGTGDFFMARGIAILTTDAYEGNYFFRLRVDIKLHECW  187



>ref|XP_009762732.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance response protein 
206, partial [Nicotiana sylvestris]
Length=179

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            ++   PCK +V YFHD++YNG+N  NATSTI+GAP+WGN TI+A+  +FG+++VFDDPIT
Sbjct  22   RRARAPCKEMVFYFHDIVYNGKNYKNATSTIIGAPEWGNRTIMASPNNFGDLIVFDDPIT  81

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LDNN HSTPVGRAQGMY YD  +T+++WLGFSFV N TD +GS+NF G D LMNKTRDIS
Sbjct  82   LDNNLHSTPVGRAQGMYFYDQMDTFSSWLGFSFVFNNTDYKGSLNFAGHDLLMNKTRDIS  141

Query  509  VVGGTGDFFMHRGVATVMTDA  571
            V+GGTG FFM RG+    T A
Sbjct  142  VIGGTGXFFMARGIVKTKTWA  162



>gb|AFG47371.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47376.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47378.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47379.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47380.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47381.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47384.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47385.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
Length=134

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +2

Query  200  IYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVGRAQGMY  379
            +YNG NA NATS IV APQ  N T L    HFG++VVFDDPITLDN+ HS PVGRAQG Y
Sbjct  1    LYNGNNAENATSAIVAAPQGANLTSLTDNNHFGDLVVFDDPITLDNDMHSPPVGRAQGFY  60

Query  380  MYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATV  559
             YD KNT++AWLGF+FVLN+T+ +G+I F GADP++ K RDISVVGGTGDF M RG+AT+
Sbjct  61   FYDMKNTFSAWLGFTFVLNSTEHRGTITFAGADPILTKYRDISVVGGTGDFLMARGIATI  120

Query  560  MTDAFEGEVYFRLR  601
             TDA+EG+VYFRLR
Sbjct  121  STDAYEGDVYFRLR  134



>gb|AFG47372.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47373.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47374.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47375.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47377.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47382.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47383.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47386.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
 gb|AFG47387.1| hypothetical protein 0_1145_01, partial [Pinus taeda]
Length=134

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +2

Query  200  IYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVGRAQGMY  379
            +YNG NA NATS IV APQ  N T L    HFG++VVFDDPITLDN+ HS PVGRAQG Y
Sbjct  1    LYNGNNADNATSAIVAAPQGANLTSLTDNNHFGDLVVFDDPITLDNDMHSPPVGRAQGFY  60

Query  380  MYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATV  559
             YD KNT++AWLGF+FVLN+T+ +G+I F GADP++ K RDISVVGGTGDF M RG+AT+
Sbjct  61   FYDMKNTFSAWLGFTFVLNSTEHRGTITFAGADPILTKYRDISVVGGTGDFLMARGIATI  120

Query  560  MTDAFEGEVYFRLR  601
             TDA+EG+VYFRLR
Sbjct  121  STDAYEGDVYFRLR  134



>gb|AEW07420.1| hypothetical protein 0_1145_01, partial [Pinus radiata]
Length=134

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +2

Query  200  IYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHSTPVGRAQGMY  379
            +YNG NA NATS IV APQ  N T L    HFG++VVFDDPITLDN+ HS PVGRAQG Y
Sbjct  1    LYNGNNAENATSAIVAAPQGANLTSLTDNNHFGDLVVFDDPITLDNDMHSPPVGRAQGFY  60

Query  380  MYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATV  559
             YD KNT++AWLGF+FVLN+T+ +G+I F GADP++ K RDISVVGGTGDF M RG AT+
Sbjct  61   FYDMKNTFSAWLGFTFVLNSTEHRGTITFAGADPILTKYRDISVVGGTGDFLMARGFATI  120

Query  560  MTDAFEGEVYFRLR  601
             TDA+EG+VYFRLR
Sbjct  121  STDAYEGDVYFRLR  134



>ref|XP_006387569.1| hypothetical protein POPTR_0832s002001g, partial [Populus trichocarpa]
 gb|ERP46483.1| hypothetical protein POPTR_0832s002001g, partial [Populus trichocarpa]
Length=160

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAP-QWGNYTILATQFHFGNVVVFDDPIT  328
            KP +PCK+LVLY+HD ++NG + ANATS     P + GN       F FG +VVFDDP+T
Sbjct  8    KPKQPCKDLVLYYHDTLFNGTDVANATSAAATDPTKLGN-------FKFGMLVVFDDPMT  60

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
             DN+  S PV RAQG Y YD K+TYTAW  F+ + N+T  +G++N +GAD +  +TRD S
Sbjct  61   KDNHLLSRPVARAQGFYFYDKKSTYTAWFAFTLIFNSTKHKGTLNIMGADLMTEETRDFS  120

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VVGGTGDFFM RG+AT+ TD F+G+ YFRL++DIK YEC+
Sbjct  121  VVGGTGDFFMARGIATIHTDTFQGDYYFRLKMDIKLYECY  160



>ref|XP_011022579.1| PREDICTED: dirigent protein 5-like [Populus euphratica]
Length=195

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAP-QWGNYTILATQFHFGNVVVFDDPIT  328
            KP +PCK+LVLY+HD ++NG + ANATS     P + GN       F FG +VVFDDP+T
Sbjct  43   KPKQPCKDLVLYYHDTLFNGTDVANATSAAATDPTKLGN-------FKFGMLVVFDDPMT  95

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
             DN+  S PV RAQG Y YD K+TYTAW  F+ + N+T  +G++N +GAD +  +TRD S
Sbjct  96   KDNHLLSRPVARAQGFYFYDKKSTYTAWFAFTLIFNSTKHKGTLNIMGADLMTEETRDFS  155

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VVGGTGDFFM RG+AT+ TD F+G+ YFRL++DIK YEC+
Sbjct  156  VVGGTGDFFMARGIATIHTDTFQGDYYFRLKMDIKLYECY  195



>ref|XP_010541338.1| PREDICTED: dirigent protein 6 [Tarenaya hassleriana]
Length=185

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +2

Query  155  PYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            P KPCK  V Y+HD++Y+G N ANATS  IV  P  GN       F FG  VVFDDPIT+
Sbjct  34   PKKPCKRFVFYYHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVVFDDPITV  86

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N+ STPV RAQG Y YD K  Y +W  ++ V N+T+ +G++N +GAD +M KTRD+S+
Sbjct  87   DKNYLSTPVARAQGFYFYDMKTDYNSWFAYTLVFNSTEHRGTLNIMGADLMMEKTRDLSI  146

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+AT  TD F+G  YFR+++DIK YEC+
Sbjct  147  VGGTGDFFMARGIATFETDIFQGAKYFRVKMDIKLYECY  185



>gb|AFG50970.1| hypothetical protein 0_9449_02, partial [Pinus taeda]
Length=149

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + K  KPC N VLYFHD++YNG+NA NAT+ IV APQ  N T L    HFG++VVFDDPI
Sbjct  16   KGKHLKPCWNKVLYFHDILYNGKNAKNATAAIVAAPQGANLTTLTGNNHFGDLVVFDDPI  75

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG+Y+YD K T++AWLGF+FVLN+T+ +G+I F GADP++ K RDI
Sbjct  76   TLDNNLHSPPVGRAQGIYVYDMKTTFSAWLGFTFVLNSTEHRGTITFAGADPILTKYRDI  135

Query  506  SVVGGTGDFFMHRG  547
            SVVGGTGDF M RG
Sbjct  136  SVVGGTGDFVMARG  149



>gb|AFG50969.1| hypothetical protein 0_9449_02, partial [Pinus taeda]
 gb|AFG50971.1| hypothetical protein 0_9449_02, partial [Pinus taeda]
 gb|AFG50972.1| hypothetical protein 0_9449_02, partial [Pinus taeda]
 gb|AFG50973.1| hypothetical protein 0_9449_02, partial [Pinus taeda]
Length=149

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + K  KPC N VLYFHD++YNG+NA NAT+ IV APQ  N T L    HFG++VVFDDPI
Sbjct  16   KGKHLKPCWNKVLYFHDILYNGKNAKNATAAIVAAPQGANLTTLTGNNHFGDLVVFDDPI  75

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS PVGRAQG Y+YD K T++AWLGF+FVLN+T+ +G+I F GADP++ K RDI
Sbjct  76   TLDNNLHSPPVGRAQGFYVYDMKTTFSAWLGFTFVLNSTEHRGTITFAGADPILTKYRDI  135

Query  506  SVVGGTGDFFMHRG  547
            SVVGGTGDF M RG
Sbjct  136  SVVGGTGDFVMARG  149



>ref|XP_011073507.1| PREDICTED: dirigent protein 5-like [Sesamum indicum]
Length=182

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 118/167 (71%), Gaps = 8/167 (5%)
 Frame = +2

Query  128  STHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVV  307
            STH   +  P KPCK LVLY+HD+++NG + ANATS  +      N + L +  HFG +V
Sbjct  23   STHA-KKLSPDKPCKRLVLYYHDILFNGTDLANATSAKIT-----NDSALGS--HFGMMV  74

Query  308  VFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLM  487
            VFDDP+T D   HS PV RAQG Y YD K+ Y AW  ++ V N+++ +G++N +GADPL+
Sbjct  75   VFDDPVTADRRLHSPPVARAQGFYFYDKKDAYNAWFAYTLVFNSSEYKGTLNIMGADPLL  134

Query  488  NKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             KTRD+SVVGGTGDFFM RG+AT  TD  +G+ YFRL +DIK +EC+
Sbjct  135  EKTRDLSVVGGTGDFFMARGIATFRTDEAQGDYYFRLEMDIKLFECY  181



>gb|KFK28929.1| hypothetical protein AALP_AA7G066700 [Arabis alpina]
Length=186

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (71%), Gaps = 8/158 (5%)
 Frame = +2

Query  155  PYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            P KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FDDPIT+
Sbjct  36   PKKPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDDPITM  88

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N+ S P+ RAQG Y YD K+ + AW  ++ V N+TD +G++N +GAD +M  TRD+SV
Sbjct  89   DKNYLSKPLARAQGFYFYDMKSDFNAWFCYTLVFNSTDYKGTLNIMGADLMMEATRDLSV  148

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VGGTGDFFM RG+AT +TD F+G  YFR+++DIK YEC
Sbjct  149  VGGTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYEC  186



>ref|XP_004300845.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=185

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 8/166 (5%)
 Frame = +2

Query  140  MGRKKPYK---PCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVV  310
            +  K P+K   PCK LVLY+HD+++NG +A+NATS  V      N T LAT   FG +VV
Sbjct  25   LATKTPFKESKPCKRLVLYYHDILFNGTDASNATSAAVA-----NATGLATPHKFGMLVV  79

Query  311  FDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMN  490
            F+DP+T D++  S  VGRAQG Y YD K+ YTAW  ++ V N+++ +G++N +GAD + +
Sbjct  80   FNDPLTKDHHLLSPAVGRAQGFYFYDMKDEYTAWFAYTLVFNSSEHKGTLNIMGADLMYD  139

Query  491  KTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            KTRD+SVVGGTGDFFM RG+ T  TD F+G+ YFRL++DIK YEC+
Sbjct  140  KTRDLSVVGGTGDFFMARGICTFQTDTFQGDYYFRLKMDIKLYECY  185



>gb|AFG50974.1| hypothetical protein 0_9449_02, partial [Pinus taeda]
Length=149

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            + K  KPC N VLYFHD++YNG+NA NAT+ IV APQ  N T L    HFG++VVFDDPI
Sbjct  16   KGKHLKPCWNKVLYFHDILYNGKNAKNATAAIVAAPQGANLTTLTGNNHFGDLVVFDDPI  75

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            TLDNN HS  VGRAQG Y+YD K T++AWLGF+FVLN+T+ +G+I F GADP++ K RDI
Sbjct  76   TLDNNLHSPRVGRAQGFYVYDMKTTFSAWLGFTFVLNSTEHRGTITFAGADPILTKYRDI  135

Query  506  SVVGGTGDFFMHRG  547
            SVVGGTGDF M RG
Sbjct  136  SVVGGTGDFVMARG  149



>ref|XP_006391662.1| hypothetical protein EUTSA_v10024130mg [Eutrema salsugineum]
 gb|ESQ28948.1| hypothetical protein EUTSA_v10024130mg [Eutrema salsugineum]
Length=182

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 114/170 (67%), Gaps = 10/170 (6%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIV-GAPQWGNYTILATQFHFG  298
            +S+  P   K   KPCKN VLY+HD+++   +  NATS  V   P  GN       F FG
Sbjct  22   ISARKP--SKSQVKPCKNFVLYYHDIMFGVDDVQNATSAAVTNPPGLGN-------FKFG  72

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D N+ S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  73   KLVIFDDPVTIDRNYQSEPVARAQGFYFYDMKNDYNAWFSYTLVFNSTQHKGTLNIMGAD  132

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M KTRD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK YEC+
Sbjct  133  LMMEKTRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYECY  182



>ref|XP_009586870.1| PREDICTED: dirigent protein 5-like [Nicotiana tomentosiformis]
Length=180

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            KP KPCK  VLY+HD+++N  N ANATS  V  P       + + F+FG +VVFDDPIT+
Sbjct  28   KPEKPCKRFVLYYHDILFNVTNTANATSANVSNPPN-----VISDFNFGMLVVFDDPITV  82

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N  STPV RAQG Y+YD K TY AW  ++ V N+++  G+++ +GAD +  KTRD+S+
Sbjct  83   DQNLVSTPVARAQGFYLYDMKTTYNAWFAYTLVFNSSEYNGTLSIMGADIIGEKTRDLSI  142

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VGGTGDFFM RGV T  TDA EG  YFRL++DIK YEC
Sbjct  143  VGGTGDFFMARGVVTFSTDAVEGLGYFRLKMDIKLYEC  180



>emb|CDY25563.1| BnaC09g11880D [Brassica napus]
Length=182

 Score =   187 bits (474),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 114/170 (67%), Gaps = 10/170 (6%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIV-GAPQWGNYTILATQFHFG  298
            +S+  P   K   KPCKN VLY+HD+++   +  NATS  V   P  GN       F FG
Sbjct  22   ISARKP--SKSQSKPCKNFVLYYHDIMFGVDDVQNATSAAVTNPPGLGN-------FKFG  72

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D N+ S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  73   KLVIFDDPVTIDKNYQSEPVARAQGFYFYDMKNDYNAWFSYTLVFNSTQHKGTLNIMGAD  132

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M KTRD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  133  LMMEKTRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>emb|CDY34400.1| BnaA09g11420D [Brassica napus]
Length=182

 Score =   187 bits (474),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 114/170 (67%), Gaps = 10/170 (6%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIV-GAPQWGNYTILATQFHFG  298
            +S+  P   K   KPCKN VLY+HD+++   +  NATS  V   P  GN       F FG
Sbjct  22   ISARKP--SKSQSKPCKNFVLYYHDIMFGVDDVQNATSAAVTNPPGLGN-------FKFG  72

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D N+ S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  73   KLVIFDDPVTIDKNYQSEPVARAQGFYFYDMKNDYNAWFSYTLVFNSTQHKGTLNIMGAD  132

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M KTRD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  133  LMMEKTRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>gb|AAF25369.2|AF210073_1 dirigent-like protein [Fraxinus mandshurica]
 gb|AAF25370.2|AF210074_1 dirigent-like protein [Fraxinus mandshurica]
Length=123

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  170  KNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHS  349
            K LV YFHD+++ G N  NATS I+G+P+WGN T LA  ++FG++V FDDPITLDNN HS
Sbjct  1    KELVFYFHDILFKGDNYNNATSAIIGSPEWGNKTALAQPYNFGDLVAFDDPITLDNNLHS  60

Query  350  TPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGD  529
             PVGRAQGMY+YD K+ Y+AWLGF+F+ N+T   G++NF GADPLMNKTRD+SV+GGTGD
Sbjct  61   PPVGRAQGMYLYDQKSIYSAWLGFTFLFNSTKLVGTLNFAGADPLMNKTRDLSVIGGTGD  120

Query  530  FFM  538
            FFM
Sbjct  121  FFM  123



>ref|XP_006413528.1| hypothetical protein EUTSA_v10026947mg [Eutrema salsugineum]
 gb|ESQ54981.1| hypothetical protein EUTSA_v10026947mg [Eutrema salsugineum]
Length=187

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 10/171 (6%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHF  295
            +V ST  +  +K  KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F F
Sbjct  26   TVFSTRKVFDQK--KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKF  76

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G  V+FDDPIT+D N+ S PV RAQG Y YD K  + AW  ++ V N+T+ +G++N +GA
Sbjct  77   GKFVIFDDPITMDKNYLSEPVARAQGFYFYDMKMDFNAWFCYTLVFNSTEHKGTLNIMGA  136

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            D +M  TRD+SVVGGTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  137  DLMMEPTRDLSVVGGTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  187



>ref|XP_009112896.1| PREDICTED: dirigent protein 5 [Brassica rapa]
Length=182

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 114/170 (67%), Gaps = 10/170 (6%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIV-GAPQWGNYTILATQFHFG  298
            +S+  P   K   KPCKN VLY+HD+++   +  NATS  V   P  GN       F FG
Sbjct  22   ISARKP--SKSQSKPCKNFVLYYHDIMFGVDDVQNATSAAVTNPPGLGN-------FKFG  72

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D N+ S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  73   KLVIFDDPVTIDKNYQSEPVARAQGFYFYDMKNDYNAWFSYTLVFNSTQHKGTLNIMGAD  132

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M KTRD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  133  LMMEKTRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>ref|XP_006302880.1| hypothetical protein CARUB_v10021010mg [Capsella rubella]
 gb|EOA35778.1| hypothetical protein CARUB_v10021010mg [Capsella rubella]
Length=183

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 115/170 (68%), Gaps = 9/170 (5%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFG  298
            VSS     + +P KPCKN VLY+HD+++   +  NATS  I   P  GN       F FG
Sbjct  22   VSSARKPSKSQP-KPCKNFVLYYHDIMFGVDDVQNATSAAITNPPGLGN-------FKFG  73

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D NF S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  74   KLVIFDDPMTIDKNFKSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGAD  133

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M K+RD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  134  LMMVKSRDLSVVGGTGDFFMTRGIVTFETDTFEGAKYFRVKMDIKLYDCY  183



>ref|XP_010439143.1| PREDICTED: dirigent protein 6 [Camelina sativa]
Length=187

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FDDPIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDDPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKMDFNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  187



>ref|XP_010430535.1| PREDICTED: dirigent protein 5 [Camelina sativa]
Length=182

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 116/170 (68%), Gaps = 10/170 (6%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFG  298
            VS+  P  + +P KPCKN VLY+HD+++   +  NATS  I   P  GN       F FG
Sbjct  22   VSARKP-SKSQP-KPCKNFVLYYHDIMFGVDDVQNATSAAITSPPGLGN-------FKFG  72

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D NF S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  73   KLVIFDDPMTIDKNFKSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGAD  132

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M K+RD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  133  LMMVKSRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>ref|XP_010448670.1| PREDICTED: dirigent protein 6-like [Camelina sativa]
Length=187

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FDDPIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDDPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKMDFNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  187



>ref|XP_010433875.1| PREDICTED: dirigent protein 6-like [Camelina sativa]
Length=187

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FDDPIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDDPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKMDFNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  187



>ref|XP_006284582.1| hypothetical protein CARUB_v10005816mg [Capsella rubella]
 gb|ACC91257.1| disease resistance-responsive family protein [Capsella rubella]
 gb|EOA17480.1| hypothetical protein CARUB_v10005816mg [Capsella rubella]
Length=187

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FDDPIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDDPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKMDFNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY  187



>ref|NP_176598.1| dirigent-like protein DIR5 [Arabidopsis thaliana]
 sp|Q9SH66.1|DIR5_ARATH RecName: Full=Dirigent protein 5; Short=AtDIR5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF24580.1|AC007764_22 F22C12.8 [Arabidopsis thaliana]
 gb|AAQ65109.1| At1g64160 [Arabidopsis thaliana]
 dbj|BAD43018.1| putative dirigent protein [Arabidopsis thaliana]
 dbj|BAD44501.1| putative dirigent protein [Arabidopsis thaliana]
 gb|AEE34203.1| dirigent-like protein DIR5 [Arabidopsis thaliana]
Length=182

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 115/171 (67%), Gaps = 9/171 (5%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIV-GAPQWGNYTILATQFHF  295
            +V S     + +P KPCKN VLY+HD+++   +  NATS  V   P  GN       F F
Sbjct  20   TVISARKPSKSQP-KPCKNFVLYYHDIMFGVDDVQNATSAAVTNPPGLGN-------FKF  71

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G +V+FDDP+T+D NF S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GA
Sbjct  72   GKLVIFDDPMTIDKNFQSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGA  131

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            D +M ++RD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK YEC+
Sbjct  132  DLMMVQSRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYECY  182



>ref|XP_009137381.1| PREDICTED: dirigent protein 6 [Brassica rapa]
Length=187

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + +W  F+ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKTDFNSWFSFTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDLFQGARYFRVKMDIKLYECY  187



>gb|ABV89607.1| disease resistance response protein [Brassica rapa]
 emb|CDY67926.1| BnaA03g58750D [Brassica napus]
Length=187

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + +W  F+ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKTDFNSWFSFTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDLFQGARYFRVKMDIKLYECY  187



>ref|XP_010473670.1| PREDICTED: dirigent protein 5 [Camelina sativa]
Length=182

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 115/171 (67%), Gaps = 9/171 (5%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHF  295
            +V S     + +P KPCKN VLY+HD+++   +  NATS  I   P  GN       F F
Sbjct  20   TVVSARKPSKSQP-KPCKNFVLYYHDIMFGVDDVQNATSAAITNPPGLGN-------FKF  71

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G +V+FDDP+T+D NF S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GA
Sbjct  72   GKLVIFDDPMTIDKNFKSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGA  131

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            D +M K+RD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  132  DLMMVKSRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>emb|CDY03531.1| BnaC01g15510D [Brassica napus]
Length=186

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  37   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  89

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S P+ RAQG Y YD K  Y AW  ++ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  90   NYLSEPLARAQGFYFYDMKTDYNAWFCYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  149

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  150  GTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  186



>ref|XP_002867693.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH43952.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=187

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 111/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  155  PYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            P KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FDDPIT 
Sbjct  36   PKKPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDDPITT  88

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N+ S P+ RAQG Y YD K  + AW  ++ V N+++ +G++N +GAD +M  TRD+SV
Sbjct  89   DKNYLSKPLARAQGFYFYDMKMDFNAWFCYTLVFNSSEYKGTLNIMGADLMMEPTRDLSV  148

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  149  VGGTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  187



>emb|CDX94207.1| BnaC07g38410D [Brassica napus]
Length=187

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + +W  ++ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPVARAQGFYFYDMKTDFNSWFSYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDLFQGARYFRVKMDIKLYECY  187



>ref|XP_009137314.1| PREDICTED: dirigent protein 6-like [Brassica rapa]
 emb|CDY68371.1| BnaAnng27090D [Brassica napus]
Length=186

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  37   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  89

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S P+ RAQG Y YD K  Y AW  ++ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  90   NYLSEPLARAQGFYFYDMKTDYNAWFCYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  149

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  150  GTGDFFMARGIATFVTDIFQGAKYFRVKMDIKLYECY  186



>ref|XP_010533614.1| PREDICTED: dirigent protein 5 [Tarenaya hassleriana]
Length=182

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 110/159 (69%), Gaps = 8/159 (5%)
 Frame = +2

Query  155  PYKPCKNLVLYFHDVIYNGQNAANATSTIV-GAPQWGNYTILATQFHFGNVVVFDDPITL  331
            P KPCK  VLY+HD+++   +  NATS  V   P  GN       F FG +V+FDDP+T+
Sbjct  31   PPKPCKRFVLYYHDIMFGVDDVQNATSAAVTNPPGLGN-------FKFGKLVIFDDPMTM  83

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N+ S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD +M KTRD+SV
Sbjct  84   DRNYMSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGADLMMEKTRDLSV  143

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+AT  TD F+G  YFR+++DIK YEC+
Sbjct  144  VGGTGDFFMTRGIATFETDEFQGAKYFRVKMDIKLYECY  182



>ref|XP_010418469.1| PREDICTED: dirigent protein 5-like [Camelina sativa]
Length=182

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 115/170 (68%), Gaps = 10/170 (6%)
 Frame = +2

Query  122  VSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFG  298
            VS   P  + +P KPCKN VLY+HD+++   +  NATS  I   P  GN       F FG
Sbjct  22   VSGRKP-SKSQP-KPCKNFVLYYHDIMFGVDDVQNATSAAITSPPGLGN-------FKFG  72

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +V+FDDP+T+D NF S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GAD
Sbjct  73   KLVIFDDPMTIDKNFKSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGAD  132

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +M K+RD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  133  LMMVKSRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>ref|XP_002887917.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64176.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=182

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 115/171 (67%), Gaps = 9/171 (5%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHF  295
            +V S     + +P KPCKN VLY+HD+++   +  NATS  I   P  GN       F F
Sbjct  20   TVISARKPSKSQP-KPCKNFVLYYHDIMFGVDDVQNATSAAITNPPGLGN-------FKF  71

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G +V+FDDP+T+D NF S PV RAQG Y YD KN Y AW  ++ V N+T  +G++N +GA
Sbjct  72   GKLVIFDDPMTIDKNFQSEPVARAQGFYFYDMKNDYNAWFAYTLVFNSTQHKGTLNIMGA  131

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            D +M ++RD+SVVGGTGDFFM RG+ T  TD FEG  YFR+++DIK Y+C+
Sbjct  132  DLMMVQSRDLSVVGGTGDFFMSRGIVTFETDTFEGAKYFRVKMDIKLYDCY  182



>ref|XP_007210844.1| hypothetical protein PRUPE_ppa016381mg [Prunus persica]
 gb|EMJ12043.1| hypothetical protein PRUPE_ppa016381mg [Prunus persica]
Length=184

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 120/170 (71%), Gaps = 5/170 (3%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            SVS+T    + +  KPCK +VLY+HD +++G     A +T V A    N + L+   +FG
Sbjct  20   SVSATRA-SKFQAEKPCKRMVLYYHDKLFDGTEKDKANATSVTA---ANASKLSDT-NFG  74

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +VVF+DPIT+D+ FHS PV RAQG Y YD K+TYTAW  ++ V N+++ +G++N +GAD
Sbjct  75   MLVVFNDPITIDDKFHSPPVARAQGFYFYDRKDTYTAWFAYTLVFNSSEHKGTLNIMGAD  134

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +  KTRD+SVVGGTGDFFM RG+AT  TD  +G  YFRL++DIK YEC+
Sbjct  135  LMTEKTRDLSVVGGTGDFFMARGIATFQTDTLQGLYYFRLKMDIKLYECY  184



>ref|NP_194100.1| dirigent protein 6 [Arabidopsis thaliana]
 sp|Q9SUQ8.1|DIR6_ARATH RecName: Full=Dirigent protein 6; Short=AtDIR6; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA23035.1| putative disease resistance response protein [Arabidopsis thaliana]
 emb|CAB79324.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AAM65959.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AAO00799.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AEE84795.1| dirigent protein 6 [Arabidopsis thaliana]
Length=187

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG Y YD K  + +W  ++ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSKPVARAQGFYFYDMKMDFNSWFSYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY  187



>gb|AAF25371.2|AF210075_1 dirigent-like protein [Populus tremuloides]
 gb|AAF25372.2|AF210076_1 dirigent-like protein [Populus tremuloides]
Length=123

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  170  KNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHS  349
            K LV YFHD+IYNG+NA NATS IVG+P WGN T LAT   FG+VV+FDDPITLD++  S
Sbjct  1    KELVFYFHDIIYNGKNARNATSAIVGSPAWGNKTNLATPNRFGDVVIFDDPITLDSDLRS  60

Query  350  TPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGD  529
            TP+GRAQG+Y+YD K   TAW GFSFV N+T  +G+INF GAD +M  TRD+SVVGGTGD
Sbjct  61   TPIGRAQGLYLYDKKEILTAWFGFSFVFNSTQLKGTINFAGADDIMKTTRDLSVVGGTGD  120

Query  530  FFM  538
            FFM
Sbjct  121  FFM  123



>ref|XP_011026950.1| PREDICTED: dirigent protein 5-like [Populus euphratica]
Length=179

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 125/172 (73%), Gaps = 8/172 (5%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAP-QWGNYTILATQFH  292
            IS+S +      KP +PCK++VLY+HD+++NG +AANATS       + GN       F+
Sbjct  15   ISLSVSSAKNSFKPKEPCKHIVLYYHDILFNGTDAANATSAAATNATKLGN-------FN  67

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG +VVFDDP+T DN+  S PV RAQG Y YD K+TYTAW  ++ + N+T+ +G++N +G
Sbjct  68   FGMLVVFDDPMTKDNHLLSRPVARAQGFYFYDMKSTYTAWFAYTLIFNSTEYKGTLNIMG  127

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            AD +M +TRD SVVGGTGDFFM RG+AT+ TD F+G+ YFRL++DIK YEC+
Sbjct  128  ADLMMMETRDFSVVGGTGDFFMARGIATIHTDTFQGDYYFRLKMDIKLYECY  179



>gb|ACC91237.1| putative disease resistance protein [Arabidopsis halleri]
Length=187

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S P+ RAQG Y YD K  + AW  ++ V N+T+ +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSKPLARAQGFYFYDMKMDFNAWFCYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT +TD F+G  YFR+++DIK YEC+
Sbjct  151  GTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY  187



>ref|XP_010055810.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
Length=183

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = +2

Query  164  PCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            PCK  VLY+HD++++G + ANATS TI    + G+       F FG +VVFDDP+T DN+
Sbjct  35   PCKRFVLYYHDILFDGSDVANATSATIANETKLGD-------FKFGKLVVFDDPMTKDNH  87

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
             HS  V RAQG Y YD K+ Y +W  ++ V N+T+ +G++N +GAD +  +TRD S+VGG
Sbjct  88   LHSPAVARAQGFYFYDMKSDYNSWFAYTLVFNSTEQKGTLNIMGADIMAAQTRDFSIVGG  147

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDFFM RG+AT+ TD F+G  YFRL++DIK YEC+
Sbjct  148  TGDFFMARGIATIETDTFQGAKYFRLKMDIKLYECY  183



>ref|XP_010041232.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
 gb|KCW44515.1| hypothetical protein EUGRSUZ_L01975 [Eucalyptus grandis]
Length=180

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  +PCK +VLY+HD+++ G + ANATS      +  N T L  +F  G +VVFDDPIT 
Sbjct  28   KENEPCKRVVLYYHDILFGGNDTANATS-----ARATNGTGLG-KFVLGMLVVFDDPITK  81

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D + HSTPV RAQG Y YD K TY AW  ++ V N+T+ +G++N +GAD +M KTRD+SV
Sbjct  82   DQHLHSTPVARAQGFYFYDMKTTYNAWFTYTLVFNSTEYKGTMNIMGADMMMEKTRDLSV  141

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VGGTGDFFM RG+AT  TD  EG  YFRL++DIK YEC
Sbjct  142  VGGTGDFFMARGIATFQTDEVEGFKYFRLKMDIKLYEC  179



>gb|KCW72360.1| hypothetical protein EUGRSUZ_E00815, partial [Eucalyptus grandis]
Length=151

 Score =   181 bits (458),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = +2

Query  164  PCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            PCK  VLY+HD++++G + ANATS TI    + G+       F FG +VVFDDP+T DN+
Sbjct  3    PCKRFVLYYHDILFDGSDVANATSATIANETKLGD-------FKFGKLVVFDDPMTKDNH  55

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
             HS  V RAQG Y YD K+ Y +W  ++ V N+T+ +G++N +GAD +  +TRD S+VGG
Sbjct  56   LHSPAVARAQGFYFYDMKSDYNSWFAYTLVFNSTEQKGTLNIMGADIMAAQTRDFSIVGG  115

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDFFM RG+AT+ TD F+G  YFRL++DIK YEC+
Sbjct  116  TGDFFMARGIATIETDTFQGAKYFRLKMDIKLYECY  151



>emb|CDY24804.1| BnaA08g15060D [Brassica napus]
Length=186

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 108/156 (69%), Gaps = 8/156 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S P+ RAQG Y YD K  Y AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPLARAQGFYFYDMKMDYNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            GTGDFFM RG+AT +TD F+G  YFR+++D+K YEC
Sbjct  151  GTGDFFMARGIATFVTDIFQGAKYFRVKMDVKLYEC  186



>ref|XP_006368774.1| hypothetical protein POPTR_0001s10160g [Populus trichocarpa]
 gb|ERP65343.1| hypothetical protein POPTR_0001s10160g [Populus trichocarpa]
Length=181

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 123/172 (72%), Gaps = 8/172 (5%)
 Frame = +2

Query  116  ISVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAP-QWGNYTILATQFH  292
            IS+S +      KP +PCK++VLY+HD ++NG +AANATS       + GN       F+
Sbjct  17   ISLSVSSAKNSFKPEEPCKHIVLYYHDTLFNGTDAANATSAAATNATKLGN-------FN  69

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG +VVFDDP+T DN+  S PV RAQG Y YD K+TYTAW  ++ + N+T+ +G++N +G
Sbjct  70   FGMLVVFDDPMTKDNHLLSRPVARAQGFYFYDMKSTYTAWFAYTLIFNSTEHKGTLNIMG  129

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            AD +M +TRD SVVGGTGDFFM RG+AT+ TD F+G  YFRL++DIK YEC+
Sbjct  130  ADLMMMETRDFSVVGGTGDFFMARGIATIRTDTFQGAYYFRLKMDIKLYECY  181



>ref|XP_002463249.1| hypothetical protein SORBIDRAFT_02g040570 [Sorghum bicolor]
 gb|EER99770.1| hypothetical protein SORBIDRAFT_02g040570 [Sorghum bicolor]
Length=198

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 111/167 (66%), Gaps = 5/167 (3%)
 Frame = +2

Query  143  GRKKPY-----KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVV  307
            GRKK       +PC  + +Y HD++Y+G N ANATS +   P   + ++      FG VV
Sbjct  31   GRKKLVSSSDGEPCHKMTVYCHDILYDGTNTANATSAVAAQPTLLSRSVSVNDTFFGEVV  90

Query  308  VFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLM  487
            VF+D +T      S PV RA+G Y YD K + +AW  FS V N+T  +G++N +GAD + 
Sbjct  91   VFNDVVTAGRALASEPVARAEGFYFYDKKESLSAWFAFSLVFNSTAHRGTLNLMGADIIA  150

Query  488  NKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +KTRDISVVGGTGDFFM RGVAT+ TDAFEG  YFRL++DIK YEC+
Sbjct  151  DKTRDISVVGGTGDFFMARGVATLRTDAFEGLNYFRLQMDIKLYECY  197



>emb|CDY35446.1| BnaC03g62140D [Brassica napus]
Length=185

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 8/156 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  37   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  89

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S P+ RAQG Y YD K  + AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  90   NYLSEPLARAQGFYFYDMKMDFNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  149

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            GTGDFFM RG+AT +TD F+G  YFR+++D+K YEC
Sbjct  150  GTGDFFMARGIATFVTDIFQGAKYFRVKMDVKLYEC  185



>ref|XP_009109298.1| PREDICTED: dirigent protein 6-like [Brassica rapa]
Length=186

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 8/156 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+   YFHD++Y+G N ANATS  IV  P  GN       F FG  V+FD PIT+D 
Sbjct  38   KPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGN-------FKFGKFVIFDGPITMDK  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S P+ RAQG Y YD K  + AW  ++ V N+T  +G++N +GAD +M  TRD+SVVG
Sbjct  91   NYLSEPLARAQGFYFYDMKMDFNAWFCYTLVFNSTQHKGTLNIMGADLMMEPTRDLSVVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            GTGDFFM RG+AT +TD F+G  YFR+++D+K YEC
Sbjct  151  GTGDFFMARGIATFVTDIFQGAKYFRVKMDVKLYEC  186



>ref|XP_010925804.1| PREDICTED: dirigent protein 5-like [Elaeis guineensis]
Length=188

 Score =   179 bits (455),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK LVLY+HD+++NG N +NATS  V      N T L   + FG  VVFDDP+T D++
Sbjct  38   KPCKRLVLYYHDILFNGTNVSNATSAAVA-----NQTALG-DYKFGMFVVFDDPMTEDHH  91

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTD-SQGSINFIGADPLMNKTRDISVVG  517
              S PV RAQG Y YD K  Y AW  ++ V N+T+  QG+IN +GAD +  +TRD+SVVG
Sbjct  92   LLSKPVARAQGFYFYDMKKEYNAWFAYTLVFNSTEYGQGTINIMGADLMGQETRDLSVVG  151

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT  TD F+G+ YFRL +DIK +EC+
Sbjct  152  GTGDFFMARGIATFRTDTFQGDAYFRLEMDIKLFECY  188



>ref|XP_010053186.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
Length=176

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 9/174 (5%)
 Frame = +2

Query  116  ISVSS---THPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ  286
            IS+SS    H        +PCK +V Y+HD+++ G + ANATS      +  N T L  +
Sbjct  9    ISLSSCTVAHQQNSISRNEPCKRVVFYYHDILFGGNDTANATS-----ARATNGTGLG-K  62

Query  287  FHFGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINF  466
            F  G +VVFDDPIT D + HSTPV RAQG Y +D K TY AW  ++ V N+T+ +G+IN 
Sbjct  63   FVLGMLVVFDDPITKDQHLHSTPVARAQGFYFHDMKTTYNAWFAYTLVFNSTEYKGTINI  122

Query  467  IGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +GA  +M KTRD+SVVGGTGDFFM RG+AT  TD  EG  YFRL++DIK YEC+
Sbjct  123  MGAGMMMEKTRDLSVVGGTGDFFMARGIATFQTDEVEGFKYFRLKMDIKLYECY  176



>gb|KCW77449.1| hypothetical protein EUGRSUZ_D01787 [Eucalyptus grandis]
Length=180

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 6/159 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  +PCK +V Y+HD+++ G + ANATS      +  N T L  +F  G +VVFDDPIT 
Sbjct  28   KENEPCKRVVFYYHDILFGGNDTANATS-----ARATNGTGLG-KFVLGMLVVFDDPITK  81

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D + HSTPV RAQG Y +D K TY AW  ++ V N+T+ +G+IN +GA  +M KTRD+SV
Sbjct  82   DQHLHSTPVARAQGFYFHDMKTTYNAWFAYTLVFNSTEYKGTINIMGAGMMMEKTRDLSV  141

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+AT  TD  EG  YFRL++DIK YEC+
Sbjct  142  VGGTGDFFMARGIATFQTDEVEGFKYFRLKMDIKLYECY  180



>gb|KDP25353.1| hypothetical protein JCGZ_20509 [Jatropha curcas]
Length=182

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 113/160 (71%), Gaps = 8/160 (5%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPIT  328
            K  +PC+  VLY+HD++++G++ AN+TS  I  A + G+Y        FG ++VFDDP+T
Sbjct  29   KHKEPCQRFVLYYHDILFDGKDVANSTSARITNATKLGDYI-------FGMMIVFDDPVT  81

Query  329  LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
            LD N  S PVGRAQG Y YD K  Y AW+  + V N+T+ +G++N +GAD +  +TRD+ 
Sbjct  82   LDKNLLSPPVGRAQGFYFYDKKTDYNAWMSLTLVFNSTEHRGTLNIMGADFMNEETRDLP  141

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +VGGTGDFFM RG+AT  TDA EG  YFRL++DIK YEC+
Sbjct  142  IVGGTGDFFMSRGIATFHTDATEGIKYFRLKMDIKLYECY  181



>ref|XP_010055809.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
 gb|KCW72359.1| hypothetical protein EUGRSUZ_E00814 [Eucalyptus grandis]
Length=186

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            +PCK  VLYFHD+++ G + ANATS  V      N T L   F FG + VFDDP+T D N
Sbjct  37   QPCKRFVLYFHDILFGGNDVANATSAAVA-----NETGLG-NFKFGKLFVFDDPMTKDKN  90

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S  V RAQG Y YD KN Y AW  +S V N+T+ +G++N +GAD +  +TRD+S+VGG
Sbjct  91   YLSPAVARAQGFYFYDMKNDYNAWFAYSLVFNSTEHKGTLNIMGADIMAAQTRDLSIVGG  150

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDFFM RG+AT  TD F+G  YFR+++DIK YEC+
Sbjct  151  TGDFFMARGIATFETDLFQGAKYFRIKMDIKLYECY  186



>ref|XP_010055807.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
 gb|KCW72358.1| hypothetical protein EUGRSUZ_E00813 [Eucalyptus grandis]
Length=187

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            +PCK  VLYFHD+++ G + ANATS  V      N T L   F FG + VFDDP+T D N
Sbjct  38   QPCKRFVLYFHDILFGGNDVANATSAAVA-----NETGLG-NFKFGKLFVFDDPMTKDKN  91

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S  V RAQG Y YD K+ Y AW  ++ V N+T  +G++N +GAD +  +TRD+S+VGG
Sbjct  92   YPSPAVARAQGFYFYDMKSDYNAWFAYTLVFNSTKLKGTLNIMGADIMAAQTRDLSIVGG  151

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDFFM RG+AT MTD F+G  YFR+++DIK YEC+
Sbjct  152  TGDFFMARGIATFMTDTFQGAKYFRVKMDIKLYECY  187



>ref|XP_008239094.1| PREDICTED: dirigent protein 5-like [Prunus mume]
Length=184

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 117/170 (69%), Gaps = 5/170 (3%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            SVS+T    + +  KPCK +VLY+HD +++G     A +T   A          +  +FG
Sbjct  20   SVSATRA-SKFQAEKPCKRMVLYYHDKLFDGTEKDKANATSATAANASK----LSDTNFG  74

Query  299  NVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGAD  478
             +VVF+DPIT+D+ FHS PV RAQG Y YD K+TYTAW  ++ V N+++ +G++N +GAD
Sbjct  75   MLVVFNDPITIDDKFHSPPVARAQGFYFYDRKDTYTAWFAYTLVFNSSEHKGTLNIMGAD  134

Query  479  PLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +  KTRD+SVVGGTGDFFM RG+AT  TD F+G  YFRL++DIK YEC+
Sbjct  135  LMTEKTRDLSVVGGTGDFFMARGIATFQTDTFQGLYYFRLKMDIKLYECY  184



>ref|XP_009136269.1| PREDICTED: dirigent protein 6-like [Brassica rapa]
Length=188

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNG-QNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLD  334
            KPCK    Y+HD+IY+G  NAANATS  IV  P  GN       F FG +V+FDDPIT+D
Sbjct  38   KPCKQFSFYYHDIIYDGADNAANATSAAIVNPPGLGN-------FKFGKLVIFDDPITMD  90

Query  335  NNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVV  514
             N+ S  V RAQG Y YD K    AW+  + V N+T+ +G++N +GAD +   TRDI VV
Sbjct  91   TNYLSEYVARAQGFYFYDKKLGVNAWICLTLVFNSTEHKGTLNIMGADLMREPTRDIPVV  150

Query  515  GGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GGTGDFFM RG+ATV TDA EG  YFRL++DIK YEC+
Sbjct  151  GGTGDFFMARGIATVETDATEGLRYFRLKMDIKLYECY  188



>ref|XP_006658012.1| PREDICTED: dirigent protein 5-like [Oryza brachyantha]
Length=208

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 111/161 (69%), Gaps = 6/161 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNA-ANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT---  328
            +PCK + LY HD++Y+  N+ AN+T+  V  P   +  +  + + FG VVVF+DP+T   
Sbjct  48   EPCKKMRLYLHDILYDYSNSTANSTAAAVTKPTALSTAVSKSGYFFGRVVVFNDPVTEGK  107

Query  329  -LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
             L      T V RAQG+Y+YD K  YTAWL FS V N+T  +G++N IGADPL  KTRDI
Sbjct  108  ALPPALEETAV-RAQGLYLYDNKEDYTAWLAFSVVFNSTAHRGTLNLIGADPLAEKTRDI  166

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDFFM RGVAT+ TDA EG  YFRL++DI  YEC+
Sbjct  167  SVVGGTGDFFMARGVATIRTDAIEGFKYFRLQMDINLYECY  207



>ref|XP_010055806.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
 gb|KCW72357.1| hypothetical protein EUGRSUZ_E00812 [Eucalyptus grandis]
Length=185

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            +PCK  VLYFHD+++ G + AN+TS  V      N T L   F+FG + VFDDP+T D N
Sbjct  36   QPCKRFVLYFHDILFGGNDVANSTSAAVA-----NETGLG-NFNFGKLFVFDDPMTKDKN  89

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S  V RAQG Y YD K+ Y AW  ++ V N+T+ +G++N +GAD +  +TRD+S+VGG
Sbjct  90   YLSPAVARAQGFYFYDMKSAYNAWFAYTLVFNSTEHKGTLNIMGADIMAAQTRDLSIVGG  149

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDFFM RG+ T  TD F+G  YFRL++DIK YEC+
Sbjct  150  TGDFFMARGITTFETDTFQGAKYFRLKMDIKLYECY  185



>emb|CDX89657.1| BnaC03g45710D [Brassica napus]
Length=188

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNG-QNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLD  334
            KPCK    Y+HD+IY+G  NAANATS  IV  P  GN       F FG +V+FDDPIT+D
Sbjct  38   KPCKQFSFYYHDIIYDGGDNAANATSAAIVNPPGLGN-------FKFGKLVIFDDPITMD  90

Query  335  NNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVV  514
             N+ S  V RAQG Y YD K    AW+  + V N+T+  G++N +GAD +   TRDI VV
Sbjct  91   RNYLSEYVARAQGFYFYDKKLGVNAWICLTLVFNSTEHNGTLNIMGADLMREPTRDIPVV  150

Query  515  GGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GGTGDFFM RG+ATV TDA EG  YFRL++DIK YEC+
Sbjct  151  GGTGDFFMARGIATVETDATEGLRYFRLKMDIKLYECY  188



>ref|XP_009128680.1| PREDICTED: dirigent protein 6-like [Brassica rapa]
 emb|CDY25277.1| BnaA02g21790D [Brassica napus]
Length=187

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+ VL  H++ Y+G NA NATS TIV     GN       F+FG  VVFD+P+T+D 
Sbjct  38   KPCKHFVLRLHNIAYDGDNADNATSATIVNPIGLGN-------FNFGKFVVFDNPVTMDE  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG + Y+ K TY  W+ F+ + N+T  +G++  I A+P+M  TRD+S+VG
Sbjct  91   NYLSEPVARAQGFFFYNKKTTYNTWVTFTLLFNSTQHKGTMTIIDANPMMEPTRDLSIVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDF M RGV T+ TD FEG  YFR+++DIK YEC+
Sbjct  151  GTGDFLMTRGVVTLTTDTFEGSKYFRIKLDIKLYECY  187



>gb|AAY45735.1| putative dirigent protein 7.5 [Quercus suber]
Length=95

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLM  487
            VFDDPITLDNN HS PVGRAQG+Y+YDTKNT+T+WLGF+FVLN+TD QG+INF GADP+M
Sbjct  1    VFDDPITLDNNLHSKPVGRAQGLYIYDTKNTFTSWLGFTFVLNSTDHQGTINFSGADPIM  60

Query  488  NKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYF  592
             K+RDIS+VGGTGDFFMHRG+AT+MTD+FEG+VYF
Sbjct  61   VKSRDISIVGGTGDFFMHRGIATIMTDSFEGDVYF  95



>emb|CDX93160.1| BnaA03g38820D [Brassica napus]
Length=188

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNG-QNAANATST-IVGAPQWGNYTILATQFHFGNVVVFDDPITLD  334
            KPCK    Y+HD+IY+G  NAANATS  IV  P  GN       F FG +V+FDDPIT+D
Sbjct  38   KPCKQFSFYYHDIIYDGADNAANATSAAIVNPPGLGN-------FKFGKLVIFDDPITMD  90

Query  335  NNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVV  514
             N+ S  V RAQG Y YD K    AW+  + V N+T+ +G++N +GAD +   TRDI VV
Sbjct  91   TNYLSEYVARAQGFYFYDKKLGVNAWICLTLVFNSTEHKGTLNIMGADLMREPTRDIPVV  150

Query  515  GGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GGTGDFFM RG+A V TDA EG  YFRL++DIK YEC+
Sbjct  151  GGTGDFFMARGIAIVETDATEGLRYFRLKMDIKLYECY  188



>ref|XP_010273520.1| PREDICTED: dirigent protein 5-like [Nelumbo nucifera]
Length=178

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 8/161 (5%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPI  325
            +K+P +PCK LVLY+H V+++G N ANATS IV      N T L   F+FG  VVFDDP+
Sbjct  26   KKRP-EPCKRLVLYYH-VLFDGTNEANATSAIVS-----NITKLG-DFNFGQFVVFDDPM  77

Query  326  TLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
            T D++  S PV RAQG Y Y+ K TY A   +  + N++D +G++N +GAD +  + RDI
Sbjct  78   TDDHHLLSPPVARAQGFYFYNMKTTYNAGFAYKLIFNSSDYKGTLNLMGADIIAQEARDI  137

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDFFM RG+ T+ TD F+G  YFRL++DIK YEC+
Sbjct  138  SVVGGTGDFFMARGICTLRTDTFQGNAYFRLQMDIKLYECY  178



>ref|XP_004300844.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (67%), Gaps = 12/172 (7%)
 Frame = +2

Query  119  SVSST-HPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATST-IVGAPQWGNYTILATQFH  292
            SVS+T H +   K  KPCK  VLY+HD ++NG +  NATS     A   GNY        
Sbjct  20   SVSATKHSI---KESKPCKRFVLYYHDTLFNGTDVNNATSARAANATGLGNY-------K  69

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG +VVF+DP+T D++  S  +GRAQG Y YD K+ YTAW  ++ V N++  +G++N +G
Sbjct  70   FGMLVVFNDPLTKDHHLLSPAIGRAQGFYFYDMKDDYTAWFAYTLVFNSSQHKGTLNIMG  129

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            AD +  +TRD+SVVGGTGDFFM RG+ T  TD F+G  YFRL++DIK YEC+
Sbjct  130  ADLMYAETRDLSVVGGTGDFFMARGICTFKTDTFQGANYFRLQMDIKLYECY  181



>ref|XP_010041233.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
Length=193

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 107/158 (68%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  +P K +VLY+HD+++ G   ANATS  V  P   +      QF  G +VVFDD +T 
Sbjct  41   KKSEPRKRIVLYYHDILFRGNYTANATSAEVTKPTGLD------QFMQGLMVVFDDLVTK  94

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D + HSTP  RA+G+Y Y+TK  Y+ W  ++ V N+T+  G+IN +GAD LM KTRD+S+
Sbjct  95   DQHLHSTPAARAEGLYFYNTKTAYSVWFSYTLVFNSTEYNGTINIMGADMLMEKTRDLSI  154

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VGGTGDFF+ RG+ T  T+A EG  YFRL++DIK YEC
Sbjct  155  VGGTGDFFIARGIMTFQTEAIEGFKYFRLKMDIKLYEC  192



>gb|KCW44516.1| hypothetical protein EUGRSUZ_L01976 [Eucalyptus grandis]
Length=181

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 107/158 (68%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  +P K +VLY+HD+++ G   ANATS  V  P   +      QF  G +VVFDD +T 
Sbjct  29   KKSEPRKRIVLYYHDILFRGNYTANATSAEVTKPTGLD------QFMQGLMVVFDDLVTK  82

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D + HSTP  RA+G+Y Y+TK  Y+ W  ++ V N+T+  G+IN +GAD LM KTRD+S+
Sbjct  83   DQHLHSTPAARAEGLYFYNTKTAYSVWFSYTLVFNSTEYNGTINIMGADMLMEKTRDLSI  142

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VGGTGDFF+ RG+ T  T+A EG  YFRL++DIK YEC
Sbjct  143  VGGTGDFFIARGIMTFQTEAIEGFKYFRLKMDIKLYEC  180



>ref|XP_004958454.1| PREDICTED: disease resistance response protein 206-like [Setaria 
italica]
Length=201

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 107/164 (65%), Gaps = 14/164 (9%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQN-AANATSTIVGAPQ-------WGNYTILATQFHFGNVVVFD  316
            KPCK + +Y+HD++YNG N  ANATS  V  P        W N T       FG +VVFD
Sbjct  42   KPCKKMTVYYHDILYNGSNNTANATSAAVTKPSAALSRSNWSNGTF------FGMLVVFD  95

Query  317  DPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKT  496
            D +T +    S PV RAQG Y+YD K  Y  W+ F+ V ++   +G++N +GAD +  +T
Sbjct  96   DLVTEEQALTSEPVARAQGFYLYDKKEAYNVWIAFTLVFDSKAYKGTLNLMGADLMAEET  155

Query  497  RDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RD+SVVGGTGDFFM RGVAT+ T+A EG  YFRL++DIK YEC+
Sbjct  156  RDLSVVGGTGDFFMSRGVATLSTNATEGYFYFRLKMDIKLYECY  199



>gb|EMT21148.1| hypothetical protein F775_05542 [Aegilops tauschii]
Length=201

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 113/177 (64%), Gaps = 7/177 (4%)
 Frame = +2

Query  119  SVSSTHPMGR---KKPYKPCKNLVLYFHDVIYNG-QNAANATSTIVGAPQWGNYTILATQ  286
            S ++ H + R       +PC  + LY+HD++YNG  N  NATS     P   + T     
Sbjct  24   SAAAAHGLRRVVSSSSDEPCNEMTLYYHDILYNGVNNTRNATSAAATKPTALSTTHWKNG  83

Query  287  FHFGNVVVFDDPITLDNNF---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGS  457
             +FG +VVFDDP+T+          P  RAQG Y YD + +YT+W GFS V N+T  +G+
Sbjct  84   TYFGMLVVFDDPLTVGKALPVAGEEPAARAQGFYFYDKQESYTSWFGFSIVFNSTAHKGT  143

Query  458  INFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +N +GAD + +KTRD+SVVGGTGDFFM RG+AT+  DA EG VYFRL++DIK YEC+
Sbjct  144  MNLVGADLMDDKTRDLSVVGGTGDFFMARGIATLRLDASEGAVYFRLQMDIKLYECY  200



>ref|XP_006396936.1| hypothetical protein EUTSA_v10028996mg [Eutrema salsugineum]
 gb|ESQ38389.1| hypothetical protein EUTSA_v10028996mg [Eutrema salsugineum]
Length=187

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK  VL+FH++ Y+G NA NATS TIV     G+       F FG  V++D+P+T+D 
Sbjct  38   KPCKRFVLHFHNIAYDGDNADNATSATIVNPLGLGD-------FSFGKFVIYDNPLTMDE  90

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG + Y+ K TY +W   + + N+T  +G++  I A+P M  TRD+S+VG
Sbjct  91   NYLSEPVARAQGFFFYNKKTTYNSWFASTLIFNSTQHKGTLTLIDANPFMEPTRDLSIVG  150

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDF M RGV T  TD FEG  YFR+++DIK YEC+
Sbjct  151  GTGDFIMSRGVVTFTTDFFEGSKYFRIKMDIKLYECY  187



>gb|EMT02295.1| hypothetical protein F775_18233 [Aegilops tauschii]
Length=199

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = +2

Query  155  PYKPCKNLVLYFHDVIYNG-QNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            P +PCK + LY HD++YNG  N+ANAT+     P   + T  +    FG +VVFDDP+T 
Sbjct  37   PDEPCKKMTLYLHDILYNGVNNSANATAAPATKPTDLSTTHWSNGTFFGMLVVFDDPVTE  96

Query  332  DNNF---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
                      P  RAQG Y YD K +Y+ W  FS V N+   +G++N +GADP+  +TRD
Sbjct  97   GTALPIGQEEPAARAQGFYFYDKKESYSGWFSFSLVFNSKACRGTLNLMGADPMDAETRD  156

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             SVVGGTGDFFM RGVAT+ TDA EG  YFRL++DIK YEC+
Sbjct  157  FSVVGGTGDFFMARGVATIHTDATEGYFYFRLKMDIKLYECY  198



>gb|EMT21147.1| hypothetical protein F775_05541 [Aegilops tauschii]
Length=200

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNG-QNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            +PC  + LY+HD++YNG  N  NATS     P   + T      +FG +VVF+DP+T+  
Sbjct  40   EPCNEMTLYYHDILYNGVNNTRNATSAAATKPTALSTTHWKNGTYFGTLVVFNDPMTVGK  99

Query  338  NF---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDIS  508
                    P  RAQG Y YD + +YT+W GFS V N+T  +G++N +GAD + +KTRD+S
Sbjct  100  ALPVAGEEPAARAQGFYFYDKQESYTSWFGFSIVFNSTAHKGTMNLVGADLMDDKTRDLS  159

Query  509  VVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VVGGTGDFFM RG+AT+  DA EG VYFRL++DIK YEC+
Sbjct  160  VVGGTGDFFMARGIATLRLDASEGTVYFRLQMDIKLYECY  199



>ref|XP_008653393.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 6-like [Zea 
mays]
Length=190

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 108/167 (65%), Gaps = 13/167 (8%)
 Frame = +2

Query  143  GRKKPY-----KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVV  307
            GRKK       +PC+ + +Y+HD++Y+G N ANATS +   P   + ++     +FG VV
Sbjct  31   GRKKKLVSSYDEPCQQMTVYYHDILYDGTNTANATSAVAAQPTLLSRSVSVNDTYFGEVV  90

Query  308  VFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLM  487
            VF+D +T           RA+G Y YD K + +AW  FS V N+T  +G++N +G D + 
Sbjct  91   VFNDAVTAGX--------RAEGFYFYDRKESLSAWFAFSLVFNSTAHRGTLNLMGPDTIA  142

Query  488  NKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             KTRDISVVGGTGDFFM RG+AT+ TD F+G  YFRL++DIK YEC+
Sbjct  143  AKTRDISVVGGTGDFFMARGIATLRTDTFQGSYYFRLQMDIKLYECY  189



>gb|EAZ04892.1| hypothetical protein OsI_27074 [Oryza sativa Indica Group]
Length=206

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 106/163 (65%), Gaps = 7/163 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAA-NATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            +PCK + LYFHD++Y+  N+  N+TS     P      +      FG VVVFDDP+T   
Sbjct  43   EPCKKMTLYFHDILYDYSNSTTNSTSAAAAKPTALATAVSPNGTFFGEVVVFDDPMTEGT  102

Query  338  ------NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
                  +   T   RAQG+Y+YD+K  Y AW  FS V N+T  +G++N +GAD +  KTR
Sbjct  103  RALPPPSLRETAAARAQGVYLYDSKEVYDAWFAFSVVFNSTGRRGTLNLMGADLMSEKTR  162

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            DISVVGGTGDFFM RGVAT+ TDA EG VYFRL++DIK YEC+
Sbjct  163  DISVVGGTGDFFMSRGVATLRTDAVEGLVYFRLQMDIKLYECY  205



>gb|AAY45736.1| putative dirigent protein 9.21 [Quercus suber]
Length=95

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLM  487
            VFDDPITLDNN HSTPVGRAQG Y+YD K+ +TAW+GFSFV N+T  +GSINF GADPL 
Sbjct  1    VFDDPITLDNNLHSTPVGRAQGFYVYDKKDIFTAWMGFSFVFNSTRHKGSINFAGADPLS  60

Query  488  NKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYF  592
            NKTRDISVVGGTGDFFM RG+AT+MTDAFEG+VYF
Sbjct  61   NKTRDISVVGGTGDFFMARGIATLMTDAFEGDVYF  95



>gb|KCW75894.1| hypothetical protein EUGRSUZ_D00276 [Eucalyptus grandis]
Length=183

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            +  KPCK++VLY HD+I+ G N+ANAT     +P      +    F FG V +FD+P+T 
Sbjct  31   RKLKPCKHIVLYMHDIIFKGNNSANATEAAATSP------VGLGPFSFGQVSIFDNPMTK  84

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N HS PV RAQG Y YD K   +AW  F+ V N+T+ +G+IN +G+D +  KTR +SV
Sbjct  85   DQNLHSPPVARAQGFYFYDMKTAPSAWFAFTLVFNSTEYKGTINVMGSDFIPAKTRYLSV  144

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+  + +  F    YFRL++D+K YEC+
Sbjct  145  VGGTGDFFMTRGIVELQSGGFVLYEYFRLKMDVKLYECY  183



>ref|XP_010052039.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
Length=184

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            +  KPCK++VLY HD+I+ G N+ANAT     +P      +    F FG V +FD+P+T 
Sbjct  32   RKLKPCKHIVLYMHDIIFKGNNSANATEAAATSP------VGLGPFSFGQVSIFDNPMTK  85

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N HS PV RAQG Y YD K   +AW  F+ V N+T+ +G+IN +G+D +  KTR +SV
Sbjct  86   DQNLHSPPVARAQGFYFYDMKTAPSAWFAFTLVFNSTEYKGTINVMGSDFIPAKTRYLSV  145

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+  + +  F    YFRL++D+K YEC+
Sbjct  146  VGGTGDFFMTRGIVELQSGGFVLYEYFRLKMDVKLYECY  184



>gb|KCW77450.1| hypothetical protein EUGRSUZ_D01788 [Eucalyptus grandis]
Length=185

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  +P K +VLY+HD+++ G   ANATS  V  P          QF  G +VVFDDP+T 
Sbjct  29   KKSEPRKRIVLYYHDILFRGNYTANATSAAVTKPTGLG------QFMQGLMVVFDDPVTE  82

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D   HSTPV RA+G+Y Y+TK  Y+ W  ++ V N+T+  G+IN +GAD LM KTRD+S+
Sbjct  83   DQQLHSTPVARAEGLYFYNTKTAYSVWFAYTLVFNSTEYNGTINVMGADMLMEKTRDLSI  142

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VG TGDF + RG+ T  T+A E   YFRL++DI  YEC
Sbjct  143  VGDTGDFSIARGIMTFQTEAIEEFKYFRLKMDIMLYEC  180



>ref|XP_010054766.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
Length=197

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  +P K +VLY+HD+++ G   ANATS  V  P          QF  G +VVFDDP+T 
Sbjct  41   KKSEPRKRIVLYYHDILFRGNYTANATSAAVTKPTGLG------QFMQGLMVVFDDPVTE  94

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D   HSTPV RA+G+Y Y+TK  Y+ W  ++ V N+T+  G+IN +GAD LM KTRD+S+
Sbjct  95   DQQLHSTPVARAEGLYFYNTKTAYSVWFAYTLVFNSTEYNGTINVMGADMLMEKTRDLSI  154

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            VG TGDF + RG+ T  T+A E   YFRL++DI  YEC
Sbjct  155  VGDTGDFSIARGIMTFQTEAIEEFKYFRLKMDIMLYEC  192



>ref|XP_006476460.1| PREDICTED: dirigent protein 5-like, partial [Citrus sinensis]
 gb|KDO76394.1| hypothetical protein CISIN_1g038058mg [Citrus sinensis]
Length=170

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 114/172 (66%), Gaps = 11/172 (6%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHD-VIYNGQNAANATST-IVGAPQWGNYTILATQFH  292
            SVS+T  + + +  KP K  VLY+HD ++ +  + AN+TS  +    + GNY        
Sbjct  8    SVSATRKISKYQ--KPRKQFVLYYHDNLLLDPDDVANSTSAKVTSGTKLGNY-------E  58

Query  293  FGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIG  472
            FG VVVF+DP+T D +F S     AQG Y Y+ KN Y+AW  ++ V N+++ +G++N +G
Sbjct  59   FGMVVVFNDPVTKDQSFQSPEAATAQGFYFYNMKNDYSAWFAYTLVFNSSEYKGTLNIMG  118

Query  473  ADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            AD +  KTRD+SVVGGTGDFFM RG+AT  TDA EG  YFRL++DIK YEC+
Sbjct  119  ADLMPEKTRDLSVVGGTGDFFMARGIATFTTDAVEGIKYFRLKMDIKLYECY  170



>gb|EMS55049.1| hypothetical protein TRIUR3_07796 [Triticum urartu]
Length=171

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNG-QNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            +PC  + LY+HD++YNG  N  NATS     P   + T      +FG +VVFDDP+T+  
Sbjct  9    EPCNEMTLYYHDILYNGVNNTKNATSAAATKPTALSTTHWKNGTYFGTLVVFDDPMTVGK  68

Query  338  NF---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR--D  502
                    P  RAQG Y YD + +YT+W GFS V N+T  + +IN +GAD L +KTR  D
Sbjct  69   ALPMAGEEPAARAQGFYFYDKQESYTSWFGFSIVFNSTAHKSTINLVGADLLDDKTRTRD  128

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +SVVGGTGDFFM RG+AT+  DA EG VYFRL++DIK YEC+
Sbjct  129  LSVVGGTGDFFMARGIATLRLDASEGTVYFRLQMDIKLYECY  170



>emb|CDP18855.1| unnamed protein product [Coffea canephora]
Length=177

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 109/164 (66%), Gaps = 12/164 (7%)
 Frame = +2

Query  146  RKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQF---HFGNVVVFD  316
            R  P KPCK+  +Y+H VI+NG N ANAT+ +V  P         T+F    FG +V+FD
Sbjct  23   RTNPDKPCKHFTVYYHTVIFNGTNTANATAAVVREP---------TKFWNTSFGQMVIFD  73

Query  317  DPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKT  496
             P+T D +  STP+GRAQG+Y YD K    +W  +S + N+T+ +G IN +GA+ +  +T
Sbjct  74   SPLTKDQSLLSTPIGRAQGLYFYDMKMRVGSWFAYSLLFNSTEHKGIINIMGANLMHEET  133

Query  497  RDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RD+S+VGGTGDFFM RG+ T+ T+  +   YFRL++D+K YEC+
Sbjct  134  RDLSIVGGTGDFFMARGIVTLRTEDVDIPRYFRLQMDVKLYECY  177



>ref|NP_192860.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9T019.1|DIR14_ARATH RecName: Full=Dirigent protein 14; Short=AtDIR14; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB43056.1| putative disease resistance response protein [Arabidopsis thaliana]
 emb|CAB81222.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AEE82984.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=184

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  VL+ HD+ Y+G NAANATS  +  P      +    F FG  V+ DDP+T+D N
Sbjct  34   KPCKRFVLHLHDIAYDGDNAANATSAAIVNP------LGLGDFSFGKFVIMDDPVTMDQN  87

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV R QG + Y  K TY AW+ ++ V N+T  +G+   +G +P M  TRD+ +VGG
Sbjct  88   YLSKPVARVQGFFCYHGKATYDAWIAWTVVFNSTQHKGAFTIMGENPFMEPTRDLPIVGG  147

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT+ TD  +G  YFR+++DIK YEC+
Sbjct  148  TGDFIMTRGIATLTTDHIDGSKYFRVKLDIKLYECY  183



>ref|XP_004959849.1| PREDICTED: disease resistance response protein 206-like [Setaria 
italica]
Length=195

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 111/166 (67%), Gaps = 1/166 (1%)
 Frame = +2

Query  131  THPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVV  310
             H  GR++   PCK + +Y+H+++Y+G N ANAT+     P   + +      +FG +VV
Sbjct  29   AHGGGRQRN-PPCKEMTVYYHNILYDGTNTANATAAFATQPTLLSRSASINDTYFGEIVV  87

Query  311  FDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMN  490
            FDDP+T      S PV RAQG + YD K +  AW  FS V N+T  +G++N +GAD +  
Sbjct  88   FDDPVTAGPALASEPVARAQGFFFYDKKESPNAWFAFSLVFNSTAHRGTLNLMGADLMAE  147

Query  491  KTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            KTRDISVVGGTGDFFM RGVAT+ TD++EG  YFRL++DIK Y+C+
Sbjct  148  KTRDISVVGGTGDFFMARGVATLRTDSYEGLYYFRLQMDIKLYDCY  193



>ref|XP_004958453.1| PREDICTED: disease resistance response protein 206-like [Setaria 
italica]
Length=197

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            +PC N+ +Y+HD++Y+G N ANAT+     P   + ++     +FG +VVF+D +T    
Sbjct  41   EPCLNMTVYYHDILYDGTNTANATAAAATQPTLLSRSVSINDTYFGEIVVFNDVVTAAPA  100

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
              S PV RA+G Y YD K   +AW  FS V N+T  +G++N +GAD +  KTRDISVVGG
Sbjct  101  LASAPVARAEGFYFYDRKEALSAWFAFSLVFNSTAHRGTLNLMGADLMAEKTRDISVVGG  160

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDFFM RGVAT+ TD F+G  YFRL++DIK YEC+
Sbjct  161  TGDFFMARGVATLRTDTFQGLYYFRLQMDIKLYECY  196



>ref|XP_010435306.1| PREDICTED: dirigent protein 13-like [Camelina sativa]
Length=188

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  VL+ HDV YNG NAANATS  +  P  G        F+FG  V+ D P+T+D N
Sbjct  37   KPCKRFVLHLHDVTYNGDNAANATSAAIVNPIGG-----LGDFNFGKFVITDSPVTMDEN  91

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
              S PV R QG++    K  +  W  +S V N+T  +G++N +G + +M  TRD++VVGG
Sbjct  92   HLSEPVARVQGLWFVHGKKKFDTWFAWSLVFNSTQHKGTLNMMGENQIMESTRDVTVVGG  151

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT+ ++A EG  YFR+++DIK YEC+
Sbjct  152  TGDFIMTRGIATLTSEAVEGNTYFRVKMDIKLYECY  187



>ref|XP_010455526.1| PREDICTED: dirigent protein 13-like [Camelina sativa]
Length=184

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  V++ H+V Y+G N ANATS  V  P      +    F FGN ++ D+P+T+D N
Sbjct  34   KPCKRFVVHLHNVAYDGNNTANATSATVVKP------VGLGDFSFGNFIIMDNPVTMDEN  87

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV RAQG + Y  K  + +WL FS V N+T  +G++N +G +P M  TRD+ VVGG
Sbjct  88   YLSKPVARAQGFFFYHGKWKFDSWLSFSVVFNSTKHKGALNIMGENPFMEPTRDLPVVGG  147

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT+ TD  +   YFR+++DIK YEC+
Sbjct  148  TGDFIMTRGIATLTTDLIQVPKYFRIKMDIKLYECY  183



>ref|XP_006286574.1| hypothetical protein CARUB_v10002055mg [Capsella rubella]
 gb|EOA19472.1| hypothetical protein CARUB_v10002055mg [Capsella rubella]
Length=186

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  VL+ HDV ++G NA NATS  +  P      I    F+FG  ++ D P+T+D N
Sbjct  36   KPCKRFVLHLHDVTFDGDNADNATSAAIVNP------IGLGGFNFGKFLITDSPLTMDEN  89

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            F S PV R QG +    K  +  WL +S V N+T  +GSIN +G +P+M  +RD+SVVGG
Sbjct  90   FLSEPVARVQGFWFVHGKTKFDTWLAWSVVFNSTKHKGSINMMGENPIMEPSRDVSVVGG  149

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT+ +DA EG  Y+R+++DIK YEC+
Sbjct  150  TGDFIMTRGIATITSDAVEGNKYYRIKMDIKLYECY  185



>ref|XP_010435284.1| PREDICTED: dirigent protein 13 [Camelina sativa]
Length=187

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  V + H+V Y+G N  NATS  +  P      I    F+FG  ++ D+P+T+D N
Sbjct  37   KPCKRFVFHLHNVAYDGDNTVNATSAAIVNP------IGLGDFNFGKFIIMDNPVTMDEN  90

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV R QG + Y  K+ Y  WL +S V N+T  +G++N +G +P M  TRD+ VVGG
Sbjct  91   YLSKPVARVQGFFFYHGKSKYDTWLSWSVVFNSTQQKGTLNIMGENPFMEPTRDLPVVGG  150

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT  TD  EG  YFR+++DIK YEC+
Sbjct  151  TGDFIMTRGIATFTTDLVEGNKYFRIKMDIKLYECY  186



>ref|XP_007040401.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
 gb|EOY24902.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
Length=175

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 109/170 (64%), Gaps = 11/170 (6%)
 Frame = +2

Query  128  STHPMGRKK---PYKPCKNLVLYFHDVIYNGQNAANATSTIVGA-PQWGNYTILATQFHF  295
            ST  +G +K   P KPCK  VLY+HD ++ G + ANATS       + GN       F+F
Sbjct  12   STLCLGYQKALNPQKPCKRFVLYYHDFLFGGDDMANATSAAATNMTKLGN-------FNF  64

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G +VVFDDP+T D    S PV RAQG Y YD K  Y AW  ++ + N++  +G++N +GA
Sbjct  65   GMLVVFDDPMTKDQRLLSHPVARAQGFYFYDMKTDYNAWFAYTLIFNSSHHKGTLNIMGA  124

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            D +M KTRD+SVVGG  DFFM RG+AT  TD  +G+ YFRL+ DIK YEC
Sbjct  125  DMMMEKTRDLSVVGGRRDFFMARGIATFKTDTMQGDKYFRLKKDIKLYEC  174



>ref|XP_010422064.1| PREDICTED: dirigent protein 13-like [Camelina sativa]
Length=187

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  V + H+V Y+G N  NATS  +  P      I    F+FG  ++ D+P+T+D N
Sbjct  37   KPCKRFVFHLHNVAYDGDNTVNATSAAIVNP------IGLGDFNFGKFIIMDNPVTMDEN  90

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV R QG + Y  K+ Y  WL +S V N+T+ +G++N +G +P M  TRD+ VVGG
Sbjct  91   YLSKPVARVQGFFFYHGKSKYDTWLSWSVVFNSTEQKGTLNIMGENPFMEPTRDLPVVGG  150

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT  TD  +G  YFR+++DIK YEC+
Sbjct  151  TGDFIMTRGIATFTTDHIDGNKYFRIKMDIKLYECY  186



>ref|XP_008341336.1| PREDICTED: dirigent protein 5-like [Malus domestica]
 ref|XP_008353920.1| PREDICTED: dirigent protein 5-like [Malus domestica]
Length=150

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +2

Query  176  LVLYFHDVIYNG--QNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFHS  349
            + LY+HD +++G  ++  NATS     P     T LA    FG +VVF+DPIT D+ +HS
Sbjct  3    MQLYYHDKLFDGTHKDKTNATSAATANP-----TKLAPGSQFGMLVVFNDPITRDDKYHS  57

Query  350  TPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGD  529
              +  AQG Y YD K+TY+AW  F+ V N+++ +G+ N +GAD +  KTRD+SVVGGTGD
Sbjct  58   PHIANAQGFYFYDRKDTYSAWFAFTLVFNSSEHRGTSNIMGADLMPEKTRDLSVVGGTGD  117

Query  530  FFMHRGVATVMTDAFEGEVYFRLRVDIKFYE  622
            FFM RG+A++ TD F+G+ YFRL++DIK YE
Sbjct  118  FFMARGIASLQTDTFQGQYYFRLKMDIKLYE  148



>ref|XP_010435272.1| PREDICTED: dirigent protein 13-like [Camelina sativa]
Length=187

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 104/163 (64%), Gaps = 9/163 (6%)
 Frame = +2

Query  149  KKPY---KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDD  319
            +KP+   KPCK  V++ H+V Y+G N ANATS  +  P      I    F+FG  ++ D+
Sbjct  30   RKPFDLAKPCKRFVVHLHNVAYDGDNTANATSAAIVNP------IGFGDFNFGKFIIMDN  83

Query  320  PITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTR  499
            P+T+D N+ S PV R QG + Y  K+ Y  WL +S V N+T  +G+ N +G +P M  TR
Sbjct  84   PVTMDENYLSKPVARVQGFFFYHGKSKYDTWLSWSVVFNSTKHKGASNIMGENPFMEPTR  143

Query  500  DISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            D+ VVGGTGDF M RG+AT  TD  +G  YFR+++DIK YEC+
Sbjct  144  DLPVVGGTGDFIMTRGIATFTTDHIDGNKYFRIKMDIKLYECY  186



>ref|XP_006396935.1| hypothetical protein EUTSA_v10028997mg [Eutrema salsugineum]
 gb|ESQ38388.1| hypothetical protein EUTSA_v10028997mg [Eutrema salsugineum]
Length=187

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 109/171 (64%), Gaps = 10/171 (6%)
 Frame = +2

Query  119  SVSSTHPMGRKKPYKPCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHF  295
            +VSS   +   K  KPCK+ VL+ H++ Y+  NA NATS TIV     G+       F+F
Sbjct  26   TVSSVRTLIDLK--KPCKHFVLHLHNIAYDSDNADNATSATIVNPLGLGD-------FNF  76

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G  V+FD+P+T+D NF S  V RAQG + Y+   TY  W+  + V N+T  +G++  + A
Sbjct  77   GKFVIFDNPVTMDENFLSEAVARAQGFFFYNKITTYNTWVACTLVFNSTQHKGTLTIMDA  136

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +P+M  TRD+S+VGGTGDF M RGV T  TD  +G  YFRL++DIK YEC+
Sbjct  137  NPMMEPTRDLSIVGGTGDFIMTRGVVTFSTDLIQGNKYFRLKMDIKLYECY  187



>ref|XP_006289266.1| hypothetical protein CARUB_v10002732mg [Capsella rubella]
 gb|EOA22164.1| hypothetical protein CARUB_v10002732mg [Capsella rubella]
Length=187

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  +++ H+V Y+G N ANATS  +  P      I    F+FG  +V ++P+T+D N
Sbjct  38   KPCKRFIVHLHNVAYDGDNTANATSAAIVNP------IGLGDFNFGKFIVMNNPVTMDEN  91

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV R QG + Y  K+ Y  WL +S V N+T+ +G +N +G +P M  TRDI +VGG
Sbjct  92   YLSKPVARVQGFFFYHGKSQYDTWLSWSVVFNSTEHKGQLNMMGENPFMEPTRDIPIVGG  151

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT  TD  +G  YFR+++D+K YEC+
Sbjct  152  TGDFIMTRGIATFTTDHIDGNKYFRIKMDVKLYECY  187



>ref|XP_009108189.1| PREDICTED: dirigent protein 12-like [Brassica rapa]
 emb|CDX86806.1| BnaA09g21960D [Brassica napus]
Length=178

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 103/157 (66%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+ VLY H++ Y+  N  NATS TI+     GN       F FG  V+FD+P+T+D 
Sbjct  29   KPCKSFVLYQHNIAYDSDNTDNATSATILNPLGLGN-------FLFGKFVIFDNPVTMDQ  81

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG + Y+ K+ Y  W+  + V N+T  +G+   + A+P+M  TRD+S+VG
Sbjct  82   NYLSKPVARAQGFFFYNKKSNYNIWVACTLVFNSTQHKGTFTIMDANPIMEPTRDLSIVG  141

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT  +D  +G  YFRL++DI  YEC+
Sbjct  142  GTGDFFMTRGIATFKSDLIQGSKYFRLKMDIDLYECY  178



>ref|XP_009134230.1| PREDICTED: dirigent protein 6-like [Brassica rapa]
Length=186

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPC++ + + H+V Y+  N ANATS TI+     GN       F+FG  V+FD+P+T+D 
Sbjct  37   KPCRSFLFHLHNVAYDSDNTANATSATIINPLGLGN-------FNFGKYVIFDNPVTMDE  89

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQ  + Y+ K TY  W+  + V N+T  +G++  + A+P+M  TRD+++VG
Sbjct  90   NYLSEPVARAQSFFFYNKKTTYNIWMACTLVFNSTQHKGTMTIMDANPMMEPTRDLAIVG  149

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDF M RG+ T+ TD  +   YFRL++DIK YEC+
Sbjct  150  GTGDFIMARGIVTLTTDLIQESKYFRLKLDIKLYECY  186



>ref|XP_010455525.1| PREDICTED: dirigent protein 13-like [Camelina sativa]
Length=187

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  V + H+V Y+G N  NATS  +  P      I    F+FG  ++ D+P+T+D N
Sbjct  37   KPCKRFVFHLHNVAYDGDNTVNATSAAIVNP------IGLGDFNFGKFIIMDNPVTMDEN  90

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV R QG + Y  K+ Y  WL +S V N+T  +G++N +G +P M  TRD+ VVGG
Sbjct  91   YLSKPVARVQGFFFYHGKSKYDTWLSWSVVFNSTQHKGTLNIMGENPFMEPTRDLPVVGG  150

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+AT  TD  +G  YFR+++DIK YEC+
Sbjct  151  TGDFIMTRGIATFTTDHIDGNKYFRIKMDIKLYECY  186



>gb|KCW77452.1| hypothetical protein EUGRSUZ_D01790, partial [Eucalyptus grandis]
Length=155

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 6/159 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  KPCK++VL+ H VI+NG N+AN T   V +P      +    F FG V +FD+P+T 
Sbjct  3    KELKPCKHIVLHMHQVIFNGSNSANTTGAAVTSP------VGLGHFAFGQVFIFDNPMTK  56

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N  S P  RAQG Y Y  K   +AW+ F+ V N+T+ +G+IN +G++ +  KTR +SV
Sbjct  57   DQNLLSPPAARAQGFYFYHMKTVPSAWMTFTLVFNSTEHKGTINVMGSNFIPAKTRYLSV  116

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+  +  D     VYFRL++DIK YEC+
Sbjct  117  VGGTGDFFMTRGILEIEEDGVVPFVYFRLKMDIKLYECY  155



>dbj|BAC19943.1| putative disease resistance response protein [Oryza sativa Japonica 
Group]
 gb|EAZ40848.1| hypothetical protein OsJ_25327 [Oryza sativa Japonica Group]
Length=207

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 108/164 (66%), Gaps = 8/164 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDDPITLD-  334
            +PCK + LYFHD++Y+  N+   +++   A      T ++     FG VVVFDDP+T   
Sbjct  43   EPCKKMTLYFHDILYDYSNSTANSTSAAAAKPTALATAVSPNGTFFGEVVVFDDPMTEGT  102

Query  335  ------NNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKT  496
                  ++   T   RAQG+Y+YD+K  Y AW  FS V N+T  +G++N +GAD +  KT
Sbjct  103  RALPPPSSLRETAAARAQGVYLYDSKEVYDAWFAFSVVFNSTGRRGTLNLMGADLMSEKT  162

Query  497  RDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            RDISVVGGTGDFFM RGVAT+ TDA EG VYFRL++DIK YEC+
Sbjct  163  RDISVVGGTGDFFMSRGVATLRTDAVEGLVYFRLQMDIKLYECY  206



>ref|XP_002872559.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48818.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=184

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 97/156 (62%), Gaps = 6/156 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK  V + H+V Y+G N  NATS  +  P      +    F+FG  V+ D+P+T+D N
Sbjct  34   KPCKRFVFHLHNVAYDGDNMDNATSAAIVNP------LGLGDFNFGKFVIMDNPVTMDQN  87

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGG  520
            + S PV R QG + Y  K  Y  WL +S   N+T  +G++N +G +P M  TRD+ VVGG
Sbjct  88   YLSKPVARVQGFFFYHGKAKYDTWLSWSVAFNSTQHKGTLNIMGENPFMEPTRDLQVVGG  147

Query  521  TGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            TGDF M RG+A  MTD  EG  YFR+++DIK YEC+
Sbjct  148  TGDFVMTRGIAMFMTDLVEGNKYFRIKMDIKLYECY  183



>ref|XP_010054768.1| PREDICTED: dirigent protein 5-like [Eucalyptus grandis]
Length=184

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 6/159 (4%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
            K  KPCK++VL+ H VI+NG N+AN T   V +P      +    F FG V +FD+P+T 
Sbjct  32   KELKPCKHIVLHMHQVIFNGSNSANTTGAAVTSP------VGLGHFAFGQVFIFDNPMTK  85

Query  332  DNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
            D N  S P  RAQG Y Y  K   +AW+ F+ V N+T+ +G+IN +G++ +  KTR +SV
Sbjct  86   DQNLLSPPAARAQGFYFYHMKTVPSAWMTFTLVFNSTEHKGTINVMGSNFIPAKTRYLSV  145

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+  +  D     VYFRL++DIK YEC+
Sbjct  146  VGGTGDFFMTRGILEIEEDGVVPFVYFRLKMDIKLYECY  184



>ref|NP_192858.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9T017.1|DIR13_ARATH RecName: Full=Dirigent protein 13; Short=AtDIR13; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB43054.1| putative disease resistance response protein [Arabidopsis thaliana]
 emb|CAB81220.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AAP88352.1| At4g11190 [Arabidopsis thaliana]
 gb|AEE82983.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=184

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 102/171 (60%), Gaps = 9/171 (5%)
 Frame = +2

Query  125  SSTHPMGRKKPY---KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHF  295
             ST  +  ++P+   KPCK  V Y H+V Y+G N  NATS  +  P      +    F F
Sbjct  19   QSTTVLSFRQPFNLAKPCKRFVFYLHNVAYDGDNTDNATSAAIVNP------LGLGDFSF  72

Query  296  GNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGA  475
            G  V+ D+P+T+D N  S  V R QG + Y  K  Y  WL +S V N+T  +G++N +G 
Sbjct  73   GKFVIMDNPVTMDQNMLSEQVARVQGFFFYHGKTKYDTWLSWSVVFNSTQHKGALNIMGE  132

Query  476  DPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +  M  TRD+ VVGGTGDF M RG+AT MTD  EG  YFR+++DIK YEC+
Sbjct  133  NAFMEPTRDLPVVGGTGDFVMTRGIATFMTDLVEGSKYFRVKMDIKLYECY  183



>emb|CDY13238.1| BnaC09g24180D [Brassica napus]
Length=178

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 103/157 (66%), Gaps = 8/157 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATS-TIVGAPQWGNYTILATQFHFGNVVVFDDPITLDN  337
            KPCK+ VLY H++ Y+  N  NATS TI+     GN       F FG  V+FD+P+T+D 
Sbjct  29   KPCKSFVLYQHNIAYDSDNTDNATSATILNPLGLGN-------FLFGKFVIFDNPVTMDQ  81

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
            N+ S PV RAQG + Y+ K+ +  W+  + V N+T  +G+   + A+P+M  TRD+S+VG
Sbjct  82   NYLSKPVARAQGFFFYNKKSYFNIWVACTLVFNSTQHKGTFTIMDANPIMEPTRDLSIVG  141

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GTGDFFM RG+AT  +D  +G  YFRL++DI  YEC+
Sbjct  142  GTGDFFMTRGIATFKSDLIQGSKYFRLKMDINLYECY  178



>gb|AFK46449.1| unknown [Lotus japonicus]
Length=127

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +2

Query  119  SVSSTHPMGRKKPY---KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQF  289
            + +S  P   +K Y   KPCK LV YFHD+IYNG NA NAT+ IVGAP WGN T+L  + 
Sbjct  17   TTTSATPTRHRKNYRFPKPCKKLVFYFHDIIYNGHNAKNATAAIVGAPAWGNTTVLTGKN  76

Query  290  HFGNVVVFDDPITLDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTT  442
            HFG+VVVFDDPIT+DNN HS PVGRAQG Y+YD K  +TAWLGFSFV N+T
Sbjct  77   HFGDVVVFDDPITMDNNLHSPPVGRAQGFYIYDKKEIFTAWLGFSFVFNST  127



>gb|EMT00410.1| hypothetical protein F775_16017 [Aegilops tauschii]
Length=196

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            +PCK + LY+HD++Y+G N     ++          T L+   +FG +VVFDDP+T    
Sbjct  41   EPCKKMTLYYHDILYDGGNNTANATSAAATEP----TALSNSTYFGMLVVFDDPMTKRKA  96

Query  341  F---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISV  511
                +  P  RAQG Y YD K +  +W  FS V N+T  +G++N +GAD +  +TRDISV
Sbjct  97   LPVGNELPTARAQGFYFYDKKGSLNSWFAFSLVFNSTAYKGTLNLMGADLMGERTRDISV  156

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDFFM RG+AT+ TDA EG  YFRL++DIK YEC+
Sbjct  157  VGGTGDFFMARGIATLRTDAMEGLYYFRLQMDIKLYECY  195



>ref|XP_010435326.1| PREDICTED: dirigent protein 12-like [Camelina sativa]
Length=187

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNN  340
            KPCK+ VLY HD+ Y+G NAANATS  +  P      I    F+FG  V+ D+P+T+D N
Sbjct  35   KPCKHFVLYLHDITYDGNNAANATSASIMNP------IGFGDFNFGKFVIMDNPVTMDEN  88

Query  341  FHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPL---MNKTRDISV  511
            + S PV RAQG Y Y+ K  + AW+ ++ V N+T  +G+   +GA+P    M  TRD+S+
Sbjct  89   YLSEPVARAQGFYFYNMKMNFNAWVAWTLVFNSTMHKGTFTIMGANPYAMEMELTRDLSI  148

Query  512  VGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            VGGTGDF M RG+AT+ T   +G +YF + ++IK YEC+
Sbjct  149  VGGTGDFLMTRGIATLETKFVQGSMYFCVEMNIKLYECY  187



>gb|EAZ40801.1| hypothetical protein OsJ_25279 [Oryza sativa Japonica Group]
Length=195

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 113/189 (60%), Gaps = 26/189 (14%)
 Frame = +2

Query  116  ISVSSTHPMGRK----KPY-KPCKNLVLYFHDVIYN---------GQNAANATSTIVGAP  253
            +S S++   GR+      Y KPCK + LY HD++Y+            A   T+     P
Sbjct  13   LSCSASVAHGRRFVRSSSYDKPCKEMRLYLHDILYDYSNSTSNSTSAAATKPTALATAVP  72

Query  254  QWGNYTILATQFHFGNVVVFDDPIT----LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGF  421
              G          FG VVVF+DP+T    L  +   T V RAQG+Y+Y++K  + AW  F
Sbjct  73   STGGT-------FFGQVVVFNDPMTEGRALPPSLEETAV-RAQGVYLYNSKEAFNAWFAF  124

Query  422  SFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLR  601
            S V N+T  +G++N +GAD +  KTRDISVVGGTGDFFM RGVAT+ TDAFEG  YFRL+
Sbjct  125  SIVFNSTGRRGTLNLMGADIIAEKTRDISVVGGTGDFFMSRGVATLRTDAFEGFTYFRLQ  184

Query  602  VDIKFYECW  628
            +DIK YEC+
Sbjct  185  MDIKLYECY  193



>gb|EAZ40847.1| hypothetical protein OsJ_25326 [Oryza sativa Japonica Group]
Length=199

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 7/162 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNA-ANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDDPIT--  328
            +PC  + LY HD++Y+  N+ +N+T+     P      + +T    FG VVVF+DP+T  
Sbjct  38   EPCMEMRLYLHDILYDYSNSTSNSTAAAATKPTALANAVPSTGGTFFGEVVVFNDPVTEG  97

Query  329  --LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
              L  +   T V RAQG+Y+Y++K  + AWL FS V N+T  +G++N +GAD +  KTRD
Sbjct  98   RALPPSLEETAV-RAQGLYLYNSKEAFNAWLAFSIVFNSTGRRGTLNLMGADIIAEKTRD  156

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            ISVVGGTGDFFM RGVAT+ TDAFEG  YFRL++DIK YEC+
Sbjct  157  ISVVGGTGDFFMSRGVATLRTDAFEGFTYFRLQMDIKLYECY  198



>gb|EAZ04848.1| hypothetical protein OsI_27026 [Oryza sativa Indica Group]
Length=200

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAA-NATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT---  328
            +PC  + LY HD++Y+  N+  N+TS     P   +  +  + + FG VVVF+DP+T   
Sbjct  41   EPCMEMRLYLHDILYDYSNSTTNSTSAAATKPTALSTAVSKSGYFFGRVVVFNDPMTEGR  100

Query  329  -LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
             L  +   T V RAQG+Y+ D K+ ++AW  FS V N+T  +G++N +GADP    TRDI
Sbjct  101  ALPPSLEETAV-RAQGLYLLDKKDDFSAWFAFSIVFNSTARRGTLNLMGADP-NAATRDI  158

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDFFM RGVAT+ TDA EG  YFR+++DIK YEC+
Sbjct  159  SVVGGTGDFFMSRGVATLRTDAIEGFKYFRVQMDIKLYECY  199



>ref|NP_001060395.1| Os07g0636600 [Oryza sativa Japonica Group]
 dbj|BAC79525.1| putative dirigent protein [Oryza sativa Japonica Group]
 dbj|BAF22309.1| Os07g0636600 [Oryza sativa Japonica Group]
 dbj|BAG97514.1| unnamed protein product [Oryza sativa Japonica Group]
Length=204

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 109/184 (59%), Gaps = 22/184 (12%)
 Frame = +2

Query  119  SVSSTHPMGRKKPY-KPCKNLVLYFHDVIYN---------GQNAANATSTIVGAPQWGNY  268
            SV+      R   Y KPCK + LY HD++Y+            A   T+     P  G  
Sbjct  27   SVAHGRRFVRSSSYDKPCKEMRLYLHDILYDYSNSTSNSTSAAATKPTALATAVPSTGGT  86

Query  269  TILATQFHFGNVVVFDDPIT----LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLN  436
                    FG VVVF+DP+T    L  +   T V RAQG+Y+Y++K  + AW  FS V N
Sbjct  87   -------FFGQVVVFNDPMTEGRALPPSLEETAV-RAQGVYLYNSKEAFNAWFAFSIVFN  138

Query  437  TTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKF  616
            +T  +G++N +GAD +  KTRDISVVGGTGDFFM RGVAT+ TDAFEG  YFRL++DIK 
Sbjct  139  STGRRGTLNLMGADIIAEKTRDISVVGGTGDFFMSRGVATLRTDAFEGFTYFRLQMDIKL  198

Query  617  YECW  628
            YEC+
Sbjct  199  YECY  202



>ref|XP_006658874.1| PREDICTED: dirigent protein 5-like [Oryza brachyantha]
Length=202

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQ-FHFGNVVVFDDPITLDN  337
            +PCK + LY HD++Y+  N+   ++           T ++   + FG VVVF+DP+T   
Sbjct  45   EPCKKMRLYLHDILYDYSNSTANSTAAAATKPTALSTAVSKSGYFFGGVVVFNDPVTEGK  104

Query  338  NFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVG  517
                T V RAQG+Y YD K+   AWL FS V N+T  QG++N +GAD +  KTRDISVVG
Sbjct  105  ALEETAV-RAQGLYFYDRKDAPNAWLAFSIVFNSTAQQGTLNLMGADLMSEKTRDISVVG  163

Query  518  GTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYEC  625
            GTGDFFM RGVAT+ TDA EG  YFRL++DI  YEC
Sbjct  164  GTGDFFMARGVATLRTDAVEGLKYFRLQMDISLYEC  199



>gb|EMT04615.1| hypothetical protein F775_16948 [Aegilops tauschii]
Length=199

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 109/173 (63%), Gaps = 6/173 (3%)
 Frame = +2

Query  128  STHPMGR---KKPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFG  298
            + H + R     P +PC N+ LY+HD++YNG N ANAT+     P     T      +FG
Sbjct  26   AAHGLARVVANSPDEPCMNMTLYYHDILYNGNNTANATTAAATKPTALATTYWKNSTYFG  85

Query  299  NVVVFDDPITLDNNF---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFI  469
             ++VF+DP+T+          P  RAQG Y YD + + T+W GFS V N+T  +G++N +
Sbjct  86   ALMVFNDPMTVGKALPLAGEEPAARAQGFYFYDKQESLTSWFGFSIVFNSTAHKGTLNLV  145

Query  470  GADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            GAD + + TRD SVVGGTGDFFM RGV T+ TDA EG  YFRL++DIK YEC+
Sbjct  146  GADLMGDATRDFSVVGGTGDFFMARGVTTIRTDAIEGLYYFRLQMDIKLYECY  198



>gb|EAZ04838.1| hypothetical protein OsI_27016 [Oryza sativa Indica Group]
Length=195

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 113/189 (60%), Gaps = 26/189 (14%)
 Frame = +2

Query  116  ISVSSTHPMGRK----KPY-KPCKNLVLYFHDVIYN---------GQNAANATSTIVGAP  253
            +S S++   GR+      Y +PCK + LY HD++Y+            A   T+     P
Sbjct  13   LSCSASVAHGRRFVRSSSYDEPCKEMRLYLHDILYDYSNSTSNSTSAAATKPTALATAVP  72

Query  254  QWGNYTILATQFHFGNVVVFDDPIT----LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGF  421
              G          FG VVVF+DP+T    L  +   T V RAQG+Y+Y++K  + AW  F
Sbjct  73   STGGT-------FFGQVVVFNDPMTEGRALPPSLEETAV-RAQGVYLYNSKEAFNAWFAF  124

Query  422  SFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLR  601
            S V N+T  +G++N +GAD +  KTRDISVVGGTGDFFM RGVAT+ TDAFEG  YFRL+
Sbjct  125  SIVFNSTGRRGTLNLMGADIIAEKTRDISVVGGTGDFFMSRGVATLRTDAFEGFTYFRLQ  184

Query  602  VDIKFYECW  628
            +DIK YEC+
Sbjct  185  MDIKLYECY  193



>gb|EMS58222.1| hypothetical protein TRIUR3_30180 [Triticum urartu]
Length=199

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = +2

Query  152  KPYKPCKNLVLYFHDVIYNGQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITL  331
             P +PC N+ LY+HD++YNG N ANAT+     P     T      +FG ++VF+DP+T+
Sbjct  37   SPDEPCMNMTLYYHDILYNGNNTANATTAAATKPTALATTYWKNSTYFGALMVFNDPMTV  96

Query  332  DNNF---HSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
                      P  RAQG Y YD + + T+W GFS V N+T ++G++N +GAD + + TRD
Sbjct  97   GRALPLAGEEPAARAQGFYFYDKQESLTSWFGFSIVFNSTANKGTLNLVGADLMGDATRD  156

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             SVV GTGDFFM RGVAT+ TDA EG  YFRL++DIK YEC+
Sbjct  157  FSVVSGTGDFFMARGVATIRTDAIEGLYYFRLQMDIKLYECY  198



>dbj|BAC45193.1| putative disease resistance response protein [Oryza sativa Japonica 
Group]
Length=195

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 106/161 (66%), Gaps = 7/161 (4%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNAA-NATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT---  328
            +PC  + LY HD++Y+  N+  N+TS     P   +  + +  + FG VVVF+DP+T   
Sbjct  36   EPCMEMRLYLHDILYDYSNSTTNSTSAAATKPTALSTAVSSPGYFFGRVVVFNDPMTEGR  95

Query  329  -LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDI  505
             L  +   T V RAQG+Y+ D K+ ++AW  FS V N+T  +G++N +GADP    TRDI
Sbjct  96   ALPPSLEETAV-RAQGLYLLDKKDDFSAWFAFSIVFNSTARRGTLNLMGADP-NAATRDI  153

Query  506  SVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            SVVGGTGDF M RGVAT+ TDA EG  YFR+++DIK YEC+
Sbjct  154  SVVGGTGDFLMSRGVATLRTDAIEGFKYFRVQMDIKLYECY  194



>ref|XP_003562603.1| PREDICTED: dirigent protein 5-like [Brachypodium distachyon]
Length=208

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 108/185 (58%), Gaps = 25/185 (14%)
 Frame = +2

Query  125  SSTHPMGRKKPY--------KPCKNLVLYFHDVIYNG---QNAANATSTIVGAPQWGNYT  271
            +  H  GR K          +PCK + LY+HD++Y        ANATS+    P     T
Sbjct  31   ADAHAAGRNKRRLVSSDSEDEPCKKMTLYYHDILYEAVPSNETANATSSAATLP-----T  85

Query  272  ILATQFHFGNVVVFDDPITLDNNFHSTPV------GRAQGMYMYDTKNTYTAWLGFSFVL  433
             ++   +FG +VVFDDP+T      + PV       RAQG Y Y+ K  + AW   S V 
Sbjct  86   AMSNATYFGMLVVFDDPVT---ESKALPVVAEDVAARAQGFYFYNGKAKFNAWFAMSLVF  142

Query  434  NTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIK  613
            N+T  +G++N +GAD +  KTRDISVVGGTGDFFM  GVAT+ TDA EG  YFRL++DIK
Sbjct  143  NSTGCRGTLNLMGADLMDQKTRDISVVGGTGDFFMALGVATLRTDATEGFFYFRLQMDIK  202

Query  614  FYECW  628
             Y+C+
Sbjct  203  LYQCY  207



>ref|XP_006658873.1| PREDICTED: dirigent protein 5-like [Oryza brachyantha]
Length=193

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 112/167 (67%), Gaps = 7/167 (4%)
 Frame = +2

Query  143  GRKKPYKPCKNLVLYFHDVIYN-GQNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDD  319
            GR+   +PCK + LYFHD+IY+   + +N+TS  V  P   + T+  + + FG VVVF+D
Sbjct  27   GRRSYGEPCKKMKLYFHDIIYDYSNSTSNSTSAAVTKPTALSTTVSKSGYFFGRVVVFND  86

Query  320  PIT----LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLM  487
            P+T    L      T V RAQG+Y  D K+ + AW+ FS V N+T  QG+++ +GADP +
Sbjct  87   PMTEGKALPPELEETAV-RAQGLYFLDRKDDFGAWMAFSIVFNSTAQQGTLSLMGADPNV  145

Query  488  NKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
             +T+DISVVGGTGDFFM RGVAT+  DA EG  YFRL++DI  YEC+
Sbjct  146  -ETKDISVVGGTGDFFMARGVATLRGDAVEGLKYFRLQMDISLYECY  191



>gb|EAZ04891.1| hypothetical protein OsI_27073 [Oryza sativa Indica Group]
Length=198

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 103/169 (61%), Gaps = 21/169 (12%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYN---------GQNAANATSTIVGAPQWGNYTILATQFHFGNVVVF  313
            +PC  + LY HD++Y+            A   T+     P  G          FG VVVF
Sbjct  37   EPCMEMRLYLHDILYDYSNSTSNSTSAAATKPTALATAVPSTGGT-------FFGQVVVF  89

Query  314  DDPIT----LDNNFHSTPVGRAQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADP  481
            +DP+T    L  +   T V RAQG+Y+Y++K  + AW  FS V N+T  +G++N +GAD 
Sbjct  90   NDPMTEGRALPPSLEETAV-RAQGVYLYNSKEAFNAWFAFSIVFNSTGRRGTLNLMGADI  148

Query  482  LMNKTRDISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +  KTRDISVVGGTGDFFM RGVAT+ TDAFEG  YFRL++DIK YEC+
Sbjct  149  IAEKTRDISVVGGTGDFFMSRGVATLRTDAFEGFTYFRLQMDIKLYECY  197



>ref|XP_006658879.1| PREDICTED: dirigent protein 6-like [Oryza brachyantha]
Length=198

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 107/162 (66%), Gaps = 8/162 (5%)
 Frame = +2

Query  161  KPCKNLVLYFHDVIYNGQNA-ANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPIT---  328
            +PC+ + LYFHD++Y+  N+ AN+TS +V  P       +     FG ++VFDDP+T   
Sbjct  38   EPCEKMRLYFHDILYDVSNSTANSTSAVVAKPTALLQATMNASV-FGTMMVFDDPMTEGK  96

Query  329  -LDNNFHSTPVGRAQGMYMYDTKNTYT-AWLGFSFVLNTTDSQGSINFIGADPLMNKTRD  502
             L      T V RAQG+Y YD +   + AW  FS V N+T+ +G+++ +GAD +  +TRD
Sbjct  97   ALPPALEETAV-RAQGLYFYDQRRAPSDAWFAFSVVFNSTERRGTLSVMGADIVAEETRD  155

Query  503  ISVVGGTGDFFMHRGVATVMTDAFEGEVYFRLRVDIKFYECW  628
            +SVVGGTGDFFM RGVAT+  DA EG  YFRL++DIK YEC+
Sbjct  156  LSVVGGTGDFFMARGVATLRGDAVEGFKYFRLQMDIKLYECY  197



>gb|EMS55048.1| hypothetical protein TRIUR3_07795 [Triticum urartu]
Length=184

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 97/148 (66%), Gaps = 4/148 (3%)
 Frame = +2

Query  197  VIYNG-QNAANATSTIVGAPQWGNYTILATQFHFGNVVVFDDPITLDNNFH---STPVGR  364
            V+YNG  N  NATS     P   + T      +FG +VVFDDP+T+          P  R
Sbjct  36   VLYNGVNNTKNATSAAATKPTALSTTHWKNGTYFGTLVVFDDPMTVGKALPVAGEEPAAR  95

Query  365  AQGMYMYDTKNTYTAWLGFSFVLNTTDSQGSINFIGADPLMNKTRDISVVGGTGDFFMHR  544
            AQG Y YD + +YT+W GFS V N+T  +G++N +GAD + +KTRD+SVVGGTGDFFM  
Sbjct  96   AQGFYFYDKQESYTSWFGFSIVFNSTAHKGTLNLVGADLMDDKTRDLSVVGGTGDFFMAC  155

Query  545  GVATVMTDAFEGEVYFRLRVDIKFYECW  628
            G+AT+  DA EG VYFRL++DIK YEC+
Sbjct  156  GIATLWLDASEGTVYFRLQMDIKLYECY  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1749734148162