BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31688_g1_i1 len=1125 path=[1:0-1124]

Length=1125
                                                                      Score     E

ref|XP_006360579.1|  PREDICTED: transcription factor ILR3-like is...    292   8e-94   
ref|XP_010323806.1|  PREDICTED: transcription factor ILR3 isoform X1    291   2e-93   
ref|XP_009764628.1|  PREDICTED: transcription factor ILR3-like          284   2e-90   
ref|XP_009612610.1|  PREDICTED: transcription factor ILR3-like          280   1e-88   
ref|XP_010323807.1|  PREDICTED: transcription factor ILR3 isoform X2    278   3e-88   
ref|XP_002274829.2|  PREDICTED: transcription factor ILR3-like is...    261   9e-82   Vitis vinifera
ref|XP_010247015.1|  PREDICTED: transcription factor ILR3-like          258   3e-80   
ref|XP_010657331.1|  PREDICTED: transcription factor ILR3-like is...    255   4e-79   
gb|KDO59874.1|  hypothetical protein CISIN_1g026646mg                   250   2e-77   
ref|XP_010267809.1|  PREDICTED: transcription factor ILR3               249   6e-77   
ref|XP_006447466.1|  hypothetical protein CICLE_v10016381mg             247   2e-76   
emb|CBI28976.3|  unnamed protein product                                245   1e-75   
ref|XP_007043353.1|  Basic helix-loop-helix DNA-binding superfami...    245   1e-75   
emb|CDP05806.1|  unnamed protein product                                244   3e-75   
ref|XP_010035617.1|  PREDICTED: transcription factor ILR3-like          239   6e-73   
ref|XP_010931430.1|  PREDICTED: transcription factor ILR3-like          238   6e-73   
ref|XP_006447467.1|  hypothetical protein CICLE_v10016381mg             236   7e-72   
gb|EYU19205.1|  hypothetical protein MIMGU_mgv1a012900mg                234   3e-71   
gb|KDP39043.1|  hypothetical protein JCGZ_00800                         234   5e-71   
ref|XP_004505433.1|  PREDICTED: transcription factor ILR3-like          231   3e-70   
ref|XP_002522828.1|  DNA binding protein, putative                      231   5e-70   Ricinus communis
ref|XP_007211667.1|  hypothetical protein PRUPE_ppa009077mg             233   8e-70   
ref|XP_004294336.1|  PREDICTED: transcription factor ILR3-like is...    230   8e-70   
ref|XP_008224874.1|  PREDICTED: transcription factor ILR3-like          231   8e-70   
ref|XP_004248337.1|  PREDICTED: transcription factor ILR3-like          230   1e-69   
ref|XP_008244399.1|  PREDICTED: transcription factor ILR3               232   1e-69   
ref|XP_004151873.1|  PREDICTED: transcription factor ILR3-like          230   2e-69   
gb|EYU33597.1|  hypothetical protein MIMGU_mgv1a013092mg                229   2e-69   
ref|XP_011097928.1|  PREDICTED: transcription factor ILR3-like          229   2e-69   
ref|XP_002282727.1|  PREDICTED: transcription factor ILR3               229   3e-69   Vitis vinifera
ref|XP_010092311.1|  hypothetical protein L484_021173                   229   3e-69   
ref|XP_003527314.1|  PREDICTED: transcription factor ILR3-like is...    228   5e-69   
ref|XP_009792846.1|  PREDICTED: transcription factor ILR3-like          228   6e-69   
gb|KCW70120.1|  hypothetical protein EUGRSUZ_F03420                     228   7e-69   
ref|XP_008455829.1|  PREDICTED: transcription factor ILR3-like          228   9e-69   
ref|XP_008793739.1|  PREDICTED: transcription factor ILR3               228   1e-68   
ref|XP_010923988.1|  PREDICTED: transcription factor ILR3-like          227   1e-68   
ref|XP_003607701.1|  Transcription factor ILR3                          227   2e-68   
ref|XP_007211937.1|  hypothetical protein PRUPE_ppa010730mg             227   2e-68   
ref|XP_008349949.1|  PREDICTED: transcription factor ILR3-like          226   3e-68   
ref|XP_009630429.1|  PREDICTED: transcription factor ILR3-like          226   3e-68   
gb|KHG29871.1|  Transcription factor ILR3 -like protein                 226   4e-68   
ref|XP_007132981.1|  hypothetical protein PHAVU_011G141300g             226   4e-68   
ref|XP_006360098.1|  PREDICTED: transcription factor ILR3-like          226   4e-68   
ref|XP_003540036.1|  PREDICTED: transcription factor ILR3               226   4e-68   
ref|XP_009366840.1|  PREDICTED: transcription factor ILR3-like          226   6e-68   
ref|XP_010062960.1|  PREDICTED: transcription factor ILR3-like          226   7e-68   
ref|XP_009358090.1|  PREDICTED: transcription factor ILR3-like          225   7e-68   
ref|XP_011095314.1|  PREDICTED: transcription factor ILR3-like          225   7e-68   
ref|XP_008365724.1|  PREDICTED: transcription factor ILR3               225   1e-67   
ref|XP_003596613.1|  Transcription factor ILR3                          224   1e-67   
ref|XP_006352486.1|  PREDICTED: transcription factor ILR3-like          224   2e-67   
gb|ACU23766.1|  unknown                                                 224   2e-67   Glycine max [soybeans]
ref|XP_009791575.1|  PREDICTED: transcription factor ILR3-like          224   2e-67   
ref|XP_004244159.1|  PREDICTED: transcription factor ILR3               224   2e-67   
ref|XP_009597422.1|  PREDICTED: transcription factor ILR3-like          224   3e-67   
gb|ADL36593.1|  BHLH domain class transcription factor                  224   3e-67   
gb|AFN84533.1|  BHLH domain class transcription factor                  223   4e-67   
ref|XP_008800495.1|  PREDICTED: transcription factor ILR3-like          223   4e-67   
gb|AFK48825.1|  unknown                                                 223   5e-67   
ref|XP_009355579.1|  PREDICTED: transcription factor ILR3-like          221   3e-66   
ref|XP_002273184.2|  PREDICTED: transcription factor ILR3-like is...    221   4e-66   Vitis vinifera
ref|XP_006467957.1|  PREDICTED: transcription factor ILR3-like          219   1e-65   
ref|XP_003543375.1|  PREDICTED: transcription factor ILR3-like is...    218   3e-65   
gb|AEJ88330.1|  putative MYC protein                                    218   4e-65   
ref|XP_004156771.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    218   4e-65   
ref|XP_007021087.1|  DNA binding protein, putative                      218   6e-65   
ref|XP_007149692.1|  hypothetical protein PHAVU_005G091000g             217   9e-65   
ref|XP_004309656.1|  PREDICTED: transcription factor ILR3-like          217   1e-64   
ref|XP_006449136.1|  hypothetical protein CICLE_v10016511mg             216   2e-64   
gb|AEI83428.1|  bHLH transcription factor 1                             216   3e-64   
ref|XP_006393084.1|  hypothetical protein EUTSA_v10011752mg             216   3e-64   
ref|XP_009383663.1|  PREDICTED: transcription factor ILR3-like          216   4e-64   
ref|XP_003607702.1|  Transcription factor ILR3                          216   5e-64   
ref|XP_006452147.1|  hypothetical protein CICLE_v10009354mg             215   6e-64   
ref|XP_006475303.1|  PREDICTED: transcription factor ILR3-like          215   9e-64   
ref|XP_002316706.2|  hypothetical protein POPTR_0011s03360g             214   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010694263.1|  PREDICTED: transcription factor ILR3               213   3e-63   
ref|XP_004487616.1|  PREDICTED: transcription factor ILR3-like          213   5e-63   
gb|KFK35883.1|  hypothetical protein AALP_AA4G049100                    212   7e-63   
ref|XP_004151959.1|  PREDICTED: transcription factor ILR3-like          212   1e-62   
ref|XP_002891614.1|  basic helix-loop-helix family protein              211   1e-62   
ref|XP_011003406.1|  PREDICTED: transcription factor ILR3-like          212   1e-62   
ref|XP_010999542.1|  PREDICTED: transcription factor ILR3-like          212   2e-62   
ref|XP_006401546.1|  hypothetical protein EUTSA_v10014564mg             211   2e-62   
ref|NP_200279.1|  transcription factor ILR3                             211   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64276.1|  bHLH transcription factor, putative                     211   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909862.1|  PREDICTED: transcription factor ILR3-like          211   3e-62   
gb|KHN36564.1|  Transcription factor bHLH115                            211   4e-62   
ref|XP_004487368.1|  PREDICTED: transcription factor bHLH115-like       211   4e-62   
ref|XP_007149945.1|  hypothetical protein PHAVU_005G112500g             210   4e-62   
ref|XP_008371203.1|  PREDICTED: transcription factor ILR3-like          208   6e-62   
gb|EPS70109.1|  hypothetical protein M569_04652                         210   7e-62   
ref|XP_010482878.1|  PREDICTED: transcription factor ILR3-like          209   2e-61   
ref|XP_010443048.1|  PREDICTED: transcription factor ILR3               209   2e-61   
ref|XP_002304984.1|  hypothetical protein POPTR_0004s03190g             209   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009393337.1|  PREDICTED: transcription factor ILR3-like          208   2e-61   
gb|KHN27978.1|  Transcription factor ILR3                               208   3e-61   
ref|XP_006280790.1|  hypothetical protein CARUB_v10026758mg             211   3e-61   
ref|XP_008454558.1|  PREDICTED: transcription factor ILR3-like is...    208   4e-61   
ref|XP_010448513.1|  PREDICTED: transcription factor ILR3-like          208   4e-61   
ref|XP_008454561.1|  PREDICTED: transcription factor ILR3-like          208   4e-61   
ref|XP_004151962.1|  PREDICTED: transcription factor ILR3-like          208   4e-61   
gb|KGN57965.1|  hypothetical protein Csa_3G415100                       207   5e-61   
emb|CDY42475.1|  BnaA10g08510D                                          207   9e-61   
ref|XP_009120001.1|  PREDICTED: transcription factor ILR3-like          207   1e-60   
ref|XP_010539274.1|  PREDICTED: transcription factor ILR3               207   1e-60   
emb|CDY41004.1|  BnaA02g27940D                                          206   1e-60   
ref|XP_004173321.1|  PREDICTED: transcription factor ILR3-like          206   1e-60   
ref|XP_010062961.1|  PREDICTED: transcription factor ILR3-like is...    206   2e-60   
emb|CDY28758.1|  BnaA02g09500D                                          206   2e-60   
ref|XP_009127072.1|  PREDICTED: transcription factor ILR3               206   3e-60   
gb|KFK27081.1|  hypothetical protein AALP_AA8G331500                    206   3e-60   
ref|NP_175518.1|  transcription factor bHLH115                          204   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304584.1|  hypothetical protein CARUB_v10011628mg             204   8e-60   
gb|AES89899.2|  BHLH domain class transcription factor                  203   1e-59   
ref|XP_006837018.1|  hypothetical protein AMTR_s00098p00170370          203   2e-59   
emb|CDY35576.1|  BnaC05g27050D                                          202   6e-59   
gb|AFK34442.1|  unknown                                                 202   7e-59   
ref|XP_010479562.1|  PREDICTED: transcription factor bHLH115-like       202   9e-59   
ref|XP_010461939.1|  PREDICTED: transcription factor bHLH115            201   2e-58   
ref|XP_010647171.1|  PREDICTED: transcription factor ILR3-like is...    200   2e-58   
emb|CDY47456.1|  BnaC09g31010D                                          201   2e-58   
ref|XP_008776472.1|  PREDICTED: transcription factor ILR3-like          201   3e-58   
ref|XP_007025918.1|  DNA binding protein, putative isoform 2            200   3e-58   
ref|XP_010647172.1|  PREDICTED: transcription factor ILR3-like is...    199   5e-58   
ref|XP_009144925.1|  PREDICTED: transcription factor bHLH115            199   5e-58   
ref|XP_004232754.1|  PREDICTED: transcription factor ILR3               199   6e-58   
ref|XP_010647170.1|  PREDICTED: transcription factor ILR3-like is...    199   7e-58   
emb|CDY71937.1|  BnaA05g35780D                                          199   8e-58   
ref|NP_001239799.1|  uncharacterized protein LOC100813088               199   8e-58   
gb|KGN57970.1|  hypothetical protein Csa_3G416140                       199   9e-58   
ref|XP_010500676.1|  PREDICTED: transcription factor bHLH115-like       199   1e-57   
ref|XP_006365882.1|  PREDICTED: transcription factor ILR3-like          199   1e-57   
ref|NP_001242620.1|  uncharacterized protein LOC100806838               198   3e-57   
ref|XP_009617474.1|  PREDICTED: transcription factor ILR3-like          198   3e-57   
ref|XP_002518568.1|  DNA binding protein, putative                      197   6e-57   Ricinus communis
ref|XP_003597042.1|  Transcription factor ILR3                          196   2e-56   
ref|XP_009772342.1|  PREDICTED: transcription factor ILR3-like          196   2e-56   
gb|ACG38605.1|  bHLH transcription factor                               196   2e-56   Zea mays [maize]
ref|XP_008677332.1|  PREDICTED: LOC100284429 isoform X1                 196   2e-56   
gb|KHG21334.1|  Transcription factor ILR3 -like protein                 196   2e-56   
ref|XP_003543288.1|  PREDICTED: transcription factor ILR3-like is...    195   3e-56   
gb|KHN36734.1|  Transcription factor ILR3                               194   7e-56   
emb|CDY43809.1|  BnaC03g14420D                                          194   9e-56   
ref|XP_003547112.1|  PREDICTED: transcription factor ILR3-like          192   2e-55   
emb|CAN70830.1|  hypothetical protein VITISV_005283                     197   3e-55   Vitis vinifera
gb|KHN25765.1|  Transcription factor ILR3                               193   3e-55   
ref|NP_001185192.1|  transcription factor bHLH115                       194   4e-55   
ref|XP_007025917.1|  Basic helix-loop-helix DNA-binding superfami...    193   9e-55   
ref|XP_009414543.1|  PREDICTED: transcription factor ILR3               191   1e-54   
gb|KDP20820.1|  hypothetical protein JCGZ_21291                         191   2e-54   
ref|XP_006847910.1|  hypothetical protein AMTR_s00029p00112130          190   2e-54   
ref|XP_006659812.1|  PREDICTED: transcription factor ILR3-like          191   3e-54   
emb|CDY43028.1|  BnaA03g11750D                                          190   3e-54   
gb|KCW70124.1|  hypothetical protein EUGRSUZ_F03420                     189   5e-54   
ref|XP_004294337.1|  PREDICTED: transcription factor ILR3-like is...    188   6e-54   
gb|KHG15485.1|  Transcription factor ILR3 -like protein                 189   7e-54   
ref|XP_009132430.1|  PREDICTED: transcription factor ILR3-like          189   8e-54   
gb|ADC33137.1|  helix-loop-helix-like protein                           189   8e-54   Triticum aestivum [Canadian hard winter wheat]
gb|AHZ94970.1|  helix-loop-helix-like protein                           186   2e-53   
gb|EAZ41459.1|  hypothetical protein OsJ_25981                          189   2e-53   Oryza sativa Japonica Group [Japonica rice]
gb|ACN40263.1|  unknown                                                 188   2e-53   Picea sitchensis
ref|NP_001060960.1|  Os08g0138500                                       188   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658659.1|  PREDICTED: transcription factor ILR3-like          188   2e-53   
ref|XP_002316971.1|  basic helix-loop-helix family protein              188   3e-53   Populus trichocarpa [western balsam poplar]
gb|ABK23190.1|  unknown                                                 187   3e-53   Picea sitchensis
gb|EAZ05534.1|  hypothetical protein OsI_27750                          187   4e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_010274798.1|  PREDICTED: transcription factor bHLH104-like       186   4e-53   
ref|XP_008454559.1|  PREDICTED: transcription factor ILR3-like is...    186   5e-53   
dbj|BAK03093.1|  predicted protein                                      187   7e-53   
ref|XP_008441610.1|  PREDICTED: transcription factor ILR3-like          186   1e-52   
gb|ABK96448.1|  unknown                                                 186   1e-52   Populus trichocarpa x Populus deltoides
ref|XP_003562971.1|  PREDICTED: transcription factor ILR3-like          186   1e-52   
ref|XP_006370611.1|  basic helix-loop-helix family protein              186   1e-52   
ref|XP_011048283.1|  PREDICTED: transcription factor ILR3-like          186   4e-52   
gb|EMS54079.1|  Transcription factor ILR3                               184   5e-52   
ref|XP_011030891.1|  PREDICTED: transcription factor ILR3-like          184   6e-52   
gb|EEC82221.1|  hypothetical protein OsI_26369                          185   6e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001059905.1|  Os07g0543000                                       185   6e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004172808.1|  PREDICTED: transcription factor ILR3-like          181   9e-52   
gb|ACN40301.1|  unknown                                                 183   1e-51   Picea sitchensis
ref|XP_004972892.1|  PREDICTED: transcription factor ILR3-like          183   2e-51   
gb|AFW57417.1|  putative HLH DNA-binding domain superfamily protein     182   5e-51   
ref|XP_004145091.1|  PREDICTED: transcription factor ILR3-like          182   5e-51   
emb|CDO99702.1|  unnamed protein product                                182   5e-51   
ref|NP_001146503.1|  uncharacterized protein LOC100280093               182   6e-51   Zea mays [maize]
gb|AAO72577.1|  helix-loop-helix-like protein                           181   8e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007148298.1|  hypothetical protein PHAVU_006G196600g             179   2e-50   
ref|XP_003573355.1|  PREDICTED: transcription factor ILR3-like          181   2e-50   
ref|XP_001778884.1|  predicted protein                                  180   2e-50   
ref|XP_002962528.1|  hypothetical protein SELMODRAFT_165556             180   3e-50   
ref|XP_001754335.1|  predicted protein                                  178   4e-50   
ref|XP_010940315.1|  PREDICTED: transcription factor ILR3-like is...    177   4e-50   
ref|XP_010062962.1|  PREDICTED: transcription factor ILR3-like is...    178   7e-50   
ref|XP_004957936.1|  PREDICTED: transcription factor ILR3-like is...    179   8e-50   
ref|XP_004957935.1|  PREDICTED: transcription factor ILR3-like is...    179   8e-50   
gb|EMT27826.1|  Transcription factor ILR3                               178   9e-50   
ref|NP_001150796.1|  LOC100284429                                       178   1e-49   Zea mays [maize]
gb|AFW61272.1|  putative HLH DNA-binding domain superfamily protein     178   1e-49   
ref|XP_010940314.1|  PREDICTED: transcription factor ILR3-like is...    177   2e-49   
ref|XP_008813314.1|  PREDICTED: transcription factor ILR3-like is...    177   2e-49   
ref|XP_010109550.1|  hypothetical protein L484_018285                   179   3e-49   
ref|XP_008813306.1|  PREDICTED: transcription factor ILR3-like is...    177   3e-49   
ref|XP_006827502.1|  hypothetical protein AMTR_s00009p00175450          176   5e-49   
ref|XP_010092690.1|  hypothetical protein L484_019764                   174   1e-48   
ref|XP_009381065.1|  PREDICTED: transcription factor bHLH115-like       174   3e-48   
ref|XP_010544248.1|  PREDICTED: transcription factor bHLH115            174   5e-48   
ref|XP_010262298.1|  PREDICTED: transcription factor bHLH104-like       173   7e-48   
ref|XP_006489749.1|  PREDICTED: transcription factor bHLH104-like...    172   1e-47   
ref|XP_002268590.2|  PREDICTED: transcription factor bHLH104-like       172   2e-47   Vitis vinifera
ref|XP_002462974.1|  hypothetical protein SORBIDRAFT_02g035580          172   2e-47   Sorghum bicolor [broomcorn]
dbj|BAJ40866.1|  bHLH transcriptional factor                            170   6e-47   
ref|XP_008651108.1|  PREDICTED: uncharacterized protein LOC100273...    171   7e-47   
ref|XP_010935491.1|  PREDICTED: transcription factor bHLH115-like       171   8e-47   
ref|XP_008651109.1|  PREDICTED: uncharacterized protein LOC100273...    171   9e-47   
ref|XP_006594877.1|  PREDICTED: transcription factor ILR3-like is...    168   2e-46   
gb|KHG04921.1|  Transcription factor protein                            169   2e-46   
dbj|BAK01217.1|  predicted protein                                      169   5e-46   
ref|XP_006489748.1|  PREDICTED: transcription factor bHLH104-like...    167   1e-45   
ref|XP_006420195.1|  hypothetical protein CICLE_v10005872mg             167   1e-45   
ref|XP_009388594.1|  PREDICTED: transcription factor bHLH115-like       166   3e-45   
ref|XP_001777933.1|  predicted protein                                  164   4e-45   
ref|XP_004497838.1|  PREDICTED: transcription factor bHLH104-like       166   4e-45   
ref|XP_006493504.1|  PREDICTED: transcription factor ILR3-like          163   6e-45   
ref|XP_010326757.1|  PREDICTED: transcription factor bHLH104            164   2e-44   
ref|XP_003568328.1|  PREDICTED: transcription factor ILR3-like          164   2e-44   
ref|XP_009409051.1|  PREDICTED: transcription factor ILR3-like is...    164   2e-44   
gb|EMT07811.1|  Transcription factor ILR3                               167   2e-44   
ref|XP_006354504.1|  PREDICTED: transcription factor bHLH104-like       164   3e-44   
ref|XP_009775135.1|  PREDICTED: transcription factor bHLH104 isof...    163   3e-44   
ref|XP_008803703.1|  PREDICTED: transcription factor bHLH115-like       163   4e-44   
ref|XP_008803141.1|  PREDICTED: transcription factor bHLH115-like       163   5e-44   
ref|XP_007223393.1|  hypothetical protein PRUPE_ppa011217mg             162   1e-43   
ref|XP_009609911.1|  PREDICTED: transcription factor bHLH104-like       162   1e-43   
ref|XP_003590056.1|  Transcription factor bHLH104                       161   3e-43   
ref|XP_009409049.1|  PREDICTED: transcription factor bHLH115-like...    160   4e-43   
ref|XP_007145840.1|  hypothetical protein PHAVU_007G272600g             159   1e-42   
ref|XP_008224372.1|  PREDICTED: transcription factor bHLH104            159   1e-42   
ref|XP_006420196.1|  hypothetical protein CICLE_v10005872mg             158   2e-42   
ref|XP_010937539.1|  PREDICTED: transcription factor ILR3-like is...    159   2e-42   
gb|KDO50387.1|  hypothetical protein CISIN_1g032672mg                   153   2e-41   
ref|XP_010937538.1|  PREDICTED: transcription factor bHLH115-like...    156   2e-41   
ref|XP_006378346.1|  hypothetical protein POPTR_0010s08360g             155   2e-41   
ref|XP_002314636.1|  basic helix-loop-helix family protein              155   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011073517.1|  PREDICTED: transcription factor bHLH104            156   2e-41   
ref|XP_004961887.1|  PREDICTED: transcription factor ILR3-like          156   3e-41   
ref|XP_004296358.1|  PREDICTED: transcription factor bHLH104-like       156   3e-41   
gb|ACL54160.1|  unknown                                                 153   5e-41   Zea mays [maize]
dbj|BAJ87023.1|  predicted protein                                      155   6e-41   
ref|XP_009395404.1|  PREDICTED: transcription factor ILR3-like          154   8e-41   
ref|XP_006594652.1|  PREDICTED: transcription factor ILR3-like          152   8e-41   
ref|XP_003535811.1|  PREDICTED: transcription factor bHLH104-like       154   1e-40   
ref|XP_009395406.1|  PREDICTED: transcription factor ILR3-like          154   1e-40   
ref|XP_009420541.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    151   1e-40   
ref|XP_010532633.1|  PREDICTED: transcription factor bHLH104            157   1e-40   
ref|XP_009419715.1|  PREDICTED: transcription factor ILR3-like          154   1e-40   
ref|XP_010241997.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    151   2e-40   
ref|XP_009775141.1|  PREDICTED: transcription factor bHLH104 isof...    153   2e-40   
ref|XP_010069141.1|  PREDICTED: transcription factor bHLH104-like       154   3e-40   
ref|XP_003555760.1|  PREDICTED: transcription factor bHLH104-like       152   3e-40   
ref|XP_010488368.1|  PREDICTED: transcription factor bHLH34-like        155   4e-40   
gb|ACG27921.1|  DNA binding protein                                     152   6e-40   Zea mays [maize]
ref|XP_008676877.1|  PREDICTED: uncharacterized protein LOC100274...    152   6e-40   
gb|AFW66775.1|  putative HLH DNA-binding domain superfamily protein     152   6e-40   
gb|KDP40313.1|  hypothetical protein JCGZ_02311                         152   8e-40   
emb|CDO99218.1|  unnamed protein product                                152   1e-39   
ref|XP_009378999.1|  PREDICTED: transcription factor bHLH104-like       151   1e-39   
ref|XP_010466638.1|  PREDICTED: transcription factor bHLH34-like        154   1e-39   
gb|ACF81377.1|  unknown                                                 151   2e-39   Zea mays [maize]
gb|ACU18977.1|  unknown                                                 150   2e-39   Glycine max [soybeans]
ref|XP_010512182.1|  PREDICTED: transcription factor bHLH34-like        154   2e-39   
gb|KHN00301.1|  Transcription factor bHLH104                            150   2e-39   
ref|XP_006379889.1|  hypothetical protein POPTR_0008s16560g             150   3e-39   
ref|XP_006447465.1|  hypothetical protein CICLE_v10016381mg             149   4e-39   
ref|XP_011030516.1|  PREDICTED: transcription factor bHLH104-like       150   4e-39   
ref|XP_006648231.1|  PREDICTED: transcription factor ILR3-like          150   5e-39   
ref|XP_010937540.1|  PREDICTED: transcription factor ILR3-like is...    149   5e-39   
ref|XP_010256783.1|  PREDICTED: transcription factor ILR3-like          149   8e-39   
ref|XP_004134070.1|  PREDICTED: transcription factor bHLH104-like       149   1e-38   
ref|XP_009408170.1|  PREDICTED: transcription factor ILR3-like is...    147   1e-38   
ref|XP_009408169.1|  PREDICTED: transcription factor ILR3-like is...    148   1e-38   
gb|KHN22198.1|  Transcription factor bHLH104                            148   2e-38   
ref|XP_006406065.1|  hypothetical protein EUTSA_v10021177mg             150   2e-38   
ref|XP_008391189.1|  PREDICTED: transcription factor bHLH104-like       147   3e-38   
ref|XP_002439907.1|  hypothetical protein SORBIDRAFT_09g022280          148   3e-38   
ref|NP_001150072.1|  DNA binding protein                                147   4e-38   
ref|XP_010650065.1|  PREDICTED: transcription factor bHLH104 isof...    146   1e-37   
ref|XP_006298151.1|  hypothetical protein CARUB_v10014200mg             149   1e-37   
gb|KHN33610.1|  Transcription factor ILR3                               142   2e-37   
ref|XP_002280987.2|  PREDICTED: transcription factor bHLH104 isof...    145   2e-37   
ref|XP_004952164.1|  PREDICTED: transcription factor ILR3-like          145   3e-37   
ref|XP_008438540.1|  PREDICTED: transcription factor bHLH104-like       144   5e-37   
emb|CBI23608.3|  unnamed protein product                                145   5e-37   
ref|XP_002870316.1|  basic helix-loop-helix family protein              145   6e-37   
gb|KFK39609.1|  hypothetical protein AALP_AA3G266100                    146   8e-37   
gb|KFK23754.1|  hypothetical protein AALP_AAs74096U000300               145   1e-36   
gb|KHG15573.1|  Transcription factor ILR3 -like protein                 140   1e-36   
ref|XP_011096123.1|  PREDICTED: transcription factor ILR3-like          143   1e-36   
ref|XP_011091209.1|  PREDICTED: transcription factor bHLH104            143   1e-36   
ref|NP_001148890.1|  DNA binding protein                                143   2e-36   
ref|XP_006414711.1|  hypothetical protein EUTSA_v10025927mg             144   2e-36   
ref|XP_011029840.1|  PREDICTED: transcription factor bHLH104-like...    142   3e-36   
gb|EYU32540.1|  hypothetical protein MIMGU_mgv1a012843mg                142   3e-36   
emb|CDY49420.1|  BnaCnng17300D                                          144   3e-36   
ref|XP_009124106.1|  PREDICTED: transcription factor bHLH104 isof...    143   4e-36   
ref|XP_009124105.1|  PREDICTED: transcription factor bHLH104 isof...    143   4e-36   
ref|XP_010435125.1|  PREDICTED: transcription factor bHLH104            142   8e-36   
ref|XP_010440465.1|  PREDICTED: transcription factor bHLH104-like       142   1e-35   
emb|CDY12770.1|  BnaC04g28710D                                          142   1e-35   
ref|NP_849383.1|  transcription factor bHLH104                          141   3e-35   
gb|KHN19061.1|  Transcription factor ILR3                               137   3e-35   
ref|XP_006284189.1|  hypothetical protein CARUB_v10005335mg             141   3e-35   
ref|XP_010450041.1|  PREDICTED: transcription factor bHLH104-like       141   4e-35   
ref|NP_567431.1|  transcription factor bHLH104                          141   4e-35   
ref|XP_010093421.1|  hypothetical protein L484_012819                   139   9e-35   
emb|CDY08983.1|  BnaC01g31080D                                          140   1e-34   
ref|XP_010671056.1|  PREDICTED: transcription factor bHLH104            138   2e-34   
ref|XP_002529295.1|  DNA binding protein, putative                      136   4e-34   
ref|XP_002885559.1|  basic helix-loop-helix family protein              139   4e-34   
ref|XP_011029839.1|  PREDICTED: transcription factor bHLH104-like...    136   6e-34   
emb|CDX77539.1|  BnaA07g06770D                                          138   6e-34   
ref|NP_001142225.1|  uncharacterized protein LOC100274393               134   6e-34   
ref|NP_001045680.1|  Os02g0116600                                       136   8e-34   
ref|XP_007035086.1|  Basic helix-loop-helix DNA-binding superfami...    135   8e-34   
emb|CAN61035.1|  hypothetical protein VITISV_041750                     134   1e-33   
ref|XP_009102650.1|  PREDICTED: transcription factor bHLH34             136   2e-33   
ref|XP_007035087.1|  Basic helix-loop-helix DNA-binding superfami...    133   5e-33   
emb|CDY35510.1|  BnaA01g24020D                                          134   1e-32   
emb|CBI35161.3|  unnamed protein product                                130   1e-32   
gb|EMT29974.1|  Transcription factor ILR3                               133   3e-32   
gb|EMS59404.1|  Transcription factor ILR3                               134   3e-32   
gb|AAM10939.1|AF488573_1  putative bHLH transcription factor            132   5e-32   
ref|XP_010674918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    128   5e-32   
dbj|BAK00374.1|  predicted protein                                      131   7e-32   
ref|NP_188962.2|  transcription factor bHLH34                           132   1e-31   
gb|EYU25978.1|  hypothetical protein MIMGU_mgv1a0142551mg               127   1e-31   
gb|EMT28781.1|  Transcription factor ILR3                               128   2e-31   
gb|AFW87276.1|  putative HLH DNA-binding domain superfamily protein     123   2e-29   
gb|ACU17812.1|  unknown                                                 119   8e-29   
ref|XP_003573308.1|  PREDICTED: transcription factor ILR3-like          122   9e-29   
emb|CDX85069.1|  BnaC07g08370D                                          124   9e-29   
gb|EPS62474.1|  hypothetical protein M569_12315                         119   3e-28   
ref|XP_002881143.1|  predicted protein                                  116   9e-28   
gb|ACU21182.1|  unknown                                                 116   4e-27   
ref|XP_002862580.1|  hypothetical protein ARALYDRAFT_920517             114   5e-27   
gb|ACN37104.1|  unknown                                                 114   9e-27   
ref|XP_002993147.1|  hypothetical protein SELMODRAFT_431241             114   3e-26   
ref|XP_010497553.1|  PREDICTED: transcription factor bHLH115-like       110   1e-25   
gb|AFW66778.1|  putative HLH DNA-binding domain superfamily protein     107   2e-24   
gb|EAY98281.1|  hypothetical protein OsI_20189                          108   5e-24   
gb|EEE63953.1|  hypothetical protein OsJ_18778                          105   5e-23   
gb|ABA27067.1|  TO91-1rc                                              97.8    1e-21   
gb|EMS59536.1|  Transcription factor ILR3                               101   2e-21   
ref|XP_008813250.1|  PREDICTED: transcription factor bHLH104-like     98.2    7e-21   
ref|XP_008660879.1|  PREDICTED: transcription factor ILR3-like        97.4    1e-20   
ref|XP_008350013.1|  PREDICTED: transcription factor bHLH34-like      90.9    2e-18   
ref|XP_010650066.1|  PREDICTED: transcription factor ILR3 isoform X3  91.7    2e-18   
ref|XP_008361598.1|  PREDICTED: transcription factor bHLH34-like      87.8    2e-17   
ref|XP_010918791.1|  PREDICTED: transcription factor bHLH104-like...  85.9    9e-17   
ref|XP_006383101.1|  hypothetical protein POPTR_0005s11550g           85.1    2e-15   
ref|XP_006859207.1|  hypothetical protein AMTR_s00070p00188780        86.7    2e-15   
ref|XP_004287813.1|  PREDICTED: transcription factor bHLH121-like     85.5    2e-15   
ref|XP_008336910.1|  PREDICTED: transcription factor bHLH121-like     85.1    3e-15   
ref|XP_003531414.1|  PREDICTED: transcription factor bHLH121-like     83.2    1e-14   
ref|XP_001758113.1|  predicted protein                                85.1    1e-14   
ref|XP_010679934.1|  PREDICTED: transcription factor bHLH121          83.6    1e-14   
ref|XP_011043188.1|  PREDICTED: transcription factor bHLH121-like     83.2    2e-14   
ref|XP_003546649.1|  PREDICTED: transcription factor bHLH121 isof...  81.6    3e-14   
ref|XP_010548277.1|  PREDICTED: transcription factor bHLH11           82.0    4e-14   
gb|EEC73066.1|  hypothetical protein OsI_07026                        82.0    5e-14   
ref|XP_008236198.1|  PREDICTED: transcription factor bHLH121          81.6    6e-14   
ref|XP_007200377.1|  hypothetical protein PRUPE_ppa008347mg           81.6    6e-14   
ref|XP_006851964.1|  hypothetical protein AMTR_s00041p00193340        81.6    6e-14   
ref|XP_004289841.1|  PREDICTED: transcription factor bHLH121-like     81.3    8e-14   
ref|NP_001046730.1|  Os02g0433600                                     81.3    8e-14   
ref|XP_009783164.1|  PREDICTED: transcription factor bHLH121-like     81.3    8e-14   
gb|KEH30588.1|  transcription factor                                  80.5    8e-14   
gb|EMS61636.1|  hypothetical protein TRIUR3_06306                     79.7    8e-14   
ref|XP_009379403.1|  PREDICTED: transcription factor bHLH121-like     80.9    1e-13   
gb|KEH30589.1|  transcription factor                                  80.1    1e-13   
ref|XP_002277206.2|  PREDICTED: transcription factor bHLH121          80.5    1e-13   
emb|CDO96948.1|  unnamed protein product                              80.5    2e-13   
ref|XP_001771284.1|  predicted protein                                81.6    2e-13   
ref|XP_003059710.1|  predicted protein                                79.3    2e-13   
ref|XP_002521657.1|  DNA binding protein, putative                    79.7    2e-13   
emb|CAN74571.1|  hypothetical protein VITISV_018451                   80.5    2e-13   
ref|XP_010029679.1|  PREDICTED: transcription factor bHLH121 isof...  79.7    2e-13   
ref|XP_002458163.1|  hypothetical protein SORBIDRAFT_03g028030        79.3    3e-13   
gb|KCW56632.1|  hypothetical protein EUGRSUZ_I02346                   79.0    5e-13   
ref|NP_001152439.1|  LOC100286079                                     78.6    5e-13   
gb|KHN05467.1|  Transcription factor bHLH121                          78.2    5e-13   
ref|XP_004505689.1|  PREDICTED: transcription factor bHLH121-like...  78.2    6e-13   
ref|XP_007153217.1|  hypothetical protein PHAVU_003G016700g           78.6    6e-13   
emb|CEG02114.1|  Myc-type, basic helix-loop-helix (bHLH) domain       77.4    6e-13   
ref|XP_007133432.1|  hypothetical protein PHAVU_011G178100g           77.8    7e-13   
ref|XP_010029678.1|  PREDICTED: transcription factor bHLH121 isof...  79.0    7e-13   
ref|XP_009363493.1|  PREDICTED: transcription factor bHLH121-like     78.2    9e-13   
ref|XP_010261279.1|  PREDICTED: transcription factor bHLH121          78.2    9e-13   
ref|XP_010113346.1|  hypothetical protein L484_026678                 77.8    1e-12   
ref|XP_006391636.1|  hypothetical protein EUTSA_v10023630mg           77.4    1e-12   
gb|KDP44874.1|  hypothetical protein JCGZ_01374                       75.9    1e-12   
ref|XP_006665082.1|  PREDICTED: transcription factor bHLH121-like     78.2    1e-12   
ref|XP_007204901.1|  hypothetical protein PRUPE_ppa008596mg           77.8    1e-12   
ref|XP_009383990.1|  PREDICTED: transcription factor bHLH121          77.4    1e-12   
ref|XP_010508140.1|  PREDICTED: transcription factor bHLH121-like     77.0    2e-12   
ref|XP_003529225.1|  PREDICTED: transcription factor bHLH121 isof...  77.4    2e-12   
ref|XP_007046692.1|  Basic helix-loop-helix DNA-binding superfami...  77.4    2e-12   
ref|XP_009346632.1|  PREDICTED: transcription factor bHLH121          77.4    2e-12   
ref|XP_004230930.1|  PREDICTED: transcription factor bHLH121          77.4    2e-12   
ref|XP_002312979.2|  hypothetical protein POPTR_0009s13220g           77.0    2e-12   
ref|XP_004952384.1|  PREDICTED: transcription factor bHLH121-like     77.0    2e-12   
gb|KDP46754.1|  hypothetical protein JCGZ_06542                       77.0    2e-12   
ref|XP_011092862.1|  PREDICTED: transcription factor bHLH121          76.6    3e-12   
ref|XP_008440819.1|  PREDICTED: transcription factor bHLH121          76.6    3e-12   
gb|KDP27585.1|  hypothetical protein JCGZ_19590                       76.6    3e-12   
ref|XP_004134862.1|  PREDICTED: transcription factor bHLH121-like     76.3    4e-12   
gb|KGN48915.1|  hypothetical protein Csa_6G505920                     76.3    4e-12   
ref|XP_004158905.1|  PREDICTED: transcription factor bHLH121-like     75.5    5e-12   
ref|XP_010920215.1|  PREDICTED: transcription factor bHLH121          76.3    5e-12   
ref|XP_010526564.1|  PREDICTED: transcription factor bHLH121          75.5    5e-12   
ref|XP_002964160.1|  hypothetical protein SELMODRAFT_405883           72.8    5e-12   
ref|XP_006412028.1|  hypothetical protein EUTSA_v10026039mg           74.7    5e-12   
ref|XP_003573201.1|  PREDICTED: transcription factor bHLH121-like     75.9    5e-12   
ref|XP_010487939.1|  PREDICTED: transcription factor bHLH121-like     75.1    6e-12   
gb|KFK30238.1|  hypothetical protein AALP_AA7G235400                  75.1    6e-12   
ref|NP_188620.1|  transcription factor bHLH121                        75.1    6e-12   
ref|XP_006406448.1|  hypothetical protein EUTSA_v10021271mg           75.1    6e-12   
ref|XP_011046795.1|  PREDICTED: transcription factor bHLH121-like     75.5    6e-12   
ref|XP_010466150.1|  PREDICTED: transcription factor bHLH121          75.1    7e-12   
ref|XP_010066253.1|  PREDICTED: transcription factor bHLH121-like     75.5    8e-12   
gb|ACU18754.1|  unknown                                               72.0    8e-12   
ref|XP_010437386.1|  PREDICTED: transcription factor bHLH11-like ...  74.3    8e-12   
ref|NP_001242300.1|  uncharacterized protein LOC100817000             74.3    9e-12   
emb|CAN69664.1|  hypothetical protein VITISV_029413                   76.6    9e-12   
emb|CDX72574.1|  BnaC07g45960D                                        73.9    9e-12   
ref|XP_009138406.1|  PREDICTED: transcription factor bHLH11           73.9    1e-11   
ref|XP_002505435.1|  predicted protein                                73.9    1e-11   
ref|XP_009610672.1|  PREDICTED: transcription factor bHLH121-like...  75.1    1e-11   
ref|XP_010437385.1|  PREDICTED: transcription factor bHLH11-like ...  74.3    1e-11   
ref|XP_009111465.1|  PREDICTED: transcription factor bHLH121          74.3    1e-11   
ref|XP_002529247.1|  DNA binding protein, putative                    74.7    1e-11   
ref|NP_001030729.1|  transcription factor bHLH121                     74.7    1e-11   
ref|XP_007041927.1|  Basic helix-loop-helix DNA-binding superfami...  74.7    2e-11   
ref|XP_009610673.1|  PREDICTED: transcription factor bHLH121-like...  74.3    2e-11   
gb|KDO39039.1|  hypothetical protein CISIN_1g022288mg                 73.9    2e-11   
ref|XP_006359649.1|  PREDICTED: transcription factor bHLH121-like...  74.3    2e-11   
ref|XP_006359650.1|  PREDICTED: transcription factor bHLH121-like...  74.3    2e-11   
ref|XP_008241823.1|  PREDICTED: transcription factor bHLH121          74.3    2e-11   
ref|XP_008457648.1|  PREDICTED: transcription factor bHLH121 isof...  74.3    2e-11   
ref|XP_010090287.1|  hypothetical protein L484_024952                 73.9    2e-11   
ref|XP_006487406.1|  PREDICTED: transcription factor bHLH121-like...  74.3    2e-11   
ref|XP_006423595.1|  hypothetical protein CICLE_v10028783mg           74.3    2e-11   
ref|XP_009788103.1|  PREDICTED: transcription factor bHLH121          73.9    3e-11   
gb|KHG29974.1|  Transcription factor protein                          73.9    3e-11   
emb|CDY42214.1|  BnaA01g25810D                                        73.6    3e-11   
ref|XP_002885338.1|  basic helix-loop-helix family protein            72.8    3e-11   
emb|CDY33424.1|  BnaC01g33010D                                        73.9    4e-11   
ref|XP_010690442.1|  PREDICTED: transcription factor bHLH121-like     72.8    4e-11   
ref|XP_002306170.1|  hypothetical protein POPTR_0004s17540g           73.2    5e-11   
ref|XP_004158392.1|  PREDICTED: transcription factor bHLH121-like     72.8    5e-11   
ref|XP_011031843.1|  PREDICTED: transcription factor bHLH47-like      71.6    5e-11   
ref|XP_007131595.1|  hypothetical protein PHAVU_011G026500g           72.4    5e-11   
emb|CBI17374.3|  unnamed protein product                              72.8    5e-11   
ref|XP_002265960.1|  PREDICTED: transcription factor bHLH121          72.8    6e-11   
ref|XP_004147018.1|  PREDICTED: transcription factor bHLH121-like     72.8    6e-11   
emb|CDY47051.1|  BnaAnng08390D                                        71.6    7e-11   
gb|KEH40640.1|  transcription factor                                  72.8    7e-11   
gb|EPS66403.1|  hypothetical protein M569_08377                       70.9    1e-10   
ref|XP_002984127.1|  hypothetical protein SELMODRAFT_445783           70.9    1e-10   
ref|XP_008788364.1|  PREDICTED: transcription factor bHLH121 isof...  71.6    2e-10   
ref|XP_010446832.1|  PREDICTED: transcription factor bHLH11-like      71.6    2e-10   
ref|XP_011037263.1|  PREDICTED: transcription factor bHLH121-like     71.2    2e-10   
ref|XP_008788362.1|  PREDICTED: transcription factor bHLH121 isof...  71.2    3e-10   
gb|KHN33607.1|  Transcription factor ILR3                             66.2    3e-10   
ref|XP_002303343.1|  hypothetical protein POPTR_0003s07200g           68.9    4e-10   
ref|XP_003083024.1|  unnamed protein product                          68.6    6e-10   
ref|XP_001770260.1|  predicted protein                                69.7    6e-10   
gb|ABS79318.1|  At4g36060-like protein                                67.0    8e-10   
gb|ABS79290.1|  At4g36060-like protein                                66.6    9e-10   
gb|ABS79297.1|  At4g36060-like protein                                66.6    1e-09   
tpg|DAA58568.1|  TPA: putative HLH DNA-binding domain superfamily...  68.6    1e-09   
ref|XP_006406447.1|  hypothetical protein EUTSA_v10021271mg           68.6    1e-09   
gb|ABS79313.1|  At4g36060-like protein                                66.2    1e-09   
gb|AAL91266.1|  AT4g36060/T19K4_190                                   67.8    1e-09   
ref|NP_195330.2|  transcription factor bHLH11                         67.8    2e-09   
gb|ABS79306.1|  At4g36060-like protein                                65.9    2e-09   
gb|ABS79305.1|  At4g36060-like protein                                65.9    2e-09   
gb|ABS79289.1|  At4g36060-like protein                                65.5    2e-09   
gb|ABS79309.1|  At4g36060-like protein                                65.5    2e-09   
ref|NP_849566.1|  transcription factor bHLH11                         67.8    2e-09   
emb|CDY68426.1|  BnaC01g40740D                                        67.0    2e-09   
gb|ABS79292.1|  At4g36060-like protein                                65.5    2e-09   
gb|ABS79295.1|  At4g36060-like protein                                65.5    2e-09   
ref|XP_002869046.1|  basic helix-loop-helix family protein            67.0    3e-09   
gb|KFM24060.1|  Transcription factor                                  65.1    4e-09   
ref|XP_009393705.1|  PREDICTED: transcription factor bHLH47-like ...  66.2    4e-09   
emb|CAA18500.1|  putative Myc-type transcription factor               66.6    4e-09   
ref|XP_009393704.1|  PREDICTED: transcription factor bHLH47-like ...  66.2    4e-09   
gb|ABS79310.1|  At4g36060-like protein                                64.3    5e-09   



>ref|XP_006360579.1| PREDICTED: transcription factor ILR3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360580.1| PREDICTED: transcription factor ILR3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006360581.1| PREDICTED: transcription factor ILR3-like isoform X3 [Solanum 
tuberosum]
Length=244

 Score =   292 bits (748),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 177/246 (72%), Gaps = 12/246 (5%)
 Frame = -2

Query  986  METDS----NWLIDYEMMDDISSAVSATAS-FPSSATIDFSWVSQTVNYSSTATGSTACQ  822
            ME DS    NWL DYE++ DI+SA S T + F S ATIDFSW +QT+  SS     T   
Sbjct  1    MEVDSSGNPNWLFDYELITDITSAASVTVTDFQSPATIDFSWPAQTIYASSNLIAETDYT  60

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            F D+EV KEA SRKRLK E C    SKACREK+RRD +NERFLELSS+L+P RPPKT+K+
Sbjct  61   FADSEVSKEASSRKRLKSEWCSSPRSKACREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            AILS A R++  LRTE +KLKESN EL EKI ELKAEK ELRDEK++LKE+K  LEQQV 
Sbjct  121  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKRRLKEEKENLEQQVK  180

Query  461  GAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
              A  +KP   SHP         +GQVAAG K+MP +GYP  AMWQFMQP +VDTSQDHV
Sbjct  181  SLA--SKPGFLSHPSAVGAAFTAQGQVAAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHV  238

Query  296  LHPPVA  279
            L PPVA
Sbjct  239  LRPPVA  244



>ref|XP_010323806.1| PREDICTED: transcription factor ILR3 isoform X1 [Solanum lycopersicum]
Length=244

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 175/246 (71%), Gaps = 12/246 (5%)
 Frame = -2

Query  986  METDS----NWLIDYEMMDDISSAVSAT-ASFPSSATIDFSWVSQTVNYSSTATGSTACQ  822
            ME DS    NWL DYE+M DI+SA S T A F S ATIDFSW +QT+  SS     T   
Sbjct  1    MEVDSSGNPNWLFDYELMTDITSAASVTVAEFQSPATIDFSWPAQTIYASSNLITETDYT  60

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            F D+EV KEA SRKRLK E C    SKACREK+RRD +NERFL LSS+L+P RPPKT+K+
Sbjct  61   FADSEVSKEASSRKRLKSECCSSPRSKACREKLRRDRLNERFLALSSVLDPGRPPKTEKV  120

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            AILS A R++  LRTE +KLKESN EL EKI ELKAEK ELRDEKQ+LKE+K  LEQQV 
Sbjct  121  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKQRLKEEKDNLEQQVK  180

Query  461  GAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
              A  +K    SHP         +GQVAAG K+MP +GYP  AMWQFMQP +VDTSQDHV
Sbjct  181  SLA--SKAGFLSHPSAMGAAFTAQGQVAAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHV  238

Query  296  LHPPVA  279
            L PPVA
Sbjct  239  LRPPVA  244



>ref|XP_009764628.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=243

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 176/246 (72%), Gaps = 13/246 (5%)
 Frame = -2

Query  986  METDS----NWLIDYEMMDDISSAVS-ATASFPSSATIDFSWVSQTVNYSSTATGSTACQ  822
            ME DS    NWL DYE+M DI+SA S A   F S ATIDFSW +QT+  SS     T   
Sbjct  1    MEIDSSGNPNWLFDYELMTDITSAASVAVTDFQSPATIDFSWPAQTIYASSNLIAETDYT  60

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            F+D+EV KEA SRKR ++E C    SKA REK+RRD +NERFLELSS+L+P RPPKT+K+
Sbjct  61   FDDSEVSKEASSRKRSRIECCSSPRSKASREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            AILS A +++  LRTE +KLKESN EL EKI ELKAEK+ELRDEKQ+LKE+K  LEQQV 
Sbjct  121  AILSDAQKMLIELRTETQKLKESNEELQEKIKELKAEKIELRDEKQRLKEEKENLEQQVK  180

Query  461  GAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
              A  +KP   SHP         +GQV AG K+MP +GYP  AMWQFMQP +VDTSQDHV
Sbjct  181  TLA--SKPGFLSHPSAMGAAFTAQGQV-AGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHV  237

Query  296  LHPPVA  279
            L PPVA
Sbjct  238  LRPPVA  243



>ref|XP_009612610.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=243

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 174/246 (71%), Gaps = 13/246 (5%)
 Frame = -2

Query  986  METDS----NWLIDYEMMDDISSAVS-ATASFPSSATIDFSWVSQTVNYSSTATGSTACQ  822
            ME DS    NWL DYE++ DI+SA S A A F S ATIDFSW +QT+  SS     T   
Sbjct  1    MEIDSSGNPNWLFDYELITDITSAASVAVADFQSPATIDFSWPAQTIYASSNLIAETDYT  60

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            F+D+EV KEA SRKR ++E C    SKA REK+RRD +NERFLELSS+L+P RPPKT+K+
Sbjct  61   FDDSEVSKEASSRKRSRIECCNSPRSKASREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            AILS A +++  LR E +KLKESN EL EKI ELKAEK ELRDEKQ LKE+K  LEQQV 
Sbjct  121  AILSDAQKMLIELRAETQKLKESNEELQEKIKELKAEKNELRDEKQSLKEEKENLEQQVK  180

Query  461  GAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
               + +KP   SHP         +GQV AG K+MP +GYP  AMWQFMQP +VDTSQDHV
Sbjct  181  N--LSSKPGFLSHPSAMGAAFTAQGQV-AGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHV  237

Query  296  LHPPVA  279
            L PPVA
Sbjct  238  LRPPVA  243



>ref|XP_010323807.1| PREDICTED: transcription factor ILR3 isoform X2 [Solanum lycopersicum]
Length=237

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 171/246 (70%), Gaps = 19/246 (8%)
 Frame = -2

Query  986  METDS----NWLIDYEMMDDISSAVSAT-ASFPSSATIDFSWVSQTVNYSSTATGSTACQ  822
            ME DS    NWL DYE+M DI+SA S T A F S ATIDFSW +QT+  SS     T   
Sbjct  1    MEVDSSGNPNWLFDYELMTDITSAASVTVAEFQSPATIDFSWPAQTIYASSNLITETDYT  60

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            F D+EV KEA SRKR          SKACREK+RRD +NERFL LSS+L+P RPPKT+K+
Sbjct  61   FADSEVSKEASSRKR-------SPRSKACREKLRRDRLNERFLALSSVLDPGRPPKTEKV  113

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            AILS A R++  LRTE +KLKESN EL EKI ELKAEK ELRDEKQ+LKE+K  LEQQV 
Sbjct  114  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKQRLKEEKDNLEQQVK  173

Query  461  GAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
              A  +K    SHP         +GQVAAG K+MP +GYP  AMWQFMQP +VDTSQDHV
Sbjct  174  SLA--SKAGFLSHPSAMGAAFTAQGQVAAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHV  231

Query  296  LHPPVA  279
            L PPVA
Sbjct  232  LRPPVA  237



>ref|XP_002274829.2| PREDICTED: transcription factor ILR3-like isoform X2 [Vitis vinifera]
Length=240

 Score =   261 bits (668),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 165/239 (69%), Gaps = 12/239 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            +SNWL DY +M+DI+        FP  +    FSW SQ +  SS+ +    C F D++  
Sbjct  8    NSNWLFDYGLMEDITVP---GGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGDSDGL  64

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE G RKRLK E+C  +G+KACREK+RRD +NERFLEL SILEP RPPKTDK AILS AV
Sbjct  65   KELGPRKRLKHESCGATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAILSDAV  124

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR+E +KLKESN +L EKI ELKAEK ELRDEKQ+LK +K KLEQQV   A+ A+
Sbjct  125  RMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVK--AISAQ  182

Query  440  PASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P    HP         +G+ A G K+MP +GYP  AMWQFM P  VDTSQDHVL PPVA
Sbjct  183  PGFLPHPSAMPAAFAAQGR-APGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHVLRPPVA  240



>ref|XP_010247015.1| PREDICTED: transcription factor ILR3-like [Nelumbo nucifera]
Length=236

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 163/238 (68%), Gaps = 12/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL +Y +MDDI+        + + AT  F W SQ +N S+       C F D++  K
Sbjct  6    NSNWLYEYGLMDDITVP---GGDYTAPAT-GFQWNSQPLNGSTNVNVEIDCSFGDSDGFK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKR++ E+C   GSKACREKMRRD +N+RFLEL SILEP RPPK DK AILS AVR
Sbjct  62   EVGSRKRVRTESCSAVGSKACREKMRRDRLNDRFLELGSILEPGRPPKMDKAAILSDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR+E +KLKESN  L+EKI ELKAEK ELRDEKQ+LK ++ KLEQQV    + A P
Sbjct  122  MVTQLRSEAQKLKESNESLLEKIKELKAEKNELRDEKQRLKTEREKLEQQVK--TLSAPP  179

Query  437  ASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +   HP         +GQ AAG K+MP +GYPG AMWQFM P  VDTSQDHVL  PVA
Sbjct  180  SFLPHPTTIPAAFTAQGQ-AAGNKLMPFIGYPGVAMWQFMPPAAVDTSQDHVLRSPVA  236



>ref|XP_010657331.1| PREDICTED: transcription factor ILR3-like isoform X1 [Vitis vinifera]
Length=244

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 165/243 (68%), Gaps = 16/243 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            +SNWL DY +M+DI+        FP  +    FSW SQ +  SS+ +    C F D++  
Sbjct  8    NSNWLFDYGLMEDITVP---GGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGDSDGL  64

Query  800  KEAGSRKR----LKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAIL  633
            KE G RKR    LK E+C  +G+KACREK+RRD +NERFLEL SILEP RPPKTDK AIL
Sbjct  65   KELGPRKRCFYRLKHESCGATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAIL  124

Query  632  SGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA  453
            S AVR+VT LR+E +KLKESN +L EKI ELKAEK ELRDEKQ+LK +K KLEQQV   A
Sbjct  125  SDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVK--A  182

Query  452  MFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
            + A+P    HP         +G+ A G K+MP +GYP  AMWQFM P  VDTSQDHVL P
Sbjct  183  ISAQPGFLPHPSAMPAAFAAQGR-APGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHVLRP  241

Query  287  PVA  279
            PVA
Sbjct  242  PVA  244



>gb|KDO59874.1| hypothetical protein CISIN_1g026646mg [Citrus sinensis]
Length=235

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 164/247 (66%), Gaps = 25/247 (10%)
 Frame = -2

Query  989  AMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT---VNYSSTATGSTACQF  819
            A   +S+WLIDY ++DDI  A             +F W SQ    VN SS A+ +  C F
Sbjct  4    ASSDNSDWLIDYSIVDDIPIAG------------NFDWPSQAAPAVNASSAASVTIDCSF  51

Query  818  EDTEVCKE--AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDK  645
             D++  KE  AGSRKRL+ E+C  SGSKACREK+RRD +NERFLEL S+LEP RPPKTDK
Sbjct  52   GDSDGPKEVEAGSRKRLRSESCCVSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  644  IAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV  465
              ILS AV+++  LRTE +KLK+SN  L EKI ELKAEK ELRDEKQ+LK DK KLEQQV
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLEQQV  171

Query  464  NGAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
               AM A      HP         + QV AG K++P +GYPG AMWQFM P  VDTSQDH
Sbjct  172  K--AMSAPSGFLPHPSSMSAAFAAQSQV-AGNKLVPFIGYPGVAMWQFMPPAAVDTSQDH  228

Query  299  VLHPPVA  279
            VL PPVA
Sbjct  229  VLRPPVA  235



>ref|XP_010267809.1| PREDICTED: transcription factor ILR3 [Nelumbo nucifera]
Length=237

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 164/237 (69%), Gaps = 13/237 (5%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NWL DY +MDDIS        F +++T  F W SQ +N S++ +      F +++  KE 
Sbjct  8    NWLYDYGLMDDISVP---GGDF-TASTAGFHWNSQPLNGSTSVSLEADGSFGNSDGLKEM  63

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS+KR++  +C   GSKACREKMRRD +N++F+EL SIL+P RPPK DK AILS AVR+V
Sbjct  64   GSKKRVRTASCSAVGSKACREKMRRDRLNDKFVELGSILDPGRPPKMDKAAILSDAVRMV  123

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T LR+E +KLKESN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+    + A+P S
Sbjct  124  TQLRSEAQKLKESNESLQEKIKELKAEKNELRDEKQRLKVEKEKLEQQIK--TLSAQPTS  181

Query  431  F-SHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            F  HP         +GQ AAG K+MP +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  182  FLPHPSTIPAAFPAQGQ-AAGNKLMPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_006447466.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 ref|XP_006469731.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|ESR60706.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=235

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 166/248 (67%), Gaps = 27/248 (11%)
 Frame = -2

Query  989  AMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT---VNYSSTATGSTACQF  819
            A   +S+WLIDY ++DDI  A             +F W SQ    VN SS A+ +  C F
Sbjct  4    ASSDNSDWLIDYSIVDDIPIAG------------NFDWPSQAAPAVNASSAASVTIDCSF  51

Query  818  EDTEVCKE--AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDK  645
             D++  KE  AGSRKRL+ E+C  SGSKACREK+RRD +NERFLEL S+LEP RPPKTDK
Sbjct  52   GDSDGPKEVEAGSRKRLRSESCCVSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  644  IAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV  465
              ILS AV+++  LRTE +KLK+SN  L EKI ELKAEK ELRDEKQ+LK DK KL+QQV
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLQQQV  171

Query  464  NGAAMFAKPASF-SHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQD  303
                + + P+ F  HP         + QV AG K++P +GYPG AMWQFM P  VDTSQD
Sbjct  172  K---VMSAPSGFLPHPSSMSAAFAAQSQV-AGNKLVPFIGYPGVAMWQFMPPAAVDTSQD  227

Query  302  HVLHPPVA  279
            HVL PPVA
Sbjct  228  HVLRPPVA  235



>emb|CBI28976.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 157/229 (69%), Gaps = 12/229 (5%)
 Frame = -2

Query  947  MDDISSAVSATASFPS-SATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLK  771
            M+DI+        FP  +    FSW SQ +  SS+ +    C F D++  KE G RKRLK
Sbjct  1    MEDITVP---GGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGDSDGLKELGPRKRLK  57

Query  770  LETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEI  591
             E+C  +G+KACREK+RRD +NERFLEL SILEP RPPKTDK AILS AVR+VT LR+E 
Sbjct  58   HESCGATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAILSDAVRMVTQLRSEA  117

Query  590  EKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHP---  420
            +KLKESN +L EKI ELKAEK ELRDEKQ+LK +K KLEQQV   A+ A+P    HP   
Sbjct  118  QKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVK--AISAQPGFLPHPSAM  175

Query  419  --ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                  +G+ A G K+MP +GYP  AMWQFM P  VDTSQDHVL PPVA
Sbjct  176  PAAFAAQGR-APGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHVLRPPVA  223



>ref|XP_007043353.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX99184.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=231

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 161/246 (65%), Gaps = 25/246 (10%)
 Frame = -2

Query  986  METDS----NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT-VNYSSTATGSTACQ  822
            ME DS    NWL+DY + D           FP  A   + W  QT ++  S  + +  C 
Sbjct  1    MELDSSENTNWLLDYGIPD-----------FPRPAA-GYGWPPQTTLDARSNLSAAVDCS  48

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            F D++  KE  SRKRLK E+C  SGSKACREK+RR+ +N+RFLEL +ILEP RPPK DK+
Sbjct  49   FPDSDSLKEVASRKRLKSESCYASGSKACREKLRRNKLNDRFLELGAILEPGRPPKADKV  108

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            AIL  AV++V  LR+E +KLKE N EL  KI ELKAEK ELRDEKQ+LK DK KLEQQVN
Sbjct  109  AILIVAVKMVHQLRSEAQKLKELNEELQAKIKELKAEKNELRDEKQRLKADKEKLEQQVN  168

Query  461  GAAMFAKPASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
              AM  +P    HP         +GQ AAG K+MP +G+PG AMWQFM P  VDTSQDHV
Sbjct  169  --AMSTRPGFLPHPTPMAAAFASQGQ-AAGNKLMPYIGFPGVAMWQFMPPAAVDTSQDHV  225

Query  296  LHPPVA  279
            L PPVA
Sbjct  226  LRPPVA  231



>emb|CDP05806.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 163/236 (69%), Gaps = 10/236 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   +DI+       +FP+SA+  F+W  QT+N SS  +        D++  K
Sbjct  6    NTNWLYDY-AFEDIAVP---DGNFPASAS-GFNWPVQTLNGSSNVSVEIDGSLGDSDGPK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKRL+ E+C  + SKACREK RRD +N++F+EL ++L+P RPPKTDK AIL  AVR
Sbjct  61   ETGSRKRLRTESCASTSSKACREKQRRDRLNDKFVELGALLDPGRPPKTDKAAILVDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMF  447
            +VT LRTE +KLK+SNL L EKI ELKAEK ELRDEKQ+LK +K KLEQQ   VN  A F
Sbjct  121  IVTQLRTEAQKLKDSNLSLQEKIKELKAEKNELRDEKQRLKGEKEKLEQQLKTVNTQASF  180

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P +   P    +GQ A G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  MPPPTMPAPFA-AQGQ-APGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_010035617.1| PREDICTED: transcription factor ILR3-like [Eucalyptus grandis]
 gb|KCW47065.1| hypothetical protein EUGRSUZ_K00871 [Eucalyptus grandis]
Length=237

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 158/237 (67%), Gaps = 11/237 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL+DY + D     VSA    PS+    +S  S  V+ S+ +         D+E  K
Sbjct  8    NSNWLVDYGLAD-----VSAGDVLPSAGGFAWSSPSFDVSSSNASIEVNCASTRDSENLK  62

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
                 KRLK E+C+ SGSKACREK+RRD +NERFLEL SILEP RPPKTDK AILS AVR
Sbjct  63   GKSCHKRLKSESCLSSGSKACREKLRRDRLNERFLELGSILEPGRPPKTDKSAILSDAVR  122

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF---  447
            +VT LRTE +KLKESN EL EKI ELKAEK ELRDEKQ+LK DK KLEQQ+  ++     
Sbjct  123  MVTQLRTEAQKLKESNEELQEKIKELKAEKNELRDEKQRLKADKEKLEQQLKVSSFHPVF  182

Query  446  -AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               P+  S P    E   A G K+MP +G+PG AMWQFM P+ VDTSQDHVL PPVA
Sbjct  183  PPHPSVVSTPFAAQE--RAGGNKLMPYIGFPGVAMWQFMPPSTVDTSQDHVLRPPVA  237



>ref|XP_010931430.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=237

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 160/238 (67%), Gaps = 11/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNW+ D  ++DD+S A      FP+  T  F W  Q +N +S ++   +  F D+    
Sbjct  6    NSNWVFDCPLIDDMSVA---GGDFPAPGT-GFYWTPQGINSTSNSSVEISGSFVDSAGIN  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+    GSKACREKMRRD +N RFLEL SILEP +PPK DK AILS AVR
Sbjct  62   ESGSKKRVRSESSSQPGSKACREKMRRDKLNNRFLELGSILEPGKPPKMDKAAILSDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR+E +KLK+SN +L EKI ELKAEK ELRDEKQ+LK +K  LEQQ+    + A+P
Sbjct  122  MVTQLRSEAQKLKDSNEDLQEKIKELKAEKNELRDEKQRLKAEKENLEQQIK--ILNARP  179

Query  437  ASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +  +HP         +GQ AA K MMPV+GYPGF MWQFM P  VDTSQD    PPVA
Sbjct  180  SFVAHPPVIPAAFAPQGQTAAHKLMMPVIGYPGFPMWQFMPPADVDTSQDAESCPPVA  237



>ref|XP_006447467.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 gb|ESR60707.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=250

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 166/263 (63%), Gaps = 42/263 (16%)
 Frame = -2

Query  989  AMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT---VNYSSTATGSTACQF  819
            A   +S+WLIDY ++DDI  A             +F W SQ    VN SS A+ +  C F
Sbjct  4    ASSDNSDWLIDYSIVDDIPIAG------------NFDWPSQAAPAVNASSAASVTIDCSF  51

Query  818  EDTEVCKE--AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDK  645
             D++  KE  AGSRKRL+ E+C  SGSKACREK+RRD +NERFLEL S+LEP RPPKTDK
Sbjct  52   GDSDGPKEVEAGSRKRLRSESCCVSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  644  IAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELK---------------AEKMELRDE  510
              ILS AV+++  LRTE +KLK+SN  L EKI ELK               AEK ELRDE
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKGLDDHVQLSCCLSMQAEKNELRDE  171

Query  509  KQKLKEDKMKLEQQVNGAAMFAKPASF-SHP-----ILNLEGQVAAGKKMMPVVGYPGFA  348
            KQ+LK DK KL+QQV    + + P+ F  HP         + QV AG K++P +GYPG A
Sbjct  172  KQRLKADKEKLQQQVK---VMSAPSGFLPHPSSMSAAFAAQSQV-AGNKLVPFIGYPGVA  227

Query  347  MWQFMQPTIVDTSQDHVLHPPVA  279
            MWQFM P  VDTSQDHVL PPVA
Sbjct  228  MWQFMPPAAVDTSQDHVLRPPVA  250



>gb|EYU19205.1| hypothetical protein MIMGU_mgv1a012900mg [Erythranthe guttata]
Length=236

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 158/236 (67%), Gaps = 8/236 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   D+    V+ +A  PS+    FSW  QT+N SS  +        ++++ K
Sbjct  6    NTNWLYDYGFEDNPVPDVNFSA--PSAG---FSWPMQTLNGSSNVSLQIDGSSGESDMQK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            EAGS+KR + E C PS SKACREK RRD +N++F+EL ++LEP RPPKTDK AIL  AVR
Sbjct  61   EAGSKKRTRTEACAPSSSKACREKQRRDKLNDKFMELGALLEPGRPPKTDKAAILVDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMF  447
            +VT LR++ +KLK+SNL L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   N     
Sbjct  121  MVTQLRSDAQKLKDSNLNLQEKIKELKAEKTELRDEKQRLKAEKDKLEQQLKTMNTPQPG  180

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              PA  + P        A G KM+P++ YPG AMWQFM P  +DTSQDHVL PPVA
Sbjct  181  FLPAPPAIPTAFAAQNQAVGNKMVPIISYPGVAMWQFMPPASIDTSQDHVLRPPVA  236



>gb|KDP39043.1| hypothetical protein JCGZ_00800 [Jatropha curcas]
Length=236

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 155/234 (66%), Gaps = 8/234 (3%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NWL DY ++D+ +  + A  S P S    FSW  QT+N SS A       F ++E  KE+
Sbjct  8    NWLADYGLIDE-TPVLDANFSVPVSG---FSWPVQTLNGSSDAGVEIDGPFGNSEAQKES  63

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
             S+KR + E+C  S SKACREK+RRD +N++FLEL SILEP RPPKTDK AIL  A+R V
Sbjct  64   SSKKRGRSESCGASSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILVDAIRRV  123

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMFAK  441
            T LR E + LK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   N    F  
Sbjct  124  TQLRGEAQTLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKAANSQTSFLP  183

Query  440  PASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P          +GQ A+G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  184  PPPAIPAAFAAQGQ-ASGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_004505433.1| PREDICTED: transcription factor ILR3-like [Cicer arietinum]
Length=237

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 158/238 (66%), Gaps = 11/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DDI      T + PSS  +  +W +   N SS           D++  K
Sbjct  6    NTNWLFDYGLIDDIP-VPDPTFAVPSSTLL--TWPTHPFNISSNVGAEIDGSLGDSDSLK  62

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RP KTDK AIL  AVR
Sbjct  63   ESGSKKRVRSESCAATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVR  122

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   +M A+P
Sbjct  123  MVTQLRGEAQKLKDSNTGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLK--SMNAQP  180

Query  437  ASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +    P         +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  SFLPTPTALPAAFAAQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_002522828.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF39526.1| DNA binding protein, putative [Ricinus communis]
Length=235

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 157/236 (67%), Gaps = 9/236 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWLI+Y ++DDI     A  S P +    FSW  QT+N SS  +      F + +  K
Sbjct  6    NTNWLIEYGLIDDIP-VPDANFSVPVTG---FSWPVQTLNGSSNVSVEIDGSFGNADTQK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            ++ S+KR + ++C  S SKACREK+RRD +N++FLEL SILEP RPPKTDK AIL  AVR
Sbjct  62   DSTSKKRGRSDSCA-SSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILIDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMF  447
            +VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ   VN    F
Sbjct  121  MVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKVEKEKLEQQLKAVNAQPSF  180

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P          +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  LPPPPAIPAPFAAQGQ-APGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_007211667.1| hypothetical protein PRUPE_ppa009077mg [Prunus persica]
 gb|EMJ12866.1| hypothetical protein PRUPE_ppa009077mg [Prunus persica]
Length=307

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 168/256 (66%), Gaps = 13/256 (5%)
 Frame = -2

Query  1031  TPYISVPRRKNSRNAMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYS  852
              P+  + R++ +  + E ++NWL DY ++DD   A     +FP S++  F+W  Q +  S
Sbjct  60    NPFFCLFRQRPNMVSPE-NTNWLFDYGLIDD---APVLDGNFPVSSS-GFTWPVQPLAGS  114

Query  851   STATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILE  672
             S+ +        D E  KE+GS+KR++ E+C  S SKACREK+RRD +N++FLEL SILE
Sbjct  115   SSVSVEIDGSLGDAEGVKESGSKKRVRTESCSGSSSKACREKLRRDRLNDKFLELGSILE  174

Query  671   PTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKE  492
             P RPPKTDK AIL  AVR+V  LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK 
Sbjct  175   PGRPPKTDKAAILVDAVRMVNQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKL  234

Query  491   DKMKLEQQVNGAAMFAKPASF-----SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQP  327
             +K KLEQQ+   AM A+P               +GQ A G K++P +GYPG AMWQFM P
Sbjct  235   EKEKLEQQLK--AMNAQPGFLPPPPAIPAAFAAQGQ-AHGNKLVPFIGYPGVAMWQFMPP  291

Query  326   TIVDTSQDHVLHPPVA  279
               VDTSQDHVL PPVA
Sbjct  292   ASVDTSQDHVLRPPVA  307



>ref|XP_004294336.1| PREDICTED: transcription factor ILR3-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=231

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 158/238 (66%), Gaps = 17/238 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD        A+FP S++  F+W  Q +  SS+ +        D E  K
Sbjct  6    NTNWLYDYGLIDD--------ANFPVSSSA-FNWPVQPLPGSSSVSVELDGSLGDVEGLK  56

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+   + SKACREK+RRD +N++FLEL SILEP RPPKTDK AIL  AVR
Sbjct  57   ESGSKKRVRCESSSATSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILIDAVR  116

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK+SN  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   AM A+P
Sbjct  117  MVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLK--AMTAQP  174

Query  437  A-----SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +              +GQ A G KM+P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  175  SFMPAPPAIPAAFAAQGQ-AHGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_008224874.1| PREDICTED: transcription factor ILR3-like [Prunus mume]
Length=238

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 155/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NW+ DY +++DI          P      F+W S +    +  +      F +++  K
Sbjct  7    NHNWVFDYGVLEDIPVP---GGDLPPLDLPGFTWPSHSFVAPAAPSVDFDDSFGNSDSIK  63

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+G RKR++  +C  +GSKACREKMRRD +N+RFLELSS+LEP RPPKTDK AIL  AVR
Sbjct  64   ESGCRKRVRSGSCNVTGSKACREKMRRDRLNDRFLELSSMLEPGRPPKTDKAAILGDAVR  123

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            VV  LR E ++LK+SN +L EKI+ELKAEK ELRDEKQ+LK +K  +E+Q+   A+  +P
Sbjct  124  VVNQLRGEAQQLKDSNGDLQEKINELKAEKNELRDEKQRLKTEKENIERQIK--ALNTQP  181

Query  437  ASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                HP       +  GQV  G K+MP VGYPG +MWQFM P  VDTSQDHVL PPVA
Sbjct  182  GFLPHPAAIPGPFSAPGQVVGG-KLMPFVGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_004248337.1| PREDICTED: transcription factor ILR3-like [Solanum lycopersicum]
Length=231

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 158/239 (66%), Gaps = 19/239 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   D ++  V+ + S        +SW  Q  N S+ A+        +++  K
Sbjct  6    NTNWLYDYHYEDIVTPDVNFSVS-------GYSWSMQGFNGSTNASVDIDGSLGESDCVK  58

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+G +KR + E+C  S SKACREK+RR+ +NE+F+EL+ +LEP+RPPKTDK AIL  AVR
Sbjct  59   ESGCKKRTRAESCTSSSSKACREKLRREKLNEKFMELAVLLEPSRPPKTDKSAILVDAVR  118

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF---  447
            VVT LR E +KLK+SNL+L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   +     
Sbjct  119  VVTQLRGEAQKLKDSNLDLQEKIKELKVEKNELRDEKQRLKSEKEKLEQQLKTMSAQPSF  178

Query  446  ---AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               A P +F+ P+       AAG K++P++ YPG AMWQFM P  +DTSQDHVL PPVA
Sbjct  179  LPPAMPGAFASPVQ------AAGTKLVPIISYPGVAMWQFMPPAAIDTSQDHVLRPPVA  231



>ref|XP_008244399.1| PREDICTED: transcription factor ILR3 [Prunus mume]
Length=295

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 157/233 (67%), Gaps = 14/233 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD         +FP S++  F+W  Q +  SS+ +        D E  K
Sbjct  77   NTNWLFDYGLIDDTPVL---DGNFPVSSS-GFTWPVQPLAGSSSVSVEIDGSLGDAEGVK  132

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  S SKACREK+RRD +N++FLEL SILEP RPPKTDK AIL  AVR
Sbjct  133  ESGSKKRVRTESCSGSSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILVDAVR  192

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+L  +K KLEQQ+        P
Sbjct  193  MVNQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLTLEKEKLEQQLKA----RNP  248

Query  437  ASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            A+F+      +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  249  AAFA-----AQGQ-AHGNKLVPFIGYPGVAMWQFMPPASVDTSQDHVLRPPVA  295



>ref|XP_004151873.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 gb|KGN63279.1| hypothetical protein Csa_2G423590 [Cucumis sativus]
Length=238

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 159/237 (67%), Gaps = 13/237 (5%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NWL DY  +DD++  V    S P S  I FSW + ++N+ S  +    C +ED +  KE 
Sbjct  9    NWLFDYSTVDDLA-VVDPRFSPPQS--ISFSWSNPSINFLSKDSLEVDCSYEDLDSTKEV  65

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            G RKRL+ ET   S SKACREK RRD +NERFLEL+++LEP +PPK+DK+AILS A+R++
Sbjct  66   G-RKRLRGETSAASTSKACREKQRRDKLNERFLELAAVLEPGKPPKSDKVAILSDAIRMM  124

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T L+ E +KL+ES  +L  KI ELK EK ELRDEKQ+L+ +K KLE Q+   A+  + A 
Sbjct  125  TDLQCETQKLRESKEDLKAKIKELKVEKNELRDEKQRLRAEKEKLELQIR--AVNTRAAD  182

Query  431  FSHPILNL------EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              HP   L      +GQ +AG K+MP +GYPG AMWQF+ P  VD SQDHVL PPVA
Sbjct  183  VQHPPPTLSAAFTAQGQ-SAGNKLMPFIGYPGIAMWQFLPPAAVDISQDHVLRPPVA  238



>gb|EYU33597.1| hypothetical protein MIMGU_mgv1a013092mg [Erythranthe guttata]
Length=230

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 160/239 (67%), Gaps = 20/239 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNY-SSTATGSTACQFEDTEV  804
            ++NWL DY   +DI+  V       SS +  FSW V Q +N  SS A+        +++V
Sbjct  6    NTNWLYDY-GFEDITVPVGNL----SSPSPGFSWPVQQPLNGGSSNASVEIDGSLGESDV  60

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR + E+C PS +KACREK RRD +N++F+EL +ILEP RPPKTDK AILS A
Sbjct  61   QKETGSKKRARTESCAPSNTKACREKQRRDRLNDKFMELGAILEPGRPPKTDKSAILSDA  120

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAA  453
            +R+VT LRTE +KLK++NL L EKI ELKAEK ELRDEKQ+LK +K K+EQQ   VNGA 
Sbjct  121  LRMVTQLRTEAQKLKDANLNLQEKIKELKAEKNELRDEKQRLKAEKEKVEQQLKTVNGAP  180

Query  452  MFA-KPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PA  + P          G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  QPGFLPAHQAMP---------GGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  230



>ref|XP_011097928.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=234

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 158/240 (66%), Gaps = 18/240 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   +DI+      A+  S      SW  Q +N SS A+        ++++ K
Sbjct  6    NTNWLYDYGF-EDIAVHDGNFAAHNSG----LSWPMQALNGSSNASVEIDGSLGESDLQK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            EAGS+KR + E C PS SKACREK RRD +N++F+EL ++LEP RPPKTDK AIL  AVR
Sbjct  61   EAGSKKRCRTEPCAPSSSKACREKQRRDRLNDKFMELGALLEPGRPPKTDKAAILVDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN-------G  459
            +VT LR E +KLK+SNL L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+        G
Sbjct  121  MVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNTPQPG  180

Query  458  AAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                A PA+F+      + Q  AG K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  FLPPAIPAAFA-----TQNQ-GAGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_002282727.1| PREDICTED: transcription factor ILR3 [Vitis vinifera]
 emb|CBI20499.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 162/238 (68%), Gaps = 13/238 (5%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVS-QTVNYSSTATGSTACQFEDTEVCK  798
            +NWL +Y +++DI    S  A+  S     F+W   Q +N S+  +G     F D++  K
Sbjct  7    TNWLYEYGLIEDIPVPDSNFANTNSG----FAWTPVQALNTSANVSGEIDGSFGDSDGIK  62

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GS+KR++ E+C  S SKACREK+RRD +N++F+EL SILEP RPPKTDK +IL  AVR
Sbjct  63   ETGSKKRVRSESCGASSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSSILIDAVR  122

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   AM A+P
Sbjct  123  MVTQLRGESQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLK--AMNAQP  180

Query  437  ASFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             SF  P+ ++         A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  -SFLPPVPSIPAAFAAQGQAGGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_010092311.1| hypothetical protein L484_021173 [Morus notabilis]
 gb|EXB50945.1| hypothetical protein L484_021173 [Morus notabilis]
Length=239

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 159/241 (66%), Gaps = 15/241 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DDI       A+F  S++  F+W  Q +N SS  +        D+E  K
Sbjct  6    NTNWLFDYGLIDDIPVP---DANFSVSSS-GFTWPVQPLNGSSAVSAEIDGSLGDSEGPK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+   S SKACREK RRD +N++F+EL SILEP RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSESNGASSSKACREKQRRDRLNDKFVELGSILEPGRPPKTDKAAILIDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKA--EKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +V  LR E +KLK+SNL L EKI ELKA  EK ELRDEKQ+LK +K KLE Q+ G  M A
Sbjct  122  MVNQLRGEAQKLKDSNLSLQEKIKELKARVEKNELRDEKQRLKGEKEKLELQLKG--MNA  179

Query  443  KPASF------SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPV  282
            +PA F             +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPV
Sbjct  180  QPAGFLPPPAAIPAAFAAQGQ-APGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPV  238

Query  281  A  279
            A
Sbjct  239  A  239



>ref|XP_003527314.1| PREDICTED: transcription factor ILR3-like isoform 1 [Glycine 
max]
 gb|KHN47843.1| Transcription factor ILR3 [Glycine soja]
Length=236

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 159/238 (67%), Gaps = 12/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DDI     AT    SSA   F+W    +N SS           D++  K
Sbjct  6    NTNWLFDYGLIDDIP-VPDATFGVNSSA---FTWPPNALNASSNVGVEIDGSLGDSDSLK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  SGSKACREK+RRD +N++F+EL +ILEP RP KTDK AIL  AVR
Sbjct  62   ESGSKKRVRSESCAASGSKACREKLRRDRLNDKFVELGAILEPGRPAKTDKAAILIDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK++N  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   ++ A+P
Sbjct  122  MVTQLRGEAQKLKDTNQGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLK--SLNAQP  179

Query  437  A-----SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +     +        +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  180  SFMPPPAAMPAAFAAQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_009792846.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=235

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 160/236 (68%), Gaps = 11/236 (5%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATG-STACQFEDTEVCK  798
            +NWL DY   +DI+  VS   +F S++T  FSW  Q  N S+T           +++  K
Sbjct  7    TNWLYDYNF-EDIT--VSVDPNF-SNSTTGFSWSMQPFNGSTTNISVDIDGSIGESDCLK  62

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR + E+C  S SKACREK+RR+ +N++F+EL ++LEP R PKTDK A+L  AVR
Sbjct  63   ESGSKKRARAESCTSSSSKACREKLRREKLNDKFMELGALLEPGRTPKTDKSALLVDAVR  122

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E EKLK+SNL L EKI ELKAEK ELRDEKQ+LK DK KLEQQ+    M A+P
Sbjct  123  MVTHLRGEAEKLKDSNLNLQEKIKELKAEKNELRDEKQRLKADKEKLEQQLK--TMNAQP  180

Query  437  ASFSHPI---LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              F   +       GQ AAG K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  GFFPPVVPGAFAAPGQ-AAGSKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  235



>gb|KCW70120.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
 gb|KCW70121.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=237

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 159/237 (67%), Gaps = 11/237 (5%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            +NW+ D  ++DDI  A  A   F  S +  ++W  Q +N SS  +      F +++  KE
Sbjct  7    TNWIYDCGLIDDI--AAVADGDFQVSGS-GYTWPVQPLNGSSIFSTEIDGSFGESDGVKE  63

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             GS+KR++ E+C  S SKACREK+RRD +N++FLEL+S+LEP RPPK DK AIL  AVR+
Sbjct  64   NGSKKRVRTESCGTSSSKACREKLRRDRLNDKFLELASLLEPGRPPKADKAAILIDAVRM  123

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA  435
            VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE Q+   AM A+P+
Sbjct  124  VTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLK--AMNAQPS  181

Query  434  SFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                P         +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  182  FLPPPPAIPAAFATQGQ-APGNKLVPFIGYPGVAMWQFMPPATVDTSQDHVLRPPVA  237



>ref|XP_008455829.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=238

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 158/237 (67%), Gaps = 13/237 (5%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NWL D   MDD++  V    S P S  I FSW + ++++ S  +    C +ED +  KE 
Sbjct  9    NWLFDCSTMDDLA-VVDPRFSPPQS--ISFSWSNPSISFVSKDSLEVDCSYEDLDSTKEV  65

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            G RKRL+ ET   S SKACREK RRD +NERFLEL+++LEP +PPKTDK+AILS A+R++
Sbjct  66   G-RKRLRGETSAASTSKACREKQRRDKLNERFLELAAVLEPGKPPKTDKVAILSDAIRMM  124

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T L+ E +KL+ES  +L  KI ELK EK ELRDEKQ+L+ +K KLE Q+   A+  + A 
Sbjct  125  TDLQCETQKLRESKEDLKAKIKELKVEKNELRDEKQRLRAEKEKLELQIR--AVNTRAAD  182

Query  431  FSHPILNL------EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              HP   L      +GQ AAG K+MP +GYPG AMWQF+ P  VD SQDHVL PPVA
Sbjct  183  VQHPPPTLSAAFTAQGQ-AAGNKLMPFIGYPGIAMWQFLPPAAVDISQDHVLRPPVA  238



>ref|XP_008793739.1| PREDICTED: transcription factor ILR3 [Phoenix dactylifera]
Length=237

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 161/238 (68%), Gaps = 11/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NW+ D  ++DD+S A   +  FP+  T  F W SQ +N SS ++   +  F D+   K
Sbjct  6    NTNWVFDCPLIDDMSVA---SGDFPAPGT-GFYWNSQGINSSSNSSVEISGSFVDSAGIK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+ S+KR++ E+    GSKACREKMRRD +N +FLEL SILEP +PPK DK AILS AVR
Sbjct  62   ESDSKKRVRSESSCQPGSKACREKMRRDKLNNKFLELGSILEPGKPPKMDKAAILSDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR+E +KLK+SN +L EKI ELKAEK ELRDEKQ+LK +K  LEQQ+    + A+ 
Sbjct  122  MVTQLRSEAQKLKDSNEDLQEKIKELKAEKNELRDEKQRLKAEKENLEQQIK--ILNARA  179

Query  437  ASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +  +HP         +GQ AA K MMPV+GYPGF MWQFM P  VDTSQD    PPVA
Sbjct  180  SYVAHPPVIPAAFAAQGQTAAHKLMMPVIGYPGFPMWQFMPPADVDTSQDAESCPPVA  237



>ref|XP_010923988.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=230

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 155/239 (65%), Gaps = 20/239 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNW+ D  ++DD+S+  +            F W  Q +N SS A+   +  F D+   K
Sbjct  6    NSNWVFDGSLIDDMSAPGTG-----------FYWTPQGINSSSNASVEISGSFVDSGGIK  54

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+    GSKACREK+RRD +N+RFLEL SILEP +PPK DK AILS AVR
Sbjct  55   ESGSKKRVRSESSSQPGSKACREKLRRDRLNDRFLELGSILEPGKPPKMDKAAILSDAVR  114

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR+E +KLK+SN  L EKI ELK EK ELRDEKQ+LK +K  LEQQ+    M    
Sbjct  115  MVTQLRSEAQKLKDSNENLQEKIKELKVEKNELRDEKQRLKAEKENLEQQIK---MLNTR  171

Query  437  ASF-SHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            ASF +HP         +GQ AA K MMPV+ YPGF MWQFM P  VDTS+D    PPVA
Sbjct  172  ASFVAHPPVIPAAFAAQGQTAAHKLMMPVISYPGFPMWQFMPPADVDTSKDAESCPPVA  230



>ref|XP_003607701.1| Transcription factor ILR3 [Medicago truncatula]
 gb|ACJ84233.1| unknown [Medicago truncatula]
 gb|AES89898.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK34575.1| unknown [Medicago truncatula]
Length=237

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 158/239 (66%), Gaps = 13/239 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT-VNYSSTATGSTACQFEDTEVC  801
            ++NW+ DY   DDI     +T + PSSA   F+W +Q   N SS  +        D++  
Sbjct  6    NTNWINDYGFYDDIP-VPDSTFALPSSA---FTWPTQPPFNLSSNVSAEVDGSLGDSDGL  61

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RP KTDK AIL  AV
Sbjct  62   KESGSKKRVRSESCAATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAV  121

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR E +KLK++N  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   +M A 
Sbjct  122  RMVTQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQLK--SMNAP  179

Query  440  PASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P+    P         +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  180  PSFLPTPTALPAAFAAQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_007211937.1| hypothetical protein PRUPE_ppa010730mg [Prunus persica]
 gb|EMJ13136.1| hypothetical protein PRUPE_ppa010730mg [Prunus persica]
Length=238

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 154/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NW+ DY +++DI          P      F+W S +    +  +      F +++  K
Sbjct  7    NHNWVFDYGVLEDIPVP---GGDLPPLDLPGFTWPSHSFVAPAAPSVDFDDSFGNSDSIK  63

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+G RKR++  +C  +GSKACREKMRRD +N+RFLELSS+LEP RPPKTDK AIL  AVR
Sbjct  64   ESGFRKRVRSGSCNVTGSKACREKMRRDRLNDRFLELSSMLEPGRPPKTDKAAILGDAVR  123

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            VV  LR E ++LK+SN +L EKI+ELKAEK ELRDEKQ+LK +K  +E+Q+   A+  +P
Sbjct  124  VVNQLRGEAQQLKDSNGDLQEKINELKAEKNELRDEKQRLKTEKENIERQIK--ALNTQP  181

Query  437  ASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                HP       +  GQV  G K+MP VGYPG +MWQFM P  VDTSQDHVL  PVA
Sbjct  182  GFLPHPAAIPGPFSAPGQVVGG-KLMPFVGYPGVSMWQFMPPAAVDTSQDHVLRSPVA  238



>ref|XP_008349949.1| PREDICTED: transcription factor ILR3-like [Malus domestica]
Length=229

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 154/238 (65%), Gaps = 19/238 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATID--FSWVSQTVNYSSTATGSTACQFEDTEV  804
            ++NWL DY ++DD             +  +D  F+W  Q +  SS+A+        D E 
Sbjct  6    NTNWLFDYGLIDD-------------TPVLDGNFAWPVQPIAGSSSASVELDGSLGDAEG  52

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  A
Sbjct  53   LKESGSKKRVRTESCSGTSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVDA  112

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAA  453
            VR+V  LR E +KLK++N  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   N   
Sbjct  113  VRMVNQLRGEAQKLKDTNSGLQEKIKELKAEKNELRDEKQRLKSEKEKLEQQLKSMNIQP  172

Query  452  MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             F  P          +GQ A G KM+P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  173  GFLPPPPAIPAAFAAQGQ-ARGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_009630429.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=233

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 153/238 (64%), Gaps = 15/238 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDI--SSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            ++NWL DY   +     S  SATAS        F+W  Q +N S   +        +++ 
Sbjct  6    NTNWLYDYGFEESAVPDSNFSATAS-------GFNWPMQNLNGSRNVSAEVDGSIGESDC  58

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR ++E+C P+ SKACREK RRD +N++F EL ++LEP RPPKTDK AIL  A
Sbjct  59   PKENGSKKRARVESCAPTSSKACREKQRRDRLNDKFTELGALLEPGRPPKTDKSAILVDA  118

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+VT LR E +KLK+SNL L EKI ELKAEK ELRDEKQKLK +K KLEQQ+    M A
Sbjct  119  VRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQKLKAEKEKLEQQLK--TMSA  176

Query  443  KPASF---SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P              GQV  G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  QPGFLPPAIPAAFAAHGQV-PGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>gb|KHG29871.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=237

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 148/214 (69%), Gaps = 6/214 (3%)
 Frame = -2

Query  905  PSSATIDFSWVSQTVNYSSTA-TGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACRE  729
            P      FSW +Q +N SS   +      FED++  KE+GS+KR++ E+C  S SKACRE
Sbjct  25   PDGPYSGFSWPTQAINASSNVFSVDIDGSFEDSDGLKESGSKKRVRSESCNVSSSKACRE  84

Query  728  KMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKI  549
            K+RRD +NE+F+EL+SILEP RPPKTDK AIL  AVR+VT LR E +KLK+SN  L ++I
Sbjct  85   KLRRDRLNEKFMELTSILEPERPPKTDKAAILVDAVRMVTQLRGEAQKLKDSNSSLHDRI  144

Query  548  HELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMFAKPA-SFSHPILNLEGQVAAGKK  381
             ELKAEK ELRDEKQ+LK +K KLEQQ+   N    F  PA +F       +GQV  G K
Sbjct  145  KELKAEKNELRDEKQRLKAEKEKLEQQLKAMNAQPSFMPPAPAFPTAFATAQGQV-PGNK  203

Query  380  MMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            ++P  GYPG AMWQFM P  VDTS+DHVL PPVA
Sbjct  204  LVPFFGYPGVAMWQFMPPASVDTSEDHVLRPPVA  237



>ref|XP_007132981.1| hypothetical protein PHAVU_011G141300g [Phaseolus vulgaris]
 gb|ESW04975.1| hypothetical protein PHAVU_011G141300g [Phaseolus vulgaris]
Length=237

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 156/237 (66%), Gaps = 9/237 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DDI     A+ + PSSA   F+W    +N +S           D++  K
Sbjct  6    NTNWLFDYGLIDDIP-VPDASFTVPSSA---FTWPPNALNATSNVGVEIDGSLADSDGLK  61

Query  797  EAGSRKRLKLETCIP-SGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            EAGS+KR++ ETC   + SKACREK+RRD +N++F+EL SILEP RP KTDK AIL  AV
Sbjct  62   EAGSKKRVRSETCAAATSSKACREKLRRDKLNDKFVELGSILEPERPTKTDKAAILIDAV  121

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAM  450
            R+VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ LK +K KLEQQ   +N    
Sbjct  122  RMVTQLRGEAQKLKDSNQGLQEKIKELKAEKNELRDEKQMLKAEKEKLEQQLKSLNAQPN  181

Query  449  FAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            F  P +        +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  182  FMPPPAAIPAAFAAQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_006360098.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=233

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 162/237 (68%), Gaps = 13/237 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   D   S+V   ++F +SA+  F+W  Q +N S   +        +++  K
Sbjct  6    NTNWLYDYGFED---SSV-PDSNFSASAS-GFNWPVQNLNGSRNVSSEIDGSIGESDYPK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR ++E+C P+ SKACREK+RRD +N++F+EL ++LEP RPPKTDK AIL  AVR
Sbjct  61   ESGSKKRARVESCAPTSSKACREKLRRDKLNDKFMELGALLEPGRPPKTDKSAILVDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK+SNL L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   +  A+P
Sbjct  121  MVTQLRDEAQKLKDSNLNLQEKIKELKVEKTELRDEKQRLKAEKEKLEQQLKTTS--AQP  178

Query  437  ASFSHPIL----NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             SF  P +       GQ   G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  179  -SFLPPAIPSAFAAHGQF-PGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>ref|XP_003540036.1| PREDICTED: transcription factor ILR3 [Glycine max]
 gb|KHN20440.1| Transcription factor ILR3 [Glycine soja]
Length=236

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 156/236 (66%), Gaps = 8/236 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DDI     AT    SSA   F+W    ++  S           D++  K
Sbjct  6    NTNWLFDYGLIDDIP-VPDATFGVNSSA---FTWPPNALDAPSNVGVDIDGSLGDSDGLK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  S SKACREK+RRD +N++F+EL SILEP RP KTDK AIL  AVR
Sbjct  62   ESGSKKRVRSESCAASSSKACREKLRRDRLNDKFVELGSILEPGRPAKTDKTAILIDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMF  447
            +VT LR E +KLK++N  L EKI +LKAEK ELRD+KQ+LK +K KLEQQ   +NG   F
Sbjct  122  MVTQLRGEAQKLKDTNQGLQEKIKDLKAEKNELRDQKQRLKAEKEKLEQQLKSLNGQPSF  181

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P +       ++GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  182  MPPPAAIPAAFAVQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_009366840.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=238

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 152/238 (64%), Gaps = 11/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NW+ DY +++DI   +      PS     FSW   +    +  +      F + +  K
Sbjct  7    NPNWVFDYGVIEDI---LVPGGELPSLDPPGFSWPDHSFAGPTAPSTEFDDSFGNPDSMK  63

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E G RKR +  +   SGSKACREKMRRD +N+RF+ELSSILEP RPPKTDK+AIL  AVR
Sbjct  64   ETGLRKRARTGSSSVSGSKACREKMRRDRLNDRFVELSSILEPGRPPKTDKVAILGDAVR  123

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E  +LKES+  L E I+ELKAEK ELRDEKQ+LK +K  +E+Q+   A+  +P
Sbjct  124  MVTQLRGEALQLKESSANLQETINELKAEKNELRDEKQRLKVEKDNIERQIK--ALGTQP  181

Query  437  ASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +   HP       +  GQV  G KMMP VGYPG +MWQFM P  VDTSQDHVL PPVA
Sbjct  182  SFLPHPAAIPTPFSAPGQVVGG-KMMPFVGYPGMSMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_010062960.1| PREDICTED: transcription factor ILR3-like [Eucalyptus grandis]
Length=237

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 155/235 (66%), Gaps = 7/235 (3%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            +NW+ D  ++DDI  A  A   F  S +  ++W  Q +N SS  +      F +++  KE
Sbjct  7    TNWIYDCGLIDDI--AAVADGDFQVSGS-GYTWPVQPLNGSSIFSTEIDGSFGESDGVKE  63

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             GS+KR++ E+C  S SKACREK+RRD +N++FLEL+S+LEP RPPK DK AIL  AVR+
Sbjct  64   NGSKKRVRTESCGTSSSKACREKLRRDRLNDKFLELASLLEPGRPPKADKAAILIDAVRM  123

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAM---FA  444
            VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE Q+   +    F 
Sbjct  124  VTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKATSAQPNFL  183

Query  443  KPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             P          +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  184  PPPPAMPAAFATQGQ-APGNKLVPFLGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_009358090.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=229

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 153/238 (64%), Gaps = 19/238 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD                 +F+W  Q +  S++ +        D E  K
Sbjct  6    NTNWLFDYGLIDDTPVLDG-----------NFTWPVQPIAGSASVSVELDGSLGDAEALK  54

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR
Sbjct  55   ESGSKKRVRSESCSGTSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVDAVR  114

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK++N  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   +M A+P
Sbjct  115  MVNQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKSEKEKLEQQLK--SMTAQP  172

Query  437  ASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P         +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  173  GFLPPPPGIPAAFAAQGQ-AHGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_011095314.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=236

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 154/238 (65%), Gaps = 12/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   DDI        S P+S    FSW  Q +N SS  +      F +++V K
Sbjct  6    NTNWLYDY-GFDDIH-VPDGNFSAPASG---FSWPVQALNGSSNVSVEIDGSFGESDVQK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GS+KR + E C PS SKACREK RRD +N++F+EL ++LEP RPPKTDK AIL  AVR
Sbjct  61   ETGSKKRARTEPCAPSSSKACREKQRRDRLNDKFMELGALLEPGRPPKTDKAAILVDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+    M A  
Sbjct  121  MVTQLRGEAQKLKDSNSNLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLK--TMNAPQ  178

Query  437  ASF-----SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              F     + P        AAG K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  179  PGFLSAPPAIPAAFAAQSQAAGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_008365724.1| PREDICTED: transcription factor ILR3 [Malus domestica]
Length=229

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 153/238 (64%), Gaps = 19/238 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD                 +F+W  Q V  S++ +        D E  K
Sbjct  6    NTNWLFDYGLIDDTPVLDG-----------NFTWPVQPVAGSASVSVELDGSLGDAEGLK  54

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR
Sbjct  55   ESGSKKRVRSESCSGTSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVDAVR  114

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK++N  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   +M A+P
Sbjct  115  MVNQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKSEKEKLEQQLK--SMNAQP  172

Query  437  ASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P         +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  173  GFLPPPPGIPAAFAAQGQ-AHGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_003596613.1| Transcription factor ILR3 [Medicago truncatula]
 gb|ACJ84355.1| unknown [Medicago truncatula]
 gb|AES66864.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK47306.1| unknown [Medicago truncatula]
Length=230

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 155/238 (65%), Gaps = 18/238 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++D+I   VS   SF       F+W    ++        ++    D++  K
Sbjct  6    NTNWLFDYPLIDEI--PVSVDGSF------AFTWPPPHLSNGGIEMDDSS--LVDSDGIK  55

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GS+KR + ++C PS SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR
Sbjct  56   EPGSKKRGRSDSCAPSSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILIDAVR  115

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK+SN  L EKI ELK EK ELRDEKQ+LK +K KLEQQV   +M  +P
Sbjct  116  MVTQLRGEAQKLKDSNSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQVK--SMNTQP  173

Query  437  ASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               +HP         +GQ A   K+MP + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  174  GFLTHPPAIPAAFAHQGQ-APSNKLMPFMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  230



>ref|XP_006352486.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=231

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 154/239 (64%), Gaps = 19/239 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY   D +S  V+ + S        +SW  Q  N S+ A+        +++  K
Sbjct  6    NTNWLYDYNYEDIVSPDVNFSVS-------GYSWSMQGFNGSTNASVDIDGSLGESDCLK  58

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+  +KR + E+C  S SKACREK+RR+ +N++F+EL+ +LEP RPPKTDK  IL  AVR
Sbjct  59   ESSCKKRTRAESCTSSSSKACREKLRREKLNDKFMELAVLLEPGRPPKTDKSGILVDAVR  118

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF---  447
            VVT LR E +KLK+SNL+L EKI ELK EK ELRDEKQ+LK  K KLEQQ+   +     
Sbjct  119  VVTQLRDEAQKLKDSNLDLQEKIKELKVEKNELRDEKQRLKSQKEKLEQQLKTMSAQPSF  178

Query  446  ---AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               A P +F+ PI       AAG K++P++ YPG AMWQFM P  +DTSQDHVL PPVA
Sbjct  179  LPPAMPGAFASPI------QAAGTKLVPIISYPGVAMWQFMPPAAIDTSQDHVLRPPVA  231



>gb|ACU23766.1| unknown [Glycine max]
Length=236

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 158/238 (66%), Gaps = 12/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DDI     AT    SSA   F+W    +N SS           D++  K
Sbjct  6    NTNWLFDYGLIDDIP-VPDATFGVNSSA---FTWPPNALNASSNVGVEIDGSLGDSDSLK  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  SGSKACREK+RRD +N++F+EL +ILEP RP KTDK AIL  AVR
Sbjct  62   ESGSKKRVRSESCAASGSKACREKLRRDRLNDKFVELGAILEPGRPAKTDKAAILIDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK+++  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   ++ A+P
Sbjct  122  MVTQLRGEAQKLKDTSQGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLK--SLNAQP  179

Query  437  A-----SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +     +        +GQ A G K++P + YPG AMWQFM P  VDTSQDHV  PPVA
Sbjct  180  SFMPPPAAMPAAFAAQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVFRPPVA  236



>ref|XP_009791575.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
 gb|ACG60665.1| basic helix-loop-helix protein [Nicotiana tabacum]
Length=233

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 152/238 (64%), Gaps = 15/238 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDI--SSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            ++NWL DY   +     S  SATAS        F+W  Q +N S   +        +++ 
Sbjct  6    NTNWLYDYGFEESAVPDSNFSATAS-------GFNWPMQNLNGSRNVSAEVDGSIGESDY  58

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR ++E+C P+ SKACREK RRD +N++F EL ++LEP RPPKTDK AIL  A
Sbjct  59   PKENGSKKRARVESCAPTSSKACREKQRRDRLNDKFTELGALLEPGRPPKTDKSAILVDA  118

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+VT LR E +KLK+SNL L EKI ELKAEK ELRDEKQKLK +K KLEQQ+      A
Sbjct  119  VRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQKLKAEKEKLEQQLK--TTNA  176

Query  443  KPASF---SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P              GQV  G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  QPGFLPPAIPAAFAPHGQV-PGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>ref|XP_004244159.1| PREDICTED: transcription factor ILR3 [Solanum lycopersicum]
Length=233

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 154/237 (65%), Gaps = 15/237 (6%)
 Frame = -2

Query  974  SNWLIDYEMMDDI--SSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            +NWL DY   D     S  SA+AS        F+W  Q +N S   +        +++  
Sbjct  7    TNWLYDYGFEDSCVPDSNFSASAS-------GFNWSVQNLNGSRNVSSEIDGSIGESDYP  59

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE+GS+KR ++E+C P+ SKACREK+RRD +N++F+EL ++LEP RPPKTDK AIL  AV
Sbjct  60   KESGSKKRARVESCAPTSSKACREKLRRDRLNDKFMELGALLEPGRPPKTDKSAILVDAV  119

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR E +KLK+SNL L EKI ELK EK ELRDEK +LK +K KLEQQ+   +  A+
Sbjct  120  RLVTQLRDEAQKLKDSNLNLQEKIKELKVEKTELRDEKHRLKAEKEKLEQQLKTTS--AQ  177

Query  440  PASFSHPI---LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P+     I       GQ   G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  178  PSYLPPAIPSAFAAHGQF-PGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>ref|XP_009597422.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=234

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 154/234 (66%), Gaps = 8/234 (3%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            +NWL DY   D    AVS   +F S++T  FSW  Q  N S+  +        +++  KE
Sbjct  7    TNWLYDYNFED---MAVSVDPNF-SNSTSGFSWSMQPFNGSTNVSVDIDGSIGESDCLKE  62

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
            +GS+KR + E+C  S SKACREK+RR+ +N++FLEL ++LEP R P+TDK AIL  AVR+
Sbjct  63   SGSKKRARAESCTSSSSKACREKLRRERLNDKFLELGALLEPGRTPRTDKSAILVDAVRM  122

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA  435
            VT LR E EKLK+SNL L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+    M A+P+
Sbjct  123  VTQLRGEAEKLKDSNLNLQEKITELKAEKNELRDEKQRLKAEKEKLEQQLK--TMNAQPS  180

Query  434  SFSHPILNLEGQVAAGK--KMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             F   I             K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  FFPPGIPAAIAAPGQAAGSKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>gb|ADL36593.1| BHLH domain class transcription factor [Malus domestica]
Length=229

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 153/239 (64%), Gaps = 21/239 (9%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATID--FSWVSQTVNYSSTATGSTACQFEDTEV  804
            ++NWL DY ++DD             +  +D  F+W  Q +  SS+A+        D E 
Sbjct  6    NTNWLFDYGLIDD-------------TPVLDGNFAWPVQPIAGSSSASVELDGSLGDAEG  52

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  A
Sbjct  53   LKESGSKKRVRTESCSGTSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVDA  112

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+V  LR E +KLK++N  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+   +M  
Sbjct  113  VRMVNQLRGEAQKLKDTNSGLQEKIKELKAEKNELRDEKQRLKSEKEKLEQQLK--SMNV  170

Query  443  KPASFSHPILNLEGQV----AAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P     P            A G KM+P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  171  QPGFLPPPPAIPAAFAAQSQARGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>gb|AFN84533.1| BHLH domain class transcription factor [Fragaria x ananassa]
Length=231

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 157/238 (66%), Gaps = 17/238 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD +  VS++A         F+W  Q +  SS+ +        D E  K
Sbjct  6    NTNWLYDYGLIDDANFHVSSSA---------FNWPVQPLPGSSSVSVELDGSLGDVEGLK  56

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+   + SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR
Sbjct  57   ESGSKKRVRSESSSATSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKAAILIDAVR  116

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK+SN  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   AM A+P
Sbjct  117  MVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLK--AMTAQP  174

Query  437  A-----SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +              +GQ A G KM+P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  175  SFMPAPPAIPAAFPAQGQ-AHGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_008800495.1| PREDICTED: transcription factor ILR3-like [Phoenix dactylifera]
Length=231

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 156/239 (65%), Gaps = 19/239 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNW+ D  ++DD  SA       P +    F W  Q +N SS A+   +  F D+   K
Sbjct  6    NSNWVFDCPLIDDDMSA-------PETG---FYWTPQGINSSSNASVEISGSFVDSGGIK  55

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            ++GS+KR++ E+    GSKACREK+RRD +N+RFLEL SILEP +PPK DK AILS AVR
Sbjct  56   DSGSKKRVRSESSSQPGSKACREKLRRDRLNDRFLELGSILEPGKPPKMDKAAILSDAVR  115

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR+E +KLK+SN  L EKI ELKAEK ELR+EKQ+LK +K  LEQQ+    M    
Sbjct  116  MVTQLRSEAQKLKDSNENLQEKIKELKAEKNELREEKQRLKAEKENLEQQIK---MLNTR  172

Query  437  ASF-SHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            ASF +HP         +GQ AA K MMPV+ YPGF MWQFM P  VDTS+D    PPVA
Sbjct  173  ASFVAHPPVIPAAFAAQGQTAAHKLMMPVISYPGFPMWQFMPPADVDTSKDAESCPPVA  231



>gb|AFK48825.1| unknown [Lotus japonicus]
Length=238

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 159/240 (66%), Gaps = 14/240 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATG-STACQFEDTEV  804
            ++NWL DY ++DDI  A   T + P S    F+W  SQ +N SS   G        D++ 
Sbjct  6    NTNWLFDYGLIDDIP-APEVTFTVPPSG---FTWPSSQPLNSSSNVVGVEIDGSLGDSDS  61

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  A
Sbjct  62   LKEPGSKKRVRSESCSATSSKACREKLRRDKLNDKFVELGSILEPGRPPKTDKAAILIDA  121

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+VT LR E +K+K++N+ L EKI ELK EK ELRDEKQ+LK +K +LEQQ+   +M A
Sbjct  122  VRMVTQLRGEAQKMKDTNMGLQEKIKELKTEKNELRDEKQRLKTEKERLEQQLK--SMNA  179

Query  443  KPASFSHPILNLEGQVAA-----GKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P SF  P   L    AA     G K++P + YPG AMWQF+ P   DTSQDH L PPVA
Sbjct  180  QP-SFMPPPQALPAAFAAQGQAHGNKLVPFISYPGVAMWQFLPPAARDTSQDHELRPPVA  238



>ref|XP_009355579.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=229

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 152/238 (64%), Gaps = 19/238 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD                 +F+W  Q +  SS+ +        D E  K
Sbjct  6    NTNWLFDYGLIDDTPVLGG-----------NFAWPVQPIAGSSSVSVELDGSLGDAEGLK  54

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ E+C  + SKACREK+RRD +N++F+EL +ILEP RPPKTDK AIL  AVR
Sbjct  55   ESGSKKRVRTESCSGTSSKACREKLRRDRLNDKFVELGTILEPGRPPKTDKAAILVDAVR  114

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK++N  L EKI ELKAEK ELRDEK +LK +K KLEQQ+   +M  +P
Sbjct  115  MVNQLRGEGQKLKDTNSGLQEKIKELKAEKNELRDEKLRLKLEKEKLEQQLK--SMNVQP  172

Query  437  ASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P         +GQ A G KM+P +GYPG AMWQF+ P  VDTSQDHVL PPVA
Sbjct  173  GFLPPPPAIPSSFTAQGQ-ARGNKMVPFIGYPGVAMWQFLPPAAVDTSQDHVLRPPVA  229



>ref|XP_002273184.2| PREDICTED: transcription factor ILR3-like isoform X1 [Vitis vinifera]
Length=232

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 158/244 (65%), Gaps = 25/244 (10%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDIS-SAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTE  807
            E D NW+ DY ++DD+   ++ AT ++PS    DF           TA+ +   +F+D+ 
Sbjct  5    EEDPNWIFDYGLIDDVPVPSLQATFNWPSH---DF-----------TASAALGVEFDDSP  50

Query  806  V----CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIA  639
            V     KE  SRKR++   C  SGSKACREK+RRD +N+RFLEL SILEP RPPK DK  
Sbjct  51   VNLDDVKENHSRKRMRSGLCSASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAV  110

Query  638  ILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG  459
            ILS A+R++T LR+E +KLK+S  +L EKI+ELKAEK ELRDEKQ+LK +K  + QQ+  
Sbjct  111  ILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKA  170

Query  458  ----AAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
                A     P++   P     GQV  G K+MP +GYPG +MWQFM P  VDTSQDHVL 
Sbjct  171  LSSQAGFLPHPSAIPAP-FAAPGQV-VGSKLMPFIGYPGVSMWQFMPPAAVDTSQDHVLR  228

Query  290  PPVA  279
            PPVA
Sbjct  229  PPVA  232



>ref|XP_006467957.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|KDO75607.1| hypothetical protein CISIN_1g026702mg [Citrus sinensis]
Length=235

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 160/243 (66%), Gaps = 23/243 (9%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNW+ D  ++DDI   VS     PS    +  W S T N   +A  + +  F + +  K
Sbjct  6    NSNWIFDCGLLDDI--GVSG-GDLPSLDPPEVLWSSSTSNPPLSAEFNDS--FGNLDAFK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKR++  +C  SGSKACREKMRRD +N+RF+EL+SIL+P RPPK DK  +L+ AV+
Sbjct  61   ETGSRKRVRSGSCSASGSKACREKMRRDRLNDRFMELASILDPGRPPKMDKTVLLADAVQ  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK SN +L+ KI+ELK EK ELRDEKQ+LK +K  LE+QV   A+ ++P
Sbjct  121  MVTQLRDEAQKLKVSNEKLLGKINELKCEKNELRDEKQRLKNEKENLERQVK--ALSSQP  178

Query  437  A----------SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
            A           FS P     GQV  G K++P+VGYPG +MWQFM P  VDTSQDHVL P
Sbjct  179  AFLPHPPPVPAPFSAP-----GQVVGG-KLVPLVGYPGVSMWQFMPPAAVDTSQDHVLRP  232

Query  287  PVA  279
            PVA
Sbjct  233  PVA  235



>ref|XP_003543375.1| PREDICTED: transcription factor ILR3-like isoform X1 [Glycine 
max]
 ref|XP_006594876.1| PREDICTED: transcription factor ILR3-like isoform X2 [Glycine 
max]
Length=231

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 155/238 (65%), Gaps = 10/238 (4%)
 Frame = -2

Query  992  NAMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFED  813
            N+    S+WL DY    DI  A S    F +S +  F W  Q+ N+   +  S   ++  
Sbjct  4    NSSGGASDWLYDYGF--DIPVAGS---DFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSL  58

Query  812  TEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAIL  633
                 E G  KRL+ E+C  SGSKACREK+RRD +NERFLELSSILEP+R PK+DK+AIL
Sbjct  59   DSTVMENGPSKRLRTESCA-SGSKACREKLRRDKLNERFLELSSILEPSRQPKSDKVAIL  117

Query  632  SGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA  453
            S A RVV  LR E ++LKE N EL  K+ ELK EK ELRDEK +LKE+K KLEQQV  A 
Sbjct  118  SDAARVVIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEQQVKVAN  177

Query  452  MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +  +P SF     + +GQV +  K++P +GYPG AMWQFM P  VDTS+DH+L PPVA
Sbjct  178  I--QP-SFLPQAPDAKGQVGS-HKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  231



>gb|AEJ88330.1| putative MYC protein [Tamarix hispida]
Length=238

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 156/240 (65%), Gaps = 14/240 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNW+ DY + +DI   V A    P+S    F+W    +N  S  +      F D+EV K
Sbjct  6    NSNWIFDYPL-EDIPLPV-ANYDAPNSG---FNWPVPALNGPSNVSVEGDGTFRDSEVAK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E G +KR + E+C  S SKACREK+RRD +N++F+EL++ILEP RPPKTDK AIL+ AVR
Sbjct  61   ENGLKKRGRSESCGLSNSKACREKLRRDRLNDKFVELAAILEPGRPPKTDKAAILTDAVR  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR+E +KLK++N +L EKI ELK+EK ELRDEKQ+ K +K KLEQQ+   ++ ++P
Sbjct  121  MVTQLRSESQKLKDTNSDLQEKIKELKSEKNELRDEKQRFKAEKEKLEQQLK--SVNSQP  178

Query  437  ASFSHPILNLEGQV-------AAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P                 G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  179  GYLPPPPTMPAAYAAQAPQFQTGGSKLVPFMGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_004156771.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like 
[Cucumis sativus]
Length=227

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 147/216 (68%), Gaps = 10/216 (5%)
 Frame = -2

Query  908  FPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACRE  729
            F    +I FSW + ++N+ S  +    C +ED +  KE G RKRL+ ET   S SKACRE
Sbjct  16   FSPPQSISFSWSNPSINFLSKDSLEVDCSYEDLDSTKEVG-RKRLRGETSAASTSKACRE  74

Query  728  KMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKI  549
            K RRD +NERFLEL+++LEP +PPK+DK+AILS A+R++T L+ E +KL+ES  +L  KI
Sbjct  75   KQRRDKLNERFLELAAVLEPGKPPKSDKVAILSDAIRMMTDLQCETQKLRESKEDLKAKI  134

Query  548  HELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNL------EGQVAAG  387
             ELK EK ELRDEKQ+L+ +K KLE Q+   A+  + A   HP   L      +GQ +AG
Sbjct  135  KELKVEKNELRDEKQRLRAEKEKLELQIR--AVNTRAADVQHPPXTLSAAFTAQGQ-SAG  191

Query  386  KKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             K+MP +GYPG AMWQF+ P  VD SQDHVL PPVA
Sbjct  192  NKLMPFIGYPGIAMWQFLPPAAVDISQDHVLRPPVA  227



>ref|XP_007021087.1| DNA binding protein, putative [Theobroma cacao]
 gb|EOY12612.1| DNA binding protein, putative [Theobroma cacao]
Length=235

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 145/233 (62%), Gaps = 15/233 (6%)
 Frame = -2

Query  962  IDY-EMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATG-STACQFEDTEVCKEAG  789
             DY  ++DDI          P      FSW +Q  N  S          F D +  KE+G
Sbjct  13   FDYANLIDDI----------PDGPYSSFSWPAQPTNAPSNVVSVENDGSFGDLDGLKESG  62

Query  788  SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVT  609
            S+KR++ E+C PS SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR+VT
Sbjct  63   SKKRVRSESCNPSSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKAAILIDAVRMVT  122

Query  608  SLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMFAKP  438
             LR E +KLK+SN  L EKI ELK+EK ELRDEKQ+LK +K +LEQQ+   N    F  P
Sbjct  123  QLRGEAQKLKDSNSSLQEKIKELKSEKNELRDEKQRLKAEKERLEQQLKTMNAQPSFMPP  182

Query  437  ASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                          A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  183  GPAIPAAFAAAQGQAPGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_007149692.1| hypothetical protein PHAVU_005G091000g [Phaseolus vulgaris]
 gb|AGZ15364.1| transcription factor ILR3 [Phaseolus vulgaris]
 gb|ESW21686.1| hypothetical protein PHAVU_005G091000g [Phaseolus vulgaris]
Length=231

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 146/236 (62%), Gaps = 13/236 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL DY ++DD         SF  SA   FSW     N S     S      D++  K
Sbjct  6    NSNWLFDYPLIDD--DITVGDGSFTVSA---FSWPPPPSNVSVEIDASLV----DSDGLK  56

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            +   +KR + + C  S SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR
Sbjct  57   DPALKKRGRSDLCTASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILIDAVR  116

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMF  447
            +VT LR E +KLKESN  L EKI ELK EK ELRDEKQ+LK +K KLE QV   N    F
Sbjct  117  MVTQLRDEAQKLKESNTGLQEKIKELKTEKNELRDEKQRLKVEKEKLELQVKSMNAQPAF  176

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P S        +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  LPPPSAIPAAFAPQGQ-APGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_004309656.1| PREDICTED: transcription factor ILR3-like [Fragaria vesca subsp. 
vesca]
Length=245

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 151/242 (62%), Gaps = 17/242 (7%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NW+ DY++++ IS         PS     FSW S +    +  +      F ++E+ KE 
Sbjct  10   NWVFDYDLIESISVP---GGDLPSLDPPGFSWGSDSFAAPTAPSVDFDGSFGNSEIMKET  66

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KR++  +C  S SKACREKMRRD +N++FLELS+ILEP RPPKTDK AIL  AVR+V
Sbjct  67   GSNKRVRSGSCNVSSSKACREKMRRDRLNDKFLELSTILEPGRPPKTDKAAILVDAVRMV  126

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
              LR E + LK+S+  L EKI ELKAEK ELRDEKQ+LK +K  LE+Q+   A+  +P  
Sbjct  127  NQLRGEAQNLKDSSESLQEKITELKAEKNELRDEKQRLKAEKENLERQIK--ALGTQPGF  184

Query  431  FSHPI-----LNLEGQVAAGKKMMP------VVGYPGFAMWQFMQPTIVDTSQDHVLHPP  285
              HP       +  GQV  G K+MP      V GYPG +MWQFM    VDTSQDHVL PP
Sbjct  185  LPHPAAIPAPFSAPGQVVGG-KLMPFMGYPGVSGYPGVSMWQFMPQAAVDTSQDHVLRPP  243

Query  284  VA  279
            VA
Sbjct  244  VA  245



>ref|XP_006449136.1| hypothetical protein CICLE_v10016511mg [Citrus clementina]
 gb|ESR62376.1| hypothetical protein CICLE_v10016511mg [Citrus clementina]
Length=235

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 157/243 (65%), Gaps = 23/243 (9%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNW+ D  ++D I   VS     PS    +  W S T N   +A    +  F + +  K
Sbjct  6    NSNWIFDCGLLDGI--GVSG-GDLPSLDPPEVLWSSSTSNPPLSAEFDDS--FGNLDAFK  60

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKR++  +C  SGSKACREKMRRD +N+RF+EL+SIL+P RPPK DK  +L+ AV+
Sbjct  61   ETGSRKRVRSGSCSASGSKACREKMRRDRLNDRFMELASILDPGRPPKMDKTVLLADAVQ  120

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E +KLK SN  L+ KI+ELK EK ELRDEKQ+LK +K  LE+QV   A+ ++P
Sbjct  121  MVTQLRDEAQKLKVSNENLLGKINELKCEKNELRDEKQRLKNEKENLERQVK--ALSSQP  178

Query  437  A----------SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
            A           FS P     GQV  G K++P+VGYPG +MWQFM P  VDTSQDHVL P
Sbjct  179  AFLPHPPPVPAPFSAP-----GQVVGG-KLVPLVGYPGVSMWQFMPPAAVDTSQDHVLRP  232

Query  287  PVA  279
            PVA
Sbjct  233  PVA  235



>gb|AEI83428.1| bHLH transcription factor 1 [Camellia sinensis]
Length=235

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 151/236 (64%), Gaps = 11/236 (5%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            +NWL DY +++DIS       S P+S    F W    +N SS+        F D++  KE
Sbjct  7    TNWLFDYGLIEDIS-VPDPNFSAPTSG---FCW---PLNASSSVGLEIDGSFGDSDSRKE  59

Query  794  AGSRKRLKLETC-IPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
             GS+KR + E+C   S SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  A+R
Sbjct  60   TGSKKRPRPESCGASSSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVEAIR  119

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMF  447
            +V  LR + +KLK+SNL L EKI ELKAEK ELRDEKQ+LK +K +LEQQ   VN    F
Sbjct  120  LVIQLRGDAQKLKDSNLTLQEKIKELKAEKNELRDEKQRLKAEKERLEQQLKTVNVQPGF  179

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P              A G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  180  MPPPPAIPATAFAAQGQAGGNKLVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  235



>ref|XP_006393084.1| hypothetical protein EUTSA_v10011752mg [Eutrema salsugineum]
 dbj|BAJ34492.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30370.1| hypothetical protein EUTSA_v10011752mg [Eutrema salsugineum]
Length=229

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 150/235 (64%), Gaps = 13/235 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++D   S  + T          F W    ++ S++ +        D++V K
Sbjct  6    NTNWLSDYPLIDGAFSDQNPT----------FPWPIDQIDGSASVSVEVDGFLCDSDVIK  55

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKR+K ETC  S SKACREK RRD +NE+F ELSSILEP R PKTDK+AI++ A+R
Sbjct  56   EPGSRKRIKSETCGGSSSKACREKQRRDKLNEKFTELSSILEPGRLPKTDKVAIINDAIR  115

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  +R E +KLK+ N  L EKI ELK EK ELRDEKQKLK +K ++EQQ+       +P
Sbjct  116  MVNQVRDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIEQQLKAIKTQPQP  175

Query  437  AS--FSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                  +P    +GQ A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  176  QPLFLPNPPTMSQGQ-APGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_009383663.1| PREDICTED: transcription factor ILR3-like [Musa acuminata subsp. 
malaccensis]
Length=238

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 147/236 (62%), Gaps = 10/236 (4%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NW +D  ++DDI  A      F ++      W  Q  N SS  +      F +++  KE 
Sbjct  8    NWFLDCSLIDDIPHA---GGDFAANDVGGLCWPPQGFNTSSGVSVDIDSPFVNSDGLKEP  64

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KR++ E+C    SKACREKMRR+ +N+RF+ELSS+L+P  PPKTDK AILS A RVV
Sbjct  65   GSAKRVRSESCSRPASKACREKMRREKLNDRFMELSSLLDPGNPPKTDKAAILSDAARVV  124

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
              LR E +KLK+SN  L EKI ELKAEK ELR+EKQKLK +K  LEQQV    + A+P+ 
Sbjct  125  IQLRNEAQKLKDSNESLQEKIKELKAEKNELREEKQKLKAEKESLEQQVK--LLNARPSF  182

Query  431  FSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               P     +   +GQ A  K M+PVVGYP F MWQFM P  VDTSQD    PPVA
Sbjct  183  VPQPPLVPSLFPAQGQAAGHKLMVPVVGYPSFPMWQFMPPADVDTSQDADKCPPVA  238



>ref|XP_003607702.1| Transcription factor ILR3 [Medicago truncatula]
Length=261

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 158/263 (60%), Gaps = 37/263 (14%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT-VNYSSTATGSTACQ-------  822
            ++NW+ DY   DDI     +T + PSSA   F+W +Q   N SS       C        
Sbjct  6    NTNWINDYGFYDDIP-VPDSTFALPSSA---FTWPTQPPFNLSSNVRSGVRCSNFKQCNF  61

Query  821  -----------------FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFL  693
                               D++  KE+GS+KR++ E+C  + SKACREK+RRD +N++F+
Sbjct  62   PWTDAVDMRMGAEVDGSLGDSDGLKESGSKKRVRSESCAATSSKACREKLRRDRLNDKFI  121

Query  692  ELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRD  513
            EL SILEP RP KTDK AIL  AVR+VT LR E +KLK++N  L EKI ELK EK ELRD
Sbjct  122  ELGSILEPGRPAKTDKAAILIDAVRMVTQLRGEAQKLKDANSGLQEKIKELKVEKNELRD  181

Query  512  EKQKLKEDKMKLEQQVNGAAMFAKPASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFA  348
            EKQ+LK +K KLEQQ+   +M A P+    P         +GQ A G K++P + YPG A
Sbjct  182  EKQRLKAEKEKLEQQLK--SMNAPPSFLPTPTALPAAFAAQGQ-AHGNKLVPFISYPGVA  238

Query  347  MWQFMQPTIVDTSQDHVLHPPVA  279
            MWQFM P  VDTSQDHVL PPVA
Sbjct  239  MWQFMPPAAVDTSQDHVLRPPVA  261



>ref|XP_006452147.1| hypothetical protein CICLE_v10009354mg [Citrus clementina]
 gb|ESR65387.1| hypothetical protein CICLE_v10009354mg [Citrus clementina]
Length=235

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 161/238 (68%), Gaps = 13/238 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT-VNYSSTATGSTACQFEDTEVC  801
            ++NWL+DY ++DDI+       +F  SA+  F+W  Q  +N  S         F D+   
Sbjct  6    NTNWLLDYPLIDDITVP---DGNFSVSAS-GFTWTVQPPINGPSNGCVEIDSAFGDSNGL  61

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE+ S+KR++ E+C  S SKACREK+RRD +N++F+EL+SILEP RPPKTDK AIL  AV
Sbjct  62   KES-SKKRVRSESCGSSSSKACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAV  120

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR+E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K K+EQQ+   AM  +
Sbjct  121  RMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLK--AMSTQ  178

Query  440  PASFS----HPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P+  +          +GQ A G K+MP + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  179  PSFLTPPAIPAAFAAQGQ-APGNKLMPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_006475303.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|KDO46376.1| hypothetical protein CISIN_1g026599mg [Citrus sinensis]
Length=236

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 161/239 (67%), Gaps = 14/239 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQT-VNYSSTATGSTACQFEDTEVC  801
            ++NWL+DY ++DDI+       +F  SA+  F+W  Q  +N  S         F D+   
Sbjct  6    NTNWLLDYPLIDDITVP---DGNFSVSAS-GFTWTVQPPINGPSNGCVEIDSAFGDSNGL  61

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE+ S+KR++ E+C  S SKACREK+RRD +N++F+EL+SILEP RPPKTDK AIL  AV
Sbjct  62   KES-SKKRVRSESCGSSSSKACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAV  120

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR+E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K K+EQQ+   AM  +
Sbjct  121  RMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLK--AMSTQ  178

Query  440  PASFS-----HPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P+  +           +GQ A G K+MP + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  179  PSFLTPPPAIPAAFAAQGQ-APGNKLMPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_002316706.2| hypothetical protein POPTR_0011s03360g [Populus trichocarpa]
 gb|EEE97318.2| hypothetical protein POPTR_0011s03360g [Populus trichocarpa]
Length=243

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 153/243 (63%), Gaps = 16/243 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFS-WVSQTVNYSSTATGSTACQFEDTEV  804
            + NW+ D  +++DIS          S   T + S W S     S+  +      +E+ + 
Sbjct  7    NDNWVFDCGLIEDISVPGGDLLGLESLDETPNGSLWSSHNFTDSAFLSVEFNNSYENLDG  66

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE+GSRKR++  +   +GSKACREKMRRD +N+RF EL ++L+P RPPK DK AIL  A
Sbjct  67   HKESGSRKRVRPGSSNATGSKACREKMRRDRLNDRFTELGALLDPGRPPKVDKSAILVDA  126

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAM--  450
             R+VT LR E +KLKESN+ L EKI ELKAEK ELRDEKQ+LK +K  LE+QV   +   
Sbjct  127  ARMVTQLRDESQKLKESNVSLQEKIDELKAEKNELRDEKQRLKTEKENLERQVKALSTPP  186

Query  449  ------FAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
                   A PA FS P     GQV  G K+MP VGYPG +MWQFM P +VDTSQDHVL P
Sbjct  187  NFLPHPSAIPAPFSAP-----GQV-VGSKLMPFVGYPGISMWQFMPPAVVDTSQDHVLRP  240

Query  287  PVA  279
            PVA
Sbjct  241  PVA  243



>ref|XP_010694263.1| PREDICTED: transcription factor ILR3 [Beta vulgaris subsp. vulgaris]
Length=240

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 148/238 (62%), Gaps = 4/238 (2%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            + + NWL DY  MD+I  +V        ++  +   + Q +      +      + D+E 
Sbjct  4    QENPNWLYDYSYMDEIQISVPDCNFAAPNSAFNNCQLQQALTVPINVSADIDGTYGDSEG  63

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE  S+KR + E+C PS SKACREK RRD +N++F+EL SILEP R PKTDK AIL  A
Sbjct  64   LKENNSKKRGRSESCAPSSSKACREKARRDRLNDKFMELGSILEPGRTPKTDKAAILIDA  123

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAA  453
            VR+VT LR+E +KLK+SN  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   N   
Sbjct  124  VRMVTQLRSEAQKLKDSNSSLQEKIKELKTEKNELRDEKQRLKAEKDKLEQQLKTMNTQP  183

Query  452  MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             +  P   + P        A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  184  GYL-PGPTAIPAAFAPPAQAPGGKLVPFMGYPGVAMWQFMPPASVDTSQDHVLRPPVA  240



>ref|XP_004487616.1| PREDICTED: transcription factor ILR3-like [Cicer arietinum]
Length=228

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 145/237 (61%), Gaps = 18/237 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVS-QTVNYSSTATGSTACQFEDTEVC  801
            ++NWL DY +MDDI              + +F+W      N      GS      D++  
Sbjct  6    NTNWLFDYALMDDIPVP---------DGSFNFTWPPPDPSNVGVEIDGSLG----DSDGI  52

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            K+ GS+KR + ++C PS SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AV
Sbjct  53   KDPGSKKRGRSDSCAPSSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILIDAV  112

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAM  450
            R+VT LR E +KLK SN  L EKI ELK EK ELRDEKQ+LK DK KLEQQV   N    
Sbjct  113  RMVTQLRGEAQKLKASNSSLQEKIKELKVEKNELRDEKQRLKADKEKLEQQVKSMNTQPG  172

Query  449  FAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            F  P          +GQ A   K+MP + YPG AMWQF+ P  +D SQDH L PPVA
Sbjct  173  FLTPPPAIPAAFAPQGQ-APSNKLMPFISYPGVAMWQFVPPATMDISQDHELRPPVA  228



>gb|KFK35883.1| hypothetical protein AALP_AA4G049100 [Arabis alpina]
Length=230

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 148/235 (63%), Gaps = 12/235 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NWL DY ++D   S  + T          F W +   ++ S++ +        D++V 
Sbjct  6    NTNWLSDYPLIDGAFSDQNHT----------FPWQIDHHIDGSASVSVEVDGFLCDSDVI  55

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GSRKRLK E C  S SKAC+EK RRD +N++F ELS+++EP RPPKTDK+AIL+ A+
Sbjct  56   KEPGSRKRLKSEACGGSNSKACKEKQRRDRLNDKFTELSNVMEPGRPPKTDKVAILNDAI  115

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V   R E +KLK+ N  L EKI ELK EK ELRDEKQKLK +K ++EQQ+       +
Sbjct  116  RMVNQAREEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIEQQLKAIKPQPQ  175

Query  440  PASFSHPILNLEGQVAA-GKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P     P    + Q  A G K++P   YPGFAMWQFM P  +DTSQDHVL PPVA
Sbjct  176  PCFLPTPQTLTQAQAQAPGSKLVPFTTYPGFAMWQFMPPATIDTSQDHVLRPPVA  230



>ref|XP_004151959.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=234

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 152/234 (65%), Gaps = 6/234 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  FSW  Q  N S  +         D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVTSS-SFSWPIQPFNGSHDSGVEIDGSLADLDGRL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E +KLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV       +P
Sbjct  122  MVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA-QQP  180

Query  437  ASFSHPILNLEGQVAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PI     Q  AG K++P +GY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  GFLPPPIPTFPAQGQAGNKLVPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_002891614.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67873.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 147/234 (63%), Gaps = 14/234 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++D   S  + T          F W    ++ S+T +        D++V K
Sbjct  6    NTNWLSDYPLIDGAFSDQNPT----------FPW---QIDASATVSVEVDGFLCDSDVIK  52

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKR+K E+C  S SKACREK RRD +N++F ELSSILEP R PKTDK+AI++ A+R
Sbjct  53   EPGSRKRIKTESCAGSNSKACREKQRRDRLNDKFTELSSILEPGRAPKTDKVAIINDAIR  112

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V   R E +KLK+ N  L EKI ELK EK ELRDEKQKLK +K +++QQ+       +P
Sbjct  113  MVNQAREEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIDQQLKAIKTQPQP  172

Query  437  ASFSHP-ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             S   P    L    A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  173  QSCFLPNPPTLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  226



>ref|XP_011003406.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=243

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 154/243 (63%), Gaps = 16/243 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFS-WVSQTVNYSSTATGSTACQFEDTEV  804
            +++W+ D  +++D+           S   T + S W S + N ++  +      FE+++ 
Sbjct  7    NASWVFDCGLIEDVPVPGGEQLCLESLDETPNGSLWSSHSFNDTAFLSAEFNNSFENSDG  66

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE G RKR++  +    GSKACREKMRRD +N+RF+E++++L+P RPPK DK AIL  A
Sbjct  67   LKEIGFRKRVRHGSGNAPGSKACREKMRRDRLNDRFMEMAALLDPGRPPKVDKSAILVDA  126

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA---  453
             R+VT LR E +KLKESN  L EKI ELKAEK ELRDEKQKLK +K  LE Q+   +   
Sbjct  127  ARMVTQLRDESQKLKESNESLQEKIDELKAEKNELRDEKQKLKTEKENLEWQLKALSPPP  186

Query  452  -----MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
                   A PA FS P     GQV  G K+MP VGYPG +MWQFM P +VDTSQDHVLHP
Sbjct  187  TYLPQPPAIPAPFSSP-----GQV-VGSKLMPFVGYPGISMWQFMPPAVVDTSQDHVLHP  240

Query  287  PVA  279
            PVA
Sbjct  241  PVA  243



>ref|XP_010999542.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
 ref|XP_011012469.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=243

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 153/240 (64%), Gaps = 10/240 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFS-WVSQTVNYSSTATGSTACQFEDTEV  804
            + NW+ D  +++DIS          S   T + S W S     S+  +      +E+++ 
Sbjct  7    NDNWVFDCGLIEDISVPGGDLLGLESLDETPNGSLWSSHNFTDSAFLSVEFNNSYENSDG  66

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             K++G RKR++  +   +GSKACREK+RRD +N+RF+EL ++L+P RPPK DK AIL  A
Sbjct  67   HKDSGCRKRVRPGSSNATGSKACREKLRRDRLNDRFMELGALLDPGRPPKVDKSAILVDA  126

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
             R+VT LR E +KLKESN+ L EKI ELKAEK ELRDEKQ+LK +K  LE+QV   A+  
Sbjct  127  ARMVTQLRDESQKLKESNVSLQEKIDELKAEKNELRDEKQRLKTEKENLERQV--KALRT  184

Query  443  KPASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             P    HP       +  GQV  G K+MP VGYPG +MWQFM P +VDTSQDHVL PPVA
Sbjct  185  PPNFLPHPSAIPAPFSAPGQV-GGSKLMPFVGYPGISMWQFMPPAVVDTSQDHVLRPPVA  243



>ref|XP_006401546.1| hypothetical protein EUTSA_v10014564mg [Eutrema salsugineum]
 dbj|BAJ33812.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42999.1| hypothetical protein EUTSA_v10014564mg [Eutrema salsugineum]
Length=234

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 146/239 (61%), Gaps = 16/239 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NW+ D    D  S  +             FSW V Q +  SS ++        ++E  
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQPIGVSSNSSAGVDVSAGNSEAS  56

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR + E+   +GSKACREK+RRD +N++F EL +ILEP  PPKTDK AIL  AV
Sbjct  57   KEPGSKKRGRCESSSATGSKACREKLRRDRLNDKFTELGAILEPGNPPKTDKAAILVDAV  116

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG-----A  456
            R+V  LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+        
Sbjct  117  RMVAQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKTMNAPQP  176

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + F  P        + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  SFFPAPPMMPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  234



>ref|NP_200279.1| transcription factor ILR3 [Arabidopsis thaliana]
 ref|XP_002864351.1| hypothetical protein ARALYDRAFT_495549 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9FH37.1|ILR3_ARATH RecName: Full=Transcription factor ILR3; AltName: Full=Basic 
helix-loop-helix protein 105; Short=AtbHLH105; Short=bHLH 105; 
AltName: Full=Protein IAA-LEUCINE RESISTANT 3; AltName: Full=Transcription 
factor EN 133; AltName: Full=bHLH transcription 
factor bHLH105 [Arabidopsis thaliana]
 gb|AAM10964.1|AF488629_1 putative bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAB09934.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96776.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72200.1| Unknown protein [Arabidopsis thaliana]
 gb|EFH40610.1| hypothetical protein ARALYDRAFT_495549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96526.1| transcription factor ILR3 [Arabidopsis thaliana]
Length=234

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 152/241 (63%), Gaps = 20/241 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NW+ D    D  S  +             FSW V Q +  SS ++        ++E  
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQPIGVSSNSSAGVDGSAGNSEAS  56

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  AV
Sbjct  57   KEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAILVDAV  116

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA-  444
            R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+   AM A 
Sbjct  117  RMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLK--AMNAP  174

Query  443  KPASFSHPIL------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPV  282
            +P+ F  P +      + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPV
Sbjct  175  QPSFFPAPPMMPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPV  233

Query  281  A  279
            A
Sbjct  234  A  234



>gb|AAM64276.1| bHLH transcription factor, putative [Arabidopsis thaliana]
Length=234

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 146/239 (61%), Gaps = 16/239 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NW+ D    D  S  +             FSW V Q +  SS ++        ++E  
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQPIGVSSNSSAGVDGSAGNSEAS  56

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  AV
Sbjct  57   KEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAILVDAV  116

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG-----A  456
            R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+        
Sbjct  117  RMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAINAPQP  176

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + F  P        + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  SFFPAPPMMPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  234



>ref|XP_010909862.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=237

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 147/235 (63%), Gaps = 7/235 (3%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            SNW +D  ++DD+    +  A+     T  F+W  Q  N     +G       + +  KE
Sbjct  7    SNWFLDCPLIDDMPVPGTDFAA----PTGGFNWNPQGFNPYPDVSGEIHGSIANFDGHKE  62

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             GS+KR++ E+C    SKACREKMRRD +NERFLELSSIL+P +PPK DK  ILS AV +
Sbjct  63   PGSQKRMRSESCSGPSSKACREKMRRDRLNERFLELSSILDPGKPPKMDKATILSDAVHM  122

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMFA  444
            VT LRTE +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K  LEQQ   +N    + 
Sbjct  123  VTQLRTEAQKLKQSNDSLEEKIKELKAEKSELRDEKQRLKVEKESLEQQLKLLNSRPSYV  182

Query  443  KPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             P          +GQ A  K MMPV+GYPGF MWQFM PT VDTS+D    PPVA
Sbjct  183  PPPPVIPTAFAAQGQAAGQKLMMPVIGYPGFPMWQFMPPTDVDTSKDTETCPPVA  237



>gb|KHN36564.1| Transcription factor bHLH115 [Glycine soja]
Length=239

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 155/246 (63%), Gaps = 18/246 (7%)
 Frame = -2

Query  992  NAMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFED  813
            N+    S+WL DY    DI  A S    F +S +  F W  Q+ N+   +  S   ++  
Sbjct  4    NSSGGASDWLYDYGF--DIPVAGS---DFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSL  58

Query  812  TEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINER--------FLELSSILEPTRPP  657
                 E G  KRL+ E+C  SGSKACREK+RRD +NER        FLELSSILEP+R P
Sbjct  59   DSAVMENGPSKRLRTESCA-SGSKACREKLRRDKLNERHAIILHIVFLELSSILEPSRQP  117

Query  656  KTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKL  477
            K+DK+AILS A RVV  LR E ++LKE N EL  K+ ELK EK ELRDEK +LKE+K KL
Sbjct  118  KSDKVAILSDAARVVIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKL  177

Query  476  EQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
            EQQV  A +  +P SF     + +GQV +  K++P +GYPG AMWQFM P  VDTS+DH+
Sbjct  178  EQQVKVANI--QP-SFLPQAPDAKGQVGS-HKLIPFIGYPGIAMWQFMSPAAVDTSKDHL  233

Query  296  LHPPVA  279
            L PPVA
Sbjct  234  LRPPVA  239



>ref|XP_004487368.1| PREDICTED: transcription factor bHLH115-like [Cicer arietinum]
Length=236

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 157/236 (67%), Gaps = 13/236 (6%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFE---DTEV  804
            S WL DY    DIS A S   +   S T  F+W+  T N ++  + + + + E   D+ V
Sbjct  10   SCWLYDYGF--DISVAASDFMA-SDSTTAAFTWIPHT-NITNPPSSNISLEMEYSLDSTV  65

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             + A S KRLK E+   SGSKACREK+RRD +N+RFLELSS+LEP + PKTDK+ +L+ A
Sbjct  66   LENAPS-KRLKTES-YASGSKACREKLRRDKLNDRFLELSSVLEPDKLPKTDKVTLLNDA  123

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
             RV+T LR E E+LKE N EL EK+ ELKAEK ELRDEK KLK DK KLEQQV    +  
Sbjct  124  ARVITQLRNEAERLKERNDELREKVKELKAEKNELRDEKNKLKLDKEKLEQQVRSTTV--  181

Query  443  KPASF-SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + +SF  + +   +GQ  +  K+MP +GYPG +MWQFM P  VDTSQDH+L PPVA
Sbjct  182  QQSSFLPNALAAAKGQTGS-HKLMPFIGYPGISMWQFMSPATVDTSQDHLLRPPVA  236



>ref|XP_007149945.1| hypothetical protein PHAVU_005G112500g [Phaseolus vulgaris]
 gb|ESW21939.1| hypothetical protein PHAVU_005G112500g [Phaseolus vulgaris]
Length=233

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 149/239 (62%), Gaps = 10/239 (4%)
 Frame = -2

Query  992  NAMETDSNWLIDYEMMDDISSAVSATASFPSSA-TIDFSWVSQTVNYSSTATGSTACQFE  816
            N+    S WL DY    DI  A    A F ++A +  FSW  Q     + +  S   ++ 
Sbjct  4    NSSGAASGWLYDYGF--DIPVA---GADFMAAADSGGFSWGPQNHTLKAPSNTSLDMEYS  58

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
                  E G  KRL+ E+C  SG+KACREK+RRD +NERFLELSSILEP RPPKTDK+AI
Sbjct  59   LDSTVLENGPSKRLRTESCA-SGAKACREKLRRDKLNERFLELSSILEPGRPPKTDKVAI  117

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            LS AVR V  LR E E+LKE N EL  K+ ELKAEK ELRDEK  LKE+K KLEQQV   
Sbjct  118  LSDAVRAVVQLRNEAERLKEMNDELQGKVKELKAEKNELRDEKNMLKEEKEKLEQQVKLT  177

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             +     SF       + QV +  K++P +GYPG AMWQFM P  VDTS+DH+L PPVA
Sbjct  178  NVMQH--SFLPQAPAAKEQVGS-HKLIPFIGYPGIAMWQFMPPAAVDTSKDHLLRPPVA  233



>ref|XP_008371203.1| PREDICTED: transcription factor ILR3-like [Malus domestica]
Length=177

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 129/179 (72%), Gaps = 8/179 (4%)
 Frame = -2

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE G RKR +  +   SGSKACREKMRRD +N+RF ELSSILEP RPPKTDK+AIL  AV
Sbjct  2    KETGLRKRARTGSNSVSGSKACREKMRRDRLNDRFAELSSILEPGRPPKTDKVAILGDAV  61

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR E ++LKES+  L E I+ELKAEK ELRDEKQ+LK +K  +E+Q+   A+  +
Sbjct  62   RMVTQLRGEAQQLKESSANLQETINELKAEKNELRDEKQRLKAEKDNIERQIK--ALGTQ  119

Query  440  PASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P+   HP       +  GQV  G KMMP VGYPG +MWQFM P  VDTSQDHVL PPVA
Sbjct  120  PSFLPHPAAIPTPFSAPGQVVGG-KMMPFVGYPGMSMWQFMPPAAVDTSQDHVLRPPVA  177



>gb|EPS70109.1| hypothetical protein M569_04652 [Genlisea aurea]
Length=232

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 150/237 (63%), Gaps = 10/237 (4%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            + ++NWL DY + D   +     A+ P      FSW +Q  N+SS + G       D+++
Sbjct  4    QENTNWLCDYGIGDIHENP--GIANNPG-----FSWPAQGCNFSSNSGGELEGSLGDSDM  56

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             +E G++KR +  TC  S SKACREK RRD +N++F+EL+++LEP RPPK DK AIL  A
Sbjct  57   QRETGNKKRARPNTCASSSSKACREKQRRDRLNDKFMELAALLEPGRPPKADKAAILVDA  116

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAM--  450
            VR++  L+ E +KLK+SNL L EKI ELKAEK ELR+EKQ+LK +K  LE ++       
Sbjct  117  VRMLNQLKGEAQKLKDSNLNLHEKIKELKAEKSELREEKQRLKVEKENLEYKLKTMPQPN  176

Query  449  FAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            F    +        + Q A G+K++PV+ YPG AMWQFM P  VDTSQDH L PPVA
Sbjct  177  FMPAPAAIPAAFAAQNQ-AGGEKLVPVISYPGVAMWQFMPPATVDTSQDHALRPPVA  232



>ref|XP_010482878.1| PREDICTED: transcription factor ILR3-like [Camelina sativa]
Length=235

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 146/240 (61%), Gaps = 17/240 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW--VSQTVNYSSTATGSTACQFEDTEV  804
            ++NW+ D    D  S  +             FSW    Q +  SS ++        ++E 
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQQPIGVSSNSSAGVDVSAGNSEA  56

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  A
Sbjct  57   SKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDKAAILVDA  116

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG-----  459
            VR+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+       
Sbjct  117  VRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNAPQ  176

Query  458  AAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             + F  P   +    + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  PSFFPAPPMMTTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  235



>ref|XP_010443048.1| PREDICTED: transcription factor ILR3 [Camelina sativa]
Length=234

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 146/239 (61%), Gaps = 16/239 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NW+ D    D  S  +             FSW V Q +  SS ++        ++E  
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQPIGVSSNSSVGVDVSAGNSEAN  56

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  AV
Sbjct  57   KEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDKAAILVDAV  116

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG-----A  456
            R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+        
Sbjct  117  RMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNAPQP  176

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + F  P        + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  SFFPAPPMMPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  234



>ref|XP_002304984.1| hypothetical protein POPTR_0004s03190g [Populus trichocarpa]
 gb|EEE85495.1| hypothetical protein POPTR_0004s03190g [Populus trichocarpa]
Length=243

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 152/243 (63%), Gaps = 16/243 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFS-WVSQTVNYSSTATGSTACQFEDTEV  804
            ++NW+ D  +++D+   V       S   T + S W S + N ++  +      FE+++ 
Sbjct  7    NANWVFDCGLIEDVPVPVGEQLCLESLDETPNGSLWSSHSFNDTAFLSAEFNNSFENSDG  66

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE G RKR++  +    GSKACREKMRRD +N+RF+EL ++L+P RPPK DK A+L  A
Sbjct  67   LKEIGFRKRVRHGSGNAPGSKACREKMRRDRLNDRFMELGALLDPGRPPKVDKSAMLVDA  126

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA---  453
             R+VT LR E +KLKES   L EKI ELKAEK ELRDEKQKLK +K  LE Q    +   
Sbjct  127  ARMVTQLRDESQKLKESIESLQEKIDELKAEKNELRDEKQKLKMEKENLEWQQKALSPPP  186

Query  452  -----MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
                   A PA FS P     GQV  G K+MP VGYPG +MWQFM PT+VDTSQDHVL P
Sbjct  187  TYLPHPPAIPAPFSAP-----GQV-VGSKLMPFVGYPGISMWQFMPPTVVDTSQDHVLRP  240

Query  287  PVA  279
            PVA
Sbjct  241  PVA  243



>ref|XP_009393337.1| PREDICTED: transcription factor ILR3-like [Musa acuminata subsp. 
malaccensis]
Length=230

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 147/236 (62%), Gaps = 18/236 (8%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NW +D  ++DDI  A +           DF W  Q  + +S+ +      F +++  KE 
Sbjct  8    NWFLDCSLIDDIPDAGA-----------DFGWNPQGFDPASSVSVEIDSSFVNSDGLKEP  56

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KR + E+C    SKACREKMRR+ +N+RFLEL+S+L+P  PPK DK AILS A R+V
Sbjct  57   GSAKRSRSESCSNPASKACREKMRRERLNDRFLELNSLLDPGNPPKMDKAAILSDAARLV  116

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T LR E +KLKESN  L EKI ELKAEK ELRDEKQKLK ++  LEQQV    + A+ + 
Sbjct  117  TQLRNEAQKLKESNESLQEKIKELKAEKNELRDEKQKLKAERGSLEQQVK--LLNARSSY  174

Query  431  FSHPIL-----NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               P L       +GQ A  K M+P++G+PGF MWQ+M P+ VDTSQD     PVA
Sbjct  175  VPQPPLVPTPYGAQGQAAGHKLMVPIIGFPGFPMWQYMPPSDVDTSQDADKCSPVA  230



>gb|KHN27978.1| Transcription factor ILR3 [Glycine soja]
Length=234

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 147/236 (62%), Gaps = 10/236 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL DY ++DD    V   +SF  SA+  FSW     N S     S      D++  K
Sbjct  6    NSNWLFDYPLIDDDVIPV-GDSSFAVSAST-FSWPPPPANVSVEIDASLG----DSDGPK  59

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            +   +KR + ++   S SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  A R
Sbjct  60   DTALKKRARCDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILIDAAR  119

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMF  447
            +VT LR E  KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE QV   N    F
Sbjct  120  MVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLEMQVKSMNAQPAF  179

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P          +GQ A G K+MP + YPG AMWQFM P  +DTSQDHVL PPVA
Sbjct  180  LPPPPAIPAAFAPQGQ-APGNKLMPFIRYPGVAMWQFMPPATMDTSQDHVLRPPVA  234



>ref|XP_006280790.1| hypothetical protein CARUB_v10026758mg [Capsella rubella]
 gb|EOA13688.1| hypothetical protein CARUB_v10026758mg [Capsella rubella]
Length=332

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/291 (43%), Positives = 163/291 (56%), Gaps = 24/291 (8%)
 Frame = -2

Query  1109  ILLQSVYFWTATLINVA-VKFPPAISNTPYISVPRRKNSRNAME-------TDSNWLIDY  954
             I L   + + ++LI    ++FPP  S  P+             +        ++NW+ D 
Sbjct  52    IWLIKFHLFGSSLIAAGKIQFPPGSSPKPHRLFFLFPPFFTGEKFQEMVSPENANWICDL  111

Query  953   EMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVCKEAGSRKR  777
                D  S  +             FSW V Q +  SS ++        ++E  KE GS+KR
Sbjct  112   IDADYGSFTIQGPG---------FSWPVQQPIGVSSNSSIGVDGSAGNSEASKEPGSKKR  162

Query  776   LKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRT  597
              + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  AVR+VT LR 
Sbjct  163   GRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAILVDAVRMVTQLRG  222

Query  596   EIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN-----GAAMFAKPAS  432
             E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+        + F  P  
Sbjct  223   EAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKTMNAPQPSFFPAPPM  282

Query  431   FSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                   + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  283   MPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  332



>ref|XP_008454558.1| PREDICTED: transcription factor ILR3-like isoform X1 [Cucumis 
melo]
Length=234

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 152/235 (65%), Gaps = 8/235 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  F+W  Q  N +            D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVTSS-SFTWAIQPFNGAHDTGVEIDGSLADVDGRL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E  KLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV   +M A+ 
Sbjct  122  MVNQLRSETHKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVK--SMPAQQ  179

Query  437  ASFSHPILNLEGQ-VAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              F  PI     Q  A G K+ P VGY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  180  PGFLPPIPTFPAQGQAPGNKLFPFVGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_010448513.1| PREDICTED: transcription factor ILR3-like [Camelina sativa]
Length=235

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 145/240 (60%), Gaps = 17/240 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW--VSQTVNYSSTATGSTACQFEDTEV  804
            ++NW+ D    D  S  +             FSW    Q +  SS ++        ++E 
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQQPIGVSSNSSAGVDVSAGNSEA  56

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  A
Sbjct  57   SKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDKAAILVDA  116

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG-----  459
            VR+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+       
Sbjct  117  VRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNAPQ  176

Query  458  AAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             + F  P        + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  PSFFPAPPMMPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  235



>ref|XP_008454561.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=235

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 151/235 (64%), Gaps = 7/235 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  FSW  QT N +            D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVTSS-SFSWAIQTFNGAHDTGVEIDGSLADLDGRL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E +KLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV       +P
Sbjct  122  MVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA-QQP  180

Query  437  ASFSHPILNLEGQ-VAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PI     Q  A G K+ P +GY P  AMWQFM P  VDTSQDH+L PPVA
Sbjct  181  GFLPPPIPTFPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHILRPPVA  235



>ref|XP_004151962.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=235

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 150/235 (64%), Gaps = 7/235 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  FSW  Q  N S  +         D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVTSS-SFSWPIQPFNGSHDSGVEIDGSLADLDGHL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E EKLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV       +P
Sbjct  122  MVNQLRGETEKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA-QQP  180

Query  437  ASFSHPILNLEGQ-VAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PI     Q  A G K+ P +GY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  GFLPPPIPTFPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  235



>gb|KGN57965.1| hypothetical protein Csa_3G415100 [Cucumis sativus]
Length=235

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 151/235 (64%), Gaps = 7/235 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  FSW  Q  N S  +         D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVTSS-SFSWPIQPFNGSHDSGVEIDGSLADLDGHL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E +KLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV       +P
Sbjct  122  MVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA-QQP  180

Query  437  ASFSHPILNLEGQ-VAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PI     Q  A G K+ P +GY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  GFLPPPIPTFPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  235



>emb|CDY42475.1| BnaA10g08510D [Brassica napus]
Length=233

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 139/210 (66%), Gaps = 12/210 (6%)
 Frame = -2

Query  884  FSWV--SQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDL  711
            FSW    Q +  SS     +A    ++E  KE GS+KR + E+   + SKACREK RRD 
Sbjct  28   FSWPLHQQPIGVSSLGVDGSAG---NSEATKEPGSKKRARCESSSATSSKACREKQRRDR  84

Query  710  INERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAE  531
            +N++F+EL +ILEP  PPKTDK AIL  AVR+VT LR E +KLK+SN  L +KI ELK E
Sbjct  85   LNDKFMELGAILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTE  144

Query  530  KMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPIL------NLEGQVAAGKKMMPV  369
            K ELRDEKQ+LK +K KLEQQ+       +P+ F  P +      + +GQ A G KM+PV
Sbjct  145  KNELRDEKQRLKTEKEKLEQQLKAMNAPPQPSFFPAPPMMPTAFASAQGQ-APGNKMVPV  203

Query  368  VGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  204  ISYPGVAMWQFMPPASVDTSQDHVLRPPVA  233



>ref|XP_009120001.1| PREDICTED: transcription factor ILR3-like [Brassica rapa]
Length=233

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 139/210 (66%), Gaps = 12/210 (6%)
 Frame = -2

Query  884  FSWV--SQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDL  711
            FSW    Q +  SS     +A    ++E  KE GS+KR + E+   + SKACREK RRD 
Sbjct  28   FSWPLHQQPIGVSSLGVDGSAG---NSEATKEPGSKKRARCESSSATSSKACREKQRRDR  84

Query  710  INERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAE  531
            +N++F+EL +ILEP  PPKTDK AIL  AVR+VT LR E +KLK+SN  L +KI ELK E
Sbjct  85   LNDKFMELGAILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTE  144

Query  530  KMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPIL------NLEGQVAAGKKMMPV  369
            K ELRDEKQ+LK +K KLEQQ+       +P+ F  P +      + +GQ A G KM+PV
Sbjct  145  KNELRDEKQRLKTEKEKLEQQLKAMNAPPQPSFFPAPPMMPTAFASAQGQ-APGNKMVPV  203

Query  368  VGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  204  ISYPGVAMWQFMPPASVDTSQDHVLRPPVA  233



>ref|XP_010539274.1| PREDICTED: transcription factor ILR3 [Tarenaya hassleriana]
Length=231

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 142/235 (60%), Gaps = 15/235 (6%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVCKE  795
            NWL  Y+++DD S  +             FSW V Q +  SS A+        + E  KE
Sbjct  8    NWL--YDLIDDESFTIQGPG---------FSWPVQQPIGSSSIASAGADGSVSNLETSKE  56

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             GS+KR + E    S SKACREK RRD +N++F+EL SILEP  P KTDK AIL  AVR+
Sbjct  57   PGSKKRGRPELSCASSSKACREKQRRDRLNDKFMELGSILEPGSPLKTDKAAILIDAVRM  116

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMFA  444
            VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ   +N  A F 
Sbjct  117  VTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQMKAMNAQASFF  176

Query  443  KPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                            A G K++P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  PAPPPMPAAFAAAQGQAPGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>emb|CDY41004.1| BnaA02g27940D [Brassica napus]
Length=235

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 150/242 (62%), Gaps = 21/242 (9%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NW+ D    D  S  +             FSW V Q +  SS ++        ++E  
Sbjct  6    NANWISDLIDADYGSFTIQGPG---------FSWPVHQPIAVSSNSSAGVDGSAGNSETS  56

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR + E+   + SKACREK RRD +N++F+ELS ILEP  PPKTDK AIL  AV
Sbjct  57   KEPGSKKRARCESSSATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILVDAV  116

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA-  444
            R+VT LR E +KLK++N  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+   AM A 
Sbjct  117  RMVTQLRGEAQKLKDTNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLK--AMNAP  174

Query  443  KPASFSHPIL-------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPP  285
            +P+ F  P +         +GQ A G KM+P + YPG AMWQFM P  VDTSQDHVL PP
Sbjct  175  QPSFFPAPPMMPTAFTSAAQGQ-APGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRPP  233

Query  284  VA  279
            VA
Sbjct  234  VA  235



>ref|XP_004173321.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=235

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 150/235 (64%), Gaps = 7/235 (3%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  FSW  Q  N +  +         D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVASS-SFSWPIQPFNGAHDSGVEIDGSLADLDGRL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E EKLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV       +P
Sbjct  122  MVNQLRGETEKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA-QQP  180

Query  437  ASFSHPILNLEGQ-VAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PI     Q  A G K+ P +GY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  181  GFLPPPIPTFPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_010062961.1| PREDICTED: transcription factor ILR3-like isoform X1 [Eucalyptus 
grandis]
Length=239

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 160/237 (68%), Gaps = 9/237 (4%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            +NW+ D  ++DDI++A +    F  S +  FSW  Q +N SS  +        D++  KE
Sbjct  7    ANWIYDCGLIDDIAAAAADGGPFQVSGS-GFSWPDQPLNGSSIFSAEIDGSLGDSDGVKE  65

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             GS+KR++ E+C  S SKACREK+RRD +N++FLEL+SILEP RPPKTDK AIL   VR+
Sbjct  66   NGSKKRVRSESCSASSSKACREKLRRDRLNDKFLELASILEPGRPPKTDKAAILIDVVRM  125

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA  435
            VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE Q+   AM A+P+
Sbjct  126  VTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLK--AMNAQPS  183

Query  434  SFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                P         +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  184  FLPPPPAIPAAFATQGQ-APGNKLVPFIGYPGVAMWQFMPPATVDTSQDHVLRPPVA  239



>emb|CDY28758.1| BnaA02g09500D [Brassica napus]
Length=235

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 141/211 (67%), Gaps = 12/211 (6%)
 Frame = -2

Query  884  FSW-VSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLI  708
            FSW V Q +  SS ++        ++E  KE GS+KR + E+   + SKACREK RRD +
Sbjct  28   FSWPVHQPLAVSSNSSAGVDGSAGNSEASKEPGSKKRARCESSSATSSKACREKQRRDRL  87

Query  707  NERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEK  528
            N++F+ELS ILEP  PPKTDK AIL  AVR+VT LR E +KLK++N  L EKI ELK EK
Sbjct  88   NDKFMELSVILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDTNSGLQEKIKELKTEK  147

Query  527  MELRDEKQKLKEDKMKLEQQVNGAAMFA-KPASFSHPIL-------NLEGQVAAGKKMMP  372
             ELRDEKQ+LK +K KLEQQ+   AM A +P+ F  P +         +GQ A G KM+P
Sbjct  148  NELRDEKQRLKTEKEKLEQQLK--AMNAPQPSFFPAPPMMPTAFASAAQGQ-APGNKMVP  204

Query  371  VVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  205  FISYPGVAMWQFMPPASVDTSQDHVLRPPVA  235



>ref|XP_009127072.1| PREDICTED: transcription factor ILR3 [Brassica rapa]
Length=235

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 141/211 (67%), Gaps = 12/211 (6%)
 Frame = -2

Query  884  FSW-VSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLI  708
            FSW V Q +  SS ++        ++E  KE GS+KR + E+   + SKACREK RRD +
Sbjct  28   FSWPVHQPLAVSSNSSAGVDGSAGNSEASKEPGSKKRARCESSSATSSKACREKQRRDRL  87

Query  707  NERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEK  528
            N++F+ELS ILEP  PPKTDK AIL  AVR+VT LR E +KLK++N  L EKI ELK EK
Sbjct  88   NDKFMELSVILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDTNSGLQEKIKELKTEK  147

Query  527  MELRDEKQKLKEDKMKLEQQVNGAAMFA-KPASFSHPIL-------NLEGQVAAGKKMMP  372
             ELRDEKQ+LK +K KLEQQ+   AM A +P+ F  P +         +GQ A G KM+P
Sbjct  148  NELRDEKQRLKTEKEKLEQQLK--AMNAPQPSFFPAPPMMPTAFASATQGQ-APGNKMVP  204

Query  371  VVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  205  FISYPGVAMWQFMPPASVDTSQDHVLRPPVA  235



>gb|KFK27081.1| hypothetical protein AALP_AA8G331500 [Arabis alpina]
Length=234

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 146/239 (61%), Gaps = 16/239 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVC  801
            ++NW+ D    D  S  +             FSW V Q +  SS ++        ++E  
Sbjct  6    NANWICDLIDADYGSFTIQGPG---------FSWPVQQPIGVSSNSSAGVDGSVGNSEAS  56

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR + E+   + SKACREK RRD +N++F+EL +ILEP  PPKTDK AIL  AV
Sbjct  57   KEPGSKKRGRSESSSATSSKACREKQRRDRLNDKFMELGTILEPGNPPKTDKAAILVDAV  116

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG-----A  456
            R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+        
Sbjct  117  RMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNAPQP  176

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + F  P        + +GQ A G KM+P++ YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  SFFPAPPMMPTAFASAQGQ-APGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  234



>ref|NP_175518.1| transcription factor bHLH115 [Arabidopsis thaliana]
 sp|Q9C682.1|BH115_ARATH RecName: Full=Transcription factor bHLH115; AltName: Full=Basic 
helix-loop-helix protein 115; Short=AtbHLH115; Short=bHLH 
115; AltName: Full=Transcription factor EN 134; AltName: Full=bHLH 
transcription factor bHLH115 [Arabidopsis thaliana]
 gb|AAG50538.1|AC079828_9 bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAM10965.1|AF488632_1 putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AAM62840.1| bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAO00793.1| bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAP13381.1| At1g51070 [Arabidopsis thaliana]
 gb|AEE32618.1| transcription factor bHLH115 [Arabidopsis thaliana]
Length=226

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 144/234 (62%), Gaps = 14/234 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY +++   S  + T          F W    ++ S+T +        D +V K
Sbjct  6    NTNWLSDYPLIEGAFSDQNPT----------FPW---QIDGSATVSVEVDGFLCDADVIK  52

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E  SRKR+K E+C  S SKACREK RRD +N++F ELSS+LEP R PKTDK+AI++ A+R
Sbjct  53   EPSSRKRIKTESCTGSNSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAIINDAIR  112

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V   R E +KLK+ N  L EKI ELK EK ELRDEKQKLK +K +++QQ+       +P
Sbjct  113  MVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAIKTQPQP  172

Query  437  ASFSHPILNLEGQVAA-GKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P      Q  A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  173  QPCFLPNPQTLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  226



>ref|XP_006304584.1| hypothetical protein CARUB_v10011628mg [Capsella rubella]
 gb|EOA37482.1| hypothetical protein CARUB_v10011628mg [Capsella rubella]
Length=226

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 145/234 (62%), Gaps = 14/234 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++D + S      SFP        W    ++ SS+ +        D++V K
Sbjct  6    NTNWLSDYPLIDGVFS--DQNPSFP--------W---QIDGSSSVSVEVDGFLCDSDVIK  52

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GS+KR+K E+C  S SKACREK RRD +N++F ELSSILEP R PKTDK++I++ A+R
Sbjct  53   EPGSKKRIKTESCTGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVSIINDAIR  112

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V   R E +KLK+ N  L EKI ELK EK ELRDEK KLK +K ++EQQ+       +P
Sbjct  113  MVNHARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKHKLKTEKERIEQQLKAINTQPQP  172

Query  437  ASFSHPIL-NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P    L    A G K++P   YP FAMWQFM P  VDTSQDHVL PPVA
Sbjct  173  QPCFLPNQPTLSQAQAPGSKLVPFTTYPSFAMWQFMPPAAVDTSQDHVLRPPVA  226



>gb|AES89899.2| BHLH domain class transcription factor [Medicago truncatula]
Length=193

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 132/184 (72%), Gaps = 8/184 (4%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D++  KE+GS+KR++ E+C  + SKACREK+RRD +N++F+EL SILEP RP KTDK AI
Sbjct  13   DSDGLKESGSKKRVRSESCAATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAI  72

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  AVR+VT LR E +KLK++N  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   
Sbjct  73   LIDAVRMVTQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQLK--  130

Query  455  AMFAKPASFSHPI-----LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
            +M A P+    P         +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL 
Sbjct  131  SMNAPPSFLPTPTALPAAFAAQGQ-AHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLR  189

Query  290  PPVA  279
            PPVA
Sbjct  190  PPVA  193



>ref|XP_006837018.1| hypothetical protein AMTR_s00098p00170370 [Amborella trichopoda]
 gb|ERM99871.1| hypothetical protein AMTR_s00098p00170370 [Amborella trichopoda]
Length=224

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 146/241 (61%), Gaps = 30/241 (12%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NW  D  M+DD         +F         W+SQ  N    ++      F+     +
Sbjct  6    NTNWDFDGIMVDD---------AF---------WISQASNGVPNSSVDVNVGFDGPSCNQ  47

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
               SRKR + E C  SGSKACREKMRRD +N+RFLEL +ILEP RPPKTDK  ILS A+R
Sbjct  48   NLCSRKRPRSEPCSGSGSKACREKMRRDRLNDRFLELGAILEPGRPPKTDKATILSDAIR  107

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG------A  456
            V+  L++E  KLKE+N EL EKI +LKAEK ELRDEK +LK DK +LEQQV        +
Sbjct  108  VLNQLQSEARKLKEANDELQEKIKDLKAEKNELRDEKLRLKADKERLEQQVKAINTPPPS  167

Query  455  AMFAKPASFSHPILNLEG-QVAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPV  282
                 P +FS P    +G  V AG KMMP +GY P  AMWQ+M P  VDTSQDHVL PPV
Sbjct  168  PFIPHPMAFSSP----QGPAVGAGAKMMPFMGYQPTVAMWQWMPPAAVDTSQDHVLRPPV  223

Query  281  A  279
            A
Sbjct  224  A  224



>emb|CDY35576.1| BnaC05g27050D [Brassica napus]
Length=228

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 149/237 (63%), Gaps = 18/237 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFE-DTEVC  801
            ++NWL DY ++D + S  S T          F W    ++ S+T T      F  D++V 
Sbjct  6    NTNWLSDYPLIDGVFSHQSPT----------FPW---QIDGSATVTVEEVDGFLCDSDVI  52

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR+K E+     SKA REK RRD +N++F ELSSILEP R PKTDK+AI++  +
Sbjct  53   KEPGSKKRVKSESYAGPSSKASREKQRRDKLNDKFTELSSILEPGRAPKTDKVAIINDVI  112

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAM  450
            R+V   R E ++LK+ N  L EKI ELK EK ELRDEKQKLK +K ++EQQ   +N   +
Sbjct  113  RMVNQARDEAQRLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKDRIEQQLKAINTQPL  172

Query  449  FAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             A+P    +P    + Q A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  173  PAQPCFLPNPPTLSQAQ-APGSKLVPYTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  228



>gb|AFK34442.1| unknown [Lotus japonicus]
Length=226

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 154/233 (66%), Gaps = 14/233 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            DS WL DY   DDIS  V+A A F  + + DF+WV   +N           ++       
Sbjct  8    DSCWLYDYGF-DDIS--VAAAADFMVADSADFTWVPSNMNLE--------MEYSLDSTVF  56

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+G  KRL+ E+ + SGSKACREK+RRD +NERFLEL SILEP R PKTDK AI+S AVR
Sbjct  57   ESGPSKRLRTESSV-SGSKACREKLRRDKLNERFLELGSILEPGRQPKTDKAAIISDAVR  115

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            VVT LR E EKLKE N +L EKI ELKAEK E+RDEK KLK DK KLE++V    +  +P
Sbjct  116  VVTQLRNEAEKLKEMNNDLQEKIKELKAEKNEIRDEKNKLKLDKEKLEKKVKLRNV--QP  173

Query  437  ASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                H    ++G+ AA  K++P +GYPG AMWQFM   ++DTS+DH+L PPVA
Sbjct  174  GFLPHADAAVKGKGAASHKLIPYIGYPGIAMWQFMPSAVLDTSRDHLLRPPVA  226



>ref|XP_010479562.1| PREDICTED: transcription factor bHLH115-like [Camelina sativa]
Length=227

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 144/233 (62%), Gaps = 15/233 (6%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NWL DY ++D   S  + T          F W    ++ SS+ +        D++V KE 
Sbjct  8    NWLSDYPLIDSAFSDQNPT----------FPW---QIDGSSSVSVEVDGFLCDSDVDKEP  54

Query  791  GSRKRLKLETCIP-SGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
            GSRKR+K E+C   S SKACREK RRD +N++F ELSSILEP R PKTDK+AI++ A+R+
Sbjct  55   GSRKRIKTESCTAGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVAIINDAIRM  114

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA  435
            V   R E +KLK+ N  L +KI ELK EK ELRDEK KLK +K ++EQQ+       +P 
Sbjct  115  VNHARDEAQKLKDLNSSLQDKIKELKNEKSELRDEKHKLKIEKERIEQQLKEIKTQHQPQ  174

Query  434  SFSHP-ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            S   P    L    A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  175  SCFLPNPPTLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  227



>ref|XP_010461939.1| PREDICTED: transcription factor bHLH115 [Camelina sativa]
Length=226

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 145/234 (62%), Gaps = 14/234 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++D   S  + T          F W    ++ SS+ +        D++V K
Sbjct  6    NTNWLSDYPLIDGAFSDHNPT----------FPW---QIDGSSSVSVEVDGFLCDSDVIK  52

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E GSRKR+K E+C  S SKACREK RRD +N++F ELSSILEP R PKT+K+AI++ A+R
Sbjct  53   EPGSRKRIKTESCTGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTEKVAIINDAIR  112

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V   R E +KLK+ N  L EKI ELK EK ELRDEK KLK +K ++EQQ+       +P
Sbjct  113  MVNHARDEAQKLKDLNSSLQEKIKELKDEKSELRDEKHKLKIEKERIEQQLKEIKTQPQP  172

Query  437  ASFSHPILNLEGQVAA-GKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 P      Q  A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  173  PPCFLPNPPTLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  226



>ref|XP_010647171.1| PREDICTED: transcription factor ILR3-like isoform X3 [Vitis vinifera]
Length=211

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 147/240 (61%), Gaps = 38/240 (16%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDIS-SAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTE  807
            E D NW+ DY ++DD+   ++ AT ++PS    DF+        +S A G          
Sbjct  5    EEDPNWIFDYGLIDDVPVPSLQATFNWPSH---DFT--------ASAALG----------  43

Query  806  VCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
                      ++   C  SGSKACREK+RRD +N+RFLEL SILEP RPPK DK  ILS 
Sbjct  44   ----------MRSGLCSASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILSD  93

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG----  459
            A+R++T LR+E +KLK+S  +L EKI+ELKAEK ELRDEKQ+LK +K  + QQ+      
Sbjct  94   ALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSSQ  153

Query  458  AAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            A     P++   P     GQV  G K+MP +GYPG +MWQFM P  VDTSQDHVL PPVA
Sbjct  154  AGFLPHPSAIPAP-FAAPGQV-VGSKLMPFIGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  211



>emb|CDY47456.1| BnaC09g31010D [Brassica napus]
Length=233

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 137/210 (65%), Gaps = 12/210 (6%)
 Frame = -2

Query  884  FSWV--SQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDL  711
            FSW    Q +  SS     +A    ++E  KE  S+KR + ++   + SKACREK RRD 
Sbjct  28   FSWPVHQQPIGVSSVGVDGSAG---NSEATKEPVSKKRARCDSSSATSSKACREKQRRDR  84

Query  710  INERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAE  531
            +N++F ELS ILEP  PPKTDK AIL  AVR+VT LR E +KLK+SN  L  KI+ELK E
Sbjct  85   LNDKFTELSVILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDSNSSLQGKINELKTE  144

Query  530  KMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPIL------NLEGQVAAGKKMMPV  369
            K ELRDEKQ+LK +K KLEQQ+       +P+ F  P +      + +GQ A G KM+PV
Sbjct  145  KNELRDEKQRLKTEKEKLEQQLKAMNAPPQPSFFPGPPMMPTAFASAQGQ-APGNKMVPV  203

Query  368  VGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  204  ISYPGVAMWQFMPPASVDTSQDHVLRPPVA  233



>ref|XP_008776472.1| PREDICTED: transcription factor ILR3-like [Phoenix dactylifera]
Length=237

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 144/234 (62%), Gaps = 7/234 (3%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            NW +D  ++DD+    +  A+     T   +W  Q  N     +        +++  KE 
Sbjct  8    NWFLDCPLIDDMPVPETDFAA----PTGGLNWNPQGFNPYPDVSVEINGSIANSDGHKEP  63

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS+KR++ E+C    SKACREKMRRD +NERFL+LSSIL+P +PPK DK  IL+ AV +V
Sbjct  64   GSQKRMRSESCSGPSSKACREKMRRDRLNERFLDLSSILDPGKPPKMDKATILNDAVHMV  123

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ---VNGAAMFAK  441
            T LRTE +KLKESN  L +KI+ELKAEK ELRDEKQ+LK +K  LEQQ   +N    +  
Sbjct  124  TQLRTEAQKLKESNESLQDKINELKAEKSELRDEKQRLKAEKESLEQQLKLLNPQPSYVP  183

Query  440  PASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P        + +GQ    K MMPV+ +PGF MWQFM P  VDTS+D    PPVA
Sbjct  184  PPPVMPAAFSAQGQPTGQKLMMPVISFPGFPMWQFMPPADVDTSKDAETCPPVA  237



>ref|XP_007025918.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY28540.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
Length=229

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 143/241 (59%), Gaps = 32/241 (13%)
 Frame = -2

Query  983  ETDSNWLID-YEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTE  807
            E  S W+ D Y +++DI        S   +A I   W SQ++  S+              
Sbjct  15   ENPSGWIFDDYGLLEDIPVPGGDLPSLDPAAPI---WSSQSLTCSTPPL-----------  60

Query  806  VCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
                     R +  +C  SGSKACREKMRRD +N+RFLEL SIL+P RP K DK  IL  
Sbjct  61   ---------RARSGSCSASGSKACREKMRRDRLNDRFLELGSILDPGRPLKVDKAVILVD  111

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF  447
            AVR+VT LR E +KL+ESN  L EKI+ELKAEK ELRDEKQ+LK +K  LEQQV   A+ 
Sbjct  112  AVRMVTQLRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKENLEQQVK--ALG  169

Query  446  AKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPV  282
             +P    HP       +  GQV  G K++P VGYPG +MWQF+ P  VDTSQDH+L PPV
Sbjct  170  TQPGFLPHPPAIPTPFSTPGQVVGG-KLVPFVGYPGVSMWQFLPPASVDTSQDHILRPPV  228

Query  281  A  279
            A
Sbjct  229  A  229



>ref|XP_010647172.1| PREDICTED: transcription factor ILR3-like isoform X4 [Vitis vinifera]
Length=199

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 135/194 (70%), Gaps = 18/194 (9%)
 Frame = -2

Query  824  QFEDTEV----CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPP  657
            +F+D+ V     KE  SRKR++   C  SGSKACREK+RRD +N+RFLEL SILEP RPP
Sbjct  12   EFDDSPVNLDDVKENHSRKRMRSGLCSASGSKACREKVRRDRLNDRFLELGSILEPGRPP  71

Query  656  KTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKL  477
            K DK  ILS A+R++T LR+E +KLK+S  +L EKI+ELKAEK ELRDEKQ+LK +K  +
Sbjct  72   KMDKAVILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENI  131

Query  476  EQQVNG---AAMF-----AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTI  321
             QQ+      A F     A PA F+ P     GQV  G K+MP +GYPG +MWQFM P  
Sbjct  132  VQQIKALSSQAGFLPHPSAIPAPFAAP-----GQV-VGSKLMPFIGYPGVSMWQFMPPAA  185

Query  320  VDTSQDHVLHPPVA  279
            VDTSQDHVL PPVA
Sbjct  186  VDTSQDHVLRPPVA  199



>ref|XP_009144925.1| PREDICTED: transcription factor bHLH115 [Brassica rapa]
Length=225

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 149/235 (63%), Gaps = 17/235 (7%)
 Frame = -2

Query  977  DSNWLIDYEMM-DDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFE-DTEV  804
            ++NWL DY ++ D + S  S T          F W  Q    ++T +      F  D++V
Sbjct  6    NTNWLSDYPLLIDGVFSHHSPT----------FPW--QIDGSATTVSVEEVDGFLCDSDV  53

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR+K E+     SKACREK RRD +NE+F ELSS+LEP R PKTDK+AI++ A
Sbjct  54   IKEPGSKKRVKSESNAGPSSKACREKQRRDKLNEKFTELSSVLEPGRAPKTDKVAIINDA  113

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +R+V   R E ++LK+ N  L EKI ELK EK ELRDEKQKLK +K ++EQQ+   A+  
Sbjct  114  IRMVNQARDEAQRLKDLNSNLQEKIKELKDEKNELRDEKQKLKTEKDRIEQQLK--AINT  171

Query  443  KPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P    +P    + Q A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  172  QPCFLPNPPTLSQAQ-APGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  225



>ref|XP_004232754.1| PREDICTED: transcription factor ILR3 [Solanum lycopersicum]
Length=230

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 149/240 (62%), Gaps = 20/240 (8%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            E  SNWLI+  +M+D+ S +   A +PS+A       S   N SS    S    + +++ 
Sbjct  6    EDGSNWLIELGLMEDLPS-LEPNAQWPSNA------FSLPNNLSSGLEDS----YGNSDS  54

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR++   C  S SKA REKMRRD +N+RF ELSSILEP + PK DK  IL  A
Sbjct  55   LKECGSKKRVRSGACA-SDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILGDA  113

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+V  LR E +KLKESN  L EK+ ELKAEK ELRDEKQKLK +K KLEQ +   AM  
Sbjct  114  VRMVVQLRDEAQKLKESNNNLQEKVIELKAEKNELRDEKQKLKAEKDKLEQHLK--AMNT  171

Query  443  KPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P    HP       +   QV A  KMMP +GYPG  MWQF+ P  VDTS+DH L PPVA
Sbjct  172  QPGFLPHPPAMPSPFSAPHQVFAS-KMMPYIGYPGIPMWQFVPPAAVDTSEDHSLRPPVA  230



>ref|XP_010647170.1| PREDICTED: transcription factor ILR3-like isoform X2 [Vitis vinifera]
 emb|CBI33226.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 136/194 (70%), Gaps = 18/194 (9%)
 Frame = -2

Query  824  QFEDTEV----CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPP  657
            +F+D+ V     KE  SRKR++   C  SGSKACREK+RRD +N+RFLEL SILEP RPP
Sbjct  38   EFDDSPVNLDDVKENHSRKRMRSGLCSASGSKACREKVRRDRLNDRFLELGSILEPGRPP  97

Query  656  KTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKL  477
            K DK  ILS A+R++T LR+E +KLK+S  +L EKI+ELKAEK ELRDEKQ+LK +K  +
Sbjct  98   KMDKAVILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENI  157

Query  476  EQQV---NGAAMF-----AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTI  321
             QQ+   +  A F     A PA F+ P     GQV  G K+MP +GYPG +MWQFM P  
Sbjct  158  VQQIKALSSQAGFLPHPSAIPAPFAAP-----GQV-VGSKLMPFIGYPGVSMWQFMPPAA  211

Query  320  VDTSQDHVLHPPVA  279
            VDTSQDHVL PPVA
Sbjct  212  VDTSQDHVLRPPVA  225



>emb|CDY71937.1| BnaA05g35780D, partial [Brassica napus]
Length=219

 Score =   199 bits (505),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 148/234 (63%), Gaps = 17/234 (7%)
 Frame = -2

Query  974  SNWLIDYEMM-DDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFE-DTEVC  801
            +NWL DY ++ D + S  S T          F W  Q    ++T +      F  D++V 
Sbjct  1    TNWLSDYPLLIDGVFSHHSPT----------FPW--QIDGSATTVSVEEVDGFLCDSDVI  48

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KR+K E+     SKACREK RRD +N++F ELSSILEP R PKTDK+AI++ A+
Sbjct  49   KEPGSKKRVKSESNAGPSSKACREKQRRDKLNDKFTELSSILEPGRAPKTDKVAIINDAI  108

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V   R E ++LK+ N  L EKI ELK EK ELRDEKQKLK +K ++EQQ+   A+  +
Sbjct  109  RMVNQARDEAQRLKDLNSNLQEKIKELKDEKNELRDEKQKLKTEKDRIEQQLK--AINTQ  166

Query  440  PASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P    +P    + Q A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  167  PCFLPNPPTLSQAQ-APGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  219



>ref|NP_001239799.1| uncharacterized protein LOC100813088 [Glycine max]
 gb|ACU21616.1| unknown [Glycine max]
Length=233

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 145/236 (61%), Gaps = 11/236 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL DY ++DD+   +    +  S +   FSW     N S     S      D++  K
Sbjct  6    NSNWLFDYPLIDDV---IPVGDASFSVSASAFSWPPPPANVSVEIDASLG----DSDGPK  58

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            +   +KR + ++   S SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  A R
Sbjct  59   DTALKKRARCDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILIDAAR  118

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMF  447
            +VT LR E  KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE QV   N    F
Sbjct  119  MVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLEMQVKSMNAQPAF  178

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P          +GQ A G K+MP + YPG AMWQFM P  +DTSQDHVL PPVA
Sbjct  179  LPPPPAIPAAFAPQGQ-APGNKLMPFIRYPGVAMWQFMPPATMDTSQDHVLRPPVA  233



>gb|KGN57970.1| hypothetical protein Csa_3G416140 [Cucumis sativus]
Length=230

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 149/234 (64%), Gaps = 10/234 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NWL DY +++DI        +FP +++  FSW  Q  N S  +         D +   
Sbjct  6    NPNWLFDYGLIEDIPVP---DGNFPVTSS-SFSWPIQPFNGSHDSGVEIDGSLADLDGRL  61

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR
Sbjct  62   ESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVR  121

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E +KLKESN  L EKI ELKAEK    +EKQ+LK DK +LEQQV       +P
Sbjct  122  MVNQLRSETQKLKESNSSLQEKIKELKAEK----NEKQRLKADKERLEQQVKSIPA-QQP  176

Query  437  ASFSHPILNLEGQVAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                 PI     Q  AG K++P +GY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  177  GFLPPPIPTFPAQGQAGNKLVPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  230



>ref|XP_010500676.1| PREDICTED: transcription factor bHLH115-like [Camelina sativa]
Length=227

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 143/235 (61%), Gaps = 15/235 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++D   S      SFP        W     +  S       C   D++V K
Sbjct  6    NTNWLSDYPLVDGAFS--DHNPSFP--------WQIDVSSSVSVEVDGFLC---DSDVIK  52

Query  797  EAGSRKRLKLETCIP-SGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            E GSRKR+K E+C   S SKACREK RRD +N++F ELSSILEP R PKTDK+AI++ A+
Sbjct  53   EPGSRKRIKTESCTAGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVAIINDAI  112

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V   R E +KLK+ N  L EKI E+K EK ELRDEK KLK +K ++EQQ+       +
Sbjct  113  RMVNHARDEAQKLKDLNSSLQEKIKEVKDEKSELRDEKHKLKIEKERMEQQLKEIKTQPQ  172

Query  440  PASFSHP-ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P     P   +L    A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  173  PQPCFLPNPPSLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  227



>ref|XP_006365882.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=230

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 149/240 (62%), Gaps = 20/240 (8%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            E  SNWLI+  +M+D+ S +   A +PS+A       S   N SS    S    + +++ 
Sbjct  6    EDGSNWLIELGLMEDLPS-LEPNAQWPSNA------FSIPNNLSSGLEDS----YGNSDS  54

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             KE GS+KR++   C  S SKA REKMRRD +N+RF ELSSILEP + PK DK  IL  A
Sbjct  55   LKECGSKKRVRSGACA-SDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILGDA  113

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+V  LR E +KLKESN  L EK+ ELKAEK ELRDEKQKLK +K KLEQ +   AM  
Sbjct  114  VRMVVQLRDEAQKLKESNNNLQEKVIELKAEKNELRDEKQKLKAEKDKLEQHLK--AMNT  171

Query  443  KPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P    HP       +   QV A  KMMP +GYPG  MWQF+ P  VDTS+DH L PPVA
Sbjct  172  QPGFLPHPPAMPSPFSAPHQVFAS-KMMPYLGYPGIPMWQFVPPAAVDTSEDHSLRPPVA  230



>ref|NP_001242620.1| uncharacterized protein LOC100806838 [Glycine max]
 gb|ACU21305.1| unknown [Glycine max]
Length=231

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 150/231 (65%), Gaps = 10/231 (4%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
             WL  Y    DI  A S    F +S +  FSW  Q+ N+   +  S   ++    +  E 
Sbjct  11   GWLYVYGF--DIPVAGS---DFMASDSGGFSWGPQSYNFKGPSNMSLEMEYSLDSIVMEN  65

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            G  KRL+ E+C  SGSKACREK+RRD +NERFLELSSILEP R PKTDK+A+LS A RVV
Sbjct  66   GPSKRLRTESCA-SGSKACREKLRRDKLNERFLELSSILEPGRQPKTDKVALLSDAARVV  124

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
              LR E E+LKE N EL  K+ ELK EK ELRDEK +LKE+K KLE+QV    +  +P S
Sbjct  125  IQLRNEAERLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEKQVKLTNI--QP-S  181

Query  431  FSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            F     + +GQV +  K++P +GYPG AMWQFM P  VDTS+DH+L PPVA
Sbjct  182  FLPQAPDAKGQVGS-HKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  231



>ref|XP_009617474.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=230

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 150/240 (63%), Gaps = 20/240 (8%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            E  SNWL++  +M+D+ S +   A +PS+A       S   N SS    S    +++++ 
Sbjct  6    EDGSNWLLELGLMEDLPS-LEPNAQWPSTA------FSLPNNLSSGLDDS----YDNSDS  54

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             K+ GS+KR +   C  S SKA REKMRRD +N+RF ELSSILEP + PK DK  ILS A
Sbjct  55   LKDCGSKKRARSGACA-SDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILSDA  113

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+V  LR E +KLKES   L EK++ELKAEK ELRDEKQKLK +K KLEQQ+      A
Sbjct  114  VRMVVQLRDEAQKLKESYDNLQEKVNELKAEKNELRDEKQKLKAEKDKLEQQLK--TTNA  171

Query  443  KPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P    HP       +   QV A  KMMP +GYPG  MWQF+ P  VDTS+DH L PPVA
Sbjct  172  QPGFLPHPPAMASPFSAPHQVYAS-KMMPYLGYPGIPMWQFVPPAAVDTSEDHALRPPVA  230



>ref|XP_002518568.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43955.1| DNA binding protein, putative [Ricinus communis]
Length=229

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 149/242 (62%), Gaps = 28/242 (12%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYS-STATGSTACQFEDTEVC  801
            ++NW  DY +++DI          PS   +D  W S +++     + GS+ C        
Sbjct  7    NANWAFDYGLIEDIPVP---GGDLPS---LDPLWSSPSLSVEFDDSLGSSQC-------L  53

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            ++ GSRKR++  +C   GSKACREKMRRD +N+RF+EL ++L+P RPPK DK  IL+ A+
Sbjct  54   RDNGSRKRVRPGSCSGLGSKACREKMRRDKLNDRFMELGALLDPGRPPKMDKSVILADAM  113

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            ++V  LR E +KLKESN  L EK++ELK EK ELRDEKQ+LK +K  +E+QVN  +  A+
Sbjct  114  KMVNQLRAEAQKLKESNENLQEKVNELKVEKNELRDEKQRLKTEKESIERQVNALSASAR  173

Query  440  --------PASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPP  285
                    PA FS P      QV  G K++P+VGYPG  MWQ M P  VDTSQD VL  P
Sbjct  174  FLPHLPAIPAPFSSP-----SQV-IGSKLVPIVGYPGVPMWQLMPPATVDTSQDPVLRSP  227

Query  284  VA  279
             A
Sbjct  228  AA  229



>ref|XP_003597042.1| Transcription factor ILR3 [Medicago truncatula]
 gb|AES67293.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK41880.1| unknown [Medicago truncatula]
Length=260

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 156/255 (61%), Gaps = 31/255 (12%)
 Frame = -2

Query  968  WLIDYEMMDDIS-SAVSATASFPSSATIDFSWV----SQT-------------VNYS---  852
            WL DY   DDIS SA    AS  S+A   F+W+    SQT             ++YS   
Sbjct  12   WLYDYGY-DDISISAADFMASDSSAAASTFTWMPQPQSQTQIINPPSSHMSLEMDYSLDS  70

Query  851  ----STATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELS  684
                S  +     ++       E G  KRL+ E+   S SKA REK+RRD +N+RF+ELS
Sbjct  71   TVMESNPSKRMEMEYSLDSTVLENGPSKRLRTESYA-SSSKAGREKVRRDKLNDRFMELS  129

Query  683  SILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQ  504
            S+LEP   PKTDK+++L+ AVRVVT LR E E+LKE N EL EK+ ELKAEK ELRDEK 
Sbjct  130  SVLEPDTLPKTDKVSLLNDAVRVVTQLRNEAERLKERNDELREKVKELKAEKKELRDEKN  189

Query  503  KLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPT  324
            KLK DK KLEQQV  A++    ++F    +  +GQ  A  K+MP +GYPG +MWQFM P 
Sbjct  190  KLKLDKEKLEQQVKLASV---QSNFLSNAMAAKGQT-ANHKLMPFIGYPGISMWQFMSPA  245

Query  323  IVDTSQDHVLHPPVA  279
             VDTSQDH+L PPVA
Sbjct  246  TVDTSQDHLLRPPVA  260



>ref|XP_009772342.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=230

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 149/240 (62%), Gaps = 20/240 (8%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            E  SNWLI+  +M+D+ S +   A +PS+A       S   N SS    S    + +++ 
Sbjct  6    EDGSNWLIELGLMEDLPS-LEPNAQWPSTA------FSLPNNLSSGLDDS----YGNSDS  54

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             K+ GS+KR +   C  S SKA REKMRRD +N+RF ELSSILEP + PK DK  ILS A
Sbjct  55   LKDCGSKKRARSGACA-SDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILSDA  113

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            VR+V  LR E +KL+ES   L EK++ELKAEK ELRDEKQKLK +K KLEQQ+      A
Sbjct  114  VRMVVQLRDEAQKLRESYDNLQEKVNELKAEKNELRDEKQKLKAEKDKLEQQLK--TTNA  171

Query  443  KPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P    HP       +   QV +  KMMP +GYPG  MWQF+ P  VDTS+DH L PPVA
Sbjct  172  QPGFLPHPPAMASPFSAPHQVYSS-KMMPYLGYPGIPMWQFVPPAAVDTSEDHALRPPVA  230



>gb|ACG38605.1| bHLH transcription factor [Zea mays]
Length=253

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 150/247 (61%), Gaps = 20/247 (8%)
 Frame = -2

Query  980  TDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            T  +W +D  ++DD+ +A  A  +FP  A+   S  + +V   S    + A + E  +V 
Sbjct  14   TGDDWFLDCGILDDLPAA--ACGAFPWDASPSSS--NPSVEVGSYVNANDAFK-EPNDVF  68

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS KRL+  +     SKACRE+MRR+ +N+RFLEL S LEP +P K DK AILS A 
Sbjct  69   KEPGSSKRLRSGSSDMPTSKACRERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDAT  128

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V  LR+E ++LKE+N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + 
Sbjct  129  RMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMASA  186

Query  440  PASFSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
            PA   HP L             + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D 
Sbjct  187  PAYMPHPTLMPAPFAQAPLTPFHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDS  246

Query  299  VLHPPVA  279
               PPVA
Sbjct  247  EACPPVA  253



>ref|XP_008677332.1| PREDICTED: LOC100284429 isoform X1 [Zea mays]
 gb|ACF84747.1| unknown [Zea mays]
 gb|AFW61271.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04286.1| bHLH transcription factor, partial [Zea mays]
Length=253

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 150/247 (61%), Gaps = 20/247 (8%)
 Frame = -2

Query  980  TDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            T  +W +D  ++DD+ +A  A  +FP  A+   S  + +V   S    + A + E  +V 
Sbjct  14   TGDDWFLDCGILDDLPAA--ACGAFPWDASPSSS--NPSVEVGSYVNANDAFK-EPNDVF  68

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS KRL+  +     SKACRE+MRR+ +N+RFLEL S LEP +P K DK AILS A 
Sbjct  69   KEPGSSKRLRSGSSDMPTSKACRERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDAT  128

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V  LR+E ++LKE+N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + 
Sbjct  129  RMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMASA  186

Query  440  PASFSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
            PA   HP L             + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D 
Sbjct  187  PAYMPHPTLMPAPFAQAPLAPFHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDS  246

Query  299  VLHPPVA  279
               PPVA
Sbjct  247  EACPPVA  253



>gb|KHG21334.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=238

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 153/236 (65%), Gaps = 18/236 (8%)
 Frame = -2

Query  962  IDYE-MMDDISSAVSATASFPSSATIDFSWVSQTVNY-SSTATGSTACQFEDTEVCKEAG  789
             DY  ++DDI          P      F+W +Q ++  S+  +      F D++  KE+G
Sbjct  13   FDYATLIDDIP--------VPDDPYAGFAWSTQPIDAPSNVVSVEIDGSFGDSDGLKESG  64

Query  788  SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVT  609
            S+KR++ E+C  S SKACREK+RRD +N++F+EL SILEP RPPKTDK AIL  AVR+VT
Sbjct  65   SKKRVRSESCSASSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSAILIDAVRMVT  124

Query  608  SLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA--  435
             LR E +KLK+SN  L E+I ELKAEK ELRDEKQ+LK +K +LEQQ+   AM A+P+  
Sbjct  125  QLRGEAQKLKDSNTSLQERIKELKAEKNELRDEKQRLKAEKERLEQQLK--AMNAQPSFM  182

Query  434  ----SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                S            A G K++P++GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  183  PPAPSAIPAAFAAAPGQAPGNKLVPLIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_003543288.1| PREDICTED: transcription factor ILR3-like isoform 1 [Glycine 
max]
Length=234

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 146/236 (62%), Gaps = 10/236 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL DY ++DD    V   +SF  SA+  FSW     N S     S      D++  K
Sbjct  6    NSNWLFDYPLIDDDVIPV-GDSSFAVSAST-FSWPPPPANVSVEIDASLG----DSDGLK  59

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
                +KR K ++   S SKACREK+RRD +N++F+EL SILEP RPPKTDK +IL  A R
Sbjct  60   NPALKKRTKSDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKASILIDAAR  119

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMF  447
            +VT LR E  KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE QV   N    F
Sbjct  120  MVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLEVQVKSMNAQPAF  179

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P          +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  180  LPPPPAIPAAFAPQGQ-APGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>gb|KHN36734.1| Transcription factor ILR3 [Glycine soja]
Length=234

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 146/236 (62%), Gaps = 10/236 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            +SNWL DY ++DD    V   +SF  SA+  FSW     N S     S      D++  K
Sbjct  6    NSNWLFDYPLIDDDVIPV-GDSSFAVSAST-FSWPPPPANVSVEIDTSLG----DSDGLK  59

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
                +KR K ++   S SKACREK+RRD +N++F+EL SILEP RPPKTDK +IL  A R
Sbjct  60   NPALKKRTKSDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKASILIDAAR  119

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV---NGAAMF  447
            +VT LR E  KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE QV   N    F
Sbjct  120  MVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLEVQVKSMNAQPAF  179

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P          +GQ A G K++P + YPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  180  LPPPPAIPAAFAPQGQ-APGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>emb|CDY43809.1| BnaC03g14420D [Brassica napus]
Length=238

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 149/245 (61%), Gaps = 24/245 (10%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSW-----VSQTVNYSSTATGSTACQFED  813
            + NW+ D   + D     S T   P      FSW     +  + N SS     +A     
Sbjct  6    NGNWICD---LIDADYGGSFTIQGPG-----FSWPLHQPIGVSSNNSSVGVDGSAGS---  54

Query  812  TEVCKEAG-SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            +E  KE   SRKR + E+   + SKACREK RRD +N++F+EL+ ILEP  PPKTDK AI
Sbjct  55   SEASKEPPVSRKRSRCESSSATNSKACREKQRRDRLNDKFMELAVILEPGHPPKTDKAAI  114

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  A+R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLEQQ+   
Sbjct  115  LVDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKDKLEQQLKAM  174

Query  455  AMFAKPASF-SHPIL-----NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVL  294
                +P+ F + P++     + +GQ A G KM+P + YPG AMWQFM P  VDTSQDHVL
Sbjct  175  NAPPQPSFFPASPMMPTAFASAQGQ-APGNKMVPFISYPGVAMWQFMPPASVDTSQDHVL  233

Query  293  HPPVA  279
             PPVA
Sbjct  234  RPPVA  238



>ref|XP_003547112.1| PREDICTED: transcription factor ILR3-like [Glycine max]
Length=212

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 147/234 (63%), Gaps = 23/234 (10%)
 Frame = -2

Query  980  TDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            ++SNW++DY+ +D+I          P +     ++   + +   T +      F   +  
Sbjct  2    SNSNWVLDYDYLDNI----------PLTTLEPPNFSWSSSSPPPTLSVELDDSFGILDGL  51

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE  SRKRL+     PS SKACREKMRRD +N+RF+EL SIL+P +P K DK  ILS AV
Sbjct  52   KENRSRKRLR-----PSDSKACREKMRRDRLNDRFMELGSILDPRKPLKMDKAVILSDAV  106

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            RVV+ LR E +KL+ES   L EKI+ LK EK ELRDEKQ+LK +K  LEQ+V   A+ ++
Sbjct  107  RVVSQLREEAQKLRESTENLQEKINALKDEKNELRDEKQRLKVEKENLEQKVK--ALSSQ  164

Query  440  PASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P+      L   GQV  G K++P +GYPG AMWQF+ P  VDTSQDHVL PPVA
Sbjct  165  PS-----FLAAAGQV-VGSKLVPFMGYPGVAMWQFLSPAAVDTSQDHVLRPPVA  212



>emb|CAN70830.1| hypothetical protein VITISV_005283 [Vitis vinifera]
Length=384

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 137/232 (59%), Gaps = 38/232 (16%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPS-SATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            +SNWL DY +M+DI+        FP  +    FSW SQ +  SS+ +    C F D++  
Sbjct  8    NSNWLFDYGLMEDITVP---GGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGDSDGL  64

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE G RKR                          FLEL SILEP RPPKTDK AILS AV
Sbjct  65   KELGPRKR--------------------------FLELGSILEPGRPPKTDKAAILSDAV  98

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+VT LR+E +KLKESN +L EKI ELKAEK ELRDEKQ+LK +K KLEQQV   A+ A+
Sbjct  99   RMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVK--AISAQ  156

Query  440  PASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
            P    HP         +G+ A G K+MP +GYP  AMWQFM P  VDTSQDH
Sbjct  157  PGFLPHPSAMPAAFAAQGR-APGNKLMPFIGYPSVAMWQFMPPAAVDTSQDH  207



>gb|KHN25765.1| Transcription factor ILR3 [Glycine soja]
Length=239

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 150/239 (63%), Gaps = 18/239 (8%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
             WL DY    DI  A S    F +S +  FSW  Q+ N+   +  S   ++       E 
Sbjct  11   GWLYDYGF--DIPVAGS---DFMASDSGGFSWGPQSYNFKGPSNMSLEMEYSLDSTVMEN  65

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINER--------FLELSSILEPTRPPKTDKIAI  636
            G  KRL+ E+C  SGSKACREK+RRD +NER        FLELSSILEP R PKTDK+A+
Sbjct  66   GPSKRLRTESCA-SGSKACREKLRRDKLNERHAIILHIVFLELSSILEPGRQPKTDKVAL  124

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            LS A RVV  LR E E+LKE N EL  K+ ELK EK ELRDEK +LKE+K KLE+QV   
Sbjct  125  LSDAARVVIQLRNEAERLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEKQVKLT  184

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             +  +P SF     + +GQV +  K++P +GYPG AMWQFM P  VDTS+DH+L PPVA
Sbjct  185  NI--QP-SFLPQAPDAKGQVGS-HKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  239



>ref|NP_001185192.1| transcription factor bHLH115 [Arabidopsis thaliana]
 gb|AEE32619.1| transcription factor bHLH115 [Arabidopsis thaliana]
Length=292

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 1/180 (1%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D +V KE  SRKR+K E+C  S SKACREK RRD +N++F ELSS+LEP R PKTDK+AI
Sbjct  113  DADVIKEPSSRKRIKTESCTGSNSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAI  172

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            ++ A+R+V   R E +KLK+ N  L EKI ELK EK ELRDEKQKLK +K +++QQ+   
Sbjct  173  INDAIRMVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAI  232

Query  455  AMFAKPASFSHPILNLEGQVAA-GKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                +P     P      Q  A G K++P   YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  233  KTQPQPQPCFLPNPQTLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  292



>ref|XP_007025917.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28539.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=287

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 152/279 (54%), Gaps = 50/279 (18%)
 Frame = -2

Query  983  ETDSNWLID-YEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQ-FEDT  810
            E  S W+ D Y +++DI        S   +A I   W SQ++  S+        + F ++
Sbjct  15   ENPSGWIFDDYGLLEDIPVPGGDLPSLDPAAPI---WSSQSLTCSTPPLSVEFNESFGNS  71

Query  809  EVCKEAGSRKR------LKLETCIP----------------------------SGSKACR  732
            +   E G RKR      L    C P                            SGSKACR
Sbjct  72   DSLNETGFRKRYTATQPLTFFYCFPLLCFRNAVSALASAPIYCFRARSGSCSASGSKACR  131

Query  731  EKMRRDLINER---FLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLEL  561
            EKMRRD +N+R   FLEL SIL+P RP K DK  IL  AVR+VT LR E +KL+ESN  L
Sbjct  132  EKMRRDRLNDRHVLFLELGSILDPGRPLKVDKAVILVDAVRMVTQLRDEAQKLRESNESL  191

Query  560  VEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHP-----ILNLEGQV  396
             EKI+ELKAEK ELRDEKQ+LK +K  LEQQV   A+  +P    HP       +  GQV
Sbjct  192  QEKINELKAEKNELRDEKQRLKTEKENLEQQVK--ALGTQPGFLPHPPAIPTPFSTPGQV  249

Query  395  AAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              G K++P VGYPG +MWQF+ P  VDTSQDH+L PPVA
Sbjct  250  VGG-KLVPFVGYPGVSMWQFLPPASVDTSQDHILRPPVA  287



>ref|XP_009414543.1| PREDICTED: transcription factor ILR3 [Musa acuminata subsp. malaccensis]
Length=226

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 140/230 (61%), Gaps = 19/230 (8%)
 Frame = -2

Query  950  MMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLK  771
             +DD+   + A+    +     F W     N S ++       F D+    E  + KR +
Sbjct  10   FLDDLIGDMHASEGDLAGVNGGFCWAPPGFNISFSS-------FSDSNGLTEPVTGKRKR  62

Query  770  LETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEI  591
             ETC  + +KACREKMRRD +N+RFLEL S+LEP +  K DK AILS AVRV+T LR+E 
Sbjct  63   SETC-STPAKACREKMRRDRLNDRFLELGSLLEPGKLSKLDKAAILSDAVRVLTQLRSET  121

Query  590  EKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHP---  420
            EKLKESN  L EKI+ELKAEK ELRDEKQKLK +   LEQQ+   + +      SHP   
Sbjct  122  EKLKESNEILQEKINELKAEKNELRDEKQKLKAENESLEQQIKLRSSYV-----SHPPPV  176

Query  419  ---ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                   +GQ AA K M+P++GYPGF MWQFM P+ +DTSQD   +PP A
Sbjct  177  IATPFTAKGQAAAQKLMIPIIGYPGFPMWQFMAPSDIDTSQDADKYPPAA  226



>gb|KDP20820.1| hypothetical protein JCGZ_21291 [Jatropha curcas]
Length=237

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 141/237 (59%), Gaps = 10/237 (4%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NW+ DY M+ D+        S   +  +   W S     +S+ +      F  ++V +
Sbjct  7    NANWVFDYNMIADVPVPGGELPSLEPAGAL---WSSTPFIDNSSVSVGLDGSFGKSDVIE  63

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            + GSRKR++  +C   GSKACREKMRRD +N+RF+EL ++L+P  PPK DK  IL+ AV+
Sbjct  64   DNGSRKRVRPGSCNSVGSKACREKMRRDRLNDRFMELGALLDPGMPPKMDKSVILADAVK  123

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLKESN  L EKI+ELK EK ELRDEKQ+LK +K  +E+QV    + + P
Sbjct  124  MVNQLRDEAQKLKESNESLQEKINELKVEKNELRDEKQRLKTEKETIERQVK---ILSAP  180

Query  437  ASF-SHP---ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              F  HP             G K++P VGYPG  MWQ M P  +DTSQD VL  P A
Sbjct  181  TGFMPHPPAIPAPFTPSQVFGSKLVPYVGYPGVPMWQVMSPATLDTSQDPVLRSPAA  237



>ref|XP_006847910.1| hypothetical protein AMTR_s00029p00112130 [Amborella trichopoda]
 gb|ERN09491.1| hypothetical protein AMTR_s00029p00112130 [Amborella trichopoda]
Length=225

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 140/238 (59%), Gaps = 20/238 (8%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + +W++D   +D I+    + A F         ++S+      + +    C   +    +
Sbjct  3    EQSWVLD---IDTINEVAGSDAQF---------YLSEGYGNLQSTSWDIDCINANAVGPE  50

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            +  SRKR + E+C   GSKACREKMRRD +N+RFLEL SIL+P RPPK DK  ILS A R
Sbjct  51   QTSSRKRARDESCCAPGSKACREKMRRDRLNDRFLELGSILDPGRPPKADKATILSDAAR  110

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
             ++ LR E +KLKE+N +L E I +LK EK ELRDEK +LK DK +LEQQV   AM   P
Sbjct  111  ALSQLRIEAQKLKEANEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVK--AMSMAP  168

Query  437  ASF-SHP----ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              F  HP          QV  G K +P  GYP   MWQ+M PT+VDTSQDH L PPVA
Sbjct  169  TGFIPHPAAIHAFAAPSQV-GGAKAVPYSGYPAMTMWQWMPPTVVDTSQDHKLRPPVA  225



>ref|XP_006659812.1| PREDICTED: transcription factor ILR3-like [Oryza brachyantha]
Length=246

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 155/263 (59%), Gaps = 33/263 (13%)
 Frame = -2

Query  1022  ISVPRRKNSRNAMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTA  843
             +SVP         E    W +D  +++D+ +A  A  +FP  A+   S  + +V  SS  
Sbjct  2     MSVPPESGGGGGDE----WFLDCGILEDLPAA--ACGAFPWDASPSCS--NPSVEVSSFV  53

Query  842   TGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTR  663
               S A         KE GS KR++  +C    SKACREK+RRD +N+RFLEL + LEP +
Sbjct  54    NTSDAL--------KEPGSNKRVRSGSCGRPTSKACREKIRRDKMNDRFLELGTTLEPGK  105

Query  662   PPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKM  483
             P K+DK AILS A R+V  LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K 
Sbjct  106   PVKSDKAAILSDATRMVIQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKE  165

Query  482   KLEQQVNGAAMFAKPASFSHPIL--------------NLEGQVAAGKK-MMPVVGYPGFA  348
              LEQQ+    M + PA   HP L                +GQ AAG+K MMP VGYPG+ 
Sbjct  166   TLEQQMK--IMTSTPAYMPHPTLMPAPFPQAPLAPFHPAQGQQAAGQKLMMPFVGYPGYP  223

Query  347   MWQFMQPTIVDTSQDHVLHPPVA  279
             MWQFM P+ VDTS+D+   PPVA
Sbjct  224   MWQFMPPSEVDTSKDNESCPPVA  246



>emb|CDY43028.1| BnaA03g11750D [Brassica napus]
Length=238

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 147/241 (61%), Gaps = 16/241 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISS-AVSATA-SFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            + NW+ D    D   S  + A A S+P    I  S  + +V    +A  S A +  D  +
Sbjct  6    NGNWICDLIEADYGGSFTIQAPAFSWPLHQPIGVSSHNSSVGVDGSAGISEASK--DPPL  63

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
                 SRKR++ E+   + SKACREK RRD +N++F+EL  ILEP  PPKTDK AIL  A
Sbjct  64   -----SRKRVRCESSSATSSKACREKQRRDRLNDKFMELGVILEPGHPPKTDKAAILVDA  118

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLE Q+       
Sbjct  119  LRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKEKLELQLKAMNAPP  178

Query  443  KPASFSHPIL------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPV  282
            +P+ F  P +      + +GQ A G KM+P + YPG AMWQFM P  VDTSQDHVL PPV
Sbjct  179  QPSFFPAPPMMPTAFASAQGQ-APGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRPPV  237

Query  281  A  279
            A
Sbjct  238  A  238



>gb|KCW70124.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=226

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 142/207 (69%), Gaps = 12/207 (6%)
 Frame = -2

Query  884  FSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLIN  705
            F ++   +  S+   GS      D++  KE GS+KR++ E+C  S SKACREK+RRD +N
Sbjct  27   FDFLHLYLFCSAEIDGSLG----DSDGVKENGSKKRVRSESCSASSSKACREKLRRDRLN  82

Query  704  ERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKM  525
            ++FLEL+SILEP RPPKTDK AIL   VR+VT LR E +KLK+SN  L EKI ELKAEK 
Sbjct  83   DKFLELASILEPGRPPKTDKAAILIDVVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKN  142

Query  524  ELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNL-----EGQVAAGKKMMPVVGY  360
            ELRDEKQ+LK +K KLE Q+   AM A+P+    P         +GQ A G K++P +GY
Sbjct  143  ELRDEKQRLKAEKEKLEHQLK--AMNAQPSFLPPPPAIPAAFATQGQ-APGNKLVPFIGY  199

Query  359  PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            PG AMWQFM P  VDTSQDHVL PPVA
Sbjct  200  PGVAMWQFMPPATVDTSQDHVLRPPVA  226



>ref|XP_004294337.1| PREDICTED: transcription factor ILR3-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=205

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 138/238 (58%), Gaps = 43/238 (18%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            ++NWL DY ++DD        A+FP S++  F+W  Q +  SS+ +        D E  K
Sbjct  6    NTNWLYDYGLIDD--------ANFPVSSSA-FNWPVQPLPGSSSVSVELDGSLGDVEGLK  56

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E+GS+KR                          FLEL SILEP RPPKTDK AIL  AVR
Sbjct  57   ESGSKKR--------------------------FLELGSILEPGRPPKTDKAAILIDAVR  90

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR E +KLK+SN  L EKI ELK EK ELRDEKQ+LK +K KLEQQ+   AM A+P
Sbjct  91   MVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLK--AMTAQP  148

Query  437  A-----SFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +              +GQ A G KM+P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  149  SFMPAPPAIPAAFAAQGQ-AHGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  205



>gb|KHG15485.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=253

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 145/242 (60%), Gaps = 21/242 (9%)
 Frame = -2

Query  968  WLID-YEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            W+ D Y +++DI        S   SA I   W S ++  S+  +      F +++   E 
Sbjct  21   WIFDDYGLLEDIPVPGGDLPSLDPSAPI---WSSPSLTCSTPLSVEFTESFGNSDSLNET  77

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINER---FLELSSILEPTRPPKTDKIAILSGAV  621
            GSRKR++  +   SGSKACREKMRRD +N+R   FLEL SILEP R  K DK  IL  A 
Sbjct  78   GSRKRMRSGSSSASGSKACREKMRRDKLNDRHVLFLELGSILEPGRSSKVDKAVILVDAA  137

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA----  453
            R+VT LR E +KL+ESN  L EKI+ELKAEK ELRDEKQ+LK +K  LE+QV        
Sbjct  138  RMVTQLRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKDNLERQVKALGSQPG  197

Query  452  ----MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPP  285
                  A P  FS P      QV  G K++P VGYPG +MWQF+ P  VDTSQDH+L PP
Sbjct  198  FVPQAPAIPTPFSTP-----SQVVGG-KLVPFVGYPGVSMWQFLPPAAVDTSQDHMLRPP  251

Query  284  VA  279
            VA
Sbjct  252  VA  253



>ref|XP_009132430.1| PREDICTED: transcription factor ILR3-like [Brassica rapa]
Length=238

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 146/241 (61%), Gaps = 16/241 (7%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISS-AVSATA-SFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            + NW+ D    D   S  + A A S+P    I  S  + +V    +A  S A +  D  +
Sbjct  6    NGNWICDLIEADYGGSFTIQAPAFSWPLHQPIGVSSHNSSVGVDGSAGISEASK--DPPL  63

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
                 SRKR++ E    + SKACREK RRD +N++F+EL  ILEP  PPKTDK AIL  A
Sbjct  64   -----SRKRVRCELSSATNSKACREKQRRDRLNDKFMELGVILEPGHPPKTDKAAILVDA  118

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +R+VT LR E +KLK+SN  L +KI ELK EK ELRDEKQ+LK +K KLE Q+       
Sbjct  119  LRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKEKLELQLKAMNAPP  178

Query  443  KPASFSHPIL------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPV  282
            +P+ F  P +      + +GQ A G KM+P + YPG AMWQFM P  VDTSQDHVL PPV
Sbjct  179  QPSFFPAPPMMPTAFASAQGQ-APGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRPPV  237

Query  281  A  279
            A
Sbjct  238  A  238



>gb|ADC33137.1| helix-loop-helix-like protein [Triticum aestivum]
Length=240

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 144/244 (59%), Gaps = 27/244 (11%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            +W +D  +++D+ +A  A  +FP  A++           SS  +          ++ K++
Sbjct  11   DWFLDCGILEDLPAA--ACGAFPWDASVS----------SSNPSAEVGSHVNKLDLPKDS  58

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KRL+ E C    SKACREK+RRD +N+RFLEL + L+P +P K DK AILS A R+V
Sbjct  59   GSNKRLRSEPCGRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKADKAAILSDATRMV  118

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LE Q+    + A PA 
Sbjct  119  TQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMK--LLTATPAY  176

Query  431  FSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
              HP +             + +GQ    K MMP VGYPG+ MWQ M P+ VDTS+D    
Sbjct  177  MPHPTMMPSPFAQAPMAPFHAQGQALGQKLMMPFVGYPGYPMWQLMPPSEVDTSKDSEAC  236

Query  290  PPVA  279
            PPVA
Sbjct  237  PPVA  240



>gb|AHZ94970.1| helix-loop-helix-like protein, partial [Lilium regale]
Length=169

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 116/163 (71%), Gaps = 8/163 (5%)
 Frame = -2

Query  749  GSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESN  570
            GSKACREKMRRD +N+RF+EL SIL+P +PPK DK AILS A  +VT LR+E +KLK+SN
Sbjct  9    GSKACREKMRRDKLNDRFMELGSILDPGKPPKMDKAAILSDAALMVTQLRSEAQKLKDSN  68

Query  569  LELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHP------ILNL  408
              L EKI ELK+EK ELRDEKQ+LK++K  LEQQV    + A+P+   HP          
Sbjct  69   ESLQEKIKELKSEKSELRDEKQRLKQEKENLEQQVK--MLSARPSYMPHPPVLPAAAFAA  126

Query  407  EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +GQ A  K MMPV+ YPGF MWQFM P+ VDTSQD    PPVA
Sbjct  127  QGQPAGHKMMMPVISYPGFPMWQFMPPSDVDTSQDAESCPPVA  169



>gb|EAZ41459.1| hypothetical protein OsJ_25981 [Oryza sativa Japonica Group]
Length=253

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 147/245 (60%), Gaps = 27/245 (11%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            +W +D  +++D+ +A  A  +FP +A+   S  S  V+     T         + V KE 
Sbjct  22   DWFLDCGILEDLPAA--ACGAFPWNASPSCSNPSVEVSSYVNTT---------SYVLKEP  70

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KR++  +C    SKA REK+RRD +N+RFLEL + LEP +P K+DK AILS A R+V
Sbjct  71   GSNKRVRSGSCGRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  130

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
              LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LEQQV    + A PA 
Sbjct  131  IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVK--ILTATPAY  188

Query  431  FSHPIL--------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVL  294
              HP L              + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D   
Sbjct  189  MPHPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEA  248

Query  293  HPPVA  279
             PPVA
Sbjct  249  CPPVA  253



>gb|ACN40263.1| unknown [Picea sitchensis]
Length=237

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 140/243 (58%), Gaps = 23/243 (9%)
 Frame = -2

Query  974  SNWL--IDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            + WL   D  ++D++     A   F         W    +N     +GS      + ++ 
Sbjct  7    NKWLSYFDEPLLDEVGVGQPANPFF---------WCGPGINDQPDVSGSVEIDGSNKDID  57

Query  800  KEAG--SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
            ++     RKR + E+    GSKACREKMRRD +N+RF+ELSS+LEP RPPKTDK  ILS 
Sbjct  58   EQEKLCPRKRPREESSGGPGSKACREKMRRDRLNDRFMELSSVLEPGRPPKTDKATILSD  117

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF  447
            A RV++ LR + +KLKESN  L E I +LKAEK ELRDEK +LK +K +LEQQV    + 
Sbjct  118  AARVMSQLRADAQKLKESNDHLQETIKDLKAEKNELRDEKLRLKAEKERLEQQVKAMTL-  176

Query  446  AKPASF-------SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
              P+ F                  AA  K MPV GYPG AMWQ+M P +VDTSQDHVL P
Sbjct  177  --PSGFVPHPAAFHAAAAFAAQSQAAANKTMPVPGYPGMAMWQWMPPAVVDTSQDHVLRP  234

Query  287  PVA  279
            PVA
Sbjct  235  PVA  237



>ref|NP_001060960.1| Os08g0138500 [Oryza sativa Japonica Group]
 dbj|BAD03011.1| helix-loop-helix-like protein [Oryza sativa Japonica Group]
 dbj|BAF22874.1| Os08g0138500 [Oryza sativa Japonica Group]
 dbj|BAG95797.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60264.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=253

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 146/245 (60%), Gaps = 27/245 (11%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            +W +D  +++D+ +A  A  +FP  A+   S  S  V+     T         + V KE 
Sbjct  22   DWFLDCGILEDLPAA--ACGAFPWDASPSCSNPSVEVSSYVNTT---------SYVLKEP  70

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KR++  +C    SKA REK+RRD +N+RFLEL + LEP +P K+DK AILS A R+V
Sbjct  71   GSNKRVRSGSCGRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  130

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
              LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LEQQV    + A PA 
Sbjct  131  IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVK--ILTATPAY  188

Query  431  FSHPIL--------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVL  294
              HP L              + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D   
Sbjct  189  MPHPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEA  248

Query  293  HPPVA  279
             PPVA
Sbjct  249  CPPVA  253



>ref|XP_006658659.1| PREDICTED: transcription factor ILR3-like [Oryza brachyantha]
Length=238

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            + E  KE  + KR + E+     SKACREK+RRD +NERFLEL ++LEP + PK DK AI
Sbjct  61   ECEHGKEQSANKRPRSESVSQPSSKACREKLRRDKLNERFLELGAVLEPGKTPKMDKSAI  120

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+RV+T LR+E +KLKESN  L EKI ELKAEK ELRDEKQKLK +K  LEQQ+   
Sbjct  121  LNDAIRVMTELRSEAQKLKESNQSLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIK--  178

Query  455  AMFAKPASFSHPILNLEGQVAAGKK-MMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             + A+P+   HP +      AAG+K MMPV+GYPGF MWQFM P+ VDT+ D    PPVA
Sbjct  179  FLNARPSLVPHPPVIPAAAFAAGQKLMMPVIGYPGFPMWQFMPPSDVDTTDDPKSCPPVA  238



>ref|XP_002316971.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE97583.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=249

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 147/245 (60%), Gaps = 13/245 (5%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASF--PSSATIDFSWVSQTVNYSSTATGSTA-------C  825
            ++ W+ D   MDDI+      + F  PS +            ++   T S+         
Sbjct  6    NAGWVSDSYFMDDITVHDPNFSGFSWPSPSPPVQQQQHHQTPFAPVVTASSPNFGEEIDG  65

Query  824  QFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDK  645
             F D +V KE  S+KR + E+C  S SKACREK+RRD +N++F+EL SIL+P R PKTDK
Sbjct  66   SFGDCDVHKEPNSKKRSRSESCSASSSKACREKLRRDRLNDKFMELGSILDPGRTPKTDK  125

Query  644  IAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQV  465
             AIL  AVR+VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQQ+
Sbjct  126  AAILVDAVRIVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQL  185

Query  464  ---NGAAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVL  294
               N    F             +GQ A G K+MP + YPG AMWQFM P  VDTSQDHVL
Sbjct  186  KTMNSQPSFMPAPPAIPAAFTTQGQ-APGNKLMPFISYPGVAMWQFMPPAAVDTSQDHVL  244

Query  293  HPPVA  279
             PPVA
Sbjct  245  RPPVA  249



>gb|ABK23190.1| unknown [Picea sitchensis]
 gb|ABK27132.1| unknown [Picea sitchensis]
Length=238

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 141/244 (58%), Gaps = 24/244 (10%)
 Frame = -2

Query  974  SNWL--IDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            + WL   D  ++D++     A   F         W    +N     +GS      + ++ 
Sbjct  7    NKWLSYFDEPLLDEVGVGQPANPFF---------WCGPGINDQPDVSGSVEIDGSNKDID  57

Query  800  KEAG--SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
            ++     RKR + E+    GSKACREKMRRD +N+RF+ELSS+LEP RPPKTDK  ILS 
Sbjct  58   EQEKLCPRKRPREESSGGPGSKACREKMRRDRLNDRFMELSSVLEPGRPPKTDKATILSD  117

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF  447
            A RV++ LR + +KLKESN  L E I +LKAEK ELRDEK +LK +K +LEQQV    + 
Sbjct  118  AARVMSQLRADAQKLKESNDHLQETIKDLKAEKNELRDEKLRLKAEKERLEQQVKAMTL-  176

Query  446  AKPASF--------SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
              P+ F        +          AA  K MPV GYPG AMWQ+M P +VDTSQDHVL 
Sbjct  177  --PSGFVPHPAAFHAAAAAFAAQSQAAANKTMPVPGYPGMAMWQWMPPAVVDTSQDHVLR  234

Query  290  PPVA  279
            PPVA
Sbjct  235  PPVA  238



>gb|EAZ05534.1| hypothetical protein OsI_27750 [Oryza sativa Indica Group]
Length=247

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 145/244 (59%), Gaps = 27/244 (11%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAG  789
            W +D  +++D+ +A  A  +FP  A+   S  S  V+     T         + V KE G
Sbjct  17   WFLDCGILEDLPAA--ACGAFPWDASPSCSNPSVEVSSYVNTT---------SYVLKEPG  65

Query  788  SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVT  609
            S KR++  +C    SKA REK+RRD +N+RFLEL + LEP +P K+DK AILS A R+V 
Sbjct  66   SNKRVRSGSCGRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMVI  125

Query  608  SLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF  429
             LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LEQQV    + A PA  
Sbjct  126  QLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVK--ILTATPAYM  183

Query  428  SHPIL--------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
             HP L              + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D    
Sbjct  184  PHPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEAC  243

Query  290  PPVA  279
            PPVA
Sbjct  244  PPVA  247



>ref|XP_010274798.1| PREDICTED: transcription factor bHLH104-like [Nelumbo nucifera]
Length=215

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 148/236 (63%), Gaps = 29/236 (12%)
 Frame = -2

Query  977  DSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYS-STATGSTACQFEDTEV  804
            DS+W L+DY+M++D +S+             DF W +Q       + TGS   +      
Sbjct  6    DSSWNLLDYDMIEDGTSS-------------DFYWNNQICCLDFQSPTGSVPQE------  46

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
              +A +RKR + ++C   GSKACREKMRRD +N+RFL+LSS+LEP RP KTDK AI+S A
Sbjct  47   --KACARKRGRNQSCSDPGSKACREKMRRDRMNDRFLDLSSVLEPGRPAKTDKSAIVSDA  104

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +RV+  LRTE ++LK+++ +L E I  LKAEK ELR+EK +LK DK K+EQQV   ++  
Sbjct  105  IRVLNQLRTEAQELKDASEKLREVIKNLKAEKNELREEKLQLKADKEKMEQQVKAMSLL-  163

Query  443  KPASFSHPILNLEGQVAAG-KKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             PA F  P   L      G  K+M    Y GF MWQ++ P ++DTSQDHVL PPVA
Sbjct  164  -PAGFVPP---LPATYHTGANKLMAYPSYGGFPMWQWIPPVVLDTSQDHVLRPPVA  215



>ref|XP_008454559.1| PREDICTED: transcription factor ILR3-like isoform X2 [Cucumis 
melo]
Length=207

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D +   E+GS+KR++ ++C  S SKACREK+RRD +N++FLEL SIL+P RPPKTDK AI
Sbjct  29   DVDGRLESGSKKRVRSDSCSASSSKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAI  88

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  AVR+V  LR+E  KLKESN  L EKI ELKAEK ELRDEKQ+LK DK +LEQQV   
Sbjct  89   LVDAVRMVNQLRSETHKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVK--  146

Query  455  AMFAKPASFSHPILNLEGQ-VAAGKKMMPVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPV  282
            +M A+   F  PI     Q  A G K+ P VGY P  AMWQFM P  VDTSQDHVL PPV
Sbjct  147  SMPAQQPGFLPPIPTFPAQGQAPGNKLFPFVGYHPSVAMWQFMPPAAVDTSQDHVLRPPV  206

Query  281  A  279
            A
Sbjct  207  A  207



>dbj|BAK03093.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 145/244 (59%), Gaps = 27/244 (11%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            +W +D  +++D+ +A  A  +FP  A++           SS  +        +++V K++
Sbjct  11   DWFLDCGILEDLPAA--ACGAFPWDASVS----------SSNPSAEVGSYVNNSDVPKDS  58

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
             S KRL+   C    SKACREK+RRD +N+RFLEL + L+P +P K DK AILS A R+V
Sbjct  59   SSNKRLRSGPCGRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKADKAAILSDATRMV  118

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LE Q+    + A PA 
Sbjct  119  TQLRAEAKQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMK--LLTATPAY  176

Query  431  FSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
              HP +             + +G  +A K MMP VGYPG+ MWQ M P+ VDTS+D    
Sbjct  177  MPHPTMMHSPFAQAPMAPFHAQGHASAQKLMMPFVGYPGYPMWQLMPPSEVDTSKDSEAC  236

Query  290  PPVA  279
            PPVA
Sbjct  237  PPVA  240



>ref|XP_008441610.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=234

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 145/237 (61%), Gaps = 14/237 (6%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            ++W+ DY +++D           PS   +D    +   +++++            E  KE
Sbjct  7    TDWVFDYGVIEDFPVP---GGDLPS---LDLPSFTLPCDFTASFRADFDEPLGMAEDVKE  60

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
            +GSRKR+   +     SKA +EKMRRD +N+RFLEL+SIL   RPPK DK AIL  AVR+
Sbjct  61   SGSRKRMSSGSSNAFESKARKEKMRRDKLNDRFLELNSILNHGRPPKLDKSAILGDAVRM  120

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA  435
            +  LR E +KLKESN   +EKI+E+KAEK ELRDEKQ+LKE K  LE+++   A   +P+
Sbjct  121  IIQLRDEAQKLKESNESSLEKINEMKAEKNELRDEKQRLKEAKDGLEKKMK--AFNTQPS  178

Query  434  SFSHPILNLEG-----QVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               HP     G     Q+  G K++PV+GYPG +MWQFM P  +DTSQDHVL PPVA
Sbjct  179  FLPHPPAIPPGFSSPNQIVGG-KLVPVIGYPGVSMWQFMPPGAIDTSQDHVLRPPVA  234



>gb|ABK96448.1| unknown [Populus trichocarpa x Populus deltoides]
Length=263

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (70%), Gaps = 12/199 (6%)
 Frame = -2

Query  860  NYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSS  681
            N+ +   GS    F + +V KE  S+KR + E+C  S SKACREK+RRD +N++F+EL S
Sbjct  72   NFGAEIDGS----FGECDVQKEPCSKKRGRSESCSASSSKACREKLRRDRLNDKFIELGS  127

Query  680  ILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQK  501
            ILEP R PKTDK AIL  AVR+VT LR E +KL++SN  L EKI ELKAEK+ELRDEKQ+
Sbjct  128  ILEPGRTPKTDKAAILVDAVRMVTQLRDEAQKLRDSNSSLQEKIKELKAEKIELRDEKQR  187

Query  500  LKEDKMKLEQQVNGAAMFAKPASFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQF  336
            LK +K KLE Q+   AM ++P+    P         +GQ A G K+MP +GYPG AMWQF
Sbjct  188  LKAEKEKLEHQLK--AMSSQPSFMPAPPAIPAAFATQGQ-APGNKLMPFIGYPGVAMWQF  244

Query  335  MQPTIVDTSQDHVLHPPVA  279
            + P  VDTSQDHVLHPPVA
Sbjct  245  LPPAAVDTSQDHVLHPPVA  263



>ref|XP_003562971.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=251

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 151/252 (60%), Gaps = 27/252 (11%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWV--------SQTVNYSSTATGSTACQF  819
            SNW+ D  +MDD+  AV+  A+ P+ A   F W         +Q    S+ +  +   + 
Sbjct  7    SNWVFDCPLMDDL--AVADFAAGPAGA---FYWTPPMQPQMHTQAQAVSAASLPNPCAEI  61

Query  818  E-----DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPK  654
                  D E  K   + KR + E+     SKACREK+RRD +NERFLEL ++L+P + PK
Sbjct  62   NSPVSLDCEHAKGHPTNKRPRSESSAQPSSKACREKVRRDKLNERFLELGAVLDPGKTPK  121

Query  653  TDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLE  474
             DK AIL+ A+RVVT LR+E EKLK+SN  L +KI ELK+EK ELRDEKQKLK +K  LE
Sbjct  122  IDKCAILNDAIRVVTELRSEAEKLKDSNESLQDKIKELKSEKNELRDEKQKLKAEKESLE  181

Query  473  QQVNGAAMFAKPASFSHPIL-------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVD  315
            QQ+    M A+ +   HP +         +GQ A  K MMPV+GYPGF MWQFM P+ VD
Sbjct  182  QQIK--FMNARQSLVPHPSVIPATAFAAAQGQAAGQKLMMPVIGYPGFPMWQFMPPSDVD  239

Query  314  TSQDHVLHPPVA  279
            TS D    PPVA
Sbjct  240  TSDDPKSCPPVA  251



>ref|XP_006370611.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|ERP67180.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=264

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (70%), Gaps = 12/199 (6%)
 Frame = -2

Query  860  NYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSS  681
            N+ +   GS    F + +V KE  S+KR + E+C  S SKACREK+RRD +N++F+EL S
Sbjct  73   NFGAEIDGS----FGECDVQKEPCSKKRGRSESCSASSSKACREKLRRDRLNDKFIELGS  128

Query  680  ILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQK  501
            ILEP R PKTDK AIL  AVR+VT LR E +KL++SN  L EKI ELKAEK+ELRDEKQ+
Sbjct  129  ILEPGRTPKTDKAAILVDAVRMVTQLRDEAQKLRDSNSSLQEKIKELKAEKIELRDEKQR  188

Query  500  LKEDKMKLEQQVNGAAMFAKPASFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQF  336
            LK +K KLE Q+   AM ++P+    P         +GQ A G K+MP +GYPG AMWQF
Sbjct  189  LKAEKEKLEHQLK--AMSSQPSFMPAPPAIPAAFATQGQ-APGNKLMPFIGYPGVAMWQF  245

Query  335  MQPTIVDTSQDHVLHPPVA  279
            + P  VDTSQDHVLHPPVA
Sbjct  246  LPPAAVDTSQDHVLHPPVA  264



>ref|XP_011048283.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=269

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (70%), Gaps = 12/199 (6%)
 Frame = -2

Query  860  NYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSS  681
            N+ +   GS    F + +V KE  S+KR + E+C  S SKACREK+RRD +N++F+EL S
Sbjct  78   NFGAEIDGS----FGECDVQKEPCSKKRGRSESCSASSSKACREKLRRDRLNDKFIELGS  133

Query  680  ILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQK  501
            ILEP R PKTDK AIL  AVR+VT LR E +KL++SN  L EKI ELKAEK+ELRDEKQ+
Sbjct  134  ILEPGRTPKTDKAAILVDAVRMVTQLRGEAQKLRDSNSNLQEKIKELKAEKIELRDEKQR  193

Query  500  LKEDKMKLEQQVNGAAMFAKPASFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQF  336
            LK +K KLE Q+   AM ++P+    P         +GQ A G K+MP +GYPG AMWQF
Sbjct  194  LKAEKEKLEYQLK--AMSSQPSFMPAPPAIPAAFATQGQ-APGNKLMPFIGYPGVAMWQF  250

Query  335  MQPTIVDTSQDHVLHPPVA  279
            + P  VDTSQDHVLHPPVA
Sbjct  251  LPPAAVDTSQDHVLHPPVA  269



>gb|EMS54079.1| Transcription factor ILR3 [Triticum urartu]
Length=240

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 142/244 (58%), Gaps = 27/244 (11%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            +W +D  +++D+ +A  A  +FP  A++           SS  +          ++ K++
Sbjct  11   DWFLDCGILEDLPAA--ACGAFPWDASVS----------SSNPSAEVGSHVNKLDLPKDS  58

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KRL+ E C    SKACR K+RRD +N+RFLEL + L+P +P K DK AILS A R+V
Sbjct  59   GSNKRLRSEPCGRPTSKACRGKVRRDKLNDRFLELGTTLDPGKPVKADKAAILSDATRMV  118

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LE Q+    + A PA 
Sbjct  119  TQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMK--LLTATPAY  176

Query  431  FSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
              HP +             + + Q    K MMP VGYPG+ MWQ M P+ VDTS+D    
Sbjct  177  MPHPTMMPSPFAQAPMAPFHAQAQALGQKLMMPFVGYPGYPMWQLMPPSEVDTSKDSEAC  236

Query  290  PPVA  279
            PPVA
Sbjct  237  PPVA  240



>ref|XP_011030891.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=251

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 150/247 (61%), Gaps = 15/247 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASF--PS-SATIDFSWVSQTVN-YSSTATGSTA------  828
            ++ W+ D   MDDI+      + F  PS S  +      QT+N ++   T S+       
Sbjct  6    NAGWVSDSYFMDDITVHDPNFSGFSWPSPSPPVQQQQHHQTLNAFAPVVTSSSPKFGVEI  65

Query  827  -CQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKT  651
               F D +V KE  S+KR + E+C  S SKACREK+RRD +N++F+EL SIL+P R PKT
Sbjct  66   DGSFGDCDVQKEPNSKKRSRSESCSASSSKACREKLRRDRLNDKFMELGSILDPGRTPKT  125

Query  650  DKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQ  471
            DK AIL  AVRVVT LR E + LK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLEQ
Sbjct  126  DKAAILVDAVRVVTQLRGEAQTLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQ  185

Query  470  QV---NGAAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
            Q+   N    F             + Q A G K+MP + YPG AMWQFM P  VDTSQDH
Sbjct  186  QLKTMNSQPSFMPAPPAIPAAFTTQAQ-APGNKLMPFISYPGVAMWQFMPPAAVDTSQDH  244

Query  299  VLHPPVA  279
            VL PPVA
Sbjct  245  VLRPPVA  251



>gb|EEC82221.1| hypothetical protein OsI_26369 [Oryza sativa Indica Group]
Length=256

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 9/186 (5%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D E  KE  + KR + E+     SKACREK+RRD +NERFLEL ++LEP + PK DK +I
Sbjct  73   DCEHGKEQPTNKRPRSESGTRPSSKACREKVRRDKLNERFLELGAVLEPGKTPKMDKSSI  132

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+RV+  LR+E +KLKESN  L EKI ELKAEK ELRDEKQKLK +K  LEQQ+   
Sbjct  133  LNDAIRVMAELRSEAQKLKESNESLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIK--  190

Query  455  AMFAKPASFSHP-------ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
             + A+P+   HP           +GQ A  K MMPV+GYPGF MWQFM P+ VDT+ D  
Sbjct  191  FLNARPSFVPHPPVIPASAFTAPQGQAAGQKLMMPVIGYPGFPMWQFMPPSDVDTTDDTK  250

Query  296  LHPPVA  279
              PPVA
Sbjct  251  SCPPVA  256



>ref|NP_001059905.1| Os07g0543000 [Oryza sativa Japonica Group]
 dbj|BAC78588.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC83769.1| putative bHLH protein [Oryza sativa Japonica Group]
 dbj|BAE96297.1| bHLH-HALZ myc like protein [Oryza sativa Japonica Group]
 dbj|BAF21819.1| Os07g0543000 [Oryza sativa Japonica Group]
 gb|ACF60478.1| bHLH transcription factor [Oryza sativa Japonica Group]
 dbj|BAG86829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67352.1| hypothetical protein OsJ_24621 [Oryza sativa Japonica Group]
Length=256

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 9/186 (5%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D E  KE  + KR + E+     SKACREK+RRD +NERFLEL ++LEP + PK DK +I
Sbjct  73   DCEHGKEQPTNKRPRSESGTRPSSKACREKVRRDKLNERFLELGAVLEPGKTPKMDKSSI  132

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+RV+  LR+E +KLKESN  L EKI ELKAEK ELRDEKQKLK +K  LEQQ+   
Sbjct  133  LNDAIRVMAELRSEAQKLKESNESLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIK--  190

Query  455  AMFAKPASFSHP-------ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
             + A+P+   HP           +GQ A  K MMPV+GYPGF MWQFM P+ VDT+ D  
Sbjct  191  FLNARPSFVPHPPVIPASAFTAPQGQAAGQKLMMPVIGYPGFPMWQFMPPSDVDTTDDTK  250

Query  296  LHPPVA  279
              PPVA
Sbjct  251  SCPPVA  256



>ref|XP_004172808.1| PREDICTED: transcription factor ILR3-like, partial [Cucumis sativus]
Length=168

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -2

Query  734  REKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVE  555
            REK+RRD +N++FLEL SIL+P RPPKTDK AIL  AVR+V  LR+E +KLKESN  L E
Sbjct  17   REKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVRMVNQLRSETQKLKESNSSLQE  76

Query  554  KIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMM  375
            KI ELKAEK ELRDEKQ+LK DK +LEQQV       +P     PI     Q  AG K++
Sbjct  77   KIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA-QQPGFLPPPIPTFPAQGQAGNKLV  135

Query  374  PVVGY-PGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P +GY P  AMWQFM P  VDTSQDHVL PPVA
Sbjct  136  PFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  168



>gb|ACN40301.1| unknown [Picea sitchensis]
Length=232

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 130/208 (63%), Gaps = 10/208 (5%)
 Frame = -2

Query  884  FSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLIN  705
            F W +Q VN     +   +    D E  ++   RKR + E+C   G KACREKMRR+ +N
Sbjct  29   FFWPAQPVNVQPDCSAIPSDSKNDKEDGEKMCPRKRPRDESCSKHGIKACREKMRRERLN  88

Query  704  ERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKM  525
            +RF ELS +LEP RPPKTDK AILS A+ +V  LR E  KLK+SN +L + I ELK EK 
Sbjct  89   DRFTELSILLEPGRPPKTDKSAILSDALSLVNQLREEAGKLKDSNEQLRQSIKELKTEKN  148

Query  524  ELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF------SHPILNLEGQVAAGKKMMPVVG  363
            ELRDEK +LK +K +L+QQ+   AM   P  F      SH   + + Q AA  K +P+ G
Sbjct  149  ELRDEKTRLKAEKERLDQQMK--AMMTSPPGFMPHLAVSH-AFSAQSQ-AANSKTLPIPG  204

Query  362  YPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +PG AMWQ+M P  VDTSQDH L PPVA
Sbjct  205  FPGMAMWQWMPPAAVDTSQDHALRPPVA  232



>ref|XP_004972892.1| PREDICTED: transcription factor ILR3-like [Setaria italica]
Length=249

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 140/244 (57%), Gaps = 27/244 (11%)
 Frame = -2

Query  971  NWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEA  792
            +W +D  ++DD+ +A  A  +FP  A+            SS  +          +V KE 
Sbjct  20   DWFLDCGILDDLPAA--ACGAFPWDASPS----------SSNPSVEVGSYVNTNDVFKEP  67

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KRL+  +     SKA REK RRD +N+RFLEL S LEP +P K DK AILS A R+V
Sbjct  68   GSNKRLRSGSSGRPTSKASREKQRRDKLNDRFLELGSTLEPGKPIKADKAAILSDATRMV  127

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
              LR+E ++LK++N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + PA 
Sbjct  128  IQLRSEAQQLKDTNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMTSAPAY  185

Query  431  FSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
              HP L             + +GQ A  K MMP V YPG+ MWQFM P+ VDTS+D    
Sbjct  186  MPHPTLMPAPFPQAPLAPFHPQGQAAGQKLMMPFVSYPGYPMWQFMPPSEVDTSKDSEAC  245

Query  290  PPVA  279
            PPVA
Sbjct  246  PPVA  249



>gb|AFW57417.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=257

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 147/246 (60%), Gaps = 24/246 (10%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAG  789
            W +D  ++DD+ +A  A  +FP  A+   S  + +V   S    +   + E  +V KE G
Sbjct  20   WFLDCGILDDLPAA--ACGAFPWDASPSSS--NPSVEVGSYVNTNDVFK-EPNDVFKEPG  74

Query  788  SRKRLKL---ETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            S KRL+    +  +P+ SKA REKMRR+ +N+RFLEL S LEP +P K DK AILS A R
Sbjct  75   SNKRLRSGFNDVHVPT-SKASREKMRRNKLNDRFLELGSTLEPGKPVKADKAAILSDATR  133

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E ++LKE+N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + P
Sbjct  134  MVIQLRSEAQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMTSTP  191

Query  437  ASFSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
                HP L             + +GQ A  K MMP V YPG+ MWQFM P+ VDTS+D  
Sbjct  192  TYMPHPTLMPAPFPQAPLAPFHAQGQAAGQKLMMPFVSYPGYPMWQFMPPSEVDTSKDSE  251

Query  296  LHPPVA  279
              PPVA
Sbjct  252  ACPPVA  257



>ref|XP_004145091.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 ref|XP_004154169.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 ref|XP_004167401.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 gb|KGN64576.1| hypothetical protein Csa_1G065960 [Cucumis sativus]
Length=235

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 143/240 (60%), Gaps = 19/240 (8%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            ++W+ DY ++++I          PS     F+  S     S           E  E  KE
Sbjct  7    TDWVFDYGVIENIPVP---GGDLPSLDLPSFTLPSCDFTASFREDFDEPLGME--EDVKE  61

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
            + SRKR+   +     SKA +EK+RRD +N+RFLEL+SIL   RPPK DK AIL  AVR+
Sbjct  62   SRSRKRMSSGSSNAFESKARKEKIRRDKLNDRFLELNSILNHGRPPKIDKSAILGDAVRM  121

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG---AAMF-  447
            +  LR E +KLKESN   +EKI+E+KAEK ELRDEKQ+LKE K  LE+++ G      F 
Sbjct  122  IIQLRDEAQKLKESNESSLEKINEMKAEKNELRDEKQRLKEAKDSLEKKMKGFNTQPTFL  181

Query  446  ----AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                A PA FS P      Q+  G K++PV+GYPG +MWQFM P  +DTSQDHVL PPVA
Sbjct  182  PHPPAIPAGFSSP-----NQIVGG-KLVPVIGYPGVSMWQFMPPGAIDTSQDHVLRPPVA  235



>emb|CDO99702.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 144/248 (58%), Gaps = 20/248 (8%)
 Frame = -2

Query  983  ETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEV  804
            E DSNW+ D+ +++DI          P       +W + +    ++     A  F+ ++ 
Sbjct  5    EEDSNWVFDFGLIEDIPVP---GGDLPPLDPGFQNWSNNSFYNPNSVELDGA--FQSSQS  59

Query  803  CKEAGSRKRLKLETCIPSGSKACREKMRRDLINER---------FLELSSILEPTRPPKT  651
             KEA SRKR +   C  + SKA REKMRRD +N+R         F ELS +L+P RPPK 
Sbjct  60   RKEASSRKRARSGPCSATDSKAYREKMRRDKLNDRQTLSLSLYLFQELSFLLDPERPPKV  119

Query  650  DKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQ  471
            DK AIL  A R++  LR E EKLKES   L EK++ELKAEK ELRDEKQK K +K KLE 
Sbjct  120  DKSAILGDATRMLIQLRDEAEKLKESYERLQEKVNELKAEKNELRDEKQKQKAEKDKLEH  179

Query  470  QVNGAAMFAKPASFSHPILNLEGQVAAGK----KMMPVVGYPGFAMWQFMQPTIVDTSQD  303
            Q+   A+ ++    S+P   L   VA  +    KM P VGYPG +MW FM P  VDTS+D
Sbjct  180  QLK--ALSSQTGFLSNPSAILAPFVAPHQVFSSKMTPFVGYPGTSMWHFMPPAAVDTSED  237

Query  302  HVLHPPVA  279
            HVL PPVA
Sbjct  238  HVLRPPVA  245



>ref|NP_001146503.1| uncharacterized protein LOC100280093 [Zea mays]
 gb|ACG47187.1| bHLH transcription factor [Zea mays]
Length=257

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 147/246 (60%), Gaps = 24/246 (10%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAG  789
            W +D  ++DD+ +A  A  +FP  A+   S  + +V   S    +   + E  +V KE G
Sbjct  20   WFLDCGILDDLPAA--ACGAFPWDASPSSS--NPSVEVGSYVNTNDVFK-EPNDVFKEPG  74

Query  788  SRKRLKL---ETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            S KRL+    +  +P+ SKA REKMRR+ +N+RFLEL S LEP +P K DK AILS A R
Sbjct  75   SNKRLRSGCNDVHVPT-SKASREKMRRNKLNDRFLELGSTLEPGKPVKADKAAILSDATR  133

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +V  LR+E ++LKE+N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + P
Sbjct  134  MVIQLRSEAQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMTSTP  191

Query  437  ASFSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
                HP L             + +GQ A  K MMP V YPG+ MWQFM P+ VDTS+D  
Sbjct  192  TYMPHPTLMPAPFPQAPLAPFHAQGQAAGQKLMMPFVSYPGYPMWQFMPPSEVDTSKDSE  251

Query  296  LHPPVA  279
              PPVA
Sbjct  252  ACPPVA  257



>gb|AAO72577.1| helix-loop-helix-like protein [Oryza sativa Japonica Group]
Length=216

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 16/190 (8%)
 Frame = -2

Query  806  VCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
            V KE GS KR++  +C    SKA REK+RRD +N+RFLEL + LEP +P K+DK AILS 
Sbjct  29   VLKEPGSNKRVRSGSCGRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSD  88

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF  447
            A R+V  LR E ++LK++N  L +KI ELKAEK ELRDEKQKLK +K  LEQQV    + 
Sbjct  89   ATRMVIQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVK--ILT  146

Query  446  AKPASFSHPIL--------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTS  309
            A PA   HP L              + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS
Sbjct  147  ATPAYMPHPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTS  206

Query  308  QDHVLHPPVA  279
            +D    PPVA
Sbjct  207  KDSEACPPVA  216



>ref|XP_007148298.1| hypothetical protein PHAVU_006G196600g [Phaseolus vulgaris]
 gb|ESW20292.1| hypothetical protein PHAVU_006G196600g [Phaseolus vulgaris]
Length=215

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 144/234 (62%), Gaps = 20/234 (9%)
 Frame = -2

Query  980  TDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            ++S W++DYE +D+IS         P+    +FSW S +     +          D    
Sbjct  2    SNSEWVLDYEYLDNIS--------LPTLHPPNFSWSSSSPPPIFSVEEDDPLGLSDG--F  51

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS+KRL+   C    SKAC+EKMRRD +N+RFLEL SIL+P RP K DK  ILS AV
Sbjct  52   KENGSKKRLR-SPC----SKACKEKMRRDRLNDRFLELGSILDPGRPLKMDKAVILSDAV  106

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V+ LR E  KL+ES   L  KI+ELKAEK ELR+EKQ+LK +K  LEQ++     F+ 
Sbjct  107  RLVSQLREEAHKLRESIENLQGKINELKAEKNELREEKQRLKAEKDSLEQKIEA---FSS  163

Query  440  PASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             +SF        GQV  G K++P +GYPG  MWQF+ P  VDTSQDHVL PPVA
Sbjct  164  QSSFLRAFPG-PGQV-VGSKLVPFMGYPGVGMWQFLPPAAVDTSQDHVLRPPVA  215



>ref|XP_003573355.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=246

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 142/244 (58%), Gaps = 31/244 (13%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSW-VSQTVNYSSTATGSTACQFEDTEVCKEA  792
            W +D  +++D+          P+SA   F W  S + +  S   GS       ++V K  
Sbjct  20   WFLDCGILEDL----------PASACGAFPWDASASSSNPSVEVGSY---VNTSDVSKVP  66

Query  791  GSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVV  612
            GS KR + E+C    SKACREK+RRD +N+RFLEL + L+P +P K+DK AILS A R+V
Sbjct  67   GSNKRSRSESCGRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKSDKAAILSDATRMV  126

Query  611  TSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPAS  432
            T LR E ++LK++N  L +KI ELK EK ELRDEKQKLK +K  LE Q+    + A PA 
Sbjct  127  TQLRAEAQQLKDTNESLEDKIKELKTEKDELRDEKQKLKVEKETLEHQMK--LLTATPAY  184

Query  431  FSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
              HP +             +  GQ    K MMP VGYPG+ MWQFM P+ VDTS+D    
Sbjct  185  MPHPAMMPSPFAQAPMAPFHAHGQ--GQKMMMPFVGYPGYPMWQFMPPSEVDTSKDSEAC  242

Query  290  PPVA  279
            PPVA
Sbjct  243  PPVA  246



>ref|XP_001778884.1| predicted protein [Physcomitrella patens]
 gb|EDQ56334.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 122/190 (64%), Gaps = 9/190 (5%)
 Frame = -2

Query  827  CQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTD  648
            C   +++V +++ SRKR + E    SG+KACREKMRRD +N+RFL+LS+ LEP RPPKTD
Sbjct  51   CSKGESDVPEKSCSRKRSREEGSSGSGNKACREKMRRDRLNDRFLDLSAALEPGRPPKTD  110

Query  647  KIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ  468
            K  ILS AVR++T LR E + L ESN +L E I +LK EK ELR+EK +LK DK +LEQQ
Sbjct  111  KATILSDAVRILTQLRAEAQGLTESNNQLRETIKDLKNEKNELREEKTRLKADKERLEQQ  170

Query  467  VNGAAMFAKPASFSHP-------ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTS  309
            V   AM        HP               AA  K   + GYPG AMWQ+M P  VDTS
Sbjct  171  VK--AMTIPAGYMPHPAALHAAVAAFAAQTQAASNKAAQIAGYPGMAMWQWMPPAAVDTS  228

Query  308  QDHVLHPPVA  279
            QDHVL PPVA
Sbjct  229  QDHVLRPPVA  238



>ref|XP_002962528.1| hypothetical protein SELMODRAFT_165556 [Selaginella moellendorffii]
 ref|XP_002962764.1| hypothetical protein SELMODRAFT_165311 [Selaginella moellendorffii]
 gb|EFJ35991.1| hypothetical protein SELMODRAFT_165556 [Selaginella moellendorffii]
 gb|EFJ36227.1| hypothetical protein SELMODRAFT_165311 [Selaginella moellendorffii]
Length=246

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 129/203 (64%), Gaps = 31/203 (15%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D++  ++   +KR + E+C   G+KACREKMRRD +N+RF+ELS+ LEP RPPK+DK  I
Sbjct  51   DSDEFEKTCPKKRSREESCGAPGNKACREKMRRDRLNDRFVELSAALEPGRPPKSDKATI  110

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            LS AVRV+T LR E ++LKESN +L + I ELKAEK ELR+EK +LK +K +LEQQ+   
Sbjct  111  LSDAVRVITQLRAEAQQLKESNEQLRDGIKELKAEKNELREEKMRLKSEKDRLEQQLKTM  170

Query  455  AMFAKPASF-SHPILNLE-----------------------GQVAAGKKMMPVVGYPGFA  348
            AM   P SF  HP   L                        G  AAG    P+ G+PG A
Sbjct  171  AM---PPSFMPHPAAALHAHHAAAAAAAFHAQIQAASTKTGGASAAG----PLPGFPGMA  223

Query  347  MWQFMQPTIVDTSQDHVLHPPVA  279
            MWQ+M P +VDTSQDHVL PPVA
Sbjct  224  MWQWMPPAVVDTSQDHVLRPPVA  246



>ref|XP_001754335.1| predicted protein [Physcomitrella patens]
 gb|EDQ80785.1| predicted protein [Physcomitrella patens]
Length=201

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 11/191 (6%)
 Frame = -2

Query  827  CQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTD  648
            C   D++V +++ SRKR + + C  +G+KACREKMRRD +N+RFLELS+ LEP RPPKTD
Sbjct  14   CSKGDSDVLEKSCSRKRSREDACSGAGNKACREKMRRDRLNDRFLELSAALEPGRPPKTD  73

Query  647  KIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQ  468
            K  ILS AVR++T LR E + L ESN +L E I +LK EK ELR+EK +LK DK +LEQQ
Sbjct  74   KATILSDAVRILTQLRAEAQGLTESNNQLRETIKDLKNEKNELREEKTRLKADKERLEQQ  133

Query  467  VNGAAMFAKPASF--------SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDT  312
            V   ++   P  +        +          AA  K   +  YPG AMWQ+M P  VDT
Sbjct  134  VKSISI---PTGYMPHPAAMHAAAAAFAAQTQAASTKAAQMAAYPGMAMWQWMPPAAVDT  190

Query  311  SQDHVLHPPVA  279
            SQDHVL PPVA
Sbjct  191  SQDHVLRPPVA  201



>ref|XP_010940315.1| PREDICTED: transcription factor ILR3-like isoform X2 [Elaeis 
guineensis]
Length=188

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 16/190 (8%)
 Frame = -2

Query  809  EVCK--EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            +VC   +A SRKR++ E+C    +KACREKMRRD +N+RFLELSSIL+P RPPK+DK +I
Sbjct  2    DVCNLDQASSRKRVRDESCSGPKTKACREKMRRDRLNDRFLELSSILDPGRPPKSDKASI  61

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  A RV+  LR+E  +LKESN +L E I +LK EK ELRDEK +LK DK +LEQQV   
Sbjct  62   LGDAARVLVQLRSEARQLKESNEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVK--  119

Query  455  AMFAKPASF-SHPI----------LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTS  309
            AM   PA F  HPI              GQ  A K    V  +PG AMWQ+M P +VDT+
Sbjct  120  AMSVPPAGFMPHPIAFHPAAATVAFAPHGQAPANKAGS-VTAFPGVAMWQWMPPAVVDTT  178

Query  308  QDHVLHPPVA  279
            QD  L PP A
Sbjct  179  QDTKLWPPNA  188



>ref|XP_010062962.1| PREDICTED: transcription factor ILR3-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW70123.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=213

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 139/237 (59%), Gaps = 35/237 (15%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            +NW+ D  ++DDI++A +    F  S +  FSW  Q +N SS  +        D++  KE
Sbjct  7    ANWIYDCGLIDDIAAAAADGGPFQVSGS-GFSWPDQPLNGSSIFSAEIDGSLGDSDGVKE  65

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             GS+KR                          FLEL+SILEP RPPKTDK AIL   VR+
Sbjct  66   NGSKKR--------------------------FLELASILEPGRPPKTDKAAILIDVVRM  99

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPA  435
            VT LR E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K KLE Q+   AM A+P+
Sbjct  100  VTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLK--AMNAQPS  157

Query  434  SFSHPILNL-----EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                P         +GQ A G K++P +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  158  FLPPPPAIPAAFATQGQ-APGNKLVPFIGYPGVAMWQFMPPATVDTSQDHVLRPPVA  213



>ref|XP_004957936.1| PREDICTED: transcription factor ILR3-like isoform X2 [Setaria 
italica]
Length=254

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 124/187 (66%), Gaps = 10/187 (5%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D +  KE  + KR + E+     +KACREK+RRD +NERFLEL +ILEP + PK DK AI
Sbjct  70   DCDQGKEQPTNKRPRSESTAQPSTKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAI  129

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+R V  LR+E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K  LEQQ+   
Sbjct  130  LNDAIRAVGELRSEAQKLKDSNESLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIK--  187

Query  455  AMFAKPASFSHP-------ILNLEGQVAAGKK-MMPVVGYPGFAMWQFMQPTIVDTSQDH  300
             + ++P+   HP           +G  AAG K MMPV+GYPGF MWQFM P+ VDTS D 
Sbjct  188  FLNSRPSLVPHPPVIPASAFTTPKGPPAAGHKLMMPVIGYPGFPMWQFMPPSDVDTSNDP  247

Query  299  VLHPPVA  279
               PPVA
Sbjct  248  KSCPPVA  254



>ref|XP_004957935.1| PREDICTED: transcription factor ILR3-like isoform X1 [Setaria 
italica]
Length=255

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 124/187 (66%), Gaps = 10/187 (5%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D +  KE  + KR + E+     +KACREK+RRD +NERFLEL +ILEP + PK DK AI
Sbjct  71   DCDQGKEQPTNKRPRSESTAQPSTKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAI  130

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+R V  LR+E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K  LEQQ+   
Sbjct  131  LNDAIRAVGELRSEAQKLKDSNESLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIK--  188

Query  455  AMFAKPASFSHP-------ILNLEGQVAAGKK-MMPVVGYPGFAMWQFMQPTIVDTSQDH  300
             + ++P+   HP           +G  AAG K MMPV+GYPGF MWQFM P+ VDTS D 
Sbjct  189  FLNSRPSLVPHPPVIPASAFTTPKGPPAAGHKLMMPVIGYPGFPMWQFMPPSDVDTSNDP  248

Query  299  VLHPPVA  279
               PPVA
Sbjct  249  KSCPPVA  255



>gb|EMT27826.1| Transcription factor ILR3 [Aegilops tauschii]
Length=218

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 127/208 (61%), Gaps = 22/208 (11%)
 Frame = -2

Query  842  TGSTACQ-------FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELS  684
            TG   C          +++V K++GS KRL+ E C    SKACR K+RRD +N+RFLEL 
Sbjct  13   TGGPVCMGAEVGSYVNNSDVPKDSGSNKRLRSEPCGRPTSKACRGKVRRDKLNDRFLELG  72

Query  683  SILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQ  504
            + L+P +P K DK AILS A R+VT LR E ++LK++N  L +KI ELKAEK ELRDEKQ
Sbjct  73   TTLDPGKPVKADKAAILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQ  132

Query  503  KLKEDKMKLEQQVNGAAMFAKPASFSHPIL-------------NLEGQVAAGKKMMPVVG  363
            KLK +K  LE Q+    + A PA   HP +             + +GQ    K MMP VG
Sbjct  133  KLKLEKETLEHQMK--LLTATPAYMPHPTMMPSPFAQAPMAPFHAQGQALGQKLMMPFVG  190

Query  362  YPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            YPG+ MWQ M P+ VDTS+D    PPVA
Sbjct  191  YPGYPMWQLMPPSEVDTSKDSEACPPVA  218



>ref|NP_001150796.1| LOC100284429 [Zea mays]
 gb|ACG40431.1| bHLH transcription factor [Zea mays]
Length=238

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 142/247 (57%), Gaps = 35/247 (14%)
 Frame = -2

Query  980  TDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            T  +W +D  ++DD+ +A  A  +FP  A+   S  + +V   S    + A + E  +V 
Sbjct  14   TGDDWFLDCGILDDLPAA--ACGAFPWDASPSSS--NPSVEVGSYVNANDAFK-EPNDVF  68

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS KR               E+MRR+ +N+RFLEL S LEP +P K DK AILS A 
Sbjct  69   KEPGSSKR---------------ERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDAT  113

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V  LR+E ++LKE+N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + 
Sbjct  114  RMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMASA  171

Query  440  PASFSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
            PA   HP L             + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D 
Sbjct  172  PAYMPHPTLMPAPFAQAPLTPFHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDS  231

Query  299  VLHPPVA  279
               PPVA
Sbjct  232  EACPPVA  238



>gb|AFW61272.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=238

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 142/247 (57%), Gaps = 35/247 (14%)
 Frame = -2

Query  980  TDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            T  +W +D  ++DD+ +A  A  +FP  A+   S  + +V   S    + A + E  +V 
Sbjct  14   TGDDWFLDCGILDDLPAA--ACGAFPWDASPSSS--NPSVEVGSYVNANDAFK-EPNDVF  68

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE GS KR               E+MRR+ +N+RFLEL S LEP +P K DK AILS A 
Sbjct  69   KEPGSSKR---------------ERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDAT  113

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            R+V  LR+E ++LKE+N  L EKI ELKAEK ELRDEKQKLK +K  LE Q+    M + 
Sbjct  114  RMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMK--LMASA  171

Query  440  PASFSHPIL-------------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDH  300
            PA   HP L             + +GQ A  K MMP VGYPG+ MWQFM P+ VDTS+D 
Sbjct  172  PAYMPHPTLMPAPFAQAPLAPFHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDS  231

Query  299  VLHPPVA  279
               PPVA
Sbjct  232  EACPPVA  238



>ref|XP_010940314.1| PREDICTED: transcription factor ILR3-like isoform X1 [Elaeis 
guineensis]
Length=230

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 16/190 (8%)
 Frame = -2

Query  809  EVCK--EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            +VC   +A SRKR++ E+C    +KACREKMRRD +N+RFLELSSIL+P RPPK+DK +I
Sbjct  44   DVCNLDQASSRKRVRDESCSGPKTKACREKMRRDRLNDRFLELSSILDPGRPPKSDKASI  103

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  A RV+  LR+E  +LKESN +L E I +LK EK ELRDEK +LK DK +LEQQV   
Sbjct  104  LGDAARVLVQLRSEARQLKESNEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVK--  161

Query  455  AMFAKPASF-SHPI----------LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTS  309
            AM   PA F  HPI              GQ  A  K   V  +PG AMWQ+M P +VDT+
Sbjct  162  AMSVPPAGFMPHPIAFHPAAATVAFAPHGQAPA-NKAGSVTAFPGVAMWQWMPPAVVDTT  220

Query  308  QDHVLHPPVA  279
            QD  L PP A
Sbjct  221  QDTKLWPPNA  230



>ref|XP_008813314.1| PREDICTED: transcription factor ILR3-like isoform X2 [Phoenix 
dactylifera]
Length=230

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 126/201 (63%), Gaps = 16/201 (8%)
 Frame = -2

Query  842  TGSTACQFEDTEVC--KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEP  669
            T     Q    +VC   +A SRKR++ E+C    +KACREKMRRD +N+RFLELSSIL+P
Sbjct  33   TSGIGIQGACIDVCSLDQASSRKRVRDESCSGPKTKACREKMRRDRLNDRFLELSSILDP  92

Query  668  TRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKED  489
             RPPK+D+ +ILS A RV+  LR+E ++LKESN  L E I +LK EK ELRDEK +LK D
Sbjct  93   GRPPKSDRASILSDAARVLVQLRSEAQQLKESNENLQETIKDLKVEKNELRDEKTRLKAD  152

Query  488  KMKLEQQVNGAAMFAKPASF-SHPI----------LNLEGQVAAGKKMMPVVGYPGFAMW  342
            K +LEQQV   AM   PA F  HPI              GQ  A  K   V  +PG AMW
Sbjct  153  KERLEQQVK--AMSVPPAGFMPHPISFHAAAAPVAYAPHGQAPA-NKAASVTAFPGVAMW  209

Query  341  QFMQPTIVDTSQDHVLHPPVA  279
            Q++ P +VDT+QD  L PP A
Sbjct  210  QWLPPAVVDTTQDTKLWPPNA  230



>ref|XP_010109550.1| hypothetical protein L484_018285 [Morus notabilis]
 gb|EXC23154.1| hypothetical protein L484_018285 [Morus notabilis]
Length=308

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 130/190 (68%), Gaps = 11/190 (6%)
 Frame = -2

Query  827  CQFEDTEVCKEAGSRKRLKL-ETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKT  651
            C   D++  KE GSRKR +  ++   S SKACREK+RRD +NERFLEL +++EP R PKT
Sbjct  123  CPSGDSDSIKEVGSRKRPRSDQSSGASCSKACREKLRRDRLNERFLELVAVMEPGRLPKT  182

Query  650  DKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQ  471
            DK AILS A R++T LR+E   LKE+  +L EKI ELKAEK ELR+E+Q+L+EDK +LEQ
Sbjct  183  DKAAILSDAARILTQLRSESRHLKETIDDLHEKIKELKAEKNELREERQRLREDKERLEQ  242

Query  470  QVNGAAMFAKPASFSH-----PILNLEGQVAAGKKMMPVVGYP-GFAMWQFMQPTIVDTS  309
            QV   AM A+ +   H       L ++GQ  +  K+MP + YP G  MWQ M  T +DTS
Sbjct  243  QVK--AMAAQTSFLPHSPAISSALTVQGQ--STNKLMPFISYPGGVTMWQMMPQTPLDTS  298

Query  308  QDHVLHPPVA  279
            QDH+ HPPVA
Sbjct  299  QDHIRHPPVA  308



>ref|XP_008813306.1| PREDICTED: transcription factor ILR3-like isoform X1 [Phoenix 
dactylifera]
Length=235

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 124/190 (65%), Gaps = 16/190 (8%)
 Frame = -2

Query  809  EVC--KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            +VC   +A SRKR++ E+C    +KACREKMRRD +N+RFLELSSIL+P RPPK+D+ +I
Sbjct  49   DVCSLDQASSRKRVRDESCSGPKTKACREKMRRDRLNDRFLELSSILDPGRPPKSDRASI  108

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            LS A RV+  LR+E ++LKESN  L E I +LK EK ELRDEK +LK DK +LEQQV   
Sbjct  109  LSDAARVLVQLRSEAQQLKESNENLQETIKDLKVEKNELRDEKTRLKADKERLEQQVK--  166

Query  455  AMFAKPASF-SHPI----------LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTS  309
            AM   PA F  HPI              GQ  A  K   V  +PG AMWQ++ P +VDT+
Sbjct  167  AMSVPPAGFMPHPISFHAAAAPVAYAPHGQAPA-NKAASVTAFPGVAMWQWLPPAVVDTT  225

Query  308  QDHVLHPPVA  279
            QD  L PP A
Sbjct  226  QDTKLWPPNA  235



>ref|XP_006827502.1| hypothetical protein AMTR_s00009p00175450 [Amborella trichopoda]
 gb|ERM94918.1| hypothetical protein AMTR_s00009p00175450 [Amborella trichopoda]
Length=216

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 139/239 (58%), Gaps = 25/239 (10%)
 Frame = -2

Query  992  NAMETDSNWLI-DYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFE  816
             + +  S+W+  DY +++++          PS+    FSW+  T    S   G  +    
Sbjct  2    GSFQDSSSWVWEDYNLIEEV----------PSTG---FSWLGST----SVGIGKPS----  40

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
                C++   RKR   E+    G+KACREKMRRD +N+RFLELS +LEP RPPKTDK AI
Sbjct  41   KDAGCEKVSLRKRGPEESFSGPGTKACREKMRRDRMNDRFLELSCVLEPGRPPKTDKSAI  100

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  A+RV+  LRTEI++LK +N +L E I  LKAEK ELRDEK KLK DK  LE+Q+ G 
Sbjct  101  LCDAIRVLNQLRTEIQELKNANEKLQEDITNLKAEKNELRDEKLKLKGDKEILEKQIKGM  160

Query  455  AMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +  + P    HP        A   K M    Y G AMWQ+M P+ VDTSQDHVL  PVA
Sbjct  161  SAPSPPFLAHHPTPVF---AAPLNKTMAFPHYNGMAMWQWMPPSAVDTSQDHVLRSPVA  216



>ref|XP_010092690.1| hypothetical protein L484_019764 [Morus notabilis]
 gb|EXB51987.1| hypothetical protein L484_019764 [Morus notabilis]
Length=210

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 132/238 (55%), Gaps = 38/238 (16%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NW+ DY +++D+          P+     F W S +    +T +        +++  K
Sbjct  6    NPNWVFDYSLIEDLPIP---GGGLPALDPPSFPWPSHSFTPPTTVSADFDESLANSDGFK  62

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            EAG RKR                          FLEL SI EP RPPK DK  IL  AVR
Sbjct  63   EAGCRKR--------------------------FLELGSISEPGRPPKMDKAVILGDAVR  96

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            +VT LR E EKLKESN +L EKI+ELKAEK ELRDEKQ+LK +K  L++QV   A+  +P
Sbjct  97   MVTHLRMEAEKLKESNEKLQEKINELKAEKNELRDEKQRLKAEKDVLDKQVK--ALTTQP  154

Query  437  ASFSH-----PILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             SF H     P     GQV  G K+MP VGYPG +MWQFM P  VDTSQDHVL PPVA
Sbjct  155  -SFLHPPAIPPPFPGPGQVVGG-KLMPFVGYPGISMWQFMPPAAVDTSQDHVLRPPVA  210



>ref|XP_009381065.1| PREDICTED: transcription factor bHLH115-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 135/235 (57%), Gaps = 20/235 (9%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVN---YSSTATGSTACQFEDTEVCK  798
            WL DY         +    S+ S    DF W ++ ++    SST  G      ED   C 
Sbjct  8    WLFDY-------GGIVGGDSYAS----DFIWDARVIDDPSASSTMLGFGVLHNEDN--CP  54

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
                +KR ++E+C P G+KACREKMRRD +N+RF +L SI++P +PPKTDK AILS A R
Sbjct  55   NGSLKKRTRVESCAPPGTKACREKMRRDRLNDRFTDLCSIMDPGKPPKTDKFAILSDATR  114

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            ++  LR E +K +ESN  L + I  LKAEK+ELRDEK +LK +K ++EQ +   A+   P
Sbjct  115  LLNQLRLEAKKFRESNEALQDAIKNLKAEKLELRDEKLRLKAEKEQIEQMLK--AIRIAP  172

Query  437  ASFSHPILNL--EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               + P         +AA  K +P   Y    MWQ++ P  +DTSQDHVL PPVA
Sbjct  173  QFITEPSAATLHAASIAAYSKTIPYPNYLPADMWQWIPPAALDTSQDHVLRPPVA  227



>ref|XP_010544248.1| PREDICTED: transcription factor bHLH115 [Tarenaya hassleriana]
Length=231

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 137/236 (58%), Gaps = 13/236 (6%)
 Frame = -2

Query  977  DSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCK  798
            + NW  DY ++D   S  ++             W  + ++ S + +        D +   
Sbjct  6    NPNWFCDYNLVDGDFSVHNSVVP----------WPIELISGSDSLSAEIDGFLGDLDGLN  55

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
            E  SRKRLK E+C  S SKACREK RRD +N++F+ELSSILE  RP KTDK  IL  AVR
Sbjct  56   EPASRKRLKSESCTGSNSKACREKQRRDRLNDKFMELSSILEHGRPSKTDKPTILMDAVR  115

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN--GAAMFA  444
            +V  LR E +K KE N  L EKI ELK EK ELRDEKQKLK +K KLEQQ+    A    
Sbjct  116  MVNELRVEAQKFKELNSSLQEKIKELKEEKHELRDEKQKLKTEKEKLEQQLKMVKAHHHH  175

Query  443  KPASFSHPILNLEGQVAA-GKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P     P      QV A G K++    YPGFAMWQFM P  VDTSQDHVL PPVA
Sbjct  176  QPQPIFLPNPQAVPQVQAPGNKLVQFPSYPGFAMWQFMPPASVDTSQDHVLRPPVA  231



>ref|XP_010262298.1| PREDICTED: transcription factor bHLH104-like [Nelumbo nucifera]
Length=216

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 142/236 (60%), Gaps = 28/236 (12%)
 Frame = -2

Query  977  DSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQ--TVNYSSTATGSTACQFEDTE  807
            DS+W L+DY +++D +S              DF W +Q   +++  +   S         
Sbjct  6    DSSWNLLDYSIIEDGTST-------------DFYWNNQDCCLDFDVSPIESI--------  44

Query  806  VCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
            + ++A +RKR + E+C   GSKACREKMRRD +N+ F +L+SILEP RP KTDK AIL  
Sbjct  45   LQEKACTRKRGRNESCSGPGSKACREKMRRDRMNDMFSDLTSILEPGRPAKTDKSAILGD  104

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF  447
            A+RV+  LRTE ++LK++N +L E I  LKAEK ELR+EK  LK DK ++EQQ+    M 
Sbjct  105  AIRVLNQLRTEAQELKDANEKLQEDIKNLKAEKNELREEKLLLKADKERMEQQLK--TMS  162

Query  446  AKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P  F  P+       A   K+M    + GF MWQ++ P ++DTSQDHVL PPVA
Sbjct  163  IMPTGFVPPV--PATYQAGANKLMTYPSFGGFPMWQWIPPAVLDTSQDHVLRPPVA  216



>ref|XP_006489749.1| PREDICTED: transcription factor bHLH104-like isoform X2 [Citrus 
sinensis]
Length=212

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 132/210 (63%), Gaps = 18/210 (9%)
 Frame = -2

Query  899  SATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMR  720
            +A++DFSW  Q+ +   ++TG    + E+T        RKR + ++C   GSKACREK+R
Sbjct  18   NASLDFSWPEQSADNDISSTGVVPQENENT--------RKRARSDSCSRPGSKACREKLR  69

Query  719  RDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHEL  540
            R+ +N+RFL+LS ILEP RP +TDK AIL  A+RV+  LRTE ++LKE+N +L E+I  L
Sbjct  70   RERLNDRFLDLSCILEPGRPARTDKPAILDDAIRVLNQLRTESQELKETNEKLQEEIKSL  129

Query  539  KAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVVGY  360
            KAEK ELR+EK  LK DK KLEQQ+   AM       +HP         AG   M V  Y
Sbjct  130  KAEKNELREEKLILKADKEKLEQQLKVMAMPTGGYMPTHP-----AAYHAGLNKMAV--Y  182

Query  359  PGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
            P +    MWQ++ P++ DTS+DH L PP A
Sbjct  183  PSYGLMPMWQYLPPSLHDTSRDHELRPPAA  212



>ref|XP_002268590.2| PREDICTED: transcription factor bHLH104-like [Vitis vinifera]
Length=216

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 139/236 (59%), Gaps = 28/236 (12%)
 Frame = -2

Query  977  DSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            D  W L+DY +++D +SA             D+ W +Q+ +    A         DT   
Sbjct  6    DGGWDLLDYCIIEDATSA-------------DYFWANQSPSREINAL------VVDTVST  46

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            ++   R R K E C  + SKACREKMRR+ +N+RFL+LSS+LEP RPPKTDK +ILS A+
Sbjct  47   EKRCKRGREKGERCSRAESKACREKMRREKMNDRFLDLSSLLEPGRPPKTDKSSILSDAI  106

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
             V+  LRTE  +LK    +L E I  LKAEK ELR+EK  LK DK K++Q+V   AM   
Sbjct  107  HVLNQLRTEARELKGKTQKLREDIRTLKAEKSELREEKLILKADKEKMQQRVK--AMNVV  164

Query  440  PASF--SHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            P  +  +HP+       A   KM+   GY GF MWQ++  T++DTSQDHVL PPVA
Sbjct  165  PPGYVPAHPL----AYQAGANKMVGFPGYGGFQMWQWIPQTVLDTSQDHVLRPPVA  216



>ref|XP_002462974.1| hypothetical protein SORBIDRAFT_02g035580 [Sorghum bicolor]
 gb|EER99495.1| hypothetical protein SORBIDRAFT_02g035580 [Sorghum bicolor]
Length=254

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 125/187 (67%), Gaps = 10/187 (5%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D    KE  + KR + E+     +KA REK+RRD +NERFLEL +ILEP + PK DK AI
Sbjct  70   DCGQGKEQPTNKRPRSESTAEPSTKASREKIRRDKLNERFLELGAILEPGKTPKMDKSAI  129

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+RVV  LR+E ++LK+SN  L EKI ELKAEK ELRDEKQ+LK +K  LEQQ+   
Sbjct  130  LNDAIRVVGELRSEAKELKDSNESLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIK--  187

Query  455  AMFAKPASFS-HPILNL------EGQVAAGKK-MMPVVGYPGFAMWQFMQPTIVDTSQDH  300
             + A+P+    HP+++       +G   AG K MMPV+GYPGF MWQFM P+ VDTS D 
Sbjct  188  FLNARPSLVPHHPVISASAFTAPQGPAVAGHKLMMPVLGYPGFPMWQFMPPSDVDTSDDP  247

Query  299  VLHPPVA  279
               PPVA
Sbjct  248  KSCPPVA  254



>dbj|BAJ40866.1| bHLH transcriptional factor [Coptis japonica]
Length=219

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 135/244 (55%), Gaps = 32/244 (13%)
 Frame = -2

Query  992  NAMETDSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQT-----VNYSSTATGST  831
            N+   DS W LIDY            T  +   ++ D  W S       ++ S+   G  
Sbjct  2    NSFPEDSPWNLIDY------------TRLYEDPSSNDLLWCSNQSACTELDVSAAGAGPV  49

Query  830  ACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKT  651
                      ++  ++KR + E+C   GSKACREKMRRD +N+RF +LSS LEP RP KT
Sbjct  50   ----------EKGCAKKRGRNESCGGLGSKACREKMRRDKLNDRFADLSSALEPGRPAKT  99

Query  650  DKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQ  471
            DK AILS A+RV+  LRTE ++LKE+N +L E I  LKAEK ELR+EK  LK DK ++EQ
Sbjct  100  DKSAILSDAIRVLNQLRTESQELKEANEKLQEDIKNLKAEKNELREEKNLLKADKERIEQ  159

Query  470  QVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLH  291
            Q+   A+        HP     G      K M    Y G+ MWQ++ P  +DTSQDHVL 
Sbjct  160  QMKAMAIVPGGIVPPHPATYQAGV----NKFMAFPSYGGYPMWQYIPPASLDTSQDHVLR  215

Query  290  PPVA  279
            PPVA
Sbjct  216  PPVA  219



>ref|XP_008651108.1| PREDICTED: uncharacterized protein LOC100273838 isoform X1 [Zea 
mays]
Length=253

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 126/203 (62%), Gaps = 16/203 (8%)
 Frame = -2

Query  845  ATGSTACQFE-----DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSS  681
            A+    C  E     D    KE  + KR + E+   S +KA REK+RRD +NERFLEL +
Sbjct  53   ASAPNPCSMEISSSVDCGQEKEQPTNKRPRSESTTESSTKASREKIRRDKLNERFLELGA  112

Query  680  ILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQK  501
            ILEP + PK DK AILS A+RVV  LR+E +KLK+SN  L EKI ELKAEK ELRDEKQ+
Sbjct  113  ILEPGKTPKMDKTAILSDAIRVVGELRSEAKKLKDSNENLQEKIKELKAEKNELRDEKQR  172

Query  500  LKEDKMKLEQQVNGAAMFAKPASF-SHPILNLEGQVAAG--------KKMMPVVGYPGFA  348
            LK +K  LEQQ+    + A+P+    HP++      A          K MMPV+GYPGF 
Sbjct  173  LKAEKESLEQQIK--FLNARPSLVPHHPVIPASAFPAPQGPAAAARHKLMMPVIGYPGFP  230

Query  347  MWQFMQPTIVDTSQDHVLHPPVA  279
            MWQFM P+ VDTS D    PPVA
Sbjct  231  MWQFMPPSDVDTSDDPRSCPPVA  253



>ref|XP_010935491.1| PREDICTED: transcription factor bHLH115-like [Elaeis guineensis]
Length=230

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 124/190 (65%), Gaps = 16/190 (8%)
 Frame = -2

Query  809  EVC--KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            +VC  ++  SRKR++ E+C    SKACREKMRRD +N+RFLELSSIL+P RPPK +K +I
Sbjct  44   DVCGLEQTSSRKRIRDESCAGPKSKACREKMRRDKLNDRFLELSSILDPGRPPKFEKSSI  103

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            LS A R++  LR+E ++LKESN +L E I +LK EK ELR+EK KLK DK +L+QQV   
Sbjct  104  LSDAARLLVQLRSEAQQLKESNEKLQEAIKDLKVEKNELREEKMKLKADKERLDQQVK--  161

Query  455  AMFAKPASF-SHPI----------LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTS  309
            AM   PA F  HPI              G   A  K+ P   +PG AMWQ++ P +VDT+
Sbjct  162  AMSVPPAGFMPHPIAFHPATATAAFAPHGHTPAN-KVAPFTAFPGVAMWQWLPPAVVDTT  220

Query  308  QDHVLHPPVA  279
            QD  L PP A
Sbjct  221  QDTKLWPPNA  230



>ref|XP_008651109.1| PREDICTED: uncharacterized protein LOC100273838 isoform X2 [Zea 
mays]
 gb|ADX60077.1| bHLH transcription factor [Zea mays]
 tpg|DAA63013.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=252

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 121/183 (66%), Gaps = 11/183 (6%)
 Frame = -2

Query  800  KEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAV  621
            KE  + KR + E+   S +KA REK+RRD +NERFLEL +ILEP + PK DK AILS A+
Sbjct  72   KEQPTNKRPRSESTTESSTKASREKIRRDKLNERFLELGAILEPGKTPKMDKTAILSDAI  131

Query  620  RVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAK  441
            RVV  LR+E +KLK+SN  L EKI ELKAEK ELRDEKQ+LK +K  LEQQ+    + A+
Sbjct  132  RVVGELRSEAKKLKDSNENLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIK--FLNAR  189

Query  440  PASF-SHPILNLEGQVAAG--------KKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHP  288
            P+    HP++      A          K MMPV+GYPGF MWQFM P+ VDTS D    P
Sbjct  190  PSLVPHHPVIPASAFPAPQGPAAAARHKLMMPVIGYPGFPMWQFMPPSDVDTSDDPRSCP  249

Query  287  PVA  279
            PVA
Sbjct  250  PVA  252



>ref|XP_006594877.1| PREDICTED: transcription factor ILR3-like isoform X3 [Glycine 
max]
Length=206

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 133/238 (56%), Gaps = 35/238 (15%)
 Frame = -2

Query  992  NAMETDSNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFED  813
            N+    S+WL DY    DI  A S    F +S +  F W  Q+ N+   +  S   ++  
Sbjct  4    NSSGGASDWLYDYGF--DIPVAGS---DFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSL  58

Query  812  TEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAIL  633
                 E G  KR                          FLELSSILEP+R PK+DK+AIL
Sbjct  59   DSTVMENGPSKR--------------------------FLELSSILEPSRQPKSDKVAIL  92

Query  632  SGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA  453
            S A RVV  LR E ++LKE N EL  K+ ELK EK ELRDEK +LKE+K KLEQQV  A 
Sbjct  93   SDAARVVIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEQQVKVAN  152

Query  452  MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +  +P SF     + +GQV +  K++P +GYPG AMWQFM P  VDTS+DH+L PPVA
Sbjct  153  I--QP-SFLPQAPDAKGQVGS-HKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  206



>gb|KHG04921.1| Transcription factor protein [Gossypium arboreum]
Length=213

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 133/213 (62%), Gaps = 18/213 (8%)
 Frame = -2

Query  890  IDFSWVSQTV-------NYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACR  732
            +D+S++++         NYSS   G      ++ E      SRKR +  +C   G+KACR
Sbjct  10   LDYSFINENTSPDILLPNYSS---GREIVVHQEKEFVDRDCSRKRGRSGSCSRPGTKACR  66

Query  731  EKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEK  552
            EK+RR+ +NERFL+LSSILEP RP +TDK AIL  A+RV+T LRT+ ++LKE+N +L+E+
Sbjct  67   EKLRREKLNERFLDLSSILEPGRPARTDKSAILDDAIRVLTQLRTDAQELKETNEKLLEE  126

Query  551  IHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF--SHPILNLEGQVAAGKKM  378
            I  LKAEK E+RDEK  LK +K ++EQQ+    +   PA +  +HP     G  AA  KM
Sbjct  127  IKSLKAEKNEIRDEKLVLKANKERIEQQLK--TLNVSPARYLPAHPA----GYHAATNKM  180

Query  377  MPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                GY    MWQ++ P+  DTSQDH L PP A
Sbjct  181  AVFPGYGLVPMWQYLPPSARDTSQDHELRPPAA  213



>dbj|BAK01217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 120/186 (65%), Gaps = 9/186 (5%)
 Frame = -2

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            D +  K     KR + ET     SKACREK+RRD +NERFLEL ++L+P + PK DK AI
Sbjct  68   DWDHAKGQPKNKRPRSETGAQPSSKACREKVRRDKLNERFLELGAVLDPGKTPKIDKCAI  127

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L+ A+R VT LR+E EKLK+SN  L EKI ELKAEK ELRDEKQKLK +K  LEQQ+   
Sbjct  128  LNDAIRAVTELRSEAEKLKDSNESLQEKIRELKAEKNELRDEKQKLKAEKESLEQQIK--  185

Query  455  AMFAKPASFSHPIL-------NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHV  297
             M A+     HP +         +GQ A  K MMPV+ YPGF MWQFM P+ VDTS D  
Sbjct  186  FMNARQRLVPHPSVIPATAFAAAQGQAAGHKLMMPVMSYPGFPMWQFMPPSDVDTSDDPK  245

Query  296  LHPPVA  279
              PPVA
Sbjct  246  SCPPVA  251



>ref|XP_006489748.1| PREDICTED: transcription factor bHLH104-like isoform X1 [Citrus 
sinensis]
Length=214

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 132/212 (62%), Gaps = 20/212 (9%)
 Frame = -2

Query  899  SATIDFSWVSQT--VNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREK  726
            +A++DFSW  Q+   +   ++TG    + E+T        RKR + ++C   GSKACREK
Sbjct  18   NASLDFSWPEQSGSADNDISSTGVVPQENENT--------RKRARSDSCSRPGSKACREK  69

Query  725  MRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIH  546
            +RR+ +N+RFL+LS ILEP RP +TDK AIL  A+RV+  LRTE ++LKE+N +L E+I 
Sbjct  70   LRRERLNDRFLDLSCILEPGRPARTDKPAILDDAIRVLNQLRTESQELKETNEKLQEEIK  129

Query  545  ELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVV  366
             LKAEK ELR+EK  LK DK KLEQQ+   AM       +HP         AG   M V 
Sbjct  130  SLKAEKNELREEKLILKADKEKLEQQLKVMAMPTGGYMPTHP-----AAYHAGLNKMAV-  183

Query  365  GYPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
             YP +    MWQ++ P++ DTS+DH L PP A
Sbjct  184  -YPSYGLMPMWQYLPPSLHDTSRDHELRPPAA  214



>ref|XP_006420195.1| hypothetical protein CICLE_v10005872mg [Citrus clementina]
 gb|ESR33435.1| hypothetical protein CICLE_v10005872mg [Citrus clementina]
 gb|KDO57623.1| hypothetical protein CISIN_1g028060mg [Citrus sinensis]
Length=214

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 132/212 (62%), Gaps = 20/212 (9%)
 Frame = -2

Query  899  SATIDFSWVSQ--TVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREK  726
            +A++DFSW  Q  + +   ++TG    + E+T        RKR + ++C   GSKACREK
Sbjct  18   NASLDFSWPEQNGSADNDISSTGVVPPENENT--------RKRARSDSCSRPGSKACREK  69

Query  725  MRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIH  546
            +RR+ +N+RFL+LS ILEP RP +TDK AIL  A+RV+  LRTE ++LKE+N +L E+I 
Sbjct  70   LRRERLNDRFLDLSCILEPGRPARTDKPAILDDAIRVLNQLRTESQELKETNEKLQEEIK  129

Query  545  ELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVV  366
             LKAEK ELR+EK  LK DK KLEQQ+   AM       +HP         AG   M V 
Sbjct  130  SLKAEKNELREEKLILKADKEKLEQQLKVMAMPTGGYMPTHP-----AAYHAGLNKMAV-  183

Query  365  GYPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
             YP +    MWQ++ P++ DTS+DH L PP A
Sbjct  184  -YPSYGLMPMWQYLPPSLHDTSRDHELRPPAA  214



>ref|XP_009388594.1| PREDICTED: transcription factor bHLH115-like [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 131/238 (55%), Gaps = 22/238 (9%)
 Frame = -2

Query  974  SNWLIDYE-MMDDISSAVSATASFPSSATIDFSWVSQTVN---YSSTATGSTACQFEDTE  807
              W+I+Y   M+D+ ++             DF W  Q V+    SS   G  A + ED  
Sbjct  9    GGWIINYGGFMEDVHAS-------------DFIWAPQVVDDPSASSAMLGFDALRKEDNR  55

Query  806  VCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSG  627
                   RKR + E+C   G+KACREK+RRD +N RF EL SIL+P +PPKTDK AIL  
Sbjct  56   P-NNGNLRKRPRAESCAVPGTKACREKIRRDRLNCRFTELCSILDPGKPPKTDKFAILGD  114

Query  626  AVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMF  447
            A R++  LR E +K KESN  L + I  +KAEK+ELRDE+ +LK +K ++E+ +    + 
Sbjct  115  ATRLLNHLRNEAKKTKESNEALHDAIKNMKAEKVELRDERTRLKAEKARIEEMLK--VIS  172

Query  446  AKPASFSHPILNL--EGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P   + P      E   AA  K +P   Y    MWQ+  P  +DTSQDHVL PPVA
Sbjct  173  TTPQFITQPAAATFHETSAAAHSKTIPYPNYLPMGMWQWTAPAAIDTSQDHVLRPPVA  230



>ref|XP_001777933.1| predicted protein [Physcomitrella patens]
 gb|EDQ57257.1| predicted protein [Physcomitrella patens]
Length=172

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 108/174 (62%), Gaps = 9/174 (5%)
 Frame = -2

Query  779  RLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLR  600
            R + E    +G+KACREKMRRD +N+RFLEL +ILEP RPPKTDK  ILS AVR++T LR
Sbjct  1    RSREEISGGAGNKACREKMRRDRLNDRFLELGAILEPGRPPKTDKATILSDAVRILTQLR  60

Query  599  TEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHP  420
             E + L ESN +L E I +LK EK ELR+EK +LK DK +LE QV   AM        HP
Sbjct  61   AEAQGLTESNNQLRETIKDLKNEKNELREEKSRLKADKERLELQVK--AMTIPTRYMPHP  118

Query  419  -------ILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                           A   K   + GY G AMWQ+M P  VDTSQDHVL PPVA
Sbjct  119  AAIHAAAAAFSAQAQAVSTKAAQMAGYSGMAMWQWMSPAAVDTSQDHVLRPPVA  172



>ref|XP_004497838.1| PREDICTED: transcription factor bHLH104-like [Cicer arietinum]
Length=218

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 140/229 (61%), Gaps = 19/229 (8%)
 Frame = -2

Query  953  EMMDDISSAVSATASFPSSATIDFSWVSQTVNYS-STATGSTACQFEDTEVCKEAGSRKR  777
            E+++D +S      SF      DF W + +++      +G  ACQ E+T        RKR
Sbjct  5    ELLEDSASWDFLDYSFIDPPPTDFLWSNSSLSTEIDIPSGVVACQEENT--------RKR  56

Query  776  LKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRT  597
             + E+C  +G+KACREK+RR+ +NERF +LS++LEP RP +TDK AIL  A+RV++ L+T
Sbjct  57   GRTESCYKAGTKACREKLRREKLNERFCDLSAVLEPGRPVRTDKPAILDDAIRVLSQLKT  116

Query  596  EIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPI  417
            E ++LKE+N +LVE+I  LKAEK+ELR+EK  LK DK K+E+Q+    +   PA F  P 
Sbjct  117  EAQELKEANEKLVEEIKCLKAEKIELREEKLVLKADKEKIEKQLKTLPI--SPAGFMPPP  174

Query  416  LNLEGQVAAGKKMMPVVGYPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
            +      A   +M  +  YP +    MWQ++  +  DTSQDH L PP A
Sbjct  175  M-----AAYQARMNKMAVYPNYGYIPMWQYLPHSARDTSQDHELRPPAA  218



>ref|XP_006493504.1| PREDICTED: transcription factor ILR3-like, partial [Citrus sinensis]
Length=157

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = -2

Query  713  LINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKA  534
            ++   FLEL S+LEP RPPKTDK  ILS  VR++  LRTE +KLK+S  +L EKI ELKA
Sbjct  11   ILQRSFLELGSMLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKA  70

Query  533  EKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPV  369
            EK ELRDEKQ+LK DK KLEQQV   AM A      HP         + QVA+  K++P 
Sbjct  71   EKNELRDEKQRLKADKEKLEQQVK--AMSAPSGFLPHPSSMSAAFAAQSQVASN-KLVPF  127

Query  368  VGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +GYPG AMWQFM P  VDTSQDHVL PPVA
Sbjct  128  IGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  157



>ref|XP_010326757.1| PREDICTED: transcription factor bHLH104 [Solanum lycopersicum]
Length=226

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 136/238 (57%), Gaps = 25/238 (11%)
 Frame = -2

Query  977  DSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            D+NW LID+    D  S             IDF W  QT + S+ A           + C
Sbjct  9    DANWDLIDFNSFIDEESP------------IDFFWNDQTQDLSAVAEVEAPLSSAALQEC  56

Query  800  KEAGS-RKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             E    RKR + E+C   G+KACRE++RR+ +NERF +L S+LEP RP KTDK+AIL  A
Sbjct  57   IETECPRKRGRNESCSKQGNKACRERLRREKLNERFSDLCSVLEPGRPVKTDKMAILGDA  116

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +RV+  L+TE E+ KE N +L+E+I  LK EK ELR+EK  L+ DK ++EQ++      A
Sbjct  117  IRVLNQLKTESEEYKEMNQKLMEEIKTLKEEKNELREEKLALRADKERMEQELKAT---A  173

Query  443  KPASF--SHPILNLEGQVAAGK-KMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             PASF   HP      Q A  K  + P  GY    MWQ++QP+  DTSQDH L PP A
Sbjct  174  SPASFIPPHPAA---YQPAVNKMAVFPSYGY--VPMWQYLQPSSRDTSQDHELRPPAA  226



>ref|XP_003568328.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=236

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 135/241 (56%), Gaps = 21/241 (9%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            + WL+DY ++D+                 DF ++      SS   G  A + ED      
Sbjct  8    NGWLLDYGLVDEEIQGS------------DFIYMVDDPAVSSVILGFDAPRKEDGGGLDN  55

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
            +G++KR + E+  P G+KACREK+RRD +NERF EL ++LEP +PPK DK+AIL  A R+
Sbjct  56   SGAKKRSRPESSAPPGTKACREKLRRDRLNERFNELCAVLEPGKPPKADKVAILGDAARL  115

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNG--AAMFAK  441
            +  LR E +KLK+SN  L + I  LK+EK ELRDEK KLK ++ +LEQ + G  AA+ A 
Sbjct  116  LNQLRAEAQKLKKSNESLQDNIKSLKSEKSELRDEKTKLKAERERLEQMLKGATAAVAAP  175

Query  440  PASFSHPI----LNLEGQVAAGKKMMPV--VGY-PGFAMWQFMQPTIVDTSQDHVLHPPV  282
            P    HP      +     A   K +P     Y P  A WQ++ PT +DTS+D    PPV
Sbjct  176  PQFVPHPAAPPHFHPTAAFAQAGKFVPAYTASYPPPAAFWQWIPPTSLDTSKDPAHWPPV  235

Query  281  A  279
            A
Sbjct  236  A  236



>ref|XP_009409051.1| PREDICTED: transcription factor ILR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 126/209 (60%), Gaps = 10/209 (5%)
 Frame = -2

Query  887  DFSWVSQTVN---YSSTATGSTACQFEDTEVCKEAGSRK-RLKLETCIPSGSKACREKMR  720
            DF W ++ ++    SS   G      ED   C   GSRK R ++E+C   G+KACREK+R
Sbjct  17   DFIWDARIIDGPSASSAMLGFDVLSKEDN--CPNNGSRKKRNRVESCAAPGTKACREKLR  74

Query  719  RDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHEL  540
            RD +N+RF EL S+++P +PPKTDK AILS A R++  LR E +KLK+SN    + I  L
Sbjct  75   RDRLNDRFTELCSVMDPGKPPKTDKSAILSDATRLMNHLRLEAKKLKDSNEAFKDAIKSL  134

Query  539  KAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNL--EGQVAAGKKMMPVV  366
            KAEK+ELRDEK +LK +K + EQ +   A+   P   + P         VAA  K +P  
Sbjct  135  KAEKLELRDEKMRLKAEKERTEQMLK--AISTTPQFMTQPAAATPHSASVAAHIKTIPHP  192

Query  365  GYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             Y    MW+++ P  +DTSQDHVL PPVA
Sbjct  193  SYMPMGMWRWIPPAALDTSQDHVLRPPVA  221



>gb|EMT07811.1| Transcription factor ILR3 [Aegilops tauschii]
Length=315

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 115/170 (68%), Gaps = 9/170 (5%)
 Frame = -2

Query  767  ETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIE  588
            ET     SKACREK+RRD +NERFLEL ++L+P + PK DK AIL+ A+R VT LR+E E
Sbjct  148  ETGAQPSSKACREKVRRDKLNERFLELGAVLDPGKTPKIDKCAILNDAIRAVTELRSEAE  207

Query  587  KLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPIL--  414
            KLK+SN  L EKI ELKAEK ELRDEKQKLK +K  LEQQ+    M A+ +   HP +  
Sbjct  208  KLKDSNESLQEKIRELKAEKNELRDEKQKLKAEKESLEQQIK--FMNARQSLVPHPSVIP  265

Query  413  -----NLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                   +GQ A  K MMPV+ YPGF MWQFM P+ VDTS D    PPVA
Sbjct  266  AAAFAAAQGQAAGHKLMMPVMSYPGFPMWQFMPPSDVDTSDDPKSCPPVA  315



>ref|XP_006354504.1| PREDICTED: transcription factor bHLH104-like [Solanum tuberosum]
Length=226

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 137/238 (58%), Gaps = 25/238 (11%)
 Frame = -2

Query  977  DSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVC  801
            D NW LID      I+S +         A IDF W  QT N  + A           + C
Sbjct  9    DVNWDLID------INSFID------EEAPIDFFWNDQTQNLRTVAELEAPLSSAAFQEC  56

Query  800  KEAGS-RKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGA  624
             E    RKR + E+C   G+KACRE++RR+ +NERF +L S+LEP RP KTDK+AIL  A
Sbjct  57   IETEYPRKRGRNESCSKQGNKACRERLRREKLNERFSDLCSVLEPGRPVKTDKMAILGDA  116

Query  623  VRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFA  444
            +RV+  L+TE E+ KE N +L+E+I  LK EK ELR+EK  L+ DK ++EQ++      A
Sbjct  117  IRVLNQLKTESEEYKEMNQKLMEEIKTLKEEKNELREEKLALRADKERMEQELKAT---A  173

Query  443  KPASF--SHPILNLEGQVAAGK-KMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
             PASF   HP      Q A  K  + P  GY    MWQ++QP+  DTSQDH+L PP A
Sbjct  174  SPASFIPPHPAA---YQPAVNKMAVFPSYGY--VPMWQYLQPSSRDTSQDHMLRPPAA  226



>ref|XP_009775135.1| PREDICTED: transcription factor bHLH104 isoform X1 [Nicotiana 
sylvestris]
Length=228

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 137/242 (57%), Gaps = 31/242 (13%)
 Frame = -2

Query  977  DSNW-LIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGS-----TACQFE  816
            D+NW LID               SF   A  DF W  Q  N +  A        ++  F+
Sbjct  9    DNNWDLID-------------INSFIDEAPSDFFWNDQIQNQNQRAVTELEAPLSSATFQ  55

Query  815  DTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAI  636
            + E  +    RKR + E+C   GSKACRE++RR+ +NERF EL S+LEP RP KTDK+AI
Sbjct  56   E-ECIETECPRKRGRNESCSKQGSKACRERLRREKLNERFSELCSVLEPGRPVKTDKMAI  114

Query  635  LSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGA  456
            L  A+RV+  L+TE E+ KE N +L+E+I  LKAEK ELR+EK  LK DK ++EQ++   
Sbjct  115  LGDAIRVLNELKTESEEYKEMNQKLMEEIKTLKAEKNELREEKLALKADKERMEQELKAT  174

Query  455  AMFAKPASF--SHPILNLEGQVAAGK-KMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPP  285
            A    PASF   HP      Q A  K  + P  GY    MWQ++ P+  DTSQDH L PP
Sbjct  175  AT---PASFIPPHPAA---YQPAVNKMAVFPSYGY--VPMWQYLPPSSRDTSQDHALRPP  226

Query  284  VA  279
             A
Sbjct  227  AA  228



>ref|XP_008803703.1| PREDICTED: transcription factor bHLH115-like [Phoenix dactylifera]
Length=230

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 121/192 (63%), Gaps = 14/192 (7%)
 Frame = -2

Query  821  FEDTEVCKEAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKI  642
            + D    ++A  RKR++ E+C    SKACREK+RRD +N+RFLELS+IL+P R PK DK 
Sbjct  42   YRDASGLEQASLRKRMRDESCAGPKSKACREKIRRDRLNDRFLELSAILDPGRHPKFDKA  101

Query  641  AILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVN  462
            +ILS A R++  LR+E ++LKESN +L E I +LK EK ELR+EK +LK DK +LEQQ+ 
Sbjct  102  SILSDAARLLVQLRSEAQQLKESNEKLQETIKDLKVEKNELREEKMRLKADKERLEQQIK  161

Query  461  GAAMFAKPASF-SHPI----------LNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVD  315
               M   PA F  HPI              GQ A   K  P   +PG AMW+++ P +VD
Sbjct  162  --VMSVPPAGFMPHPIAYHPTAATVAFAPHGQ-APPSKCAPFTAFPGVAMWKWLPPPVVD  218

Query  314  TSQDHVLHPPVA  279
            T+QD  L PP A
Sbjct  219  TTQDTKLWPPNA  230



>ref|XP_008803141.1| PREDICTED: transcription factor bHLH115-like [Phoenix dactylifera]
Length=232

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 135/236 (57%), Gaps = 21/236 (9%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTV---NYSSTATGSTACQFEDTEVCK  798
            WL+++ ++D+++ A             DF W  Q V     SS   G    + + +    
Sbjct  12   WLLEFGLVDELNQAS------------DFIWAPQIVENPTASSVIIGFDGLRKDSS--LD  57

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
             + SRKR ++E+C   G+KA REKMRRD +N+RF EL SIL+P RPPK DKIAILS A +
Sbjct  58   NSSSRKRARVESCAAPGTKAGREKMRRDRLNDRFTELCSILDPGRPPKADKIAILSDATQ  117

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            ++  LR E EKL ESN  L + I  LKAEK+ELRDEK +LK +K ++EQ +   + FA P
Sbjct  118  LLNQLRLEAEKLNESNKTLQDAIKSLKAEKLELRDEKVRLKAEKEQMEQMMRSFS-FASP  176

Query  437  ---ASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                  +          AA  K +P   Y   +MWQ++ P  +DTS DHVL PPVA
Sbjct  177  FIPHPAAAAAPFHAASFAACSKTIPYTNYLPTSMWQWIPPAALDTSHDHVLRPPVA  232



>ref|XP_007223393.1| hypothetical protein PRUPE_ppa011217mg [Prunus persica]
 gb|EMJ24592.1| hypothetical protein PRUPE_ppa011217mg [Prunus persica]
Length=219

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 132/211 (63%), Gaps = 18/211 (9%)
 Frame = -2

Query  887  DFSWVSQTVNYSSTATGST--ACQFEDTEVCKEAGSRKRLKLETCIP-SGSKACREKMRR  717
            DF W + T ++      +      F   + C     RKR + ++  P SG+KACREK+RR
Sbjct  19   DFLWPNDTPSFREFEFSAVDVPAAFSPEKEC----PRKRGRTDSSCPGSGAKACREKLRR  74

Query  716  DLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELK  537
            + +N+RF+ELS++LEP RPPK+DK AIL  A+RV+T LR E ++LKE+N +L+E++  LK
Sbjct  75   ERLNDRFVELSAVLEPGRPPKSDKPAILDDAIRVLTQLRAEAQELKETNQKLLEEVKSLK  134

Query  536  AEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF--SHPILNLEGQVAAGKKMMPVVG  363
            AEK ELR+EK  LK DK +LEQQ+ G A+   P+ F  +HP +       A K  M    
Sbjct  135  AEKNELREEKLVLKADKERLEQQLKGMAI--SPSGFVPTHPAVPAAYHPGASKMAM----  188

Query  362  YPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
            YP ++   MW ++ P++ DTS+DH L PP A
Sbjct  189  YPSYSLVPMWHYLPPSVRDTSRDHELRPPAA  219



>ref|XP_009609911.1| PREDICTED: transcription factor bHLH104-like [Nicotiana tomentosiformis]
Length=228

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 130/219 (59%), Gaps = 17/219 (8%)
 Frame = -2

Query  911  SFPSSATIDFSWVSQTVNYSSTATGS-----TACQFEDTEVCKEAGSRKRLKLETCIPSG  747
            SF   A  DF W  Q  N +  A        ++  F++ E  +    RKR + E+C   G
Sbjct  19   SFIDEAPSDFFWNDQIQNQNQRAVAELEAPLSSATFQE-ECIETECPRKRGRNESCSKQG  77

Query  746  SKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNL  567
            +KACRE++RR+ +NERF EL S+LEP RP KTDK+AIL  A+RV+  L+TE E+ KE N 
Sbjct  78   NKACRERLRREKLNERFSELCSVLEPGRPVKTDKMAILGDAIRVLNELKTESEEYKEINQ  137

Query  566  ELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF--SHPILNLEGQVA  393
            +L+E+I  LKAEK ELR+EK  LK DK ++EQ++   A    PASF   HP      Q A
Sbjct  138  KLMEEIKTLKAEKNELREEKLALKADKERMEQELKATAT---PASFIPPHPAA---YQPA  191

Query  392  AGK-KMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              K  + P  GY    MWQ++ P+  DTSQDH L PP A
Sbjct  192  VNKMAVFPSYGY--VPMWQYLPPSSRDTSQDHALRPPAA  228



>ref|XP_003590056.1| Transcription factor bHLH104 [Medicago truncatula]
 gb|AES60307.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AET08955.1| basic helix-loop-helix transcription factor [Medicago truncatula]
Length=246

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 133/220 (60%), Gaps = 22/220 (10%)
 Frame = -2

Query  884  FSWVSQTVNYSS---TATGSTACQFEDTE--------------VCKEAGSRKRLKLETCI  756
            F W +   + S+    ++   ACQ E+T               VC+E  +RKR + E+C 
Sbjct  31   FLWSNSNPSVSTEFDISSNVVACQEENTRKSVSTETDIPSGAVVCQEENTRKRGRTESCY  90

Query  755  PSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKE  576
             +G+KACREK+RR+ +NERF +LS++LEP RP +TDK AIL  A+RV++ L+TE ++LKE
Sbjct  91   KAGTKACREKLRREKLNERFCDLSAVLEPGRPVRTDKPAILDDAIRVLSQLKTEAQELKE  150

Query  575  SNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQV  396
            SN +L+E+I  LKAEK ELR+EK  LK DK K+E+Q+   +M   PA F  P      Q 
Sbjct  151  SNEKLLEEIKCLKAEKNELREEKLVLKADKEKIEKQLK--SMPVSPAGFMPPPPMAAYQA  208

Query  395  AAGK-KMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +  K  + P  GY    MW ++  +  DTSQDH L PP A
Sbjct  209  SVNKMAVYPNYGY--IPMWHYLPQSARDTSQDHELRPPAA  246



>ref|XP_009409049.1| PREDICTED: transcription factor bHLH115-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409050.1| PREDICTED: transcription factor bHLH115-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=225

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 127/213 (60%), Gaps = 14/213 (7%)
 Frame = -2

Query  887  DFSWVSQTVN---YSSTATGSTACQFEDTEVCKEAGSRK-RLKLETCIPSGSKACREKMR  720
            DF W ++ ++    SS   G      ED   C   GSRK R ++E+C   G+KACREK+R
Sbjct  17   DFIWDARIIDGPSASSAMLGFDVLSKEDN--CPNNGSRKKRNRVESCAAPGTKACREKLR  74

Query  719  RDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKI---  549
            RD +N+RF EL S+++P +PPKTDK AILS A R++  LR E +KLK+SN    + I   
Sbjct  75   RDRLNDRFTELCSVMDPGKPPKTDKSAILSDATRLMNHLRLEAKKLKDSNEAFKDAIKSL  134

Query  548  -HELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNL--EGQVAAGKKM  378
             H L+AEK+ELRDEK +LK +K + EQ +   A+   P   + P         VAA  K 
Sbjct  135  KHALQAEKLELRDEKMRLKAEKERTEQMLK--AISTTPQFMTQPAAATPHSASVAAHIKT  192

Query  377  MPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            +P   Y    MW+++ P  +DTSQDHVL PPVA
Sbjct  193  IPHPSYMPMGMWRWIPPAALDTSQDHVLRPPVA  225



>ref|XP_007145840.1| hypothetical protein PHAVU_007G272600g [Phaseolus vulgaris]
 gb|ESW17834.1| hypothetical protein PHAVU_007G272600g [Phaseolus vulgaris]
Length=217

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 132/226 (58%), Gaps = 15/226 (7%)
 Frame = -2

Query  947  MDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKL  768
            +DD S       SF   A  DF W + ++        ST     D     E   +KR++ 
Sbjct  4    LDDTSCWDFLDYSFIDQAPSDFLWPNHSL--------STEIDIPDDAAACEENIKKRVRT  55

Query  767  ETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIE  588
            ++C  +GSKACREK+RR+ +NERF +LSS+LEP RP +TDK +IL  A+RV++ L+TE E
Sbjct  56   DSCCKAGSKACREKLRRERLNERFCDLSSVLEPGRPLRTDKPSILDDAIRVLSQLKTEAE  115

Query  587  KLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNL  408
            +LK  N +L+E+I  LKAEK ELR+EK  LK DK ++E+Q+   +M   PA F  P +  
Sbjct  116  ELKTKNEKLLEEIKCLKAEKNELREEKLVLKADKERIEKQLK--SMPVAPAGFMAPPVAA  173

Query  407  EGQVAAGKKMMPVVGYPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
                 AG   M V  YP +    MWQ++  +  DTSQDH L PP A
Sbjct  174  AAAYQAGVNKMAV--YPNYGYIPMWQYLPQSARDTSQDHELRPPAA  217



>ref|XP_008224372.1| PREDICTED: transcription factor bHLH104 [Prunus mume]
Length=223

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 132/211 (63%), Gaps = 18/211 (9%)
 Frame = -2

Query  887  DFSWVSQTVNYSSTATGST--ACQFEDTEVCKEAGSRKRLKLET-CIPSGSKACREKMRR  717
            DF W + T ++      +      F   + C     RKR + ++ C  SG+KACREK+RR
Sbjct  23   DFLWPNDTPSFREFEFSAVDVPAAFSPEKEC----PRKRGRTDSSCSGSGAKACREKLRR  78

Query  716  DLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELK  537
            + +N+RF+ELS++LEP RPPK+DK AIL  A+RV+T LR E ++LKE+N +L+E++  LK
Sbjct  79   ERLNDRFVELSAVLEPGRPPKSDKPAILDDAIRVLTQLRAEAQELKETNEKLLEEVKSLK  138

Query  536  AEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF--SHPILNLEGQVAAGKKMMPVVG  363
            AEK ELR+EK  LK DK +LE+Q+ G A+   P+ F  +HP +       A K  M    
Sbjct  139  AEKNELREEKLVLKADKERLEKQLKGMAI--SPSGFVPTHPAVPAAYHPGASKMAM----  192

Query  362  YPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
            YP ++   MW ++ P++ DTS+DH L PP A
Sbjct  193  YPSYSLVPMWHYLPPSVRDTSRDHELRPPAA  223



>ref|XP_006420196.1| hypothetical protein CICLE_v10005872mg [Citrus clementina]
 gb|ESR33436.1| hypothetical protein CICLE_v10005872mg [Citrus clementina]
 gb|KDO57624.1| hypothetical protein CISIN_1g028060mg [Citrus sinensis]
Length=200

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 130/212 (61%), Gaps = 23/212 (11%)
 Frame = -2

Query  890  IDFSW-----VSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREK  726
            I+F++     +S + +   ++TG    + E+T        RKR + ++C   GSKACREK
Sbjct  4    IEFNFCVNAKISGSADNDISSTGVVPPENENT--------RKRARSDSCSRPGSKACREK  55

Query  725  MRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIH  546
            +RR+ +N+RFL+LS ILEP RP +TDK AIL  A+RV+  LRTE ++LKE+N +L E+I 
Sbjct  56   LRRERLNDRFLDLSCILEPGRPARTDKPAILDDAIRVLNQLRTESQELKETNEKLQEEIK  115

Query  545  ELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPILNLEGQVAAGKKMMPVV  366
             LKAEK ELR+EK  LK DK KLEQQ+   AM       +HP         AG   M V 
Sbjct  116  SLKAEKNELREEKLILKADKEKLEQQLKVMAMPTGGYMPTHP-----AAYHAGLNKMAV-  169

Query  365  GYPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
             YP +    MWQ++ P++ DTS+DH L PP A
Sbjct  170  -YPSYGLMPMWQYLPPSLHDTSRDHELRPPAA  200



>ref|XP_010937539.1| PREDICTED: transcription factor ILR3-like isoform X2 [Elaeis 
guineensis]
Length=229

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 132/233 (57%), Gaps = 25/233 (11%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAG  789
            WL+++ ++D+++ A             DF W  + V   + +  S+            + 
Sbjct  19   WLLEFGLVDELNQAS------------DFIWAPKIVEKPTASRDSS---------LDNSS  57

Query  788  SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVT  609
            SRKR ++E+C  +G+KA REKMRRD +N+RF EL SIL+P RPPK DKIAILS A  ++ 
Sbjct  58   SRKRGRVESCSAAGTKAGREKMRRDRLNDRFTELCSILDPGRPPKADKIAILSDATHLLN  117

Query  608  SLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP---  438
             L  E EKLKESN  L + I  LKAEK+ELRDEK +LK +K ++EQ + G ++ A P   
Sbjct  118  QLHLEAEKLKESNETLQDAIKSLKAEKLELRDEKVRLKAEKERMEQMLRGFSL-ASPFVP  176

Query  437  ASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
               +          AA  K +P   Y    MWQ+M P  +DTSQD  L PPVA
Sbjct  177  HPAAAAATFHAASFAACSKTIPYTNYLPTCMWQWMPPAALDTSQDLALRPPVA  229



>gb|KDO50387.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
 gb|KDO50388.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
 gb|KDO50389.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
Length=136

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 96/139 (69%), Gaps = 8/139 (6%)
 Frame = -2

Query  680  ILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQK  501
            +LEP RPPKTDK  ILS  VR++  LRTE +KLK+S  +L EKI ELKAEK ELRDEKQ+
Sbjct  1    MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQR  60

Query  500  LKEDKMKLEQQVNGAAMFAKPASFSHP-----ILNLEGQVAAGKKMMPVVGYPGFAMWQF  336
            LK DK KLEQQV   AM A      HP         + QVA+  K++P +GYPG AMWQF
Sbjct  61   LKADKEKLEQQVK--AMSAPSGFLPHPSSMSAAFAAQSQVASN-KLVPFIGYPGVAMWQF  117

Query  335  MQPTIVDTSQDHVLHPPVA  279
            M P  VDTSQDHVL PPVA
Sbjct  118  MPPAAVDTSQDHVLRPPVA  136



>ref|XP_010937538.1| PREDICTED: transcription factor bHLH115-like isoform X1 [Elaeis 
guineensis]
Length=239

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 133/236 (56%), Gaps = 21/236 (9%)
 Frame = -2

Query  968  WLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTV---NYSSTATGSTACQFEDTEVCK  798
            WL+++ ++D+++ A             DF W  + V     S    G    + + +    
Sbjct  19   WLLEFGLVDELNQAS------------DFIWAPKIVEKPTASRVIIGFDGLRRDSS--LD  64

Query  797  EAGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
             + SRKR ++E+C  +G+KA REKMRRD +N+RF EL SIL+P RPPK DKIAILS A  
Sbjct  65   NSSSRKRGRVESCSAAGTKAGREKMRRDRLNDRFTELCSILDPGRPPKADKIAILSDATH  124

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            ++  L  E EKLKESN  L + I  LKAEK+ELRDEK +LK +K ++EQ + G ++ A P
Sbjct  125  LLNQLHLEAEKLKESNETLQDAIKSLKAEKLELRDEKVRLKAEKERMEQMLRGFSL-ASP  183

Query  437  ---ASFSHPILNLEGQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                  +          AA  K +P   Y    MWQ+M P  +DTSQD  L PPVA
Sbjct  184  FVPHPAAAAATFHAASFAACSKTIPYTNYLPTCMWQWMPPAALDTSQDLALRPPVA  239



>ref|XP_006378346.1| hypothetical protein POPTR_0010s08360g [Populus trichocarpa]
 gb|ERP56143.1| hypothetical protein POPTR_0010s08360g [Populus trichocarpa]
Length=218

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 113/171 (66%), Gaps = 6/171 (4%)
 Frame = -2

Query  788  SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVT  609
            SRKR + + C  +G+KACREK+RR+ +N+RF +LSS+LEP RP KTDK AIL  A+RV+ 
Sbjct  53   SRKRERSDLCSRAGTKACREKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIRVLN  112

Query  608  SLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF  429
             L+ E ++LKE+N +L+E+I  LKAEK ELR+EK  LK DK K+EQQ+   A+   P S 
Sbjct  113  QLKNEAQELKETNEKLLEEIRSLKAEKTELREEKLMLKADKEKMEQQLKTLAL---PTSG  169

Query  428  SHPILNLEGQVAAGKKMMPVV-GYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P        AA K  +PV  GY    MW ++ PT  DTS+DH L PP A
Sbjct  170  FMPTYPAAYHAAANK--IPVFPGYGLMPMWHYLPPTACDTSRDHELRPPAA  218



>ref|XP_002314636.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF00807.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=221

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 113/171 (66%), Gaps = 6/171 (4%)
 Frame = -2

Query  788  SRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVT  609
            SRKR + + C  +G+KACREK+RR+ +N+RF +LSS+LEP RP KTDK AIL  A+RV+ 
Sbjct  56   SRKRERSDLCSRAGTKACREKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIRVLN  115

Query  608  SLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF  429
             L+ E ++LKE+N +L+E+I  LKAEK ELR+EK  LK DK K+EQQ+   A+   P S 
Sbjct  116  QLKNEAQELKETNEKLLEEIRSLKAEKTELREEKLMLKADKEKMEQQLKTLAL---PTSG  172

Query  428  SHPILNLEGQVAAGKKMMPVV-GYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
              P        AA K  +PV  GY    MW ++ PT  DTS+DH L PP A
Sbjct  173  FMPTYPAAYHAAANK--IPVFPGYGLMPMWHYLPPTACDTSRDHELRPPAA  221



>ref|XP_011073517.1| PREDICTED: transcription factor bHLH104 [Sesamum indicum]
Length=236

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 126/213 (59%), Gaps = 20/213 (9%)
 Frame = -2

Query  887  DFSWVSQ--------TVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACR  732
            D  W  Q         ++ S   T S A +  +   C+    RKR + + C  +GSKACR
Sbjct  34   DICWNPQPTTQNGDVAIDASLGGTSSQARECVEERECR----RKRGRSDECGGTGSKACR  89

Query  731  EKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEK  552
            E+MRR+ +N+RF ELS+ILEP RP KTDK+AIL  A+R++  L+TE ++ KE N +L+E+
Sbjct  90   ERMRREKLNDRFSELSTILEPGRPMKTDKLAILGDAIRILNQLKTESQEYKEMNEKLLEE  149

Query  551  IHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF--SHPILNLEGQVAAGKKM  378
            I  LKAEK ELR+EK  LK DK ++EQQ+    M   P+ F  +HP +   G      KM
Sbjct  150  IKTLKAEKNELREEKLVLKADKERIEQQLK--TMAIPPSGFMPAHPSIYQTG----ANKM  203

Query  377  MPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
                GY    MWQ++ P+  DTSQDH L PP A
Sbjct  204  AMFPGYGLVPMWQYLPPSARDTSQDHELRPPAA  236



>ref|XP_004961887.1| PREDICTED: transcription factor ILR3-like [Setaria italica]
Length=232

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 136/242 (56%), Gaps = 27/242 (11%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
              WL+DY ++++                 +F ++      SS   G  A + ED  V   
Sbjct  8    GGWLLDYGLVEEEIQGS------------EFMYMVDDPAVSSVILGFDAPRKEDG-VQDN  54

Query  794  AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRV  615
             G++KR + E+  P G+KACREK+RRD +NERF EL +ILEP +PPK DK+AILS A R+
Sbjct  55   PGAKKRSRPESSAPPGTKACREKLRRDRLNERFNELCAILEPGKPPKADKVAILSDAARL  114

Query  614  VTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAA------  453
            ++ LR E +KLK+SN  L + I  LKAEK ELRDEK +LK ++ +LEQ + G +      
Sbjct  115  LSQLRAEAQKLKQSNESLQDSIKSLKAEKSELRDEKTRLKAERERLEQMLKGVSAAAAPA  174

Query  452  MFAKPASFSHPILNLEGQVAAGKKMMPVVGYPGF----AMWQFMQPTIVDTSQDHVLHPP  285
             F    + + P  +    V AGK     V YP +    A WQ++ PT +DTS+D    PP
Sbjct  175  PFVPHPAATGPSFHPAAFVQAGK----FVTYPSYAPPPAFWQWIPPTSLDTSKDPAHWPP  230

Query  284  VA  279
            VA
Sbjct  231  VA  232



>ref|XP_004296358.1| PREDICTED: transcription factor bHLH104-like [Fragaria vesca 
subsp. vesca]
Length=231

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 131/214 (61%), Gaps = 21/214 (10%)
 Frame = -2

Query  905  PSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKEAGSRKRLKLETCIPSGSKACREK  726
            PS   I+FS      N    A+ + + Q ++ E      SRKR + E+   SG+KACREK
Sbjct  34   PSFHEIEFS-----ANSGVAASAAPSSQTQEKEC-----SRKRGRTESWCGSGAKACREK  83

Query  725  MRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIH  546
            +RR+ +N++FL+LS++LEP RP KTDK AIL  A+RV+T LR E ++L ++N +L+E+I 
Sbjct  84   LRRERLNDKFLDLSAVLEPGRPAKTDKPAILDDAIRVLTQLRAEAQELTQTNEKLLEEIK  143

Query  545  ELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASF--SHPILNLEGQVAAGKKMMP  372
             LKAEK ELR+EK  LK DK +LEQQ+   AM   P+ F  +HP +       A K    
Sbjct  144  SLKAEKSELREEKVVLKADKERLEQQLK--AMTIPPSGFMPAHPAVPAAYHPGASK----  197

Query  371  VVGYPGFA---MWQFMQPTIVDTSQDHVLHPPVA  279
            +  YP +    MW ++ P+  DTS+DH L PP A
Sbjct  198  MAVYPSYGMIPMWHYLPPSTRDTSRDHELRPPAA  231



>gb|ACL54160.1| unknown [Zea mays]
 gb|ACN26446.1| unknown [Zea mays]
 gb|AFW57419.1| putative HLH DNA-binding domain superfamily protein isoform 1 
[Zea mays]
 gb|AFW57420.1| putative HLH DNA-binding domain superfamily protein isoform 2 
[Zea mays]
Length=160

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 103/162 (64%), Gaps = 15/162 (9%)
 Frame = -2

Query  725  MRRDLINERFLELSSILEPTRPPKTDKIAILSGAVRVVTSLRTEIEKLKESNLELVEKIH  546
            MRR+ +N+RFLEL S LEP +P K DK AILS A R+V  LR+E ++LKE+N  L EKI 
Sbjct  1    MRRNKLNDRFLELGSTLEPGKPVKADKAAILSDATRMVIQLRSEAQQLKETNGSLEEKIK  60

Query  545  ELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKPASFSHPIL-------------NLE  405
            ELKAEK ELRDEKQKLK +K  LE Q+    M + P    HP L             + +
Sbjct  61   ELKAEKDELRDEKQKLKLEKESLEHQMK--LMTSTPTYMPHPTLMPAPFPQAPLAPFHAQ  118

Query  404  GQVAAGKKMMPVVGYPGFAMWQFMQPTIVDTSQDHVLHPPVA  279
            GQ A  K MMP V YPG+ MWQFM P+ VDTS+D    PPVA
Sbjct  119  GQAAGQKLMMPFVSYPGYPMWQFMPPSEVDTSKDSEACPPVA  160



>dbj|BAJ87023.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 137/243 (56%), Gaps = 23/243 (9%)
 Frame = -2

Query  974  SNWLIDYEMMDDISSAVSATASFPSSATIDFSWVSQTVNYSSTATGSTACQFEDTEVCKE  795
            S WL+DY ++++   A             DF ++      SS   G  A + ED    ++
Sbjct  8    SGWLLDYGLVEEEIQAS------------DFIYMVDDPPVSSAMLGFDAPRKEDAAAARD  55

Query  794  -AGSRKRLKLETCIPSGSKACREKMRRDLINERFLELSSILEPTRPPKTDKIAILSGAVR  618
             +G++KR + E+    G+KACREK+RRD +NERF EL ++LEP +PPK DK+AILS A R
Sbjct  56   NSGAKKRSRPESSAQPGTKACREKLRRDRLNERFNELCAVLEPGKPPKADKVAILSDATR  115

Query  617  VVTSLRTEIEKLKESNLELVEKIHELKAEKMELRDEKQKLKEDKMKLEQQVNGAAMFAKP  438
            ++  LR E ++LK SN  L + I  LK+EK ELRDEK KLK ++ +LEQ + G +  A P
Sbjct  116  LLDQLRAEAQQLKSSNESLQDSIKSLKSEKSELRDEKTKLKAERERLEQMLKGVSAAAAP  175

Query  437  ASF-------SHPILNLEGQVAAGKKMMP--VVGY-PGFAMWQFMQPTIVDTSQDHVLHP  288
              F       + P  +     A   K +P    GY P  A WQ++ PT +DTS+D    P
Sbjct  176  RQFIPHPAAAAAPQFHPAAAFAHAGKFVPAYAAGYPPPAAFWQWIPPTSLDTSKDPAHWP  235

Query  287  PVA  279
            PVA
Sbjct  236  PVA  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2752291252704