BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31700_g1_i1 len=507 path=[485:0-506]

Length=507
                                                                      Score     E

gb|AAY84146.1|  lipid transfer protein                                93.6    5e-21   Catharanthus roseus [chatas]
ref|XP_009778825.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    1e-20   
ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    1e-20   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    3e-20   
gb|ACQ42221.1|  lipid transfer protein                                91.3    4e-20   Chimonanthus praecox [wintersweet]
gb|ACP43542.1|  lipid transfer protein                                90.9    5e-20   Chimonanthus praecox [wintersweet]
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  90.5    2e-19   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    1e-18   
ref|XP_009596391.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    3e-18   
emb|CDP15101.1|  unnamed protein product                              86.3    4e-18   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    5e-18   
ref|XP_004242229.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    7e-18   
ref|XP_004245220.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    1e-17   
emb|CDP12680.1|  unnamed protein product                              84.7    1e-17   
gb|AAT68264.1|  lipid transfer protein                                84.3    1e-17   Nicotiana glauca [glaucous tobacco]
ref|XP_003566138.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    3e-17   
gb|AEI70827.1|  non-specific lipid-transfer protein                   83.2    4e-17   
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    4e-17   
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    4e-17   
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          83.2    4e-17   Lactuca sativa [cultivated lettuce]
gb|AAY43800.1|  FSLTP2                                                83.2    4e-17   Gossypium hirsutum [American cotton]
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    4e-17   
ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    5e-17   
gb|AAT68262.1|  lipid transfer protein                                83.2    5e-17   Nicotiana glauca [glaucous tobacco]
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    7e-17   
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    8e-17   
gb|ACE07187.1|  Art v 3 allergen precursor                            82.0    1e-16   Artemisia vulgaris [common wormwood]
ref|NP_001055844.2|  Os05g0477900                                     82.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g           82.4    1e-16   
gb|AAT01364.1|  unknown protein                                       82.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    1e-16   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           81.6    1e-16   
gb|AEI70828.1|  non-specific lipid-transfer protein                   81.6    2e-16   
gb|AEI70829.1|  non-specific lipid-transfer protein                   81.3    2e-16   
ref|XP_009631015.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    2e-16   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    2e-16   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       80.5    4e-16   Artemisia vulgaris [common wormwood]
gb|AEI70830.1|  non-specific lipid-transfer protein                   80.5    4e-16   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    5e-16   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    5e-16   
ref|XP_009781151.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    6e-16   
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    6e-16   Vitis vinifera
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  79.0    8e-16   Morus nigra
gb|KHG10481.1|  Non-specific lipid-transfer 3                         80.1    9e-16   
gb|KHG30577.1|  Non-specific lipid-transfer                           79.7    1e-15   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    79.7    1e-15   Gossypium hirsutum [American cotton]
ref|XP_009594799.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    1e-15   
gb|AAT68263.1|  lipid transfer protein                                79.0    2e-15   Nicotiana glauca [glaucous tobacco]
gb|AFR43276.1|  lipid transfer protein precursor                      79.0    2e-15   
ref|XP_006407743.1|  hypothetical protein EUTSA_v10021759mg           79.0    2e-15   
emb|CDX93316.1|  BnaC04g45800D                                        79.0    2e-15   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  79.0    2e-15   Gerbera hybrid cultivar
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      79.0    2e-15   Nicotiana glauca [glaucous tobacco]
gb|ACE07189.1|  Art v 3 allergen precursor                            78.6    2e-15   Artemisia vulgaris [common wormwood]
ref|XP_009146980.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    2e-15   
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            78.6    2e-15   Corylus avellana [European hazelnut]
ref|XP_002532868.1|  Nonspecific lipid-transfer protein precursor...  78.2    3e-15   Ricinus communis
gb|AAC63372.1|  lipid transfer protein                                78.2    3e-15   Brassica oleracea
gb|AFM35695.1|  nonspecific lipid transfer protein                    78.2    4e-15   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    4e-15   
emb|CDY18379.1|  BnaA04g22080D                                        77.8    5e-15   
emb|CDX73941.1|  BnaA03g31060D                                        77.4    5e-15   
ref|XP_010451927.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    5e-15   
ref|XP_010515587.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    5e-15   
gb|KFK36763.1|  lipid transfer protein                                77.8    5e-15   
ref|XP_006369492.1|  hypothetical protein POPTR_0001s23940g           77.4    5e-15   
gb|ACE07186.1|  Art v 3.0201 allergen precursor                       77.4    6e-15   Artemisia vulgaris [common wormwood]
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    6e-15   
ref|XP_002877813.1|  hypothetical protein ARALYDRAFT_485512           77.4    7e-15   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  77.0    7e-15   Helianthus annuus
gb|KFK24679.1|  hypothetical protein AALP_AA8G011100                  77.4    7e-15   
ref|XP_006367906.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    7e-15   
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    8e-15   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    8e-15   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg           77.0    8e-15   
gb|ADY68820.1|  lipid transfer protein 3                              77.0    9e-15   
gb|AAY43801.1|  FSLTP3                                                77.0    9e-15   Gossypium hirsutum [American cotton]
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
gb|AAL27855.1|  lipid transfer protein precursor                      77.0    1e-14   Davidia involucrata
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            77.0    1e-14   Gossypium hirsutum [American cotton]
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  76.6    1e-14   Brassica oleracea var. italica [asparagus broccoli]
gb|AAS13435.1|  lipid-transfer protein                                76.6    1e-14   Nicotiana attenuata
ref|NP_190728.1|  pathogenesis-related protein LTP5                   76.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    1e-14   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              76.3    1e-14   
ref|XP_006292062.1|  hypothetical protein CARUB_v10018257mg           76.6    1e-14   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  76.3    1e-14   Ricinus communis
sp|Q41073.1|NLTP_PINTA  RecName: Full=Non-specific lipid-transfer...  76.6    1e-14   Pinus taeda
gb|ABY21307.1|  pollen allergen Pla o 3                               76.6    1e-14   Platanus orientalis
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            76.3    1e-14   Gossypium hirsutum [American cotton]
emb|CDY27974.1|  BnaC05g43760D                                        76.3    2e-14   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    2e-14   
gb|ABK96515.1|  unknown                                               76.3    2e-14   Populus trichocarpa x Populus deltoides
gb|AEI70826.1|  non-specific lipid-transfer protein                   76.3    2e-14   
gb|AGH32496.1|  non-specific lipid transfer protein                   76.3    2e-14   
gb|KFK34404.1|  hypothetical protein AALP_AA5G140700                  76.3    2e-14   
gb|AAT68265.1|  lipid transfer protein precursor                      75.9    2e-14   Nicotiana glauca [glaucous tobacco]
ref|XP_009778826.1|  PREDICTED: uncharacterized protein LOC104228120  77.8    2e-14   
ref|XP_006407744.1|  hypothetical protein EUTSA_v10021759mg           76.3    2e-14   
ref|XP_009618455.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  76.3    2e-14   
emb|CDY00655.1|  BnaC03g36390D                                        75.9    2e-14   
gb|KHG21711.1|  Non-specific lipid-transfer                           75.9    2e-14   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           75.9    2e-14   
ref|XP_010503855.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    2e-14   
gb|ABK94706.1|  unknown                                               75.9    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006403900.1|  hypothetical protein EUTSA_v10010829mg           75.5    3e-14   
gb|AAF14232.1|AF109195_1  lipid transfer protein                      75.5    3e-14   Hordeum vulgare [barley]
gb|ABK21262.1|  unknown                                               75.9    3e-14   Picea sitchensis
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               75.5    3e-14   Phalaenopsis japonica
gb|ABK23363.1|  unknown                                               75.5    3e-14   Picea sitchensis
ref|NP_001268120.1|  lipid transfer protein precursor                 75.5    3e-14   
ref|XP_010426733.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
gb|AGH32497.1|  non-specific lipid transfer protein                   75.5    3e-14   
ref|XP_010464489.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    3e-14   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    75.5    4e-14   Nicotiana tabacum [American tobacco]
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       75.1    4e-14   
gb|AEN70919.1|  lipid transfer protein                                75.1    4e-14   
gb|AEN70918.1|  lipid transfer protein                                75.1    4e-14   
emb|CDY36007.1|  BnaA05g29430D                                        75.1    4e-14   
ref|NP_001275802.1|  lipid-transfer protein precursor                 75.1    4e-14   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    4e-14   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            75.1    5e-14   
ref|XP_009115846.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    5e-14   
emb|CBW38497.1|  lipid transfer protein                               74.7    5e-14   
emb|CDY16295.1|  BnaC01g23300D                                        74.7    5e-14   
emb|CAL07989.1|  lipid transfer protein                               74.7    5e-14   Platanus x hispanica [London plane tree]
ref|XP_010558406.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    5e-14   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    5e-14   
gb|AHG99490.1|  lipid-transfer protein                                74.7    6e-14   
emb|CDY33268.1|  BnaA01g19350D                                        75.5    6e-14   
emb|CAN76145.1|  hypothetical protein VITISV_034315                   75.5    6e-14   Vitis vinifera
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    6e-14   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    74.7    6e-14   
ref|XP_010464583.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    6e-14   
ref|XP_006295252.1|  hypothetical protein CARUB_v10024340mg           74.7    7e-14   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    7e-14   
emb|CBW38503.1|  lipid transfer protein                               73.9    7e-14   
ref|XP_010043259.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    8e-14   
ref|XP_002872988.1|  predicted protein                                74.3    8e-14   
emb|CDO96795.1|  unnamed protein product                              74.3    8e-14   
emb|CDX78016.1|  BnaA09g32110D                                        74.3    9e-14   
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    9e-14   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           73.9    1e-13   
gb|AAM66937.1|  non-specific lipid transfer protein                   73.6    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             73.9    1e-13   Populus trichocarpa [western balsam poplar]
emb|CBW38504.1|  lipid transfer protein                               73.6    1e-13   
dbj|BAP11226.1|  hypothetical protein                                 73.9    1e-13   
gb|AEN70936.1|  lipid transfer protein                                73.9    1e-13   
ref|XP_011002608.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
emb|CBW38501.1|  lipid transfer protein                               73.6    1e-13   
ref|XP_009148874.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
ref|XP_009132605.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    1e-13   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         73.6    1e-13   Retama raetam [retem]
dbj|BAP11221.1|  hypothetical protein                                 73.6    1e-13   
dbj|BAP11218.1|  hypothetical protein                                 73.2    2e-13   
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
ref|XP_004245407.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  73.6    2e-13   
gb|KFK34405.1|  non-specific lipid transfer protein                   73.2    2e-13   
emb|CAH69197.1|  type 1 non specific lipid transfer protein precu...  73.2    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004506487.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
dbj|BAP11219.1|  hypothetical protein                                 72.8    2e-13   
gb|ACE80968.1|  putative allergen Pru du 3.03                         73.2    2e-13   Prunus dulcis x Prunus persica
dbj|BAP11220.1|  hypothetical protein                                 72.8    3e-13   
ref|XP_010253092.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    3e-13   
emb|CBW38499.1|  lipid transfer protein                               72.4    3e-13   
gb|AAQ96338.1|  lipid transfer protein                                72.8    3e-13   Vitis aestivalis
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
gb|AEN70935.1|  lipid transfer protein                                72.8    3e-13   
gb|ABE11609.1|  lipid-transfer protein precursor                      72.8    3e-13   Solanum chacoense
ref|XP_002323072.2|  hypothetical protein POPTR_0016s14290g           73.6    3e-13   Populus trichocarpa [western balsam poplar]
gb|AGH13363.1|  lipid transfer protein                                72.4    3e-13   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    3e-13   
ref|XP_004233683.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    3e-13   
emb|CDY38865.1|  BnaA03g13140D                                        72.4    4e-13   
ref|NP_001268074.1|  lipid transfer protein precursor                 72.8    4e-13   
ref|XP_004151695.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_006482792.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    4e-13   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  72.4    4e-13   Gossypium hirsutum [American cotton]
gb|KDP20367.1|  hypothetical protein JCGZ_05250                       72.4    4e-13   
gb|AEN70915.1|  lipid transfer protein                                72.4    4e-13   
ref|XP_006438990.1|  hypothetical protein CICLE_v10033098mg           72.4    4e-13   
gb|AEN70917.1|  lipid transfer protein                                72.4    4e-13   
emb|CDP14198.1|  unnamed protein product                              72.4    4e-13   
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  72.4    4e-13   Gossypium hirsutum [American cotton]
emb|CCK33472.1|  lipid transfer protein precursor                     71.6    4e-13   
ref|XP_009136622.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    4e-13   
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    4e-13   
gb|ABK20926.1|  unknown                                               72.4    5e-13   Picea sitchensis
gb|EYU42017.1|  hypothetical protein MIMGU_mgv1a016521mg              72.4    5e-13   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  72.8    5e-13   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    5e-13   
gb|ADV02773.1|  lipid transfer protein 1b                             71.6    5e-13   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    6e-13   
gb|KFK27462.1|  hypothetical protein AALP_AA8G386200                  72.0    6e-13   
ref|XP_008778991.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    7e-13   
dbj|BAO51648.1|  lipid transfer protein                               71.6    7e-13   
gb|AEN70933.1|  lipid transfer protein                                71.6    8e-13   
ref|XP_010931360.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    8e-13   
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           71.6    8e-13   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  71.2    8e-13   
ref|XP_002323667.1|  putative lipid transfer family protein           71.6    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010257636.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    9e-13   
gb|ACE80969.1|  putative allergen Pru p 3.03                          71.6    9e-13   Prunus dulcis x Prunus persica
emb|CBW38498.1|  lipid transfer protein                               71.2    9e-13   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    9e-13   
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    9e-13   
gb|AEN70916.1|  lipid transfer protein                                71.2    1e-12   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            71.2    1e-12   Gossypium hirsutum [American cotton]
ref|XP_009609143.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    1e-12   
ref|XP_010467649.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    1e-12   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    1e-12   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    1e-12   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         70.9    1e-12   Fragaria x ananassa
gb|AFR43289.1|  lipid transfer protein precursor                      70.9    1e-12   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 70.9    1e-12   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 71.2    1e-12   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           70.9    1e-12   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           70.9    1e-12   
ref|XP_002269620.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   Vitis vinifera
ref|XP_010414245.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             71.2    2e-12   
ref|XP_002305878.2|  lipid transfer family protein                    70.9    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002531706.1|  Nonspecific lipid-transfer protein precursor...  70.9    2e-12   Ricinus communis
gb|ABA29446.1|  non-specific lipid transfer protein                   70.9    2e-12   Vitis vinifera
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    2e-12   
gb|KHN43734.1|  Non-specific lipid-transfer protein 3                 71.2    2e-12   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           70.5    2e-12   
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
ref|XP_003623615.1|  Non-specific lipid-transfer protein              70.9    2e-12   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    70.9    2e-12   Prunus persica
ref|XP_008463259.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
ref|XP_011005006.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    2e-12   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    2e-12   
ref|XP_008388345.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    2e-12   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  70.9    2e-12   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    2e-12   
gb|KFK36744.1|  hypothetical protein AALP_AA4G164000                  70.5    2e-12   
gb|KCW88359.1|  hypothetical protein EUGRSUZ_A00745                   71.2    2e-12   
ref|XP_009126702.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    2e-12   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        70.5    2e-12   Vitis cinerea var. helleri x Vitis vinifera
gb|AGC08426.1|  lipid transfer protein                                70.1    3e-12   
gb|ABF74563.1|  lipid transfer protein                                70.1    3e-12   Brassica napus [oilseed rape]
gb|EYU42018.1|  hypothetical protein MIMGU_mgv1a016520mg              70.1    3e-12   
ref|XP_010931359.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    3e-12   
ref|XP_002884130.1|  protease inhibitor/seed storage/lipid transf...  70.1    3e-12   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         70.1    3e-12   Fragaria x ananassa
gb|ACM78614.1|  lipid transfer protein 2                              70.1    3e-12   Tamarix hispida
ref|XP_006446845.1|  hypothetical protein CICLE_v10017229mg           70.1    3e-12   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   70.1    3e-12   
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    3e-12   
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  70.1    3e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    3e-12   
gb|ACN11576.1|  lipid transfer protein 3 precursor                    70.1    3e-12   Prunus dulcis [sweet almond]
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    3e-12   
ref|XP_006842466.1|  hypothetical protein AMTR_s00077p00068900        69.7    4e-12   
ref|XP_003522081.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
gb|KHG04165.1|  Non-specific lipid-transfer A                         69.7    4e-12   
ref|XP_006296741.1|  hypothetical protein CARUB_v10014964mg           69.7    4e-12   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           70.5    4e-12   
ref|XP_008792224.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    4e-12   
ref|XP_006409161.1|  hypothetical protein EUTSA_v10022915mg           69.7    4e-12   
ref|XP_010922738.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    4e-12   
gb|AFG60788.1|  hypothetical protein 2_9857_02                        69.7    4e-12   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    4e-12   
gb|AFK37572.1|  unknown                                               69.7    4e-12   
ref|NP_001236518.1|  uncharacterized protein LOC100306032 precursor   69.7    4e-12   
ref|NP_001289050.1|  uncharacterized protein LOC103872288 precursor   69.7    4e-12   
emb|CAA42870.1|  E2                                                   69.7    4e-12   Brassica napus [oilseed rape]
gb|ABV25703.1|  E2B protein                                           69.7    4e-12   Brassica juncea [Indian mustard]
emb|CDY32649.1|  BnaA02g07110D                                        69.3    4e-12   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  69.3    4e-12   
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    5e-12   
gb|AFR43294.1|  lipid transfer protein precursor                      69.7    5e-12   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              69.3    5e-12   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           69.3    5e-12   
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    69.3    5e-12   
ref|XP_003605293.1|  Non-specific lipid-transfer protein              69.3    5e-12   
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    5e-12   
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    5e-12   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         69.3    5e-12   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    5e-12   
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    5e-12   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   69.3    5e-12   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    5e-12   
emb|CDX90642.1|  BnaA03g41390D                                        69.7    5e-12   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               69.3    6e-12   
emb|CBW38502.1|  lipid transfer protein                               68.9    6e-12   
ref|XP_006468966.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    6e-12   
gb|AAD09107.1|  nonspecific lipid-transfer protein precursor          68.9    6e-12   
ref|XP_006400973.1|  hypothetical protein EUTSA_v10015064mg           68.9    6e-12   
ref|XP_010517149.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    6e-12   
gb|ABR08655.1|  lipid transfer protein                                68.9    6e-12   
ref|NP_001065585.1|  Os11g0116000                                     68.9    6e-12   
gb|EAY79716.1|  hypothetical protein OsI_34868                        68.9    6e-12   
ref|XP_004488628.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    7e-12   
ref|NP_568905.1|  non-specific lipid-transfer protein 3               68.9    7e-12   
gb|AFR43295.1|  lipid transfer protein precursor                      68.9    7e-12   
ref|NP_187489.1|  lipid-transfer protein 6                            68.9    7e-12   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    7e-12   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   68.9    7e-12   
gb|AFR43288.1|  lipid transfer protein precursor                      68.9    8e-12   
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 72.4    8e-12   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  68.9    8e-12   
ref|XP_002884695.1|  hypothetical protein ARALYDRAFT_478179           68.6    8e-12   
gb|ACU24604.1|  unknown                                               68.9    8e-12   
gb|KHN40623.1|  Non-specific lipid-transfer protein                   68.9    8e-12   
gb|AGW21333.1|  lipid transfer protein                                68.6    9e-12   
ref|XP_009396870.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    9e-12   
ref|NP_001065988.1|  Os12g0115300                                     68.6    9e-12   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           68.9    9e-12   
emb|CAH69198.1|  type 1 non specific lipid transfer protein precu...  68.6    9e-12   
gb|AGH27864.1|  lipid transfer protein precursor                      68.6    9e-12   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    9e-12   
gb|AFK35133.1|  unknown                                               68.6    1e-11   
emb|CAH04985.1|  type 1 non-specific lipid transfer protein precu...  68.6    1e-11   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   68.6    1e-11   
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
ref|XP_011095131.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
gb|KDP45688.1|  hypothetical protein JCGZ_17295                       68.6    1e-11   
ref|XP_010043282.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
gb|AFG60786.1|  hypothetical protein 2_9857_02                        68.6    1e-11   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
gb|ABP01769.1|  lipid transfer protein 2                              68.2    1e-11   
emb|CAC86258.1|  lipid transfer protein                               68.2    1e-11   
gb|AGC08428.1|  lipid transfer protein                                68.6    1e-11   
ref|XP_010252071.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
ref|XP_006400974.1|  hypothetical protein EUTSA_v10014841mg           68.9    1e-11   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   
emb|CDY64020.1|  BnaCnng42980D                                        68.2    1e-11   
gb|AEC04836.1|  lipid transfer protein                                68.2    1e-11   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   68.2    1e-11   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 68.2    1e-11   
gb|ACQ42222.1|  lipid transfer protein 1                              68.2    2e-11   
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           67.8    2e-11   
gb|AFR43292.1|  lipid transfer protein precursor                      68.2    2e-11   
gb|KHN14506.1|  Non-specific lipid-transfer protein 3                 67.8    2e-11   
gb|KFK40228.1|  hypothetical protein AALP_AA3G347300                  67.8    2e-11   
ref|XP_006295253.1|  hypothetical protein CARUB_v10024341mg           67.8    2e-11   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           67.8    2e-11   
ref|XP_010424833.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    2e-11   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           68.2    2e-11   
ref|NP_179428.1|  non-specific lipid-transfer protein 8               67.8    2e-11   
gb|ABG54494.1|  putative allergen Rub i 3                             67.8    2e-11   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 67.8    2e-11   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   
emb|CDY51220.1|  BnaC09g09750D                                        67.4    2e-11   
ref|XP_011095136.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    2e-11   
emb|CDY60751.1|  BnaA05g34760D                                        67.8    2e-11   
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  67.4    2e-11   
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    2e-11   
ref|XP_011019013.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    2e-11   
dbj|BAB09777.1|  lipid transfer protein-like                          67.4    2e-11   
gb|EPS66894.1|  hypothetical protein M569_07878                       67.4    3e-11   
ref|XP_006411067.1|  hypothetical protein EUTSA_v10017425mg           67.4    3e-11   
ref|XP_009398877.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
ref|NP_001044654.1|  Os01g0822900                                     67.4    3e-11   
gb|AGH13362.1|  lipid transfer protein                                67.0    3e-11   
gb|ACM78613.1|  lipid transfer protein 1                              67.4    3e-11   
ref|XP_009112488.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
dbj|BAM28756.1|  lipid transfer protein homolog                       67.0    3e-11   
emb|CDY32650.1|  BnaA02g07120D                                        67.0    3e-11   
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
ref|XP_006292059.1|  hypothetical protein CARUB_v10018254mg           67.4    3e-11   
emb|CDY29026.1|  BnaC07g32320D                                        67.4    3e-11   
emb|CDP07650.1|  unnamed protein product                              67.0    3e-11   
gb|AFR43293.1|  lipid transfer protein precursor                      67.0    3e-11   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              67.0    3e-11   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    66.6    3e-11   
ref|XP_006411068.1|  hypothetical protein EUTSA_v10017425mg           67.0    3e-11   
ref|XP_009396875.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    4e-11   
ref|XP_009126703.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    4e-11   
ref|XP_002314213.2|  hypothetical protein POPTR_0009s03020g           67.0    4e-11   
ref|NP_001189842.1|  lipid-transfer protein 6                         67.0    4e-11   
gb|KHG09723.1|  Non-specific lipid-transfer                           67.0    4e-11   
gb|AFK38461.1|  unknown                                               66.6    4e-11   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         67.0    4e-11   
gb|AFR43285.1|  lipid transfer protein precursor                      67.0    4e-11   
gb|EMT21909.1|  Non-specific lipid-transfer protein 4.1               67.4    4e-11   
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  66.6    5e-11   
emb|CDY68127.1|  BnaC03g71570D                                        66.6    5e-11   
gb|AAL25839.1|  lipid transfer precursor protein                      66.6    5e-11   
ref|XP_003595853.1|  Non-specific lipid-transfer protein              66.6    5e-11   
emb|CAH69210.1|  type 1 non specific lipid transfer protein precu...  66.6    5e-11   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  66.6    5e-11   
gb|ADR66942.1|  non-specific lipid transfer protein                   66.6    5e-11   
ref|XP_007140136.1|  hypothetical protein PHAVU_008G087000g           66.6    5e-11   
gb|AFK45186.1|  unknown                                               66.2    6e-11   
ref|XP_002864627.1|  predicted protein                                66.2    6e-11   
emb|CDY02883.1|  BnaC02g10060D                                        66.2    6e-11   
gb|EYU23196.1|  hypothetical protein MIMGU_mgv1a016221mg              66.6    6e-11   
emb|CDY60288.1|  BnaA09g52860D                                        66.2    6e-11   
ref|XP_007017080.1|  Bifunctional inhibitor/lipid-transfer protei...  67.0    7e-11   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        66.2    7e-11   
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           66.2    7e-11   
ref|XP_008359045.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    7e-11   
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    8e-11   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         66.2    8e-11   
ref|XP_006842467.1|  hypothetical protein AMTR_s00077p00070120        66.2    8e-11   
gb|KDO78394.1|  hypothetical protein CISIN_1g047114mg                 66.2    8e-11   
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    8e-11   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    8e-11   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               65.9    8e-11   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    8e-11   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 65.9    8e-11   
ref|XP_002877812.1|  hypothetical protein ARALYDRAFT_485511           65.9    8e-11   
ref|XP_002320861.1|  hypothetical protein POPTR_0014s09360g           66.2    9e-11   
gb|ABG27026.1|  phosophlipid protein                                  65.9    9e-11   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         65.9    9e-11   
ref|XP_008366278.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    9e-11   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              65.9    9e-11   
ref|XP_011096023.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    9e-11   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    9e-11   
gb|EPS73762.1|  non-specific lipid-transfer protein                   65.9    1e-10   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           65.5    1e-10   
ref|XP_004135897.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|ADR66946.1|  non-specific lipid transfer protein                   65.9    1e-10   
gb|AFI61838.1|  harmalin                                              65.9    1e-10   
emb|CDP14199.1|  unnamed protein product                              65.5    1e-10   
gb|ADR66943.1|  non-specific lipid transfer protein                   65.5    1e-10   
ref|XP_009372012.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 65.5    1e-10   
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 65.9    1e-10   
gb|ACM78619.1|  non-specific lipid-transfer protein type 1            65.5    1e-10   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   
ref|XP_011095135.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  65.5    1e-10   
ref|XP_011016143.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   
gb|KCW88358.1|  hypothetical protein EUGRSUZ_A00744                   66.6    1e-10   
gb|ADR66945.1|  non-specific lipid transfer protein                   65.5    1e-10   
emb|CDX71121.1|  BnaC03g12050D                                        65.5    1e-10   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 65.5    1e-10   
ref|XP_004245221.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   
gb|ADV02772.1|  lipid transfer protein 1a                             65.5    1e-10   
gb|EYU42012.1|  hypothetical protein MIMGU_mgv1a016690mg              65.1    1e-10   
gb|AAT80649.1|  lipid transfer protein precursor                      65.1    2e-10   
gb|AHB19227.1|  non specific lipid transfer protein 1A                65.1    2e-10   
dbj|BAC77694.1|  lipid transfer protein                               65.1    2e-10   
sp|Q3YMR2.1|NLTP2_SOLCI  RecName: Full=Non-specific lipid-transfe...  65.1    2e-10   
ref|XP_010515586.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
gb|AGH27863.1|  lipid transfer protein precursor                      65.1    2e-10   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             65.1    2e-10   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  65.1    2e-10   
gb|EPS66895.1|  non-specific lipid-transfer protein                   64.7    2e-10   
gb|KEH29195.1|  Lipid transfer protein                                65.9    2e-10   
gb|AGC08424.1|  lipid transfer protein                                65.9    2e-10   
ref|XP_011096025.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_006367725.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              64.7    2e-10   
emb|CAA85484.1|  lipid transfer protein precursor                     64.7    2e-10   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    2e-10   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   64.7    2e-10   
gb|KDP28496.1|  hypothetical protein JCGZ_14267                       67.0    2e-10   
emb|CBI18043.3|  unnamed protein product                              65.1    3e-10   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       64.7    3e-10   
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
gb|AET05731.1|  lipid transfer protein isoform b                      63.9    3e-10   
ref|XP_003560704.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           64.7    3e-10   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  64.3    3e-10   
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   
gb|AGC08425.1|  lipid transfer protein                                64.7    3e-10   
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           64.3    3e-10   
gb|ADR66950.1|  non-specific lipid transfer protein                   64.3    3e-10   
gb|AGH27866.1|  lipid transfer protein precursor                      64.3    3e-10   
gb|AFK48111.1|  unknown                                               64.3    3e-10   
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   
dbj|BAI94496.1|  lipid transfer protein                               64.3    3e-10   
gb|ABH03042.1|  non-specific lipid transfer protein                   64.3    3e-10   
gb|KHL91133.1|  hypothetical protein QW71_36410                       64.3    3e-10   
ref|XP_006298841.1|  hypothetical protein CARUB_v10014953mg           64.3    3e-10   
dbj|BAB09776.1|  lipid transfer protein-like                          63.9    3e-10   
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   
gb|ADR66953.1|  non-specific lipid transfer protein                   64.3    4e-10   
gb|KEH29225.1|  Lipid transfer protein                                64.3    4e-10   
gb|AFK36168.1|  unknown                                               63.9    4e-10   
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 63.5    4e-10   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    4e-10   
ref|XP_004972928.1|  PREDICTED: probable non-specific lipid-trans...  64.3    4e-10   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    4e-10   
gb|AFD01291.1|  non-specific lipid-transfer protein                   63.9    4e-10   
gb|AAA86694.1|  phospholipid transfer protein precursor               63.9    4e-10   
gb|AEG79730.2|  lipid transfer protein precursor                      63.9    4e-10   



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = +2

Query  17   RKQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKK  196
            +KQL+ L++L  +   +   P  +EA +TC  + N L+ C +YV  GG +P +CC  VK 
Sbjct  9    QKQLLGLVILIWM---LAYNPRPSEA-LTCDDVNNNLISCLSYVAGGGKVPTSCCSGVKN  64

Query  197  VEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +    KT+ DRQ+AC C+K    +A  DQLKRAQ +P +C L  +PFPIS +VDCS +
Sbjct  65   LLSLAKTRNDRQTACSCLKSLAVEANNDQLKRAQTVPKSCSL-TIPFPISRDVDCSKV  121



>ref|XP_009778825.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=115

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            + +S L +C++   V  PP  A+A++TC  + + L PC  YVL G  +P+ CC  VK + 
Sbjct  5    KFLSFLFICMM---VAAPP--AKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLI  59

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             +  T  DRQSAC CVK   ++A  D+L RA  +P  C    +PF ISPNVDCS ++
Sbjct  60   STATTTADRQSACSCVKSLASRATGDELSRAAGIPGKCG-ANVPFDISPNVDCSKVN  115



>ref|XP_009757307.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 58/98 (59%), Gaps = 0/98 (0%)
 Frame = +2

Query  77   PLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKE  256
            P  AEA +TC  +VN+L+PC +YV+NGG +P TCC  +K +  + KT  DR+S C C+K 
Sbjct  25   PPRAEAAITCSTVVNSLIPCLSYVMNGGKVPPTCCQGIKSLYGAAKTAADRRSVCSCLKT  84

Query  257  TFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              +       K A  LP  C +  +PF ISP  DCS +
Sbjct  85   AASSVSGINFKNAAALPGKCGVKNIPFKISPKADCSKV  122



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWA-EAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKK  196
            KQL   L +C++ +        A +  VTC  + ++L PC  YVL G  +P  CC  +K 
Sbjct  4    KQLFPFLFICIVATATNTAAATAADETVTCNTVYDSLEPCLGYVLGGASVPPECCSGLKS  63

Query  197  VEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  + +T+ DRQSACQCVK   + A  DQ+ RA  +P  C    LPF IS NVDCS I
Sbjct  64   LLGAARTRTDRQSACQCVKSVASSATGDQISRAASIPGICK-AKLPFKISANVDCSKI  120



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKV  199
            + ++S+L   V+ +G ++   + EA +TC  + + L PC  YV NGG +PA+CC  V  +
Sbjct  3    RSMISVLAFVVMVTGALMVTPYVEAALTCGTVTSALSPCITYVRNGGSVPASCCQGVAAL  62

Query  200  EDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              + KT  DRQ+AC C+K   +     Q   A  LP  C + ++P+ ISP+ DCS +
Sbjct  63   NSAAKTTADRQAACSCLKSALSSVSGIQPSLASSLPGKCGV-SIPYQISPSTDCSKV  118



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            +S++++C++ S +++  L AEA  +C  +V++L PC  Y+ +GG +P TCC  VK +  +
Sbjct  6    VSIVVVCLMFSSILLSSLQAEAAFSCGTVVSSLTPCLTYLKSGGSVPTTCCSGVKSLNAA  65

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K   A     +L+ A  LP  C +  +P+ ISP+ DCS +
Sbjct  66   AKTTPDRQTACNCMKNAAAGITGLKLELAGSLPTKCGVN-IPYKISPSTDCSKV  118



>ref|XP_006353709.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=162

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = +2

Query  17   RKQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKK  196
            R  L+S +L+  +   VV PP  A+A +TC  + + + PC NYVL GG +P  CC  ++ 
Sbjct  6    RLMLLSFILIIYM---VVAPP-PAKAVITCDTVYDGVKPCLNYVLFGGSVPIDCCNGLES  61

Query  197  VEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
            +  S  T  DRQSAC CVK   + A  ++L RA  +P  C   ++PF ISPNVDCS
Sbjct  62   LIASATTTADRQSACSCVKSLASHATDEELSRAASIPGQCG-ASVPFEISPNVDCS  116



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 6/123 (5%)
 Frame = +2

Query  2    AVVGNRKQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCC  181
            A V ++K L+S LL+C++ S    PP  A A +TC  + N L PC NYVL GG++PA CC
Sbjct  41   ANVLSKKFLLSFLLICLVLS----PP-QARAVITCDTVFNDLKPCLNYVLVGGNVPAECC  95

Query  182  PAVKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDC  361
              +K +     T  DRQS C C+K     A  +Q+ RA  LP  C +  +PF IS +VDC
Sbjct  96   NGLKSLIVKAITTADRQSICSCLKSLATTATDEQVDRAASLPGKCGV-KVPFKISRDVDC  154

Query  362  SSI  370
            + +
Sbjct  155  TKV  157



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 64/125 (51%), Gaps = 9/125 (7%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQVT--------CPGLVNTLLPCANYVLNGGDIPAT  175
            KQL  LL +C++ S   I                  C  + ++L PC  YVL G  +P  
Sbjct  4    KQLFPLLFICIVVSVASITATATNTAAATAADATVTCNTVYDSLEPCLGYVLGGASVPPE  63

Query  176  CCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNV  355
            CC  +K +  + +T+ DRQSACQCVK   + A  DQ+ RA  +P  C    +PF IS NV
Sbjct  64   CCSGLKSLLSAARTRMDRQSACQCVKTVASSATGDQISRAASIPGICK-AKVPFKISANV  122

Query  356  DCSSI  370
            DCS I
Sbjct  123  DCSKI  127



>ref|XP_009596391.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=147

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  +VN L+PC +YV+NGG +P TCC  +K +  ++KT  DR+S C C+K   +    
Sbjct  56   ITCSTVVNGLIPCLSYVVNGGKVPPTCCKGIKSLYGAVKTTADRRSVCSCLKTATSSVSG  115

Query  278  DQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               K A  LP  C +  +PF ISP  DCS +
Sbjct  116  INFKNAAALPGKCGVKNIPFKISPKADCSKV  146



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVED  205
             +S+L++    SG        +AQ++C  + N L PC  +++NGG +P  CC  +  +  
Sbjct  20   FVSMLIMSFFRSG--------QAQISCDTVKNDLSPCIGFIMNGGKVPPACCSGLNTLLS  71

Query  206  SLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
              KT+ DRQSAC C+K     A  DQLK A  +P +C +  LPF IS +VDCS
Sbjct  72   LAKTRTDRQSACSCLKSVAESATDDQLKNAAQIPHSCGVN-LPFKISRDVDCS  123



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = +2

Query  2    AVVGNRKQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCC  181
            A V ++  L+S LL+C++ S    PP    A +TC  + + L PC +YVL GG++P  CC
Sbjct  2    ASVLSKTFLLSFLLICLVLS----PP-QTRAVITCDTVFSDLKPCLSYVLVGGNVPTECC  56

Query  182  PAVKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDC  361
              +K +  +  T +DRQ AC CVK     A  +Q+ RA  LP  C +  +PF IS +VDC
Sbjct  57   NGLKSLITNATTTEDRQMACSCVKNLATAATDEQVDRAASLPGKCGVN-VPFKISRDVDC  115

Query  362  SSI  370
            + +
Sbjct  116  TKV  118



>ref|XP_004242229.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=119

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +LLL ++   +V  P  A+A +TC  + + + PC NYVL GG +   CC  ++ V  S  
Sbjct  8    MLLLFILIIYMVAAPPPAKAVITCDTVYDGVKPCLNYVLFGGIVSTDCCNGLESVIASAT  67

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  D QS C C+K   ++A  D+L RA  +P  C    +PF ISPNVDCS +
Sbjct  68   TIADHQSTCSCIKSLASQATDDELSRAASIPGQCG-ATIPFEISPNVDCSKV  118



>ref|XP_004245220.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            +SLL L  I   V+      +A +TC  + N L+PC +YV+ GG +P TCC  +K +   
Sbjct  11   LSLLFLIYI---VIAASPRVDAAITCSSVFNGLIPCLSYVVKGGKVPPTCCRGIKSLYSI  67

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  D Q  C C+K   +       K A  LP  C +  +PF ISP VDCS +
Sbjct  68   AKTTADHQGVCSCLKMAASSVSGIDFKNAAALPGKCGVKNIPFKISPKVDCSKV  121



>emb|CDP12680.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = +2

Query  8    VGNRKQLMSLLLLCVITSGVVIP-PLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCP  184
            + N   L+ L  L +  S +++      +AQ++C  + N LLPC ++VLNGG +   CC 
Sbjct  1    MANSSGLLKLGTLVIFVSMLIMSFSHGGQAQISCDTVDNDLLPCLSFVLNGGKVAPACCS  60

Query  185  AVKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             +K +    KT+ DRQS C C+K     A   QLK A  +P  C +  +PF IS N+DCS
Sbjct  61   GIKTLLSLAKTQTDRQSVCSCLKSVAQSATNGQLKNAAQIPHLCGVN-VPFQISRNIDCS  119

Query  365  SI  370
             +
Sbjct  120  KV  121



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A+A + C  +V++L+PC NYV+ GG IPA CC  +K + +   +  DRQ+AC C+K   
Sbjct  22   HADAAIFCGRVVSSLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIKSAA  81

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            A  K      A  LP  C +  LP+ ISP++DCS++
Sbjct  82   ASIKGINFSHAGSLPGKCGV-NLPYKISPSIDCSTV  116



>ref|XP_003566138.1| PREDICTED: non-specific lipid-transfer protein P5-like [Brachypodium 
distachyon]
Length=130

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 58/99 (59%), Gaps = 2/99 (2%)
 Frame = +2

Query  77   PLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKE  256
            P  A A ++C  + NTL+PC  YV +GG +P  CC  +K++    ++ QDR++ C C+K 
Sbjct  32   PGGARAALSCSTVYNTLMPCLGYVQSGGTVPRACCTGIKRLVSGARSTQDRRTVCVCLKN  91

Query  257  TFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              + AK    L RA  LPA C +P LP+   PN  CSSI
Sbjct  92   VSSGAKGGPYLTRAAGLPARCGVP-LPYKTGPNDSCSSI  129



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M++++LC + + +V+   +AEA +TC  + ++L PC  Y+  GG +P  CC  VK + ++
Sbjct  4    MAMMVLCAVVTCMVVAAPYAEA-LTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K  +          A  LP  C + ++P+ ISP  DCS +
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGVNAGNAASLPGKCGV-SIPYKISPGTDCSKV  115



>ref|XP_011005034.1| PREDICTED: non-specific lipid-transfer protein 8-like [Populus 
euphratica]
Length=108

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (63%), Gaps = 5/104 (5%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSAC  241
            +V PP  ++A ++C  ++  L PC NY++NG G  PA CC  +  ++ +  T  D+QSAC
Sbjct  9    LVTPP--SDAAISCSDVIKDLRPCVNYLMNGTGKPPAACCSGISSIQAAASTTADKQSAC  66

Query  242  QCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             C+K    +  P + + AQ LPANC +  LPF +SPNVDCS I+
Sbjct  67   NCIKSASKQMNP-KPQLAQALPANCGI-TLPFTVSPNVDCSKIT  108



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVED  205
            L  L+ L  IT  VV P   A   +TC  ++N ++PC  Y+ NGG IPATCC  VK +  
Sbjct  7    LTKLVGLIFITMLVVAP--HAAQALTCGQVLNMVMPCLGYLKNGGSIPATCCGGVKNLAS  64

Query  206  SLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            S KTK DRQ AC+C+K   AK+      RA  LP+ C +      ISP +DCS++
Sbjct  65   SAKTKPDRQQACKCLKPA-AKSYGINYDRANKLPSACGVD-YKINISPTIDCSTV  117



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 65/114 (57%), Gaps = 4/114 (4%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M+ ++ CV+ + +V+   +AEA +TC  +V++L  CA+Y+ NGG +P  CC  VK +  +
Sbjct  4    MATMVFCVVVTCMVVAAPYAEAAITCGQVVSSLSQCASYLRNGGAVPPACCSGVKSLNSA  63

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +T  DRQ+ C C+K             A  LP  C +  +P+ ISP+ DCS +
Sbjct  64   ARTTPDRQTVCGCLKRASGGVNASN---AASLPGKCGVN-IPYKISPSTDCSKV  113



>gb|AAY43800.1| FSLTP2 [Gossypium hirsutum]
Length=120

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+  G+V+    A+  VTC  + N+L PC NY+     G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLGMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISPN DC+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPNTDCN  117



>ref|XP_009608993.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            L+++C+  +  V+    A+A ++C  +V  L PC NYV  GG +PA CC  +K + +   
Sbjct  7    LVVMCIAAATSVMLTPHADAAISCGQVVTRLSPCINYVRQGGALPAPCCSGIKALNNQAT  66

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ+AC C+K   A         A  LP+ C +  LP+ ISP++DCS++
Sbjct  67   TTPDRQAACNCIKSAAASISGINFNLAGSLPSKCGVN-LPYKISPSIDCSTV  117



>ref|XP_004245223.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=128

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = +2

Query  17   RKQLMSLLLLCV-ITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGG-DIPATCCPAV  190
             KQ   +LL+C+ +    +      +A +TC  +  TL PC +YVL GG  +P+ CC  +
Sbjct  9    NKQPFPMLLICIAVVMATITATTSQDATLTCNTVFTTLEPCLSYVLGGGLSVPSECCNGI  68

Query  191  KKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
            K + +   T  DRQSAC+C+K   + A P  + RA  +P  C    +PF ISP+VDCS
Sbjct  69   KSMLNGAYTIADRQSACKCIKSVVSSAAPGPVSRAAKVPGICK-ANVPFKISPHVDCS  125



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 67/112 (60%), Gaps = 2/112 (2%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            L+++C+    V++ P  A+A ++C  +V++L PC +YV  GG IPA CC  ++ + +   
Sbjct  7    LVVVCMAAVSVMLTP-HADAAISCGQVVSSLTPCISYVTKGGAIPAPCCNGIESLNNQAT  65

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  DRQ+AC C+K   A  K      A  LP  C +  LP+ ISP++DCS++
Sbjct  66   STPDRQTACNCIKSAAASIKGINFSLAGSLPGKCGV-NLPYKISPSIDCSTV  116



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            ++  C++ + +V+    AEA +TC  +   + PC NY+ NGG +PA CC  VK +  + K
Sbjct  9    VMFGCLVLAFMVVAAPNAEAAITCGMVATQMTPCVNYLQNGGPVPAACCNGVKTLYGAAK  68

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ+ C C+K    +    ++  A  LP  C +  +P+ ISP  DCS +
Sbjct  69   TTPDRQTTCSCMKSAATQVPTIKVGNAASLPGKCGI-TIPYKISPTTDCSKV  119



>ref|XP_006367904.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=116

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 7/119 (6%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGG-DIPATCCPAVKK  196
            KQL  LLL+C+  +         +A V+C  + + L PC  +VLNGG  +P+ CC  +K 
Sbjct  4    KQLFPLLLICIALA-----ATATDAAVSCNTVYSNLEPCLGFVLNGGPTVPSACCSGLKS  58

Query  197  VEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            +  +  T  DRQSAC+C+K   + A   Q+ RA  LP  C+   +P+ ISPNVDCS I+
Sbjct  59   LLVAAGTTADRQSACKCIKSLASSANGVQIGRASQLPGICN-AHIPYQISPNVDCSKIT  116



>gb|ACE07187.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=116

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 64/112 (57%), Gaps = 2/112 (2%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +   C +   +V+   +AEA +TC  + N + PC NY+  GG++PA CC  VK + D+ K
Sbjct  6    MKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAK  64

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ+AC C+K +F   K  +   A  LP+ C +  +P+ IS   DC+ +
Sbjct  65   TTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVN-IPYKISLETDCNKV  115



>ref|NP_001055844.2| Os05g0477900 [Oryza sativa Japonica Group]
 dbj|BAF17758.2| Os05g0477900 [Oryza sativa Japonica Group]
Length=129

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = +2

Query  56   TSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQS  235
            TS VV+    A A ++C  + NTLLPC  YV +GG +PA CC  ++ V  + +T  DR++
Sbjct  28   TSTVVV----ARAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRA  83

Query  236  ACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            AC C+K   A A     + RA  LP  C + ++PF ISPNV+C++++
Sbjct  84   ACTCLKNVAAGAAGGPYISRAAGLPGRCGV-SVPFKISPNVNCNAVN  129



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGG-DIPATCCPAVKKVEDSL  211
            L ++C++      P   A+AQ+TC  +VN L PC +YV+ GG ++PA CC  +K +    
Sbjct  11   LAIVCLVLGATTSPK--AQAQMTCGQVVNNLSPCISYVMYGGVNVPAQCCNGIKNLYGQA  68

Query  212  KTKQDRQSACQCVKETFAKA----KPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +TK DRQ+ C C+K   + +        L  A +LP  C +  +P+ ISPN DC+S+
Sbjct  69   QTKTDRQAICSCIKNAVSNSGFNYSRSNLNNAANLPKKCGVN-IPYQISPNTDCNSV  124



>gb|AAT01364.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY98428.1| hypothetical protein OsI_20343 [Oryza sativa Indica Group]
 gb|EEE64096.1| hypothetical protein OsJ_18927 [Oryza sativa Japonica Group]
Length=138

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 65/108 (60%), Gaps = 6/108 (6%)
 Frame = +2

Query  56   TSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQS  235
            TS VV+    A A ++C  + NTLLPC  YV +GG +PA CC  ++ V  + +T  DR++
Sbjct  28   TSTVVV----ARAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRA  83

Query  236  ACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSISK  376
            AC C+K   A A     + RA  LP  C + ++PF ISPNV+C++  K
Sbjct  84   ACTCLKNVAAGAAGGPYISRAAGLPGRCGV-SVPFKISPNVNCNAYVK  130



>ref|XP_004245406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 66/121 (55%), Gaps = 7/121 (6%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAE---AQVTCPGLVNTLLPCANYVLNGG-DIPATCCPA  187
            KQL SLLL+C+  +    P + AE     VTC  + + L PC  YVL GG  +P+ CC  
Sbjct  4    KQLFSLLLICIAVA--TTPSIAAEDAITVVTCSTVYSRLEPCLGYVLGGGLSVPSECCNG  61

Query  188  VKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSS  367
            +K +  + +T  DRQ  C+C+K   + A   ++ RA  L   C + AL F I P+ DCS 
Sbjct  62   IKSLHRAARTTADRQRFCRCLKNVRSNATNTRISRASQLTGICKVNAL-FKIRPDFDCSK  120

Query  368  I  370
            +
Sbjct  121  V  121



>ref|XP_006369490.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
 gb|ERP66059.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
Length=108

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 13/117 (11%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVE  202
            LM  LLL         PP  +EA ++C  ++  L PC +Y++NG G  PA CC  +  ++
Sbjct  4    LMMFLLL--------TPP--SEAAISCSDVIKDLRPCVSYLMNGTGKPPAACCSGISAIQ  53

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             S  T  D+Q+AC C+K    +  P   + AQ LPANC +  LPF +SPNVDCS I+
Sbjct  54   ASASTTADKQAACNCIKSASKQINPSP-QLAQALPANCGI-TLPFTVSPNVDCSKIT  108



>gb|AEI70828.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M++++LC + + +V+   +AEA +TC  + ++L PC  Y+  GG +P  CC  VK +  +
Sbjct  4    MAMMVLCAVVTCMVVVAPYAEA-LTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKSLNSA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K  ++         A  LP  C +  +P+ ISP  DCS +
Sbjct  63   AKTTPDRQAACGCLKSAYSSISGINEGNAASLPGKCGVN-IPYKISPGTDCSKV  115



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M++++LC + + +V+   +AEA ++C  + ++L PC  Y+  GG +P  CC  VK + ++
Sbjct  4    MAMMVLCAVVTCMVVVAPYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K  +          A  LP  C + ++P+ ISP  DCS +
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPGTDCSKV  115



>ref|XP_009631015.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=102

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +2

Query  74   PPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVK  253
            PP+ AE  +TC  + + L PC  YVL G  +P+ CC  VK +  S  T  DRQ AC CVK
Sbjct  6    PPVKAE--LTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLIASATTTADRQIACSCVK  63

Query  254  ETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
               ++A  D+L RA  +P  C    +PF ISP+VDCS ++
Sbjct  64   SLASRATGDELSRAAGIPGKCG-ANVPFDISPDVDCSKVN  102



>ref|XP_009135090.1| PREDICTED: non-specific lipid-transfer protein 6-like [Brassica 
rapa]
Length=115

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPAT-CCPAVKKVEDSLKTKQDRQSACQCVKET  259
              EA VTC  +V  L PC +YV+ GG+ P+T CC  V+ +    +T  DRQS C+C+K  
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  260  FAKA--KPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               A      LK A  LPA C +  LPF ISP+ +C+SI
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVN-LPFSISPSTNCNSI  114



>gb|ACE07188.1| Art v 3.0301 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 1/110 (1%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            + C++   +V+   +AE+ +TC  +   + PC +Y+  GG++PA CC  VK + D+ KT 
Sbjct  8    VFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTT  67

Query  221  QDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+AC C+K +F   K  +   A  LP+ C L  LP+ +S   DC+ +
Sbjct  68   PDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGL-NLPYKLSLETDCNKV  116



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (59%), Gaps = 2/114 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M++++LC + + +V+   +AEA ++C  + ++L PC +Y+  GG +P  CC  VK +  +
Sbjct  4    MAMMVLCAVVTCMVVAAPYAEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNCA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  115



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 66/117 (56%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L+ L+L C+I +G    P+ A A +TC  + + + PC  Y+  GG +P  CC  V K+ 
Sbjct  6    KLVCLVLACMIVAG----PITANAALTCGTVNSNVAPCIGYITQGGPLPGACCTGVSKLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC+C+K   +   P     RA  +P  C + ++PFPIS N +C+S+
Sbjct  62   SMARTTPDRQQACRCLKTAASALGPSLNAGRAAGIPKACGV-SVPFPISTNTNCNSV  117



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            ++ SL ++C+    + I    AEA VTC  +   L PC +YV  GG IPA CC  ++ + 
Sbjct  3    KVASLAVVCIAAMLIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGIRSLF  62

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +  T QDRQ+ C C+K          L  A  LP  C +  +P+ ISP++DC+ +
Sbjct  63   SAASTTQDRQTVCNCMKSAAGAISGVNLNLAAALPNKCGVN-IPYKISPSIDCAKV  117



>ref|XP_009781151.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+ P  A A +TC  + N L PC +YVL GG +P  CC  +K +  +  T  DRQSAC 
Sbjct  22   MVVAPPPAMAGITCDTVYNDLQPCLSYVLVGGSVPEECCSGLKSLLANATTTPDRQSACS  81

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            CVK   + A  +++ RA  +   C    +PF ISP+VDCS ++
Sbjct  82   CVKNLASAATGEEVSRAASITGQCGA-NVPFKISPDVDCSKVN  123



>ref|XP_002276372.1| PREDICTED: non-specific lipid-transfer protein 1 [Vitis vinifera]
 emb|CBI15816.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            A+A VTC  +   L PC NY++ GG IP++CC  VK+V+ + KT +DR++AC C+++  A
Sbjct  25   ADATVTCSQVTQLLNPCVNYLIYGGAIPSSCCAGVKQVKAASKTGEDRRTACSCIQDGAA  84

Query  266  KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                        LP+ C + +LP+ ISP+ DCS I+
Sbjct  85   MIPGIDYNLVASLPSQCGV-SLPYKISPSTDCSRIN  119



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  + ++L PC NY+  GG +PA CC  V+ + ++ KT  DRQ+AC C+K  F   K 
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG  60

Query  278  DQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              L  A  LP  C + ++P+ ISP+ DC S+
Sbjct  61   LNLNLAAGLPGKCGV-SVPYKISPSTDCKSV  90



>gb|KHG10481.1| Non-specific lipid-transfer 3 [Gossypium arboreum]
Length=140

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 5/117 (4%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L+S++L+  +T  V+  P  A+A +TC  +VN L+PC +YV NGG   A CC  VK + 
Sbjct  8    KLVSMILIVCMT--VMSAPKAAKAAITCSDVVNHLIPCLSYVQNGGTPAAACCSGVKALY  65

Query  203  DSLKTKQDRQSACQCVKETFAK--AKPDQLKRAQDLPANCHLPALPFPISPNVDCSS  367
               +T  DRQ+ C+C+K          + L  A  LPA C L  LP+ ISP+ DC++
Sbjct  66   GEAQTSPDRQNVCKCIKSAVNGIPYTSNNLNLAAGLPAKCGLQ-LPYSISPSTDCNN  121



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + N+L PC NY+     G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPVCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+S+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPSTDCNSV  119



>gb|AAG29777.1| lipid transfer protein 3 precursor [Gossypium hirsutum]
 gb|ACI26697.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43270.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43271.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43272.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + N+L PC NY+     G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+S+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPSTDCNSV  119



>ref|XP_009594799.1| PREDICTED: non-specific lipid-transfer protein 4-like [Nicotiana 
tomentosiformis]
Length=123

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+ P  A A +TC  + N L PC +YVL GG +   CC  +K +  S  T  D QSAC 
Sbjct  22   MVVAPPPAMAAITCDTVYNDLQPCLSYVLIGGSVSTECCSGLKSLLASATTTPDHQSACS  81

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            CVK   + A  +++ RA  +P  C    +PF ISP+VDCS ++
Sbjct  82   CVKNLASAATGEEVSRAARIPGQCGA-NVPFKISPDVDCSKVN  123



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A+A ++C  +V +L PC NYV  GG IPA CC  +K +     +  DRQ+AC C+K   
Sbjct  22   HADAAISCGQVVTSLTPCINYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIKSAA  81

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                      A  LP  C +  LP+ ISP++DCS++
Sbjct  82   RSISGINFGLASSLPGKCGV-NLPYKISPSIDCSTV  116



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYV--LNGGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + ++L PC NY+     G IP  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DCSS+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGV-NIPYKISPSTDCSSV  119



>ref|XP_006407743.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49196.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=113

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C  +V+ L PC +YV+ GG++PA+CC  ++ +    +T  DRQS C+C+K    
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  266  --KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                  + L  A  LPA C +  LP+ ISP+ +C SI+
Sbjct  77   GVSYSSNNLNNALSLPAKCGV-NLPYRISPSTNCDSIN  113



>emb|CDX93316.1| BnaC04g45800D [Brassica napus]
Length=118

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 68/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ A A +TC  + + + PC  Y+  GG +P  CC  V K+ 
Sbjct  6    KLACLVLACMIVAG----PITANAALTCGTVNSNVAPCIGYITQGGTLPGACCTGVSKLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC+C+ ET A+A    L   RA  +P  C + ++PFPIS N +C+++
Sbjct  62   SMARTTPDRQQACRCL-ETAARALGPNLNAGRAAGIPKACGV-SVPFPISTNTNCNNV  117



>sp|Q39794.1|NLTP_GERHY RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gerbera hybrid cultivar]
 emb|CAA83459.1| lipid transfer protein [Gerbera hybrid cultivar]
Length=116

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M + +LCV  + +V    +A+A ++C  + + L+PC  Y+  GG +P  CC  V+ + ++
Sbjct  4    MVMNVLCVAVACMVFSASYADA-ISCGQVTSGLVPCFGYLAAGGPVPPACCNGVRGLNNA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K   A      L  A  LP  C + ++ + I+PN+DCS I
Sbjct  63   AKTTPDRQTACGCLKGILAANTRINLNNANSLPGKCGI-SIGYKITPNIDCSKI  115



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 55/95 (58%), Gaps = 1/95 (1%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            A+A ++C  +V++L PC +YV  GG IPA CC  +K + +   +  DRQ+AC C+K    
Sbjct  23   ADAAISCGQVVSSLTPCISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAVG  82

Query  266  KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                     A  LP  C +  LP+ ISP++DCS++
Sbjct  83   SISGINFGLASSLPGKCGV-NLPYKISPSIDCSTV  116



>gb|ACE07189.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +AEA +TC  +   + PC NY+  GG++PA CC  VK + D+ KT  DRQ+AC C+K +F
Sbjct  22   YAEAALTCSDVSTKISPCLNYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASF  81

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               K  +   A  LP+ C L  LP+ +S   DC+ +
Sbjct  82   KSNKDLKSDFAVPLPSKCGL-NLPYKLSLETDCNKV  116



>ref|XP_009146980.1| PREDICTED: non-specific lipid-transfer protein 6 [Brassica rapa]
Length=113

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 3/98 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C  +V  L PC +YV+ GG++PA CC  ++ +    +T  DRQ  C+C+K    
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  266  KA--KPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                  + +  AQ LPA C +  LP+ ISP+ +C SI+
Sbjct  77   GVSFSSNNVNNAQSLPAKCGV-NLPYSISPSTNCDSIN  113



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 1/115 (1%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVED  205
            + SL L+C +   +++    A A +TCP +   L PC  Y+ NGG +P +CC  V+ V D
Sbjct  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND  60

Query  206  SLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            + +T  DRQSAC C+K+T           A  LP  C +  +P+ ISP+ +C+++
Sbjct  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV-NIPYKISPSTNCNNV  114



>ref|XP_002532868.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF29522.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=115

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            + +S L+LCV    VV  P+  +A +TC  +V  L PC  Y+++GG++ A CC  V+ + 
Sbjct  7    EFISCLVLCV----VVAMPMTTQA-ITCDQVVGGLTPCIGYLMSGGEVSAACCNGVRGLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + KT  DRQ  CQC K   A    +    A  LP  C++  + F I P+ DC+SI
Sbjct  62   SAAKTTADRQQICQCFKSLGAGGMTN--GYASSLPGKCNVN-VTFKIGPSTDCNSI  114



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 66/117 (56%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ A A +TC  + + + PC  Y+  GG +P  CC  V K+ 
Sbjct  6    KLACLVLACMIVAG----PITANAALTCGTVNSNVAPCIGYITQGGPLPRACCTGVSKLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC+C+K   +   P+    RA  +P  C + ++PFPIS N +C+++
Sbjct  62   SMARTTPDRQQACRCLKTAASALGPNLNAGRAAGIPKACGV-SVPFPISTNTNCNNV  117



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  ++++C+    VV  P   EA +TC  + ++L PC NY+ +GG +P  CC  +K + 
Sbjct  8    KLACVMVICM----VVAVPASVEAAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLN  63

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             + +T  DRQ+AC+C+K             A  LP  C + ++P+ ISP+ DCS ++
Sbjct  64   SAAQTTADRQTACKCLKSLSGSIPGINYGLASGLPGKCGV-SVPYKISPSTDCSKVT  119



>ref|XP_011011316.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=116

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +LLLC++ S    P L  EA ++C  +   L  C  Y+ NGG +PA CC  V+ + ++ K
Sbjct  9    VLLLCMVLSA---PMLNVEA-LSCGVVAGNLAQCLGYLRNGGKVPAVCCKGVEALNNAAK  64

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T QDR+ AC C+K T A+        A  LP  CH+  +P+ IS + +C+SI
Sbjct  65   TTQDRRDACNCIKTTAAQLGGVNSNYAAALPGLCHVN-IPYKISTSTNCASI  115



>emb|CDY18379.1| BnaA04g22080D [Brassica napus]
Length=119

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ A A +TC  + + + PC  Y+  GG +P  CC  V K+ 
Sbjct  6    KLACLVLACMIVAG----PITANAALTCGTVNSNVAPCIGYITQGGPLPGACCTGVSKLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCS  364
               +T  DRQ AC+C+K   +   P+    RA  +P  C + ++PFPIS N +C+
Sbjct  62   SMARTTPDRQQACRCLKTAASALGPNLNAGRAAGIPKACGV-SVPFPISTNTNCN  115



>emb|CDX73941.1| BnaA03g31060D [Brassica napus]
 emb|CDX73942.1| BnaA03g31050D [Brassica napus]
Length=113

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 4/97 (4%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPAT-CCPAVKKVEDSLKTKQDRQSACQCVKET  259
              EA VTC  +V  L PC +YV+ GG+ P+T CC  V+ +    +T  DRQS C+C+K  
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  260  FAKA--KPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
               A      LK A  LPA C +  LPF ISP+ +C+
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVN-LPFSISPSTNCN  112



>ref|XP_010451927.1| PREDICTED: non-specific lipid-transfer protein 10 [Camelina sativa]
Length=116

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 3/97 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            +EA V+C  +V  L PCA YV  GG IP +CC  ++ +    K+  DRQ  C+C+K    
Sbjct  20   SEAAVSCNAVVANLYPCAVYVAQGGTIPGSCCTGIRMLNGQAKSASDRQGVCRCIKSALG  79

Query  266  --KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                    LK A  LPA C +  LP+ I P+ +C+SI
Sbjct  80   GVSYSSKNLKNAATLPAKCGVK-LPYKIDPSTNCNSI  115



>ref|XP_010515587.1| PREDICTED: non-specific lipid-transfer protein 5-like [Camelina 
sativa]
Length=118

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 70/118 (59%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++    V  P+ ++A ++C  +   L  C NY+  GG IP  CC  V+++ 
Sbjct  6    KLSTLVIVCML----VAAPMASDAAISCGAVTGNLGQCYNYLTRGGFIPRGCCSGVQRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A++   +L   RA  LP  CH+  + +PIS  ++C+++
Sbjct  62   SMARTTRDRQQACRCIQGA-ARSLGSRLNAGRAARLPGACHVR-ISYPISARINCNTV  117



>gb|KFK36763.1| lipid transfer protein [Arabis alpina]
Length=119

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ + A + C  + N + PC  Y+L GG I + CC  V+ + 
Sbjct  6    KLACLVLTCMIVAG----PITSNAALGCGQVNNAVAPCIGYILQGGAITSGCCNGVRGLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCS  364
            ++ +T  DR++ACQC+K   A   P     RA  LP  C + ++PFPIS + +C+
Sbjct  62   NAARTTPDRKAACQCLKNAAAALGPGLNAGRAAGLPRACGV-SVPFPISTSTNCN  115



>ref|XP_006369492.1| hypothetical protein POPTR_0001s23940g [Populus trichocarpa]
 gb|ERP66061.1| hypothetical protein POPTR_0001s23940g [Populus trichocarpa]
Length=118

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            ++A ++C  ++  L PC  Y++NG G  PA CC  +  ++ +  T  D+Q+AC C+K   
Sbjct  24   SDAAISCSDVIKDLRPCVKYLMNGTGKPPAACCSGISAIQATASTTADKQAACNCIKSAS  83

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             +  P+  + AQ LPANC +  LPF +SPNVDCS I+
Sbjct  84   KQINPNP-QLAQALPANCGI-TLPFAVSPNVDCSKIT  118



>gb|ACE07186.1| Art v 3.0201 allergen precursor [Artemisia vulgaris]
Length=114

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 2/112 (2%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +   C +   +V+   +AEA + C  + N +  C +Y+  GG++PA CC  VK + D+ K
Sbjct  4    MKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAK  62

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ+AC C+K TF   K  +   A  LP+ C +  +P+ IS   DC+ +
Sbjct  63   TTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVN-IPYKISLETDCNKV  113



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = +2

Query  38   LLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKT  217
            +L  +I+SG   P +  +A ++C  L + L PC NY + GG +P  CC  V+ +  + KT
Sbjct  15   VLSMIISSG---PYVHVDAAISCGQLASLLSPCVNYFVKGGPLPPACCSGVRTLNSAAKT  71

Query  218  KQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              DRQ+ CQC+K   A      L  A  +P  C +   P+ ISP+ DCS +
Sbjct  72   TADRQATCQCLKSAAASIPGLNLGLANSIPGKCGV-NFPYKISPSTDCSRV  121



>ref|XP_002877813.1| hypothetical protein ARALYDRAFT_485512 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54072.1| hypothetical protein ARALYDRAFT_485512 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++    V  P+ +EA ++C  +  +L  C NY+  GG IP  CC  V+++ 
Sbjct  6    KLSTLVIVCML----VAAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLH  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+++
Sbjct  62   SMARTTRDRQQACRCIQGA-ARALGSRLNAGRAARLPGACRVR-ISYPISARTNCNTV  117



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 2/114 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M++++LC   + +V+   + EA ++C  + ++L PC +Y+  GG +P  CC  VK +  +
Sbjct  4    MAMMVLCAGVTCMVVGAPYTEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ+AC C+K  +          A   P  C + ++P+ ISP+ DCS +
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGV-SIPYKISPSTDCSKV  115



>gb|KFK24679.1| hypothetical protein AALP_AA8G011100 [Arabis alpina]
Length=120

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 12/116 (10%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            LL+  ++ SG       +EA V C  +V+ L PCA YV  GG +P  CC  ++ +    +
Sbjct  12   LLIASMVASG-------SEAAVNCNTVVSYLYPCATYVAQGGVVPVRCCYGIRTLIGQAR  64

Query  215  TKQDRQSACQCVKETFAKA----KPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ  C+C+K   A       P  LK A +L   C + +LP+ ISP+ +C+SI
Sbjct  65   TTGDRQGVCRCIKNALAGVSYTPSPKYLKNASNLLNRCRV-SLPYKISPSTNCNSI  119



>ref|XP_006367906.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 2/118 (2%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGG-DIPATCCPAVKK  196
            KQ+  LLL+C+  +            VTC  + ++L PC  YVL GG  +P+ CC  +K 
Sbjct  4    KQVFPLLLICIAVATAASIAAEDATVVTCSTVYSSLEPCLGYVLGGGLSVPSECCSGIKS  63

Query  197  VEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  + +T  DRQ  C+C+K   + A   ++ RA  L   C + A  F I P+ DCS +
Sbjct  64   LHRAARTTADRQRFCRCLKNVRSNATDTRINRASKLTGICKVNAF-FKIRPDFDCSKV  120



>ref|XP_011095132.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=123

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  95   QVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAK  274
            +++C  + +TL PC  YVLNGG +P +CC  VK +     T  DR+  C C+K   + A 
Sbjct  32   KISCGKVTSTLAPCFEYVLNGGKVPNSCCDGVKSLYKEASTTADRREVCVCLKSVTSSAS  91

Query  275  PDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            P  +  A+ LP  C + ++P+ I+P +DC+ +
Sbjct  92   PGVINNAKSLPGKCGV-SIPYEITPAIDCNKV  122



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 1/107 (1%)
 Frame = +2

Query  50   VITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDR  229
            V+   V+  P    A +TC  +V+++ PC NY+  GG +P  CC  VK +  + KT  DR
Sbjct  13   VVAVMVIAAPHQEVAAITCGQVVSSIAPCLNYLQKGGAVPPACCSGVKSLNSAAKTTPDR  72

Query  230  QSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            Q+AC C+K         Q   A  LPA C +  +P+ ISP+ DCS +
Sbjct  73   QTACNCLKSAAVSNPSIQAGLASSLPAKCGV-NVPYKISPSTDCSKV  118



>ref|XP_006429571.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
 ref|XP_006481184.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
 gb|ESR42811.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
Length=125

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 7/114 (6%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            L+L+C++ S  V      +AQVTC  +VN L PC +YV  GG +   CC  V+ + ++ +
Sbjct  16   LVLVCLMGSAFV----STKAQVTCRTVVNDLSPCISYVSYGGAVTTNCCNGVRTLYNAAR  71

Query  215  TKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  DRQ+ C C+K+  +       QL  A  LP  C L  +P+ ISP+ DCS +
Sbjct  72   STADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLN-IPYQISPSTDCSRV  124



>gb|ADY68820.1| lipid transfer protein 3 [Gossypium herbaceum subsp. africanum]
 gb|ADY68822.1| lipid transfer protein 3 [Gossypium barbadense]
 gb|ADY68824.1| lipid transfer protein 3 [Gossypium hirsutum]
 gb|AEN70921.1| lipid transfer protein [Gossypium darwinii]
 gb|AEN70923.1| lipid transfer protein [Gossypium tomentosum]
 gb|AEN70925.1| lipid transfer protein [Gossypium barbadense var. brasiliense]
 gb|AEN70927.1| lipid transfer protein [Gossypium barbadense var. peruvianum]
 gb|AEN70929.1| lipid transfer protein [Gossypium hirsutum subsp. latifolium]
Length=120

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + N+L PC NY+     G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPSTDCN  117



>gb|AAY43801.1| FSLTP3 [Gossypium hirsutum]
Length=116

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + N+L PC NY+     G +P  CC  +K + 
Sbjct  1    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  60

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  61   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPSTDCN  113



>ref|XP_010486423.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 62/117 (53%), Gaps = 6/117 (5%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M  LLL +    +V+     EA V+C   V  L PC +YV+ GG +P +CC  +K +   
Sbjct  1    MKFLLLAMC---LVLALRCGEAAVSCSTTVAELYPCVSYVVQGGAVPESCCNGIKALNSQ  57

Query  209  LKTKQDRQSACQCVKETFAKAK--PDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             +T  DRQS C+C+K          + L  A  LP+ C L +LP+  SP+ +C SI+
Sbjct  58   AQTAADRQSVCRCIKSAIGGVSYTSNNLNNALSLPSKCGL-SLPYKFSPSTNCDSIN  113



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 2/121 (2%)
 Frame = +2

Query  8    VGNRKQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPA  187
            +G    ++ + ++ V+   VV  P  AEA +TC  +  +L PC NY+  GG +P  CC  
Sbjct  1    MGRSGVVIKVGIVAVLMCMVVSAP-HAEAAITCGTVTVSLAPCLNYLKKGGPVPPACCNG  59

Query  188  VKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSS  367
            +K +  + KT  DRQ+AC C+K          L  A  LP  C +  +P+ ISP+ DCS 
Sbjct  60   IKSLNAAAKTTADRQAACNCLKTASTSIAGINLSYASSLPGKCGVN-VPYKISPSTDCSK  118

Query  368  I  370
            +
Sbjct  119  V  119



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYV--LNGGDIPATCCPAVKKVE  202
            M L L CV+   +V+    A+  VTC  + ++L PC NY+     G IP  CC  +K + 
Sbjct  5    MYLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DCSS+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGV-NIPYKISPSTDCSSV  119



>sp|Q42641.1|NLTPA_BRAOT RecName: Full=Non-specific lipid-transfer protein A; Short=LTP 
A; AltName: Full=Wax-associated protein 9A; Flags: Precursor 
[Brassica oleracea var. italica]
 gb|AAA73945.1| lipid transfer protein [Brassica oleracea var. italica]
Length=118

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 67/118 (57%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ A   +TC  + + + PC  Y+  GG +P  CC  V K+ 
Sbjct  6    KLACLVLACMIVAG----PITANRALTCGTVNSNVAPCIGYITQGGTLPGACCTGVSKLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC+C+ ET A+A    L   RA  +P  C + ++PFPIS N +C+++
Sbjct  62   SMARTTPDRQQACRCL-ETAARALGPNLNAGRAAGIPKACGV-SVPFPISTNTNCNNV  117



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A+A ++C  +V +L PC +YV  GG IPA CC  +K + +   +  DRQ+AC C+K   
Sbjct  22   HADAAISCGQVVASLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAA  81

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            A         A  LP+ C +  LP+ ISP++DCS++
Sbjct  82   AAINGINYSLAGSLPSKCGV-NLPYKISPSIDCSTV  116



>ref|NP_190728.1| pathogenesis-related protein LTP5 [Arabidopsis thaliana]
 sp|Q9XFS7.1|NLTP5_ARATH RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP 
5; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB43522.1| non-specific lipid transfer protein [Arabidopsis thaliana]
 emb|CAB63024.1| non-specific lipid transfer protein [Arabidopsis thaliana]
 gb|AAF76931.1| lipid transfer protein 5 [Arabidopsis thaliana]
 gb|AAL25528.1| AT3g51600/F26O13_240 [Arabidopsis thaliana]
 gb|AAM16208.1| AT3g51600/F26O13_240 [Arabidopsis thaliana]
 gb|AEE78811.1| pathogenesis-related protein LTP5 [Arabidopsis thaliana]
Length=118

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++    V  P+ +EA ++C  +  +L  C NY+  GG IP  CC  V+++ 
Sbjct  6    KLSTLVIVCML----VTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+++
Sbjct  62   SLARTTRDRQQACRCIQGA-ARALGSRLNAGRAARLPGACRVR-ISYPISARTNCNTV  117



>ref|XP_009608991.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608992.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=106

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 1/95 (1%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            A+A ++C  +V +L PC +YV  GG +PA CC  +K +     T  DRQ+AC C+K   A
Sbjct  12   ADAAISCRQVVTSLSPCISYVRQGGALPAPCCSGIKALNSQATTTPDRQAACICIKSAAA  71

Query  266  KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                     A  LP+ C +  LP+ ISP++DCS++
Sbjct  72   GVSGINFSLAGSLPSKCGV-NLPYKISPSIDCSTV  105



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = +2

Query  77   PLWAEAQVTCPGLVNTLLPCANYVLNGGDIPAT-CCPAVKKVEDSLKTKQDRQSACQCVK  253
            P  AEA ++C  + +TL PC N+VL GG  P T CC  +K + +      DRQ+ C C+K
Sbjct  16   PPQAEAAISCGTVASTLSPCINFVLYGGPTPPTSCCEGIKTLYNEATATADRQAVCSCLK  75

Query  254  ETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               + A P  +  A  LP  C + ++P+ ISP+ DCSS+
Sbjct  76   SVASSATPAIISNAAALPGKCGV-SIPYKISPSTDCSSV  113



>ref|XP_006292062.1| hypothetical protein CARUB_v10018257mg [Capsella rubella]
 gb|EOA24960.1| hypothetical protein CARUB_v10018257mg [Capsella rubella]
Length=118

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 66/117 (56%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++    V  P+ +EA ++C  +  +L  C NY+  GG IP  CC  V+++ 
Sbjct  6    KLSTLMIVCML----VTAPMASEAAISCGAVTGSLGQCYNYLTRGGIIPRGCCSGVQRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++       P    +RA  LP  C +  + +PIS   +C+++
Sbjct  62   RLARTTRDRQQACRCIQGAARALGPRLNARRAAHLPGACRVR-IAYPISARTNCNTV  117



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 61/113 (54%), Gaps = 3/113 (3%)
 Frame = +2

Query  38   LLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDI--PATCCPAVKKVEDSL  211
            L+L V    V + P  AEA ++C  + N L PC NYV+ GG    P  CC  +K + +  
Sbjct  7    LVLAVTMVVVALAPPQAEAAISCGTVANDLSPCINYVMYGGAGTPPVPCCTGIKTLYNQA  66

Query  212  KTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +  DRQ+ C C+K    +A P  +  A  LP  C + ++P+ ISP+ DCS +
Sbjct  67   SSTADRQAVCGCLKSVAGQASPAIIGTAAALPGKCGV-SIPYEISPSTDCSKV  118



>ref|XP_002528683.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF33672.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=114

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L+S L+LC+    VV  P+  EA +TC  +V+ L  C +Y+ +GG +P  CC  V+ + 
Sbjct  7    KLISFLVLCL----VVAMPMTTEA-ITCGQVVSGLSSCLSYLRSGGAVPPACCNGVRGLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + KT  DRQ  C+C+K   A      L  A  LP  C++  +P+ ISP+ DC SI
Sbjct  62   SAAKTTADRQQVCECLKSAAAGI---NLSNASSLPGKCNVN-IPYKISPSTDCKSI  113



>sp|Q41073.1|NLTP_PINTA RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Pinus taeda]
 gb|AAA82182.1| nonspecific lipid transfer protein [Pinus taeda]
Length=123

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +2

Query  89   EAQVTCPGLVNTLLPCANYVLNGGDIPA-TCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            E  ++C  +V+ + PCA Y++     PA TCCP+++ ++  +K   DRQ+ C C+K T A
Sbjct  29   EGAISCNQVVSAMTPCATYLIGNAATPAATCCPSIRGLDSQVKATPDRQAVCNCLK-TQA  87

Query  266  KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            K+   +L +A +LP  C +  L  PISPNVDCS +
Sbjct  88   KSYGVKLGKAANLPGLCKVTDLNVPISPNVDCSKV  122



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 1/110 (1%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            L C++ + +V     AEA +TC  +V  L PC  Y+ +GG +   CC  VK + +  KT 
Sbjct  9    LACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTT  68

Query  221  QDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+AC C+K         QL  A  L   C +  LP+ ISP +DCS +
Sbjct  69   PDRQAACGCLKTASTSISGIQLGNAASLAGKCGVN-LPYKISPTIDCSKV  117



>gb|AAF35184.1|AF195863_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26701.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43273.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43274.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43275.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  +  +L PC NY+  NG G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DCS +
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINYGIASGLPGKCGVN-IPYKISPSTDCSRV  119



>emb|CDY27974.1| BnaC05g43760D [Brassica napus]
Length=111

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C  +V  L PC +YV+ GG++PA CC  ++ +    +T  DRQ  C+C+K    
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  266  KA--KPDQLKRAQDLPANCHLPALPFPISPNVDC  361
                  + L  AQ LPA C +  LP+ ISP+ +C
Sbjct  77   GVSFSSNNLNNAQSLPAKCGV-NLPYSISPSTNC  109



>ref|XP_004963700.1| PREDICTED: non-specific lipid-transfer protein 2A-like, partial 
[Setaria italica]
Length=127

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            A A ++C  + NTL+PC  YV +GG +P  CC  ++++    +T  DR++ C C+K   A
Sbjct  23   AGAALSCSTVYNTLMPCLGYVQSGGTVPRACCSGIQRLVSGARTTPDRRAICTCLKNVAA  82

Query  266  KAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSS  367
             A     + RA  LP  C +P LP+ +SPN++C+S
Sbjct  83   GAAGGPYISRAAGLPGRCGVP-LPYKLSPNMNCNS  116



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            MSL L C +   +V+    AEA ++C  + ++L  C  Y+  GG +PA CC  +K +  +
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              T  DRQ  C C+K    K        A  LP+ C + ++ + ISP+ DC S+
Sbjct  65   ATTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGV-SISYKISPSTDCKSV  117



>gb|AEI70826.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=118

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 65/116 (56%), Gaps = 4/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M++++LC + + +V+   +AEA ++C  + ++L PC  Y+  GG +P  CC  VK +  +
Sbjct  4    MAMMVLCAVVTCMVVAAPYAEA-LSCGQVSSSLAPCIGYLTKGGVVPPACCSGVKSLNSA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPN--VDCSSI  370
             KT  DRQ+AC C+K  ++         A  LP  C +  +P+ ISP    DCS +
Sbjct  63   AKTTPDRQAACGCLKSAYSSISGINSGNAASLPGKCGVN-IPYKISPGTRTDCSKV  117



>gb|AGH32496.1| non-specific lipid transfer protein [Papaver somniferum]
Length=117

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            VVI P  AE  ++C  +V+ L PC  Y+   G +PA CC  VK +  + +T  DRQ+ C 
Sbjct  16   VVIVPFVAEGAISCGTVVSKLSPCVGYLTGLGSLPANCCTGVKSLYQAAQTTSDRQTVCG  75

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            C+K         ++  A  LP  C + ++P+  S ++DCS ++
Sbjct  76   CLKNAAKSMTNIKMSNAASLPGKCGV-SIPYTFSTSIDCSKVN  117



>gb|KFK34404.1| hypothetical protein AALP_AA5G140700 [Arabis alpina]
Length=118

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 68/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L + +++C++    V  P+ +EA ++C  + ++L  C  Y+  GG IP  CC  V+++ 
Sbjct  6    KLSTFVIVCML----VAAPMTSEAAISCGAVTSSLSQCIGYLFRGGFIPRACCLGVRRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++ T A+A   +L   RA  LP  C +  + +PIS   +C+ I
Sbjct  62   GMARTTRDRQQACRCIQGT-ARALGSRLNPGRAARLPGACRVR-IAYPISARTNCNRI  117



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A+A ++C  +V +L PC NYV  GGDIP  CC  +K +     +  DRQ+AC C+K   
Sbjct  22   HADAAISCGQVVTSLTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIKSAA  81

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVD  358
                      A  LP  C +  LP+ ISP++D
Sbjct  82   GSISGINFGLASSLPGKCGV-NLPYKISPSID  112



>ref|XP_009778826.1| PREDICTED: uncharacterized protein LOC104228120 [Nicotiana sylvestris]
Length=226

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 1/95 (1%)
 Frame = +2

Query  80   LWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKET  259
            L  EA ++   + ++L PC  YVL GG +P  CC  +K +    KT+ DRQS C C K  
Sbjct  47   LRTEALLSSDTVYSSLQPCIGYVLGGGTLPPECCSGLKSLISIAKTRPDRQSFCSCAKGA  106

Query  260  FAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             +   P++L RA  L   CH   +PF ISP++DCS
Sbjct  107  ASSTTPEELARANGLAGRCHA-RVPFKISPDMDCS  140



>ref|XP_006407744.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49197.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=129

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C  +V+ L PC +YV+ GG++PA+CC  ++ +    +T  DRQS C+C+K    
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  266  --KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSISK  376
                  + L  A  LPA C +  LP+ ISP+ +C    K
Sbjct  77   GVSYSSNNLNNALSLPAKCGV-NLPYRISPSTNCDRYVK  114



>ref|XP_009618455.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
 gb|AHB86570.1| non-specific lipid-transfer protein LTP1.1 [Nicotiana tabacum]
Length=129

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 10/126 (8%)
 Frame = +2

Query  20   KQLMSLLLLCV---------ITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPA  172
            KQL+S L +C+          T      P+ A+  VTC  ++N+L  C  YV+ GG +P+
Sbjct  4    KQLLSFLFICIPLVVVAVITATITTTAAPIAADETVTCDTVINSLRSCLGYVIGGGIVPS  63

Query  173  TCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPN  352
             CC  +K +    +T  D QSAC+C+K   +    ++  R   +P  C    +PF ISP+
Sbjct  64   ECCNGLKSLLIVARTTADHQSACKCLKSIDSGVTREEFSRVASIPRICK-AKVPFKISPD  122

Query  353  VDCSSI  370
            VDCS I
Sbjct  123  VDCSKI  128



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 8/119 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L SL+L+  +   VV   L A A VTC  +V TL PC +YV  GG +P  CC  VK + 
Sbjct  8    KLASLMLVVCM---VVSATLQARAAVTCGDVVRTLTPCISYVQYGGPLPDNCCNGVKTLY  64

Query  203  DSLKTKQDRQSACQCVKET---FAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ+ C+C+K     F+ +  + L  A  LP  C L  LP+ ISP+ DC+ +
Sbjct  65   GEAQTSADRQNVCKCIKSAVNGFSYSNFN-LGLAAGLPGKCGLH-LPYTISPSTDCNKV  121



>emb|CDY00655.1| BnaC03g36390D [Brassica napus]
Length=113

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 4/97 (4%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPAT-CCPAVKKVEDSLKTKQDRQSACQCVKET  259
              EA VTC  +V  L PC +YV+ GG+ P+T CC  V+ +    +T  DRQS C+C+K  
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNAPSTNCCNGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  260  FAKA--KPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
               A      L  A  LPA C +  LPF ISP+ +C+
Sbjct  77   IGGASYSSSNLNNALSLPAKCGVN-LPFSISPSTNCN  112



>gb|KHG21711.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYV--LNGGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + ++L PC +Y+     G IP  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCISYLRGTGAGAIPPGCCSGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC+C+K      +      A  LP  C +  +P+ ISP+ DC+S+
Sbjct  65   SAAQTTPDRQAACKCIKSAATGIRGINFGLASGLPGKCGVN-IPYKISPSTDCNSV  119



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ A+A +TC  + + +  C  Y+  GG +P  CC  +K + 
Sbjct  6    KLAFLVLACMIVAG----PITAKAALTCGTVTSNVAACIGYITQGGPVPGACCSGIKNLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC+C+K       P+    RA  LP  C +  +PFPIS + +C+S+
Sbjct  62   SMARTTPDRQQACRCLKTAANALGPNLNAGRAAGLPKACGVN-VPFPISTSTNCNSV  117



>ref|XP_010503855.1| PREDICTED: non-specific lipid-transfer protein 5-like [Camelina 
sativa]
Length=118

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 5/119 (4%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKV  199
            ++LM L  L VI   +V  P+ ++A ++C  +   L  C NY+  GG IP  CC  V+++
Sbjct  2    ERLMKLSTL-VIVCMLVAAPMASDAAISCGAVTGNLGQCYNYLTRGGFIPRGCCSGVQRL  60

Query  200  EDSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
                +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS  ++C+++
Sbjct  61   NSMARTTRDRQQACRCIQGA-ARALGSRLNAGRAARLPGACRVR-ISYPISARINCNTV  117



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            MSL L C +   +V+    AEA ++C  + ++L  C  Y+  GG +PA CC  +K +  +
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPAACCSGLKGLNSA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              T  DRQ  C C+K    K        A  LP+ C + ++ + ISP+ DC S+
Sbjct  65   ATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGV-SISYKISPSTDCKSV  117



>ref|XP_006403900.1| hypothetical protein EUTSA_v10010829mg [Eutrema salsugineum]
 gb|AGC11819.1| putative lipid transfer protein 5 [Eutrema halophilum]
 gb|ESQ45353.1| hypothetical protein EUTSA_v10010829mg [Eutrema salsugineum]
Length=118

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 68/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++ S     PL +EA ++C  + + L  C NY+  GG IP  CC  V+++ 
Sbjct  6    KLSTLVIVCMLVS----APLASEAAISCGAVASNLGQCINYLTRGGFIPRGCCSGVQRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+ +
Sbjct  62   SMARTTRDRQQACRCIQGA-ARALGSRLNPGRAARLPGACRVR-ISYPISARTNCNRV  117



>gb|AAF14232.1|AF109195_1 lipid transfer protein [Hordeum vulgare]
 dbj|BAJ87805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query  32   SLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            +L+L  V+ + VV PP+   A ++C  + +TL+PC  YV  GG     CC  ++ +    
Sbjct  8    ALVLAMVLAAMVVAPPVTVRAAISCSAVYSTLMPCLQYVQQGGTPARGCCAGIQNLLAEA  67

Query  212  KTKQDRQSACQCVKETFAKAKP--DQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                DR++ C C+K   A A P   ++ RA  LP+ C++  LP+ ISP+VDC+SI
Sbjct  68   NNSPDRRTICGCLKN-VANAAPGGSEITRAAALPSKCNV-NLPYKISPSVDCNSI  120



>gb|ABK21262.1| unknown [Picea sitchensis]
 gb|ABK25285.1| unknown [Picea sitchensis]
 gb|ABR16206.1| unknown [Picea sitchensis]
Length=123

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = +2

Query  80   LWA----EAQVTCPGLVNTLLPCANYVLNGGDIPA-TCCPAVKKVEDSLKTKQDRQSACQ  244
            +WA    E  VTC  +V  + PCA Y++     PA  CCP++++++  +K   DRQS C 
Sbjct  22   VWAAGRVEGAVTCNQVVTAMTPCAGYLIGNAATPAPACCPSIRQLDSQVKATPDRQSVCN  81

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K T AK+   +L +A +LP  C +  L  P++PNVDCS +
Sbjct  82   CLK-TQAKSYGVKLAKAVNLPGLCKVTDLNVPVNPNVDCSKV  122



>gb|AAF71695.1|AF198168_1 phospholipid transfer protein [Hygrochilus japonicus]
Length=120

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 67/119 (56%), Gaps = 4/119 (3%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQ--VTCPGLVNTLLPCANYVLNGGDIPATCCPAVK  193
            +   S+ ++C++ S +++  ++ EA   +TC  +V+TL PC +Y+     +P TCC  VK
Sbjct  3    RSTASMAVVCIV-SFLLVSGVFREASGTITCGQVVSTLTPCISYIRGDSTLPQTCCSGVK  61

Query  194  KVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            K+     T  DRQ AC C+K   +        RA  LP NC + ++P+PIS + DCS +
Sbjct  62   KLNALASTSPDRQGACSCLKNLASHIPNLNPARAAGLPGNCGV-SVPYPISTSTDCSKV  119



>gb|ABK23363.1| unknown [Picea sitchensis]
Length=123

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = +2

Query  80   LWA----EAQVTCPGLVNTLLPCANYVLNGGDIPA-TCCPAVKKVEDSLKTKQDRQSACQ  244
            +WA    E  VTC  +V  + PCA Y++     PA  CCP++++++  +K   DRQS C 
Sbjct  22   VWAAGRVEGAVTCNQVVTAMTPCAGYLIGNAATPAPACCPSIRQLDSQVKATPDRQSVCN  81

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K T AK+   +L +A +LP  C +  L  P++PNVDCS +
Sbjct  82   CLK-TQAKSYGVKLAKAVNLPGLCKVTDLNVPVNPNVDCSKV  122



>ref|NP_001268120.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33393.1|AF467945_1 lipid transfer protein isoform 1 [Vitis vinifera]
Length=119

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 3/93 (3%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  + + + PCA+Y+  GG +PA CC  +K +  + KT  DRQ+AC+C+K TF+ + P
Sbjct  29   ITCGQVASAVGPCASYLQKGGSVPAGCCSGIKSLNSAAKTTVDRQAACKCLK-TFSGSIP  87

Query  278  D-QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                  A  LP  C + ++P+ ISP+ DCS ++
Sbjct  88   GINFGLASGLPGKCGV-SVPYKISPSTDCSKVT  119



>ref|XP_010426733.1| PREDICTED: non-specific lipid-transfer protein 5 [Camelina sativa]
Length=118

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++    V  P+ ++A ++C  +   L  C NY+  GG IP  CC  V+++ 
Sbjct  6    KLSTLVIVCML----VAAPMASDAAISCGAVTGNLGQCYNYLTRGGFIPRGCCSGVQRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS  ++C+++
Sbjct  62   SMARTTRDRQQACRCIQGA-ARALGSRLNAGRAARLPGACRVR-ISYPISARINCNTV  117



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            MSL L C +   +V+    AEA +TC  + ++L  C  Y+  GG +P  CC  +K +  +
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGALPPACCSGLKSLNSA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT  DRQ  C C+K    K        A  LP+ C + ++P+ ISP  DC ++
Sbjct  65   AKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGV-SIPYKISPATDCKTV  117



>gb|AGH32497.1| non-specific lipid transfer protein [Papaver somniferum]
Length=116

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +2

Query  35   LLLLCVITSGVV-IPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            L L CV+ + +V + P  AE  ++C  + + + PC  Y L GG +PATCC  VK +  S 
Sbjct  5    LKLACVVLACMVAVAPYAAEGAISCGMVTSKMAPCLGY-LTGGTLPATCCAGVKSLLASA  63

Query  212  KTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +T  DRQ+AC C+K             A  LP+ C +  +P+ ISP+ DC+ +
Sbjct  64   QTTPDRQAACSCLKSASGGIAGLNYGNAASLPSKCGVN-IPYKISPSTDCTKV  115



>ref|XP_010464489.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C   V  L PC +Y++ GG++P +CC  +K +    +T  DRQS C+C+K    
Sbjct  17   GEAAVSCSTTVAELYPCVSYIVQGGNVPESCCNGIKALNSQAQTAADRQSVCRCIKSAIG  76

Query  266  KAK--PDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                  + L  A  LP+ C L  LP+  SP+ +C SI+
Sbjct  77   GVSYTSNNLNNALSLPSKCGLN-LPYKFSPSTNCDSIN  113



>ref|XP_009800887.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
 dbj|BAK19152.1| lipid transfer protein [Nicotiana tabacum]
Length=117

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A+A ++C  +V +L PC +YV  GG IPA CC  +  + +   +  DRQ+AC C+K   
Sbjct  22   HADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIKSAA  81

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            A         A  LP+ C +  LP+ ISP++DCS++
Sbjct  82   AGISGINFSLAGSLPSKCGV-NLPYKISPSIDCSTV  116



>gb|AAT45202.1| lipid transfer protein 1 precursor [Nicotiana tabacum]
Length=124

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A+A ++C  +V +L PC +YV  GG IPA CC  +  + +   +  DRQ+AC C+K   
Sbjct  29   HADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIKSAA  88

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            A         A  LP+ C +  LP+ ISP++DCS++
Sbjct  89   AGISGINFSLAGSLPSKCGV-NLPYKISPSIDCSTV  123



>gb|KDP21874.1| hypothetical protein JCGZ_00661 [Jatropha curcas]
Length=119

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            L+++  +   ++  P+ A A +TC  +V  L PC  Y+ +GG +P  CC  ++ + ++ +
Sbjct  6    LVMIVSLAVMMMFAPMAARAAITCGDVVRELTPCVGYLQSGGQVPGNCCNGIRTLYNAAQ  65

Query  215  TKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ+ CQC++   +  +     L  AQ LPA C++  +P+ I P+ +C ++
Sbjct  66   TTPDRQAVCQCLESAVSNFRYSSYNLGLAQSLPAKCNVN-IPYKIDPSTNCKNV  118



>gb|AEN70919.1| lipid transfer protein [Gossypium mustelinum]
 gb|AEN70920.1| lipid transfer protein [Gossypium mustelinum]
Length=120

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + ++L PC  Y+  NG G +P++CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGGVPSSCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDC  361
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVN-IPYKISPSTDC  116



>gb|AEN70918.1| lipid transfer protein [Gossypium turneri]
 gb|AEN70931.1| lipid transfer protein [Gossypium armourianum]
 gb|AEN70932.1| lipid transfer protein [Gossypium harknessii]
Length=120

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + ++L PC NY+  NG G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGNGAGAVPPGCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAASISGINFGIASGLPGKCGVN-IPYKISPSTDCN  117



>emb|CDY36007.1| BnaA05g29430D [Brassica napus]
Length=111

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C  +V  L PC +YV+ GG++PA CC  ++ +    +T  DRQ  C+C+K    
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  266  KA--KPDQLKRAQDLPANCHLPALPFPISPNVDC  361
                  + +  AQ LPA C +  LP+ ISP+ +C
Sbjct  77   GVSFSSNNVNNAQSLPAKCGV-NLPYSISPSTNC  109



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L+S L+LC++ +G    PL A+A +TC  +  +L PC  ++ +GG IP  CC  V+ + 
Sbjct  5    KLVSALVLCMLVTG----PLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLN  59

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC C+K+         L  A  LP  C + ++P+ IS + DCS +
Sbjct  60   AAARTTPDRQTACNCLKQAAGSIPNLNLNNAAGLPGACGV-SIPYKISTSTDCSKV  114



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
             A   +TC  + +++  C +YV +GG IPA+CC  V+ +  S KT  DR++ C C+K T 
Sbjct  23   HAANAITCGQVASSVSGCISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKSTA  82

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            A+    +   A  LP+ C +  +PF ISP+ DCS ++
Sbjct  83   ARISGIKPALAAGLPSKCGVR-IPFTISPSTDCSKVT  118



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = +2

Query  50   VITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDR  229
            V+   VV+    AEA +TC  + +++ PC NY+  GG +PA CC  V+ +  + KT  DR
Sbjct  10   VVCLAVVVGAPLAEA-ITCGQVSSSVAPCINYLKVGGAVPAACCNGVRSLNSAAKTTADR  68

Query  230  QSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
            Q+AC C+K   A  K   L  A  LP  C + ++P+ ISP+ +C+
Sbjct  69   QAACNCLKTASASIKGINLSLAAGLPGKCGV-SVPYKISPSTNCN  112



>ref|XP_009115846.1| PREDICTED: non-specific lipid-transfer protein 5 [Brassica rapa]
 emb|CDX73711.1| BnaC08g22920D [Brassica napus]
Length=118

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 68/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++ S     P+ +EA ++C  + + L  C NY+  GG +P  CC  V+++ 
Sbjct  6    KLSTLVIVCMLVS----APMASEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVRRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+ +
Sbjct  62   SMARTTRDRQQACRCIQGA-ARALGSRLNPGRAARLPGACRVR-IAYPISARTNCNKV  117



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+   +AEA ++C  + N+L PC  Y+  GG +P  CC  VK + ++ KT  DRQ+AC 
Sbjct  2    MVVAAPYAEA-LSCGQVSNSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>emb|CDY16295.1| BnaC01g23300D [Brassica napus]
Length=116

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +LL++C++ S     P+ +EA ++C  + + L  C NY+  GG +P  CC  V+++ 
Sbjct  6    KLSTLLIVCMLVS----APMASEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLH  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCS  364
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+
Sbjct  62   SMARTTRDRQQACRCIQGA-ARALGSRLNPGRAARLPGACRVR-ISYPISARTNCN  115



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 58/110 (53%), Gaps = 1/110 (1%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            L C++ + +V     AEA +TC  +V  L PC  ++ +GG +   CC  VK + +  KT 
Sbjct  9    LACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTT  68

Query  221  QDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+AC C+K         QL  A  L   C +  LP+ ISP +DCS +
Sbjct  69   PDRQAACGCLKTASTSISGIQLGNAASLAGKCGVN-LPYKISPTIDCSKV  117



>ref|XP_010558406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Tarenaya 
hassleriana]
Length=120

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 52/96 (54%), Gaps = 3/96 (3%)
 Frame = +2

Query  92   AQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKA  271
            A VTC  +V+ L+PC +YV  GG +PA CC  V+ +    +T  DRQ  C+C+K      
Sbjct  26   AAVTCNQVVSDLMPCVSYVAQGGGVPANCCNGVRALNGQARTASDRQGVCRCLKAALNGV  85

Query  272  KPD--QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                  L  A  LP+ C +  LPF ISP+  C SI+
Sbjct  86   SYTAFNLNNAASLPSKCGVR-LPFAISPSTSCDSIN  120



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            MSL L C +   +V+    AEA +TC  + ++L  C  Y+  GG +PA CC  +K +  +
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGAVPAACCSGLKSLNSA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              T  DRQ  C C+K    K        A  LP+ C + ++ + ISP+ DC ++
Sbjct  65   AATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGV-SISYKISPSTDCKTV  117



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L+S L+LC++ +G    PL A+A +TC  +  +L PC  ++ +GG IP  CC  V+ + 
Sbjct  5    KLVSALVLCMLVTG----PLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLN  59

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC C+K+         L  A  LP  C + ++P+ IS + DCS +
Sbjct  60   AAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGV-SIPYKISTSTDCSKV  114



>emb|CDY33268.1| BnaA01g19350D [Brassica napus]
Length=146

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 80/152 (53%), Gaps = 17/152 (11%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +LL++C++ S     P+ AEA ++C  + + L  C NY+  GG +P  CC  V+++ 
Sbjct  6    KLSTLLIVCMLVS----APM-AEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLH  60

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSISK  376
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+ I  
Sbjct  61   SMARTTRDRQQACRCIQGA-ARALGSRLNPGRAARLPGACRVR-ISYPISARTNCNKIG-  117

Query  377  *IN**KMVYLNLCIN*HLPEKMLIVGYMMIYI  472
                  + +  L I     E+M IV  M  YI
Sbjct  118  ------VFHFFLYIRPK-KEEMFIVSNMSKYI  142



>emb|CAN76145.1| hypothetical protein VITISV_034315 [Vitis vinifera]
Length=147

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +2

Query  104  CPGLVNTLLPCANYVLNGGDIP-ATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKPD  280
            C  ++  L PC NY++NG  +P A CC     +  S  T  D+++AC+C+K T  K  P+
Sbjct  30   CSDVIKDLRPCVNYLVNGSGMPPAACCTGASNLASSASTSADKKAACECIKTTAKKLNPN  89

Query  281  QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
              + A+ LP NC + +LPF +SPNVDCS  S
Sbjct  90   P-QLAKGLPGNCKI-SLPFTVSPNVDCSKYS  118



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +  SL ++ +    + I    AEA VTC  +   L PC +YV  GG IP  CC  ++ + 
Sbjct  3    KFASLSVMFIAAMVIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTMCCNGIRNLF  62

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +  T QDRQ+ C C+K          L  A  LP+ C +  +P+ ISP++DC+ +
Sbjct  63   SAASTTQDRQTVCNCMKSAARVISGVNLNLAAALPSKCGV-IIPYKISPSIDCAKV  117



>ref|XP_007033545.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
 gb|EOY04471.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
Length=119

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVL-NGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            A+  ++C  +   L PC +Y+  +GG +P++CC  +K +  + +T QDR++AC C+K   
Sbjct  24   AQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIKSAA  83

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                      A  +P+ C + ++P+ ISPN+DCSS+
Sbjct  84   GSISGINYALASQMPSKCGV-SIPYQISPNIDCSSV  118



>ref|XP_010464583.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
             EA V+C   V  L PC +Y++ GG +P +CC  +K +    +T  DRQS C+C+K    
Sbjct  17   GEAAVSCSTTVAELYPCVSYIVQGGTVPESCCNGIKALNSQAQTSADRQSVCRCIKSAIG  76

Query  266  KAK--PDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                  + L  A  LP+ C L  LP+  SP+ +C SI+
Sbjct  77   GVSYTSNNLNNALSLPSKCGLN-LPYRFSPSTNCDSIN  113



>ref|XP_006295252.1| hypothetical protein CARUB_v10024340mg [Capsella rubella]
 gb|EOA28150.1| hypothetical protein CARUB_v10024340mg [Capsella rubella]
Length=118

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 67/118 (57%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L L C+I +G    P+ A+A ++C  + + L PC  YV+ GG IPA CC  V+ + 
Sbjct  6    KLACLFLACMIVAG----PITADAALSCGAVTSNLAPCIGYVMQGGVIPAGCCTGVRNLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
            +  +T  DRQ AC C++ T A++    L   RA  +P  C +  +P+ IS + +C ++
Sbjct  62   NMARTTPDRQQACTCLQNT-ARSLGAGLNAGRAAGIPKACGVN-IPYKISTSTNCKTV  117



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            QL+ L  L V+   +V     AEA VTC  +VN+L+PC +YV NGG +   CC  VK + 
Sbjct  6    QLLKLACLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCLSYVTNGGALNPACCNGVKTLY  65

Query  203  DSLKTKQDRQSACQCVKETFAK--AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  +T  DRQ+ C C+K+              A  LPA C +  +P+ ISP+ DC S+
Sbjct  66   NLAQTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPARCGV-NIPYKISPSTDCKSV  122



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+   +AEA ++C  + ++L PC  Y+  GG +P  CC  VK + ++ KT  DRQ+AC 
Sbjct  2    MVVAATYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>ref|XP_010043259.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010043269.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Eucalyptus grandis]
Length=124

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = +2

Query  71   IPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCV  250
            +PP   +   +C  +VN L+PCA+YV+NGG +P  CC  ++ +  + KT  DRQ  C C+
Sbjct  24   VPPATPQMS-SCNQVVNRLMPCASYVVNGGGVPPACCSGIQSLNSTAKTTADRQGVCNCL  82

Query  251  KETFAK--AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            K       +    +  A  LPA C +  +P+ ISP+ DC S+
Sbjct  83   KSVLNGIPSNAYNISLATGLPATCGVD-IPYKISPSTDCKSV  123



>ref|XP_002872988.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49247.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (57%), Gaps = 3/97 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            +EA V+C  +   L PC  YV+ GG+IP +CC  +K ++   K+  DRQ+ C+C+K    
Sbjct  20   SEAAVSCNAVQADLYPCLAYVVQGGNIPQSCCTGIKMLKQQAKSASDRQAVCRCIKSAVG  79

Query  266  KAKPDQ--LKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +       LK A  LP  C +  LP+ I P+ +C+SI
Sbjct  80   RVSYSSTYLKNAATLPGKCGVK-LPYKIDPSTNCNSI  115



>emb|CDO96795.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = +2

Query  14   NRKQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVK  193
            N K + ++++L V+ +G + P   AEA + C  +++ L PC  Y+ NGG +P  CC  V+
Sbjct  7    NSKVVGAVIMLTVV-AGELAP--RAEAVIACGQVISFLTPCTRYLKNGGSVPGNCCAGVR  63

Query  194  KVEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             +  + +T  DR+SAC C+K  +      +L  AQ LP  C    + + I P +DCS ++
Sbjct  64   HLVAAARTPADRKSACTCLKGAYRGYPGIKLPNAQSLPKKCG-ANVRYRIIPTIDCSRVT  122



>emb|CDX78016.1| BnaA09g32110D [Brassica napus]
Length=116

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++ S     P+ +EA ++C  + + L  C NY+  GG +P  CC  V+++ 
Sbjct  6    KLSTLVIVCMLVS----APMASEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVRRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCS  364
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C+
Sbjct  62   SMARTTRDRQQACRCIQGA-ARALGSRLNPGRAARLPGACRVR-IAYPISARTNCN  115



>ref|XP_008798560.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 62/112 (55%), Gaps = 2/112 (2%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            L+L+ ++   +V  P  A+A +TC  +V+ L PC  Y  NGG IPA CC  VK +  + K
Sbjct  8    LVLVALLAVMLVAGPRMADA-ITCGQVVSFLTPCIAYARNGGPIPAGCCSGVKGLVAAAK  66

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  DRQ+AC C+K   A            +PA C +  +P+ ISP+ DCS +
Sbjct  67   STPDRQTACSCLKRAAASISGLNTGLIAGVPAKCGV-RIPYSISPSTDCSKV  117



>ref|XP_002879751.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56010.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ + A ++C  + + L PC  YVL GG IPA CC  V+ + 
Sbjct  6    KLACLVLACMIVAG----PITSNAALSCGSVNSNLAPCIGYVLQGGTIPAGCCSGVRNLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
            +  KT  DRQ AC C++   A+A    L   RA  +P  C +  +P+ IS + +C ++
Sbjct  62   NIAKTTPDRQQACNCIQGA-ARALGSGLNAGRAAGIPKACGVN-IPYKISTSTNCKTV  117



>gb|AAM66937.1| non-specific lipid transfer protein [Arabidopsis thaliana]
Length=104

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 60/104 (58%), Gaps = 4/104 (4%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V  P+ +EA ++C  +  +L  C NY+  GG IP  CC  V+++    +T +DRQ AC+
Sbjct  2    LVTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACR  61

Query  245  CVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
            C++   A+A   +L   RA  LP  C +  + +PIS   +C+++
Sbjct  62   CIQGA-ARALGSRLNAGRAARLPGACRVR-ISYPISARTNCNTV  103



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = +2

Query  26   LMSLLLLCV-ITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            ++SL L+C+ +  G+V+     E+ +TC  + + + PC  Y+  GG IP+ CC  ++ + 
Sbjct  1    MVSLKLVCLALVVGLVVAMPLTESAITCGQVRSWVAPCLGYLRAGGKIPSACCSGIRSLN  60

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            ++ +T  DR++ C+CV+      +   L     LP  C +  +P+ ISP+ DCS +
Sbjct  61   NAARTTHDRRTTCRCVQSAAGNIQGLNLGLVSALPGKCGVR-IPYKISPSTDCSRV  115



>ref|XP_002323069.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
 gb|ABK95798.1| unknown [Populus trichocarpa]
 gb|EEF04830.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
Length=116

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 5/112 (4%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +LLLC++ S    P L  EA ++C  + + L  C  Y+ NGG +P  CC  V  + ++ K
Sbjct  9    VLLLCMVLSA---PMLNVEA-LSCSVVASNLAQCLTYLRNGGAVPPACCKGVGTLNNAAK  64

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T QDR+ AC C+K T A+        A  LP  CH+  +P+ IS + +C+SI
Sbjct  65   TTQDRRDACNCIKTTAAQLGGVNSNYAAALPGLCHVN-IPYKISTSTNCASI  115



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+   +AEA ++C  + ++L PC  Y+  GG +P  CC  VK + ++ KT  DRQ+AC 
Sbjct  2    MVVAAHYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>dbj|BAP11226.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            LLC++ +      +   AQVTC  +VN L PC +YV  GG +P  CC  V+ + ++ +T 
Sbjct  1    LLCLMANAF----MGTRAQVTCSVVVNDLSPCISYVSGGGAVPVNCCNGVRTLNNAAQTT  56

Query  221  QDRQSACQCVKETF--AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+ C+C+K+           L+ A  LP  C + ++P+ ISP+ DC  +
Sbjct  57   ADRQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGI-SIPYKISPSTDCDKV  107



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN-GGDIPATCCPAVKKVED  205
            MSL L CV+   +V+    A+  VTC  +  +L PC  Y+   GG +P  CC  +K +  
Sbjct  5    MSLKLACVVVLCMVLGAPLAQGAVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNS  64

Query  206  SLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
            + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   AAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGV-NIPYKISPSTDCN  116



>ref|XP_011002608.1| PREDICTED: non-specific lipid-transfer protein 1 [Populus euphratica]
Length=120

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  32   SLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            +L L+C++   +V+     +A ++C  ++NTL PC +YV+  G +   CC A++ +  + 
Sbjct  6    ALNLVCLVVCIMVMTASTTKAAISCNQVINTLTPCISYVVGNGALTGNCCNAIRGINSAA  65

Query  212  KTKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +T  DRQS C C+K T ++   +   +  A  LP  C +  LP+ I P+ DC S+
Sbjct  66   RTTPDRQSVCTCLKNTASQFSYNSRNVALAAGLPGKCGVK-LPYKIDPSTDCKSV  119



>ref|XP_004302622.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 3/114 (3%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            ++ L V++    +    AEA +TC  +VN L+PC +YV NGG   A CC  ++ +    +
Sbjct  9    VVFLVVLSMAAALSIGGAEAALTCGQVVNKLMPCVSYVQNGGTPAANCCGGIRALYGMAQ  68

Query  215  TKQDRQSACQCVKETFAK--AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQS C C+K+  A           A  LP  C +  +P+ I+P+ DC SI
Sbjct  69   TTPDRQSVCNCLKQAIAGIPYTGANAGLAAGLPGKCGVN-IPYKINPSTDCKSI  121



>ref|XP_004245408.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGG-DIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAK  274
            VTC  + ++L PC  YVL GG  +P+ CC   K +     T  DRQSAC+C+K   + A 
Sbjct  29   VTCNMVYSSLEPCLGYVLGGGLSVPSECCGGSKSLLSMGCTIDDRQSACKCIKSAGSNAN  88

Query  275  PDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
              QL RA  LP  C    +PF ISP+VDCS ++
Sbjct  89   EAQLSRAATLPRICK-TNVPFKISPHVDCSKVN  120



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+   +AEA ++C  + ++L PC +Y+  GG +P  CC  VK +  + KT  DRQ+AC 
Sbjct  2    MVVAANYAEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>ref|XP_009148874.1| PREDICTED: non-specific lipid-transfer protein 5-like [Brassica 
rapa]
Length=117

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 69/118 (58%), Gaps = 9/118 (8%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +LL++C++ S     P+ AEA ++C  + + L  C NY+  GG +P  CC  V+++ 
Sbjct  6    KLSTLLIVCMLVS----APM-AEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLH  60

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T +DRQ AC+C++   A+A   +L   RA  LP  C +  + +PIS   +C++I
Sbjct  61   SMARTTRDRQQACRCIQGA-ARALGSRLNPGRAARLPGACRVR-ISYPISARTNCNNI  116



>ref|XP_009132605.1| PREDICTED: non-specific lipid-transfer protein 3-like [Brassica 
rapa]
Length=112

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 12/112 (11%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +L +C++ S         +A ++C  + + L+PCA Y++ GG +PA+CC  V K+    K
Sbjct  12   VLTVCIVAS--------VDAAISCGTVTSNLVPCAGYLMKGGPVPASCCAGVSKLNSMAK  63

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ AC+C+K       P     A  LP  C + ++P+PIS + +C+++
Sbjct  64   TTPDRQQACKCLKTAAKSVNPS---LASSLPGKCGV-SIPYPISMSTNCNTV  111



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            ++L+C++  G    P+ A+A +TC  +V+ L PC  Y+  GG +P  CC  VK +  S +
Sbjct  9    VVLICMVMVGAA--PI-AQA-ITCGQVVSNLTPCITYLQRGGAVPGQCCNGVKTLVSSAQ  64

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  D+Q+AC C+K T A         A  LP  C +  LP+ ISP+ +C+SI
Sbjct  65   TTADKQTACNCLKSTAATIPNINFGNAGSLPGKCGVN-LPYKISPSTNCASI  115



>dbj|BAP11221.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11224.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            LLC++ +      +   AQVTC  +VN L PC +YV  GG +P  CC  V+ + ++ +T 
Sbjct  1    LLCLMANAF----MGTRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTT  56

Query  221  QDRQSACQCVKETF--AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+ C+C+K+           L+ A  LP  C + ++P+ ISP+ DC  +
Sbjct  57   ADRQNVCKCLKQAVNGISYTGYNLRLAAGLPEKCGI-SIPYKISPSTDCDKV  107



>dbj|BAP11218.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11222.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11223.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            LLC++ +      +   AQVTC  +VN L PC +YV  GG +P  CC  V+ + ++ +T 
Sbjct  1    LLCLMANAF----MGTRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTT  56

Query  221  QDRQSACQCVKETF--AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+ C+C+K+           L+ A  LP  C + ++P+ ISP+ DC  +
Sbjct  57   ADRQNVCKCLKQAVNGISYTGYNLRLAAGLPEKCGI-SIPYKISPSTDCDKV  107



>ref|XP_004308147.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            ++ L +++    +    AEA +TC  +VN L PCA+Y+ NGG   A CC  ++ +    +
Sbjct  9    VVFLVMLSMAAALSFGGAEAALTCGQVVNKLTPCASYIQNGGTPAANCCGGIRALYGMAQ  68

Query  215  TKQDRQSACQCVKETFAKAKPDQLKR--AQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQS C C+K+  A       K   A  LP  C +  +P+ I+P+ DC SI
Sbjct  69   TTPDRQSVCNCLKQAIAGIPYTGAKAGLAAGLPGKCGVN-IPYKINPSTDCKSI  121



>ref|XP_004245407.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=117

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +2

Query  104  CPGLVNTLLPCANYVLNGG-DIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKPD  280
            C  +   L PC  +VLNGG  +P+ CC  +K +  +  T  DRQSAC+C+K   + A   
Sbjct  28   CNTVYTDLEPCLGFVLNGGLTVPSACCGGLKSLLVAAGTTADRQSACKCIKSLASSANGV  87

Query  281  QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            Q+ RA  LP  C +  +P+ ISPNVDCS I+
Sbjct  88   QIGRATQLPRICKV-NVPYQISPNVDCSKIT  117



>gb|KFK36745.1| hypothetical protein AALP_AA4G164400 [Arabis alpina]
Length=118

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 66/117 (56%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+  C+I +G    P+ + A + C  + + + PC  Y+L GG +   CC  ++++ 
Sbjct  6    KLACLVFACMIVAG----PITSNAALGCGQVNSAVAPCIGYILQGGAVTPGCCNGIRRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DR++ACQC+K   A   P     RA  LP  C + ++PFPIS + +C+++
Sbjct  62   GAARTTPDRKAACQCLKNAAAALGPGLNAGRAAGLPRACGV-SVPFPISTSTNCNNV  117



>gb|KFK34405.1| non-specific lipid transfer protein [Arabis alpina]
Length=116

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++    V  P+ +EA ++C  + + L  C  Y+  GG IP  CC  VK++ 
Sbjct  6    KLSTLVIVCML----VAAPMASEAAISCAAVTSNLRQCIGYLFGGGVIPPACCYGVKRLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCS  364
            +  +T +DRQ  C+C+++T A+A   ++   RA  LP  C +  + +PIS   +C+
Sbjct  62   NMARTTRDRQQTCRCIQQT-ARALASKINPGRAARLPGACGVK-ISYPISATTNCN  115



>emb|CAH69197.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|EMT00342.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=121

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = +2

Query  32   SLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            +++L  V+ + VV PP    A ++C  + +TL+PC  YV  GG     CC  ++ +    
Sbjct  8    AVVLAMVLAAMVVAPPATVHAAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEA  67

Query  212  KTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                DR++ C C+K     A     + RA  LP+ C++ ALP+ ISP+VDC+SI
Sbjct  68   NNSPDRRTICGCLKNVANGASGGPYITRAAALPSKCNV-ALPYKISPSVDCNSI  120



>ref|XP_004506487.1| PREDICTED: non-specific lipid-transfer protein 3-like [Cicer 
arietinum]
Length=124

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 11/122 (9%)
 Frame = +2

Query  20   KQLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGD-IPATCCPAVKK  196
             +L+   +LC++T G   P   AE  VTC  +VN L  C +Y++ GG+ +PA CC  V+ 
Sbjct  8    SKLVCFAILCLVTFG---PK--AEGAVTCGQVVNNLTSCVSYIMYGGNTVPAQCCNGVRN  62

Query  197  VEDSLKTKQDRQSACQCVKETFAKA----KPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
            +    +T  DR++ C C+K   + +        L  A  LP  C +  +P+ ISPN DC+
Sbjct  63   LNAMAQTTPDRRAVCSCIKNAVSSSGFTYSNTNLNLAASLPRRCGVN-IPYQISPNTDCN  121

Query  365  SI  370
            S+
Sbjct  122  SV  123



>dbj|BAP11219.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11225.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            LLC++ +      +   AQVTC  +VN L PC +YV  GG +P  CC  V+ + ++ +T 
Sbjct  1    LLCLMANAF----MGTRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTT  56

Query  221  QDRQSACQCVKETF--AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+ C+C+K+           L+ A  LP  C + ++P+ ISP+ DC  +
Sbjct  57   ADRQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGI-SIPYKISPSTDCDKV  107



>gb|ACE80968.1| putative allergen Pru du 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = +2

Query  38   LLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKT  217
            L +C+    VV  PL  EA +TCP +   L PC  Y+  GG     CCP +K++  S  T
Sbjct  10   LFMCM----VVAAPLITEAALTCPQIQAGLAPCLGYLQRGGVPAGGCCPGIKRLVGSATT  65

Query  218  KQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              DRQ+AC+C+K      K      A  LP+ C +  +P+ IS + +C+S+
Sbjct  66   TADRQNACKCLKTVAGAVKGINTGYAAALPSLCGVK-IPYKISASTNCNSV  115



>dbj|BAP11220.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            LLC++ +      +   AQVTC  +VN L PC +YV  GG +P  CC  V+ + ++ +T 
Sbjct  1    LLCLMANAF----MGTRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTT  56

Query  221  QDRQSACQCVKETF--AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DRQ+ C+C+K+           L+ A  LP  C + ++P+ ISP+ DC  +
Sbjct  57   ADRQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGI-SIPYKISPSTDCDKV  107



>ref|XP_010253092.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=114

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +2

Query  89   EAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAK  268
            +A ++C  + + L PC  Y++ GG +   CC  V+ +  S +T +DR++AC C+K   A 
Sbjct  21   DAGISCGQVTSQLAPCITYLVRGGAVSPLCCRGVRGLSASARTTRDRRTACGCIKSASAG  80

Query  269  AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +  +L  A  LP  C +  +P+ ISP+ DCS +
Sbjct  81   IRGLKLALAASLPGRCRVR-IPYKISPSTDCSRV  113



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+   +AEA ++C  + ++L PC  Y+  GG +P  CC  VK + ++ KT  DRQ+AC 
Sbjct  2    MVVAAPYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  + + L PC +Y+  GG +P  CC  +K +  S KT  DRQ+AC+C+K   +    
Sbjct  29   ITCGQVASALSPCISYLQKGGAVPPACCSGIKSLNSSAKTTADRQAACKCLKNFSSTVSG  88

Query  278  DQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
              L  A  LP  C + ++P+ ISP+ DC+ ++
Sbjct  89   INLSLASGLPGKCGV-SVPYKISPSTDCTKVT  119



>ref|XP_009346911.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            QL+ L  L V+   +V     AEA VTC  +VN+L+PC +YV NGG +   CC  V+ + 
Sbjct  6    QLLKLGCLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCISYVGNGGALDPACCNGVRTLY  65

Query  203  DSLKTKQDRQSACQCVKETFAK--AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  +T  DRQ+ C C+K+              A  LPA C +  +P+ ISP+ DC S+
Sbjct  66   NLAQTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPAKCGV-NIPYKISPSTDCKSV  122



>gb|AEN70935.1| lipid transfer protein [Gossypium aridum]
 gb|AEN70937.1| lipid transfer protein [Gossypium lobatum]
Length=120

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  +  +L PC  Y+  NG G +P  CC  +K + 
Sbjct  5    MSLKLACVLVLCMVVGAPLAQGAVTCGQVTTSLAPCIGYLRGNGAGTVPQGCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP+ C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPSKCGVN-IPYKISPSTDCN  117



>gb|ABE11609.1| lipid-transfer protein precursor [Solanum chacoense]
Length=115

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            ++   +LLC+    VV+ P  AEA +TC  + ++L  C  Y+ N G +   CC  VKK++
Sbjct  6    KIACFVLLCM----VVVAP-HAEAALTCGQVTSSLFSCLPYLRNTGPL-GDCCSGVKKLK  59

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ+AC C+K T    K     +A  LP+ C +  +P+ ISP+ DCS +
Sbjct  60   GQAQTTADRQTACNCLKSTAGSIKGLNFGKAASLPSTCSVN-IPYEISPSTDCSKV  114



>ref|XP_002323072.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
 gb|EEF04833.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
Length=150

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  32   SLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            +L L+C++   +V+     +A ++C  ++NTL PC +YV+  G +   CC A++ +  + 
Sbjct  36   ALHLVCLVVCIMVMTASTTKAAISCNQVINTLTPCISYVVGNGALTGNCCNAIRGLNSAA  95

Query  212  KTKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +T  DRQS C C+K T ++   +   +  A  LP  C +  LP+ I P+ DC S+
Sbjct  96   RTTPDRQSVCTCLKNTASQFSYNSRNVALAAGLPGKCGVK-LPYKIDPSTDCKSV  149



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +++   +AEA ++C  + ++L PC +Y+  GG +P  CC  VK +  + KT  DRQ+AC 
Sbjct  2    MMVAANYAEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>ref|XP_011091591.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091594.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091595.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53933.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 62/115 (54%), Gaps = 4/115 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            M +LL+  + +  V P    EA + C  +V+ L PC  YV N G +  +CC  VK +  +
Sbjct  8    MCILLIAAVLAMAVAP--RGEAAIGCGTVVSYLNPCLPYVTNKGPL-GSCCGGVKGLYGA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             +T QDRQS C C+K      K   L +A  LP  C +  +P+ ISP+ DCS ++
Sbjct  65   AQTAQDRQSVCSCLKSLAGSYKDVDLNKAAGLPGQCGV-NIPYKISPSTDCSKVN  118



>ref|XP_004233683.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=112

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 14/118 (12%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVED  205
            L+SL +L V+        +     + C  +   L PC  Y+  GGD   +CC  VKKV +
Sbjct  5    LVSLFMLLVVV-------VQLGESINCGEVGGALAPCVPYLTQGGDPSVSCCDGVKKVVE  57

Query  206  SLKTKQDRQSACQCVKETFAK---AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  T+QDRQ AC+C+K   A+    KPD    A +LP+ C L   P PISP ++C S+
Sbjct  58   TTPTQQDRQVACECMKSAAARYPNVKPDA---ASNLPSRCGL-TTPIPISPTINCKSV  111



>emb|CDY38865.1| BnaA03g13140D [Brassica napus]
Length=110

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 62/111 (56%), Gaps = 12/111 (11%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +L +C++ S         +A ++C  + + L+PCA Y++ GG +PA+CC  V K+    K
Sbjct  12   VLTVCIVAS--------VDAAISCGTVTSNLVPCAGYLMKGGPVPASCCAGVSKLNSMAK  63

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSS  367
            T  DRQ AC+C+K       P     A  LP  C + ++P+PIS + +C++
Sbjct  64   TTPDRQQACKCLKTAAKSVNPS---LASSLPGKCGV-SIPYPISMSTNCNT  110



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +2

Query  101  TCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKPD  280
            TC  + + L PC +Y+  GG +PA CC  +K +  + KT  DRQ+AC+C+K   +     
Sbjct  30   TCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGI  89

Query  281  QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                A  LP  C + ++P+ ISP+ DCS ++
Sbjct  90   NYGLASGLPGKCGV-SVPYKISPSTDCSKVT  119



>ref|XP_004151695.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 ref|XP_004167529.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 gb|KGN54448.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=125

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 11/124 (9%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWA--------EAQVTCPGLVNTLLPCANYVLNGGDIPATCCP  184
            M+  L+ ++  G+ +  L+A        EA V+C  ++  L PC +YV  GG   + CC 
Sbjct  1    MASNLITILKLGLTVTFLYAVIGGGVTTEAVVSCNQVITNLRPCVSYVTGGGYPSSNCCS  60

Query  185  AVKKVEDSLKTKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVD  358
             VK++  + +T  DRQ+ C+C+K      K +   +  A  LP  C +  LP+ I+PNVD
Sbjct  61   GVKQLSTAARTTPDRQAVCRCLKSLVNGVKYNGQNVANAAALPTKCGV-TLPYSINPNVD  119

Query  359  CSSI  370
            C++I
Sbjct  120  CNTI  123



>ref|XP_006482792.1| PREDICTED: non-specific lipid-transfer protein 8-like [Citrus 
sinensis]
Length=127

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA ++C  ++  L PC NY+ +G G  PA CC     +  +  +  D+++AC C+K   
Sbjct  33   SEAAISCSDVLKDLRPCVNYLKSGSGKPPAACCSGASALASTATSTADKKTACGCIKTAA  92

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             K  P+  + AQ LP NC +  LP P+SPNVDCS I+
Sbjct  93   QKMNPNS-QLAQALPTNCGI-TLPVPVSPNVDCSKIN  127



>ref|XP_008798559.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +2

Query  77   PLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKE  256
            P  A+A +TC  +V+ L PC NYV NGG IP  CC  V+ +  + KT  DR++AC C+K 
Sbjct  22   PHTADA-ITCGQVVSYLTPCINYVRNGGQIPGACCSGVRGLAAAAKTTPDRRTACTCLKN  80

Query  257  TFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
              A     +      +P  C +  +P+ ISP+ DCS
Sbjct  81   AAAGISGLKTGLIAGIPGKCGV-RVPYAISPSTDCS  115



>sp|Q43129.1|NLTP2_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=GH3; Flags: Precursor [Gossypium hirsutum]
 gb|AAB34774.1| LTP [Gossypium hirsutum]
 gb|AAY43799.1| NSLTP1 [Gossypium hirsutum]
Length=120

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VT   + N+L PC NY+     G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T   RQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+S+
Sbjct  65   SAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPSTDCNSV  119



>gb|KDP20367.1| hypothetical protein JCGZ_05250 [Jatropha curcas]
Length=113

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = +2

Query  89   EAQVTCPGLVNTLLPCANYVLNGGDI-PATCCPAVKKVEDSLKTKQDRQSACQCVKETFA  265
            EA + C  ++  L PC NY++ G  I PA CC   K +     T  D+++AC C+K    
Sbjct  20   EAAIACSDVIKDLRPCVNYLVKGSGIPPAACCAGAKALSSVATTTADKRAACACIKSAAQ  79

Query  266  KAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
               P+  + AQ LP+NC + + P+ +SPNVDCS I+
Sbjct  80   NINPNS-QLAQALPSNCGI-SFPYTVSPNVDCSQIN  113



>gb|AEN70915.1| lipid transfer protein [Gossypium thurberi]
 gb|AEN70938.1| lipid transfer protein [Gossypium trilobum]
Length=120

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + ++L PC  Y+  NG G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCFAYLTGNGAGSVPPRCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVN-IPYKISPSTDCN  117



>ref|XP_006438990.1| hypothetical protein CICLE_v10033098mg [Citrus clementina]
 gb|ESR52230.1| hypothetical protein CICLE_v10033098mg [Citrus clementina]
 gb|KDO46019.1| hypothetical protein CISIN_1g043898mg [Citrus sinensis]
Length=118

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA ++C  ++  L PC NY+ +G G  PA CC     +  +  +  D+++AC C+K   
Sbjct  24   SEAAISCSDVLKDLRPCVNYLKSGSGKPPAACCSGASALASTATSTADKKTACGCIKTAA  83

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             K  P+  + AQ LP NC +  LP P+SPNVDCS I+
Sbjct  84   QKMNPNS-QLAQALPTNCGI-TLPVPVSPNVDCSKIN  118



>gb|AEN70917.1| lipid transfer protein [Gossypium schwendimanii]
Length=120

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL + CV+   +V+    A+  VTC  +  +L PC  Y+  NG G +P  CC  +K + 
Sbjct  5    MSLKIACVLVLCMVVGAPLAQGAVTCGQVTTSLAPCIGYLTGNGAGTVPQGCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVN-IPYKISPSTDCN  117



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 69/115 (60%), Gaps = 6/115 (5%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
             +L++LC+    +V+P   AEA +TC  +   + PC NYV +GG +P +CC  ++ +  +
Sbjct  10   FALVILCMAV--LVVP--HAEA-ITCGQVSGAVAPCINYVRSGGVVPPSCCGGIRGLVGA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             KT  DR++AC C+K    +    +   A  LP  C + ++PFPIS +V+C++++
Sbjct  65   AKTTADRRTACNCLKSAAGRIPGLKPGLAAGLPGKCGV-SVPFPISTSVNCNTVT  118



>sp|Q42762.1|NLTP1_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA75599.1| nonspecific lipid transfer protein precursor [Gossypium hirsutum]
Length=116

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLN--GGDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VT   + N+L PC NY+     G +P  CC  +K + 
Sbjct  1    MSLKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLN  60

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T   RQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+S+
Sbjct  61   SAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVN-IPYKISPSTDCNSV  115



>emb|CCK33472.1| lipid transfer protein precursor, partial (chloroplast) [Cannabis 
sativa]
Length=91

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  + ++L PC +Y+  GG +P  CC  +K +  + KT  DRQ+AC+C+K   +  K 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG  60

Query  278  DQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                 A  LP  C + ++P+ ISP+ DCSS+
Sbjct  61   VNFNLASGLPGKCGV-SIPYKISPSTDCSSV  90



>ref|XP_009136622.1| PREDICTED: non-specific lipid-transfer protein 5-like [Brassica 
rapa]
Length=118

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 66/118 (56%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L +L+++C++ S     P+  EA ++C  + + L  C NY+  GG I   CC  V+ + 
Sbjct  6    KLSTLVIVCMLVS----APMATEAAISCGAVASNLGQCINYLTKGGYISPGCCSGVRTLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQL--KRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC+C++   AKA   +L  +RA  LP  C +  + +PIS   +C+++
Sbjct  62   SMARTTTDRQQACRCIQGA-AKALGSRLNARRAAGLPGACRVR-ISYPISARTNCNNV  117



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = +2

Query  41   LLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTK  220
            L+C++   VV P   AEA VTC  + ++LLPC  Y+  G      CC  +K +     T 
Sbjct  12   LMCML---VVAP--HAEAAVTCGQVTSSLLPCLGYLQGGASPSPACCGGIKSLNSMASTP  66

Query  221  QDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             DR++AC C+K   A  K   +  A  LP  C + ++P+PIS + DCS +
Sbjct  67   ADRKTACGCLKSAAASVKGIDMSAASGLPGKCDV-SIPYPISTSTDCSKV  115



>gb|ABK20926.1| unknown [Picea sitchensis]
Length=123

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 65/116 (56%), Gaps = 6/116 (5%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPA-TCCPAVKKVE  202
            L+ L++  +   GVV      E  ++C  +V+ L PCA Y++     PA  CCPA+K ++
Sbjct  12   LVGLVVTVMTAWGVV----RTEGAISCNQVVSALTPCAGYLIGNAATPAPACCPAIKGLD  67

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              +K   DRQ+ C C+K   A +   +L +A +LP  C +  +  P++PNVDCS I
Sbjct  68   SQVKATPDRQAVCNCLKNQ-ATSFGVKLGKAANLPGLCKVTDINVPVNPNVDCSKI  122



>gb|EYU42017.1| hypothetical protein MIMGU_mgv1a016521mg [Erythranthe guttata]
Length=118

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +2

Query  71   IPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCV  250
              P  AE  +TC  +V  L+PC NY+  GG IP+ CC  V+ +  + KT  DR++AC+C+
Sbjct  21   FSPQGAEG-ITCQTVVKGLMPCTNYLRKGGAIPSACCRGVRSINSAAKTTADRRTACECI  79

Query  251  KETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            K   AKA    ++ A  LP  C +  + + IS + DC  +
Sbjct  80   K-VAAKAYKVNVRNAAVLPRQCKVN-IGYAISYSTDCKKV  117



>ref|XP_007033546.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
 gb|EOY04472.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
Length=137

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVL-NGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            A+  ++C  +   L PC +Y+  +GG +P++CC  +K +  + +T QDR++AC C+K   
Sbjct  24   AQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIKSAA  83

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSS  367
                      A  +P+ C + ++P+ ISPN+DC+S
Sbjct  84   GSISGINYALASQMPSKCGV-SIPYQISPNIDCTS  117



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TCP +   L PC  Y+ +GG +   CC  V+ +  + +T  DR++AC+C+K   A    
Sbjct  28   ITCPQVYGDLTPCIQYLRSGGAVAPQCCSGVRSLLAAARTVTDRRTACRCIKTAAAGLSG  87

Query  278  DQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
              + RA  LP  C + ++P+ ISP+ DCS I+
Sbjct  88   LDIGRASALPGKCGV-SIPYKISPSTDCSKIN  118



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +2

Query  95   QVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAK  274
             ++C  +V  L PC +YV NGG +P  CC  ++ +  S  T  DRQ+ C C+K   +   
Sbjct  2    SMSCSTVVTDLYPCLDYVENGGAVPMDCCEGIRSLYTSAATTADRQTVCNCMKNAASSVT  61

Query  275  PDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               L  A  LP  C + ++P+ ISP+VDC+++
Sbjct  62   GLNLDLAAGLPQKCGV-SIPYQISPSVDCATV  92



>ref|XP_010277659.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 53/102 (52%), Gaps = 1/102 (1%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V  P  A+A +TC  + + L PC NY + GG +P  CC AV+ +  + KT  DRQ+ C 
Sbjct  21   MVAAPDHADAAMTCGQVASLLTPCINYFVKGGALPPACCGAVRGLITASKTTADRQAVCS  80

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C K   A      L  A  +P  C +    + ISP+ DCS I
Sbjct  81   CFKSAAASIPGVNLGLANSIPGRCGVQ-FTYKISPSTDCSRI  121



>gb|KFK27462.1| hypothetical protein AALP_AA8G386200 [Arabis alpina]
Length=112

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 62/112 (55%), Gaps = 12/112 (11%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +L +C++ S         +A +TC  + ++L PCANY+  GG +P  CC  VKK+    +
Sbjct  12   VLTVCIVAS--------VDAAITCGTVASSLAPCANYLTKGGAVPVPCCVGVKKLNGMAQ  63

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ AC+C++       P     A  LP  C + ++P+PIS + +C++I
Sbjct  64   TTPDRQQACRCLQSAAKSVNPS---LASGLPGKCGV-SIPYPISTSTNCNTI  111



>ref|XP_008778991.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +2

Query  92   AQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKA  271
            A +TC  +   LLPC  Y+ +GG + + CC  ++ +  + +T  DR++AC C+K   A  
Sbjct  26   AAITCSDVYGDLLPCVQYIQSGGAVASQCCSGLQSLVAAARTADDRRAACTCLKSAAASF  85

Query  272  KPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            K + +KRA  LP  C + ++P+ +SP+ DC+ I+
Sbjct  86   KGN-VKRASSLPGKCGV-SVPYKLSPSTDCNKIT  117



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +AEA +TC  + + L PC  Y+ +GG   A CC  VK +     T  DR++AC C+K   
Sbjct  23   FAEAAITCGQVTSKLAPCMGYLKSGGAPTAACCGGVKSLNSMASTPADRKAACGCLKSAA  82

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            A         A  LP+ C + ++P+PIS +VDC+ +
Sbjct  83   ASISGMNTAAASSLPSKCGV-SIPYPISTSVDCAKV  117



>gb|AEN70933.1| lipid transfer protein [Gossypium davidsonii]
 gb|AEN70934.1| lipid transfer protein [Gossypium klotzschianum]
Length=120

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  + ++L PC  Y+  NG G +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGVVPPRCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAASMSGINYGIASGLPGKCGVN-IPYKISPSTDCN  117



>ref|XP_010931360.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Elaeis guineensis]
Length=117

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +2

Query  74   PPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVK  253
            PP  A+A +TC  +   LLPC  YV  GG +   CC  ++ +  + +T  DR++AC+C+K
Sbjct  21   PPGRADA-ITCSDVYGDLLPCVAYVQAGGSVAPQCCSGLRSLLAAARTADDRRTACRCLK  79

Query  254  ETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               A+  P  + RA  +P  C + ++P+  SP++DCS I
Sbjct  80   TISARF-PGYVSRANTIPGKCGV-SIPYKFSPSIDCSKI  116



>ref|XP_007206160.1| hypothetical protein PRUPE_ppa013558mg [Prunus persica]
 gb|EMJ07359.1| hypothetical protein PRUPE_ppa013558mg [Prunus persica]
Length=116

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = +2

Query  38   LLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKT  217
            L +C+    VV  PL  EA +TCP +   L PC  Y+  GG     CCP +K++  S  T
Sbjct  10   LFMCM----VVAAPLITEAALTCPQIQAGLAPCLGYLQRGGVPAGGCCPGIKRLVGSATT  65

Query  218  KQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              DRQ+AC+C+K      K      A  LP+ C +  +P+ IS + +C+S+
Sbjct  66   TADRQNACKCLKTVAGAVKGINPGYAAALPSLCGVK-IPYKISASTNCNSV  115



>gb|KFK26695.1| hypothetical protein AALP_AA8G281200 [Arabis alpina]
Length=112

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 12/112 (11%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +L +C++ S         +A +TC  + ++L PCANY+  GG +P  CC  VKK+    +
Sbjct  12   VLTVCIVAS--------VDAAITCGTVASSLAPCANYLTKGGAVPVPCCAGVKKLNGMAQ  63

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ AC+C++       P     A  LP  C + ++P+PIS + +C+++
Sbjct  64   TTPDRQQACRCLQSAAKSVNPS---LASGLPGKCGV-SIPYPISMSTNCNTV  111



>ref|XP_002323667.1| putative lipid transfer family protein [Populus trichocarpa]
 gb|ABK95728.1| unknown [Populus trichocarpa]
 gb|EEF05428.1| putative lipid transfer family protein [Populus trichocarpa]
Length=120

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 64/115 (56%), Gaps = 3/115 (3%)
 Frame = +2

Query  32   SLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            +L L+C++   +V+     +A ++C  ++NTL PC +YV+  G +   CC  ++ +  + 
Sbjct  6    ALHLVCLVVCIMVMTASTTKAAISCNQVINTLTPCISYVVGNGALTDNCCNGIRGLNSAA  65

Query  212  KTKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +T  DRQS C C+K T ++   +   +  A  LP  C +  LP+ I P+ DC S+
Sbjct  66   RTTPDRQSVCTCLKNTASQFSYNSRNVALAAGLPGKCGVK-LPYKIDPSTDCKSV  119



>ref|XP_010257636.1| PREDICTED: non-specific lipid-transfer protein 8 [Nelumbo nucifera]
Length=117

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 3/96 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNGGDI-PATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA +TC  ++  L PC NY++NG  + P+ CC    ++  +  T  D+++AC C+K   
Sbjct  23   SEAAITCSDVIKYLRPCVNYLVNGSGMPPSACCAGASQLASAATTPADKRAACACIKSAS  82

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +  P+  + AQ LP NC + +LPF +S  VDCS +
Sbjct  83   QRINPNP-QLAQALPGNCGI-SLPFKVSSTVDCSKV  116



>gb|ACE80969.1| putative allergen Pru p 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = +2

Query  38   LLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKT  217
            L +C+    VV  PL  EA +TCP +   L PC  Y+  GG     CCP +K++  S  T
Sbjct  10   LFMCM----VVAAPLITEAALTCPQIQAGLAPCLGYLQRGGVPAGGCCPGIKRLVGSATT  65

Query  218  KQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              DRQ+AC+C+K      K      A  LP+ C +  +P+ IS + +C+S+
Sbjct  66   TADRQNACKCLKTVAGAVKGINPGYAAALPSLCGVK-IPYKISASTNCNSV  115



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +V+   + EA ++C  + ++L PC +Y+  GG +P  CC  VK +  + KT  DRQ+AC 
Sbjct  2    MVVAAPYTEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACG  60

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K  +          A  LP  C + ++P+ ISP+ DCS +
Sbjct  61   CLKSAYNSISGVNAGNAASLPGKCGV-SIPYKISPSTDCSKV  101



>ref|XP_010529934.1| PREDICTED: non-specific lipid-transfer protein 3 [Tarenaya hassleriana]
Length=116

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVK---ETFAK  268
            ++C  + +TL PC +Y+ NGG + + CC  VK +  + +T  DRQ ACQC+K   +  + 
Sbjct  26   ISCGTVTSTLSPCVSYLTNGGSVTSQCCAGVKALNSAAQTTPDRQQACQCLKSAAQGISG  85

Query  269  AKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KPD    AQ LP  C + +LP+PIS + +C+++
Sbjct  86   LKPD---LAQGLPGACGV-SLPYPISYSTNCNNV  115



>ref|XP_010922734.1| PREDICTED: non-specific lipid-transfer protein 1 [Elaeis guineensis]
Length=118

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 2/99 (2%)
 Frame = +2

Query  77   PLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKE  256
            P  A A +TC  +V+ L PC +Y  +GG +PA CC  VK +  + +T  DR++AC C+K 
Sbjct  22   PYTAHA-ITCGQVVSYLTPCISYARSGGQVPAGCCSGVKGLVAAARTTADRRTACTCLKN  80

Query  257  TFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
            T A     +      +P  C +  +P+ ISP+ DCS +S
Sbjct  81   TAAGLSGLKPGLISGIPGKCGV-RVPYAISPSTDCSRVS  118



>gb|AEN70916.1| lipid transfer protein [Gossypium laxum]
Length=120

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 59/114 (52%), Gaps = 3/114 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGD--IPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  VTC  +  +L PC  Y+   G   +P  CC  +K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTTSLAPCITYLRGNGAAAVPPGCCGGIKSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             + +T  DRQ+AC+C+K   A         A  LP  C +  +P+ ISP+ DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVN-IPYKISPSTDCN  117



>gb|AAF35185.1|AF195864_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43282.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43283.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43284.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL-NG-GDIPATCCPAVKKVE  202
            MSL L CV+   +V+    A+  ++C  + + L PC  Y+  NG G  P  CC  ++ + 
Sbjct  5    MSLKLTCVVVFCMVVGAPLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLN  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + KT  DRQ+AC C+K             A  LP  C +  +P+ ISP+ DC SI
Sbjct  65   SAAKTTPDRQAACSCIKSAATGISGINYSTAAGLPGKCGIN-IPYKISPSTDCKSI  119



>ref|XP_009609143.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=152

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 6/102 (6%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            +SLLL+C     V++  L  +A ++C  + ++L PC  YVL GG +P  CC  +K +   
Sbjct  9    LSLLLVCT----VLVAALQTKALLSCDTVYSSLQPCIGYVLGGGTLPPDCCGGLKSLLTV  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDL--PANCHLPA  328
             KT  DRQS C CVK   + A P++L RA +    AN HL +
Sbjct  65   AKTTLDRQSFCSCVKGVASSATPEELARANEAKGSANAHLAS  106



>ref|XP_010467649.1| PREDICTED: non-specific lipid-transfer protein 8 isoform X1 [Camelina 
sativa]
Length=117

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +2

Query  26   LMSLLLLCVITS--GVVIPPLWAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKK  196
            +MS+L    I S  G+   P ++E+ ++C  ++  L PC +Y+ +G G  P TCC  VK 
Sbjct  1    MMSILKSLAIISVLGIFFIPRYSESAISCSVVIQDLQPCVSYLTSGSGKPPDTCCKGVKS  60

Query  197  VEDSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +  +  T  D+++ACQC+K + A +   + + AQ L +NC   +LP   SP VDC+++
Sbjct  61   LAAATTTSADKKAACQCIK-SVANSVTVKTELAQALASNCG-ASLPVDASPTVDCTTV  116



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (4%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDS  208
            +S+ L+  + +  V P   +EA +TC  +V+ L  C +Y+ N G +  +CC  VK +  +
Sbjct  8    LSIFLIAAVLAMAVAP--RSEAAITCGTVVSDLDSCLSYLTNKGPL-GSCCSGVKGLYGA  64

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             KT QDRQS C C+K          L +A  LP  C +  +P+ ISP+ DCS++
Sbjct  65   AKTTQDRQSVCNCLKSLADSYTDVDLSKAAGLPGQCGVN-IPYKISPSTDCSTV  117



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  + LLC++   V +P   A   +TC  + +++ PC NYV +GG +PA CC  ++ + 
Sbjct  8    KLSLVALLCIV---VALPIAQA---ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + KT  DRQ+ C C+K+     K      A  LP  C + ++P+ IS + +C+++
Sbjct  62   SAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGV-SVPYKISTSTNCAAV  116



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 64/116 (55%), Gaps = 7/116 (6%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  + LLC++   V +P   A   +TC  + +++ PC NYV +GG +PA CC  V+ + 
Sbjct  8    KLSLVALLCIV---VALPIAQA---ITCGQVASSIAPCVNYVKSGGAVPAACCNGVRSLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + KT  DRQ+ C C+K+     K      A  LP  C +  +P+ IS + +C+++
Sbjct  62   SAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVN-VPYKISTSTNCAAV  116



>gb|AFR43289.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43290.1| lipid transfer protein precursor [Gossypium barbadense]
 gb|KHG07849.1| Non-specific lipid-transfer 6 [Gossypium arboreum]
Length=120

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 62/116 (53%), Gaps = 3/116 (3%)
 Frame = +2

Query  29   MSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVL--NGGDIPATCCPAVKKVE  202
            MSL L CV+   +++    A+  ++C  +  +LLPC  YV   N G  P  CC  ++ ++
Sbjct  5    MSLKLACVVVLCLLVGAPLAQGAISCVQVKYSLLPCVGYVRGNNAGPAPPDCCKGIRSLK  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + + + DRQ+AC+C+K   A         A  LP  C +  +P+ ISP++DC  +
Sbjct  65   SAARRRLDRQAACKCIKSLAADISDINYSVAAGLPGQCKV-HIPYKISPSIDCKRV  119



>gb|KHN40180.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=115

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA ++C  ++  L PC +Y+++G G  PA CC   K +  +  T +D+++AC C+K T 
Sbjct  21   SEAAISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKSLASAATTSEDKKAACNCIKST-  79

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +K+     + AQ LP NC +  LP  ISPN DCS +
Sbjct  80   SKSININSQLAQALPGNCGI-TLPVAISPNADCSKV  114



>gb|KHN21357.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=139

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA ++C  ++  L PC +Y+++G G  PA CC   K +  +  T +D+++AC C+K T 
Sbjct  45   SEAAISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKST-  103

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +K+     + AQ LP NC +  LP  ISPN DCS +
Sbjct  104  SKSININSQLAQALPGNCGI-TLPVAISPNADCSKV  138



>ref|XP_007206148.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
 sp|Q43019.1|NLTP3_PRUDU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Prunus dulcis]
 emb|CAA65477.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80966.1| putative allergen Pru du 3.02 [Prunus dulcis x Prunus persica]
 gb|ACE80967.1| putative allergen Pru p 3.02 [Prunus dulcis x Prunus persica]
 gb|EMJ07347.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
Length=123

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 9/121 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            QL+ L+ L  +   + +    A A V+C  +VN L PC NYV NGG +  +CC  V+ + 
Sbjct  6    QLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLY  65

Query  203  DSLKTKQDRQSACQCVKET-----FAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSS  367
               +T  DRQS C C+K+      +  A       A  LP  C +  +P+ ISP+ DC S
Sbjct  66   SLAQTTADRQSICNCLKQAVNGIPYTNANAG---LAAGLPGKCGVN-IPYKISPSTDCKS  121

Query  368  I  370
            I
Sbjct  122  I  122



>ref|XP_006429567.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
 ref|XP_006481182.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42807.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
Length=115

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (57%), Gaps = 6/116 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L+S L+LC++ +G    PL A+A +TC  +  +L PC  Y+ +GG IP  CC  V+ + 
Sbjct  5    KLVSALVLCMLVTG----PLSAQA-ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLN  59

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             + +T  DRQ+AC C+K+            A  LP  C + ++P+ IS + DCS +
Sbjct  60   AAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGV-SIPYKISISTDCSKV  114



>ref|XP_002269620.1| PREDICTED: non-specific lipid-transfer protein 8-like [Vitis 
vinifera]
Length=118

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +2

Query  104  CPGLVNTLLPCANYVLNGGDIP-ATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKPD  280
            C  ++  L PC NY++NG  +P A CC     +  S  T  D+++AC+C+K    K  P+
Sbjct  30   CSDVIKDLRPCVNYLVNGSGMPPAACCTGASNLASSASTSADKKAACECIKTAAKKLNPN  89

Query  281  QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
              + A+ LP NC + +LPF +S NVDCS I
Sbjct  90   P-QLAKGLPGNCKI-SLPFTVSANVDCSKI  117



>ref|XP_010414245.1| PREDICTED: non-specific lipid-transfer protein 8 [Camelina sativa]
 ref|XP_010467650.1| PREDICTED: non-specific lipid-transfer protein 8 isoform X2 [Camelina 
sativa]
 ref|XP_010489543.1| PREDICTED: non-specific lipid-transfer protein 8 [Camelina sativa]
Length=117

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVE  202
            L SL ++ V+  G+   P ++E+ ++C  ++  L PC +Y+ +G G  P TCC  VK + 
Sbjct  5    LKSLAIISVL--GIFFIPRYSESAISCSVVIQDLQPCVSYLTSGSGKPPDTCCKGVKSLA  62

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
             +  T  D+++ACQC+K + A +   + + AQ L +NC   +LP   SP VDC+++
Sbjct  63   AATTTSADKKAACQCIK-SVANSVTVKTELAQALASNCG-ASLPVDASPTVDCTTV  116



>ref|NP_001236847.1| uncharacterized protein LOC100306055 [Glycine max]
 gb|ACU14045.1| unknown [Glycine max]
Length=139

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA ++C  ++  L PC +Y+++G G  PA CC   K +  +  T +D+++AC C+K T 
Sbjct  45   SEAAISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKST-  103

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +K+     + AQ LP NC +  LP  ISPN DCS +
Sbjct  104  SKSININSQLAQALPGNCGI-TLPVAISPNADCSKV  138



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 2/102 (2%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            VV  PL AEA ++C  + ++L  C  Y+  GG +PA CC  +K +  +  T  DRQ  C 
Sbjct  18   VVSAPL-AEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCN  76

Query  245  CVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K    K        A  LP+ C + ++ + ISP+ DC S+
Sbjct  77   CLKSLAGKISGINYGVAAGLPSKCGV-SISYKISPSTDCKSV  117



>ref|XP_002531706.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF30665.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 emb|CBA13553.1| putative nonspecific lipid transfer protein precursor [Ricinus 
communis]
Length=122

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 9/114 (8%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVE  202
            + ++++L ++T+ V      +EA ++C  ++  L PC NY++NG G  PA CC     + 
Sbjct  11   MATVMMLLLLTTSV------SEAAISCSDVIKDLRPCVNYLVNGTGTPPAACCAGASALA  64

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
             +  T  D+++AC C+K    +  P+  + AQ LPANC + +LP+ ISPN DCS
Sbjct  65   SAATTTADKRAACACIKTAAQQLNPNA-QLAQALPANCGI-SLPYTISPNFDCS  116



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  + ++L  C NY+  GG +P  CC  +K +  + KT  DRQ+AC+C+K   +    
Sbjct  29   ITCGQVASSLSQCINYLQKGGAVPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISG  88

Query  278  DQLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
                 A  LP  C + ++P+ ISP+ DCS ++
Sbjct  89   INFGLASGLPGKCGV-SVPYKISPSTDCSKVT  119



>ref|XP_008461223.1| PREDICTED: non-specific lipid-transfer protein 8 [Cucumis melo]
Length=115

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            ++A ++C  +   L+PC +Y+++G G  P+ CC   K +  +  +  D+++ACQC+K   
Sbjct  21   SKATISCSDVTKDLMPCVSYLVSGSGKPPSACCDGAKALSSAATSGADKKAACQCIKSAA  80

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +    +  K AQDLP+NC +  LPF IS  +DCS I
Sbjct  81   SNVNYNA-KLAQDLPSNCGI-TLPFSISAGIDCSKI  114



>gb|KHN43734.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=155

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 60/106 (57%), Gaps = 8/106 (8%)
 Frame = +2

Query  68   VIPPLWAEAQVTCPGLVNTLLPCANYVLNGG-DIPATCCPAVKKVEDSLKTKQDRQSACQ  244
            +IP   A+ +V+C  +V+ L PC +YVL GG  +PA CC  ++ +    +TK DRQ+ C 
Sbjct  23   IIP--MAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQTKPDRQAVCN  80

Query  245  CVKETFAKA----KPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            C+K     +        L  A +LP NC +  +P+ ISP+ DC+S 
Sbjct  81   CIKNAVRNSGFTYSHFNLNLAANLPKNCGVN-IPYQISPDTDCTSF  125



>ref|XP_007149145.1| hypothetical protein PHAVU_005G045100g [Phaseolus vulgaris]
 gb|ESW21139.1| hypothetical protein PHAVU_005G045100g [Phaseolus vulgaris]
Length=115

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 11/112 (10%)
 Frame = +2

Query  56   TSGVVIPPL--------WAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDS  208
            +SG + P L         +E  ++C  ++  L PC +Y+++G G  PA CC   K +  +
Sbjct  3    SSGALFPALVILILLVSTSEGAISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASA  62

Query  209  LKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCS  364
              T +D+++AC C+K T +K+     + AQ LP NC +  LP  ISPN DCS
Sbjct  63   ASTTEDKKAACNCIKST-SKSININSQLAQALPGNCGI-TLPVAISPNADCS  112



>ref|XP_003564507.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Brachypodium 
distachyon]
Length=121

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  32   SLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSL  211
            +L+L  V+ + V+ PP    A ++C  + +TL+PC  +V  GG     CC  ++ +    
Sbjct  8    TLVLAMVLAATVLAPPAMVRAAISCSAVYSTLMPCLQFVQGGGAPSRGCCSGIQSLLAEA  67

Query  212  KTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                DR++ C C+K     A     + RA  LP+ C++ ALP+ ISP+V+C SI
Sbjct  68   NNTPDRRTICGCLKNVANGASGGPYITRAAALPSKCNV-ALPYKISPDVNCDSI  120



>ref|XP_003623615.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES79833.1| Lipid transfer protein [Medicago truncatula]
Length=119

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +2

Query  83   WAEAQVTCPGLVNTLLPCANYVLN-GGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKET  259
             A A ++C  +++TL PC  Y+ N G  +PA CC  ++ V D  K   DRQS C+C+K T
Sbjct  23   LANADLSCGQVLSTLYPCLGYIRNPGASVPAPCCNGIRIVNDEAKNTSDRQSVCRCLKST  82

Query  260  FAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
                  + L    +LP NC +  LP+ I+P++DC+ I
Sbjct  83   IVLPGIN-LDALANLPTNCGV-NLPYKITPDIDCNKI  117



>gb|AAM22767.2| lipid transfer protein 2 precursor [Prunus persica]
Length=123

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            QL+ L+ L  +   + +    A A V+C  +VN L PC NYV NGG +  +CC  V+ + 
Sbjct  6    QLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLY  65

Query  203  DSLKTKQDRQSACQCVKETFAKA-KPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQS C C+K+       P+     A  LP  C +  +P+ ISP+ DC SI
Sbjct  66   SLAQTTADRQSICNCLKQAVNGIPYPNANAGLAAGLPGKCGVN-IPYKISPSTDCKSI  122



>ref|XP_008463259.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=125

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 59/117 (50%), Gaps = 8/117 (7%)
 Frame = +2

Query  26   LMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVED  205
            L   LL  VI  GV       EA VTC  +V+ L PC +YV  GG     CC  V+++  
Sbjct  13   LTVTLLYAVIGGGVT-----TEATVTCNQVVSNLSPCISYVTGGGSPSFNCCSGVRQLNK  67

Query  206  SLKTKQDRQSACQCVKETFAKAKPD--QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            + +T  DRQ  C+C+K        +   +  A  LP  C +  LP+ I+PN DCS+I
Sbjct  68   AAQTTPDRQDVCRCLKSLINGVTYNGQNVANAAALPTKCGVN-LPYTINPNADCSTI  123



>ref|XP_011005006.1| PREDICTED: non-specific lipid-transfer protein 8-like [Populus 
euphratica]
Length=113

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 12/105 (11%)
 Frame = +2

Query  65   VVIPPLWAEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSAC  241
            ++ PP  + A ++C  ++  L PC NY++NG G  PA CC  +  ++ +  T  D+Q+AC
Sbjct  19   LLTPP--SHAAISCNDVIKDLRPCVNYLMNGTGKPPAACCSGISAIQAAASTTADKQTAC  76

Query  242  QCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
             C+K    +  P+ QL       ANC +  LPF +SPNVDCS I+
Sbjct  77   NCIKSASKQINPNPQL-------ANCGI-TLPFTVSPNVDCSKIT  113



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L L C+I +G    P+ A A ++C  + + L PC  YV+ GG IP  CC  V+ + 
Sbjct  6    KLACLFLACMIVAG----PITANAALSCGAVSSNLAPCIGYVMQGGAIPPACCNGVRNLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPD-QLKRAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC C++             RA  +P +C +  +P+ IS + +C ++
Sbjct  62   SMARTTPDRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVN-IPYKISTSTNCKTV  117



>ref|XP_008388345.1| PREDICTED: non-specific lipid-transfer protein 1-like [Malus 
domestica]
Length=119

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  + L+C+    VV  P       +C  + N + PC  Y+  GG +P TCC  ++K+ 
Sbjct  8    KLAFVALVCI----VVGAPFAQATISSCGQVTNYVAPCIPYLKTGGKVPPTCCQGIQKLN  63

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            D+ +T  DR++AC C+  T  K +  +      LP  C +  LP+PI PN  C+SI
Sbjct  64   DAAQTAPDRRTACTCLVNTATKVQGIKPNLIYGLPGACGV-RLPYPIGPNTKCNSI  118



>ref|XP_003546844.1| PREDICTED: LOW QUALITY PROTEIN: non-specific lipid-transfer protein 
8-like [Glycine max]
Length=138

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +2

Query  86   AEAQVTCPGLVNTLLPCANYVLNG-GDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETF  262
            +EA ++C  ++  L PC +Y+++G G  PA CC   K +  +  T +D+++AC C+K T 
Sbjct  44   SEAAISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKST-  102

Query  263  AKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            +K+     + AQ LP NC +  LP  ISPN DCS +
Sbjct  103  SKSININSQLAQALPGNCGI-TLPVAISPNADCSKV  137



>ref|XP_010517150.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 8/118 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L L C+I +G    P+ A+A ++C  + + L PC  YVL GG IP  CC  V+ + 
Sbjct  6    KLACLFLACMIVAG----PITADAALSCGAVNSNLGPCIGYVLQGGVIPPACCTGVRNLN  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSI  370
               +T  DRQ AC C+ +T A+     L   R   +P  C +  +P+ IS + +C ++
Sbjct  62   SMARTTPDRQQACNCI-QTVARGLGSGLNAGRVAGIPKACGVN-IPYKISTSTNCKTV  117



>gb|KFK36744.1| hypothetical protein AALP_AA4G164000 [Arabis alpina]
Length=118

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 8/119 (7%)
 Frame = +2

Query  23   QLMSLLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVE  202
            +L  L+L C+I +G    P+ + A + C  + N +L C  Y+  GG +P  CC  +  ++
Sbjct  6    KLACLVLACMIVAG----PITSNATLACTTVNNNVLSCFGYLTQGGPLPVKCCTDIGNLK  61

Query  203  DSLKTKQDRQSACQCVKETFAKAKPDQLK--RAQDLPANCHLPALPFPISPNVDCSSIS  373
                T  DRQ+AC+C++   AKA   +L   RA  LP  C + ++PFPIS + +C+S+S
Sbjct  62   KLAGTTPDRQAACRCLQAA-AKALGSRLNAGRAAGLPKACKV-SVPFPISASTNCNSVS  118



>gb|KCW88359.1| hypothetical protein EUGRSUZ_A00745, partial [Eucalyptus grandis]
Length=164

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +2

Query  101  TCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAK--AK  274
            +C  +VN L+PCA+YV+NGG +P  CC  ++ +  + KT  DRQ  C C+K       + 
Sbjct  57   SCNQVVNRLMPCASYVVNGGGVPPACCSGIQSLNSTAKTTADRQGVCNCLKSVLNGIPSN  116

Query  275  PDQLKRAQDLPANCHLPALPFPISPNVDC  361
               +  A  LPA C +  +P+ ISP+ DC
Sbjct  117  AYNISLATGLPATCGVD-IPYKISPSTDC  144



>ref|XP_009126702.1| PREDICTED: non-specific lipid-transfer protein 4-like [Brassica 
rapa]
Length=112

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 12/112 (11%)
 Frame = +2

Query  35   LLLLCVITSGVVIPPLWAEAQVTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLK  214
            +L +C++ S         +A +TC  + ++L PCA Y+ +GG++P  CC  VKK+    +
Sbjct  12   VLTVCIVAS--------VDAAITCGTVTSSLAPCATYLSSGGEVPPPCCAGVKKLNGMAQ  63

Query  215  TKQDRQSACQCVKETFAKAKPDQLKRAQDLPANCHLPALPFPISPNVDCSSI  370
            T  DRQ AC+C+K       P     A  LP  C + ++P+PIS + +C ++
Sbjct  64   TTADRQQACKCLKAAAQGINPS---LASSLPGKCSV-SIPYPISMSTNCDNV  111



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = +2

Query  98   VTCPGLVNTLLPCANYVLNGGDIPATCCPAVKKVEDSLKTKQDRQSACQCVKETFAKAKP  277
            +TC  + + L  C  Y+ NGG +P  CC  +K +  + +T  DRQ+AC+C+K TF+ + P
Sbjct  29   ITCGQVSSALSSCLGYLKNGGAVPPGCCSGIKNLNSAAQTTADRQAACKCLK-TFSNSIP  87

Query  278  D-QLKRAQDLPANCHLPALPFPISPNVDCSSIS  373
               L  A  LP  C + ++P+ ISP+ DCS ++
Sbjct  88   GINLGLASGLPGKCGV-SVPYKISPSTDCSKVT  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527900078628