BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31679_g1_i1 len=1003 path=[1:0-1002]

Length=1003
                                                                      Score     E

ref|XP_009801737.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    142   4e-37   
emb|CDP07388.1|  unnamed protein product                                133   4e-34   
ref|XP_009779346.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    133   6e-34   
ref|NP_001234377.1|  DNAJ-like protein                                  132   9e-34   
ref|XP_009766377.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    129   2e-32   
ref|XP_009625709.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    129   3e-32   
ref|XP_002301971.1|  hypothetical protein POPTR_0002s02240g             129   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002274505.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    127   1e-31   Vitis vinifera
ref|XP_006342061.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    127   1e-31   
ref|XP_002265844.2|  PREDICTED: chaperone protein dnaJ 11, chloro...    127   1e-31   Vitis vinifera
gb|ABK96283.1|  unknown                                                 127   1e-31   Populus trichocarpa x Populus deltoides
ref|XP_002301970.1|  hypothetical protein POPTR_0002s02220g             127   1e-31   Populus trichocarpa [western balsam poplar]
gb|KDP36913.1|  hypothetical protein JCGZ_08204                         125   8e-31   
ref|XP_007017815.1|  Chaperone DnaJ-domain superfamily protein, p...    124   2e-30   
ref|NP_001241283.1|  uncharacterized protein LOC100800959               123   2e-30   
ref|XP_007157915.1|  hypothetical protein PHAVU_002G108600g             121   1e-29   
gb|AAB36543.1|  DnaJ-like protein                                       121   1e-29   Phaseolus vulgaris [French bean]
ref|XP_003517172.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    120   3e-29   
gb|AET03791.2|  chaperone DnaJ domain protein                           120   3e-29   
ref|XP_004134859.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    120   4e-29   
gb|KDO84881.1|  hypothetical protein CISIN_1g030733mg                   120   5e-29   
ref|XP_008440823.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    120   6e-29   
ref|XP_002306936.1|  hypothetical protein POPTR_0005s26220g             120   6e-29   Populus trichocarpa [western balsam poplar]
ref|XP_003612176.1|  Chaperone protein dnaJ                             119   8e-29   
ref|XP_011045071.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    119   1e-28   
ref|XP_009363492.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    119   1e-28   
ref|XP_008241825.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    118   2e-28   
ref|XP_006435191.1|  hypothetical protein CICLE_v10002683mg             119   2e-28   
ref|XP_007202710.1|  hypothetical protein PRUPE_ppa012770mg             118   3e-28   
ref|XP_003629315.1|  Chaperone protein dnaJ                             118   3e-28   
ref|XP_008377137.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    117   4e-28   
gb|AFK38004.1|  unknown                                                 117   6e-28   
ref|XP_009379401.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    117   8e-28   
ref|XP_011029033.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    117   8e-28   
gb|EYU38799.1|  hypothetical protein MIMGU_mgv1a015308mg                116   1e-27   
ref|XP_004512137.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    116   1e-27   
ref|XP_008394321.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    115   2e-27   
ref|XP_010691874.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    116   2e-27   
ref|XP_004509362.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    116   2e-27   
ref|XP_010104467.1|  Chaperone protein dnaJ 11                          115   2e-27   
ref|XP_009334954.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    115   3e-27   
ref|XP_003612178.1|  DnaJ-like protein                                  115   4e-27   
gb|EYU36790.1|  hypothetical protein MIMGU_mgv1a015569mg                114   5e-27   
ref|XP_010042756.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    114   6e-27   
ref|XP_008337119.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    114   8e-27   
ref|XP_011029032.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    114   8e-27   
ref|XP_008221249.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    114   1e-26   
ref|XP_008366742.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    113   1e-26   
ref|XP_003547933.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    113   1e-26   
ref|XP_010069818.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    113   2e-26   
gb|EPS74128.1|  hypothetical protein M569_00628                         112   2e-26   
ref|XP_007223654.1|  hypothetical protein PRUPE_ppa012765mg             112   2e-26   
gb|KHN01597.1|  Chaperone protein dnaJ 11, chloroplastic                112   3e-26   
ref|XP_003612179.1|  Chaperone protein dnaJ                             112   3e-26   
ref|XP_003548847.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    112   3e-26   
ref|XP_002521655.1|  Chaperone protein dnaJ 11, chloroplast precu...    112   3e-26   Ricinus communis
ref|XP_011083572.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    112   4e-26   
ref|XP_002510545.1|  Chaperone protein dnaJ 11, chloroplast precu...    112   5e-26   Ricinus communis
ref|XP_010679930.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    112   5e-26   
ref|XP_010113343.1|  Chaperone protein dnaJ 11                          112   5e-26   
ref|XP_009386190.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    111   5e-26   
ref|XP_007046689.1|  Chaperone DnaJ-domain superfamily protein, p...    112   5e-26   
ref|XP_002277590.3|  PREDICTED: chaperone protein dnaJ 11, chloro...    111   6e-26   Vitis vinifera
ref|XP_006425455.1|  hypothetical protein CICLE_v10026825mg             109   1e-25   
ref|XP_008653416.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    110   1e-25   
ref|XP_006383098.1|  DnaJ-like family protein                           110   1e-25   
ref|XP_011043186.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    110   2e-25   
ref|NP_179378.1|  DNAJ heat shock N-terminal domain-containing pr...    109   4e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96182.1|  predicted protein                                      108   5e-25   
ref|XP_002305500.2|  hypothetical protein POPTR_0004s17810g             108   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009401913.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    109   7e-25   
emb|CAN73239.1|  hypothetical protein VITISV_035335                     114   8e-25   Vitis vinifera
ref|XP_004291355.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    108   9e-25   
ref|XP_009782440.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    107   1e-24   
ref|XP_009611393.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    108   1e-24   
ref|XP_010041102.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    107   2e-24   
ref|XP_010437388.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    107   2e-24   
ref|XP_010531087.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    107   2e-24   
ref|XP_008788382.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    107   2e-24   
gb|KDP46757.1|  hypothetical protein JCGZ_06545                         107   2e-24   
ref|XP_002886134.1|  hypothetical protein ARALYDRAFT_480688             107   2e-24   
ref|XP_006574675.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    105   2e-24   
ref|XP_009618358.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    107   3e-24   
ref|XP_002528286.1|  Chaperone protein dnaJ 11, chloroplast precu...    105   4e-24   Ricinus communis
ref|XP_006422640.1|  hypothetical protein CICLE_v10029600mg             105   4e-24   
ref|XP_004292163.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    104   5e-24   
emb|CDY30342.1|  BnaA09g09350D                                          105   7e-24   
ref|XP_004985025.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    105   8e-24   
emb|CDX72573.1|  BnaC07g45950D                                          105   1e-23   
ref|NP_001236960.1|  uncharacterized protein LOC100305807               103   1e-23   
ref|XP_011002000.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    103   1e-23   
gb|KFK30236.1|  hypothetical protein AALP_AA7G235200                    105   1e-23   
ref|XP_010446825.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    105   1e-23   
ref|XP_010268660.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    105   1e-23   
ref|XP_010446837.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    105   2e-23   
ref|NP_195328.1|  chaperone protein dnaJ 11                             105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235989.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    103   2e-23   
emb|CAC03599.1|  J11 protein                                            104   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284661.1|  hypothetical protein CARUB_v10005918mg             104   2e-23   
dbj|BAJ34233.1|  unnamed protein product                                104   3e-23   
ref|XP_009412902.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    103   4e-23   
emb|CDP01896.1|  unnamed protein product                                104   4e-23   
ref|NP_001239933.1|  uncharacterized protein LOC100798520               102   5e-23   
ref|XP_007041894.1|  Chaperone DnaJ-domain superfamily protein          102   5e-23   
ref|XP_002465568.1|  hypothetical protein SORBIDRAFT_01g041250          103   8e-23   Sorghum bicolor [broomcorn]
ref|XP_008457665.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   9e-23   
gb|KDP20408.1|  hypothetical protein JCGZ_06367                         101   9e-23   
ref|XP_010228886.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    103   1e-22   
ref|XP_002867039.1|  DNAJ heat shock N-terminal domain-containing...    102   1e-22   
ref|XP_006409224.1|  hypothetical protein EUTSA_v10022892mg             102   1e-22   
emb|CDY26834.1|  BnaC09g09610D                                          102   1e-22   
ref|XP_010034692.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   1e-22   
ref|XP_009147799.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   1e-22   
ref|XP_007131691.1|  hypothetical protein PHAVU_011G033800g             100   1e-22   
ref|XP_008781007.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   2e-22   
ref|XP_010029676.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   2e-22   
ref|NP_001173344.1|  Os03g0244950                                       102   2e-22   
ref|XP_004287809.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   2e-22   
ref|XP_007200212.1|  hypothetical protein PRUPE_ppa015688mg             100   2e-22   
gb|EAZ07898.1|  hypothetical protein OsI_30153                          101   2e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAJ95160.1|  predicted protein                                      102   2e-22   
ref|NP_001062435.2|  Os08g0548400                                       101   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74856.1|  hypothetical protein OsI_10727                          102   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_009138405.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    101   2e-22   
gb|AFC01202.1|  heat shock protein                                      102   2e-22   
ref|XP_006299674.1|  hypothetical protein CARUB_v10015866mg             101   3e-22   
ref|XP_010920182.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   3e-22   
emb|CDX69193.1|  BnaC01g02600D                                          101   3e-22   
ref|XP_010934179.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    102   3e-22   
gb|EEE58684.1|  hypothetical protein OsJ_10115                          102   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009784395.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    101   4e-22   
ref|XP_010028702.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    101   4e-22   
ref|XP_004147068.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  99.8    4e-22   
ref|XP_006851919.1|  hypothetical protein AMTR_s00041p00168770          100   5e-22   
ref|XP_009112461.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    100   5e-22   
ref|XP_010935074.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    100   5e-22   
emb|CDY24828.1|  BnaA08g14820D                                          100   5e-22   
gb|KGN61913.1|  hypothetical protein Csa_2G264570                       100   6e-22   
gb|KFK40165.1|  hypothetical protein AALP_AA3G339100                    100   7e-22   
gb|KCW55495.1|  hypothetical protein EUGRSUZ_I01393                     102   8e-22   
ref|XP_009109258.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    100   8e-22   
ref|XP_008375105.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  98.6    1e-21   
ref|XP_010413346.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    100   1e-21   
emb|CDX75547.1|  BnaA01g01550D                                        99.8    1e-21   
ref|XP_004232493.1|  PREDICTED: chaperone protein dnaJ 11, chloro...    100   1e-21   
ref|XP_002313725.1|  hypothetical protein POPTR_0009s13440g           98.2    1e-21   Populus trichocarpa [western balsam poplar]
gb|KHN41895.1|  Chaperone protein dnaJ 11, chloroplastic              99.0    1e-21   
ref|XP_010271559.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  99.8    2e-21   
emb|CDY34072.1|  BnaC03g62600D                                        98.6    4e-21   
gb|ACN28370.1|  unknown                                               97.8    4e-21   Zea mays [maize]
ref|XP_006847076.1|  hypothetical protein AMTR_s00017p00209650        97.4    4e-21   
ref|XP_010467587.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  97.8    6e-21   
ref|XP_010526799.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  97.8    6e-21   
ref|XP_006361931.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  97.4    7e-21   
emb|CBI37900.3|  unnamed protein product                              97.1    7e-21   
tpg|DAA64525.1|  TPA: DnaJ                                            97.4    7e-21   
ref|XP_008788620.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  97.4    8e-21   
ref|XP_003574898.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  97.1    8e-21   
ref|XP_002974218.1|  hypothetical protein SELMODRAFT_100874           95.5    1e-20   
emb|CDY29205.1|  BnaA06g25520D                                        95.9    3e-20   
ref|XP_010489427.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  95.9    3e-20   
ref|XP_003533165.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  95.1    3e-20   
emb|CBI19879.3|  unnamed protein product                              97.4    3e-20   
gb|KHN36030.1|  Chaperone protein dnaJ 11, chloroplastic              94.7    4e-20   
ref|XP_007156132.1|  hypothetical protein PHAVU_003G261300g           95.1    4e-20   
ref|XP_009383308.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  95.1    4e-20   
ref|NP_001151820.1|  chaperone protein dnaJ 11                        94.4    6e-20   Zea mays [maize]
emb|CDY07811.1|  BnaC03g48110D                                        94.7    6e-20   
ref|XP_009124576.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  94.7    8e-20   
ref|XP_004233983.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  94.4    8e-20   
dbj|BAJ95674.1|  predicted protein                                    93.6    1e-19   
ref|XP_003544555.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  92.4    3e-19   
ref|XP_004974140.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  92.4    3e-19   
ref|XP_010941292.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  92.8    4e-19   
ref|NP_001058589.1|  Os06g0716100                                     91.7    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400352.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  92.0    6e-19   
ref|XP_010090310.1|  Chaperone protein dnaJ 11                        90.9    6e-19   
ref|NP_001147476.1|  chaperone protein dnaJ 11                        90.9    7e-19   Zea mays [maize]
gb|ABR18263.1|  unknown                                               92.8    7e-19   Picea sitchensis
ref|XP_004134860.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  91.7    8e-19   
ref|XP_010552334.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  91.7    8e-19   
ref|XP_009392102.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  90.5    1e-18   
ref|XP_002445743.1|  hypothetical protein SORBIDRAFT_07g024945        91.3    1e-18   Sorghum bicolor [broomcorn]
ref|NP_001147752.1|  chaperone protein dnaJ 11                        90.5    1e-18   Zea mays [maize]
gb|AFW69512.1|  chaperone protein dnaJ 11                             90.1    1e-18   
ref|XP_006474793.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  90.5    2e-18   
gb|AFG54479.1|  hypothetical protein 0_11756_01                       89.7    2e-18   
ref|XP_010272528.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  90.5    2e-18   
ref|XP_003563273.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  89.7    2e-18   
ref|XP_006851920.1|  hypothetical protein AMTR_s00041p00169040        89.4    4e-18   
gb|EPS66636.1|  hypothetical protein M569_08141                       88.6    4e-18   
ref|XP_004966466.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  88.6    5e-18   
dbj|BAJ97507.1|  predicted protein                                    89.0    5e-18   
ref|XP_007142460.1|  hypothetical protein PHAVU_008G282500g           89.0    6e-18   
ref|XP_004500165.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  88.6    1e-17   
ref|NP_001144979.1|  uncharacterized protein LOC100278133             88.2    1e-17   Zea mays [maize]
ref|XP_006377981.1|  DNAJ heat shock N-terminal domain-containing...  89.0    1e-17   
ref|XP_003600440.1|  Chaperone protein dnaJ                           88.6    1e-17   
ref|XP_009418213.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.4    1e-17   
ref|XP_009391200.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.8    1e-17   
ref|XP_008808640.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  86.7    2e-17   
ref|XP_003551367.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.4    2e-17   
ref|XP_010500313.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.8    2e-17   
ref|XP_010253033.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.0    2e-17   
ref|XP_010487083.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.8    2e-17   
ref|XP_003528478.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.0    2e-17   
ref|XP_010465160.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  87.4    3e-17   
gb|EMT12125.1|  Chaperone protein dnaJ 11, chloroplastic              85.9    3e-17   
ref|XP_006407237.1|  hypothetical protein EUTSA_v10021681mg           87.0    3e-17   
ref|XP_002437597.1|  hypothetical protein SORBIDRAFT_10g030200        86.7    3e-17   Sorghum bicolor [broomcorn]
ref|XP_010092380.1|  Chaperone protein dnaJ 11                        87.0    4e-17   
ref|XP_002530622.1|  chaperone protein DNAj, putative                 87.0    5e-17   Ricinus communis
ref|XP_003519866.1|  PREDICTED: uncharacterized protein LOC100780051  87.8    5e-17   
ref|XP_008775970.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  85.9    5e-17   
ref|XP_006346096.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  86.7    6e-17   
ref|XP_007146684.1|  hypothetical protein PHAVU_006G060700g           86.3    6e-17   
gb|KHN21275.1|  Chaperone protein dnaJ 11, chloroplastic              85.1    6e-17   
ref|XP_006387084.1|  hypothetical protein POPTR_1909s00200g           86.7    7e-17   
ref|XP_006452722.1|  hypothetical protein CICLE_v10009810mg           85.9    8e-17   
emb|CDY43357.1|  BnaA01g29880D                                        85.9    9e-17   
gb|ACN40652.1|  unknown                                               86.3    1e-16   Picea sitchensis
ref|XP_011022963.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  85.5    1e-16   
ref|XP_003551346.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  85.1    1e-16   
ref|XP_002309904.1|  hypothetical protein POPTR_0007s03990g           85.1    1e-16   Populus trichocarpa [western balsam poplar]
gb|EYU27496.1|  hypothetical protein MIMGU_mgv1a017725mg              84.7    1e-16   
ref|XP_009780405.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  85.1    2e-16   
emb|CDP13660.1|  unnamed protein product                              86.3    2e-16   
emb|CDY23588.1|  BnaC05g40060D                                        84.7    2e-16   
ref|XP_011000339.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  85.1    2e-16   
ref|XP_002300579.2|  hypothetical protein POPTR_0001s47360g           85.1    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006432056.1|  hypothetical protein CICLE_v10003690mg           84.0    2e-16   
gb|KDP32638.1|  hypothetical protein JCGZ_13188                       84.7    2e-16   
ref|XP_004500166.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  84.7    2e-16   
gb|ABK26231.1|  unknown                                               84.7    3e-16   Picea sitchensis
gb|EPS72425.1|  hypothetical protein M569_02347                       83.2    3e-16   
gb|ABK21524.1|  unknown                                               84.7    4e-16   Picea sitchensis
ref|XP_011097800.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  83.6    5e-16   
ref|XP_009632020.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  83.6    6e-16   
ref|XP_009146535.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  83.2    8e-16   
ref|XP_004296124.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  83.2    8e-16   
ref|XP_009413778.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  83.6    9e-16   
ref|XP_002307840.1|  hypothetical protein POPTR_0006s00340g           82.8    9e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006300220.1|  hypothetical protein CARUB_v10016456mg           82.8    9e-16   
ref|XP_011005773.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  82.8    1e-15   
ref|XP_004244015.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  83.2    1e-15   
ref|XP_009339274.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  82.4    1e-15   
ref|XP_002884960.1|  DNAJ heat shock N-terminal domain-containing...  82.4    1e-15   
ref|NP_187939.1|  chaperone DnaJ-domain containing protein            82.4    2e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24196.1|  BnaC01g37760D                                        82.4    2e-15   
ref|XP_003530823.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  82.4    2e-15   
ref|XP_010061408.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  82.0    2e-15   
gb|EMT28816.1|  Chaperone protein dnaJ 11, chloroplastic              80.9    2e-15   
ref|XP_006857633.1|  hypothetical protein AMTR_s00061p00131740        82.4    2e-15   
ref|XP_010912186.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  81.3    2e-15   
emb|CDX75702.1|  BnaC03g37850D                                        82.0    3e-15   
ref|XP_010928031.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.9    3e-15   
ref|XP_007206102.1|  hypothetical protein PRUPE_ppa012971mg           81.3    3e-15   
ref|XP_008218991.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  81.3    4e-15   
ref|XP_009394970.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.5    4e-15   
ref|XP_002275924.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.9    5e-15   Vitis vinifera
ref|XP_006346095.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.9    5e-15   
ref|XP_011039836.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.9    6e-15   
gb|KFK38667.1|  hypothetical protein AALP_AA3G144300                  80.9    6e-15   
ref|XP_009135295.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.9    6e-15   
ref|XP_009124738.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  80.5    8e-15   
emb|CDX82546.1|  BnaA03g32750D                                        80.5    8e-15   
ref|XP_009780404.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  79.7    1e-14   
ref|XP_008344733.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  79.0    2e-14   
ref|XP_010324234.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  78.6    4e-14   
gb|ABK21067.1|  unknown                                               79.0    1e-13   Picea sitchensis
ref|XP_010054486.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  76.6    2e-13   
ref|XP_010042323.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  76.6    2e-13   
ref|XP_007020368.1|  Chaperone DnaJ-domain superfamily protein, p...  76.3    2e-13   
ref|XP_009632019.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  76.6    2e-13   
ref|XP_009391793.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  75.1    4e-13   
gb|ACN40582.1|  unknown                                               75.5    7e-13   Picea sitchensis
ref|XP_008813790.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  75.5    9e-13   
ref|XP_004967895.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  75.5    1e-12   
ref|XP_004139766.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  73.6    1e-12   
ref|XP_004156351.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  73.2    2e-12   
emb|CDP03919.1|  unnamed protein product                              74.7    2e-12   
ref|XP_010551663.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  74.3    2e-12   
gb|KHN34232.1|  Chaperone protein dnaJ 11, chloroplastic              72.4    3e-12   
ref|XP_009602891.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  73.6    4e-12   
ref|WP_025896521.1|  hypothetical protein                             75.5    5e-12   
gb|ABK25977.1|  unknown                                               73.2    5e-12   
ref|XP_004297043.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  73.6    5e-12   
ref|XP_010909969.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  73.6    5e-12   
ref|XP_011003613.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  72.8    8e-12   
ref|XP_010023660.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  73.2    8e-12   
gb|KDP39335.1|  hypothetical protein JCGZ_01092                       72.8    8e-12   
gb|EAZ02366.1|  hypothetical protein OsI_24470                        71.6    1e-11   
ref|NP_001041744.2|  Os01g0101700                                     71.6    1e-11   
ref|XP_004966918.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  70.1    2e-11   
dbj|BAB62630.1|  P0402A09.13                                          71.6    2e-11   
ref|XP_011003612.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  72.0    2e-11   
ref|XP_011089060.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  71.6    2e-11   
gb|EAZ10187.1|  hypothetical protein OsJ_00014                        72.8    2e-11   
ref|XP_011084204.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  71.2    3e-11   
ref|XP_002438281.1|  hypothetical protein SORBIDRAFT_10g011060        69.3    3e-11   
gb|ADN34003.1|  chaperone protein dnaj 11                             68.9    3e-11   
ref|XP_002457544.1|  hypothetical protein SORBIDRAFT_03g009120        71.2    3e-11   
ref|XP_009347001.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  71.2    4e-11   
ref|XP_006643629.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  70.5    4e-11   
ref|XP_006643630.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  70.9    4e-11   
gb|KDO43196.1|  hypothetical protein CISIN_1g044278mg                 68.9    4e-11   
ref|XP_008380479.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  70.9    5e-11   
ref|XP_002300151.1|  heat shock protein DnaJ                          70.9    5e-11   
ref|XP_002518039.1|  Chaperone protein dnaJ 20, chloroplast precu...  70.9    5e-11   
emb|CDY51381.1|  BnaCnng20870D                                        70.1    7e-11   
ref|XP_004133982.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  70.5    8e-11   
ref|XP_002531089.1|  chaperone protein DNAj, putative                 70.1    9e-11   
gb|KDO42177.1|  hypothetical protein CISIN_1g038518mg                 68.6    9e-11   
tpg|DAA64526.1|  TPA: DnaJ                                            70.5    1e-10   
dbj|BAJ95113.1|  predicted protein                                    69.7    1e-10   
ref|XP_010673395.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  69.7    1e-10   
ref|WP_022794941.1|  molecular chaperone DnaJ                         72.0    1e-10   
emb|CDY47319.1|  BnaAnng08930D                                        69.7    1e-10   
ref|WP_038048599.1|  hypothetical protein                             69.3    1e-10   
ref|XP_006365470.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  69.3    2e-10   
ref|XP_009602020.1|  PREDICTED: dnaJ homolog subfamily A member 3...  68.6    2e-10   
ref|XP_008812237.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  69.3    2e-10   
gb|ABK95188.1|  unknown                                               68.9    2e-10   
ref|NP_001151671.1|  chaperone protein dnaJ 20                        68.9    2e-10   
ref|XP_006373081.1|  heat shock protein DnaJ                          68.9    2e-10   
ref|XP_010227744.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  67.4    2e-10   
ref|XP_009107502.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  68.6    3e-10   
ref|XP_010274065.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  68.6    3e-10   
ref|XP_008673834.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  68.2    4e-10   
ref|WP_018086864.1|  hypothetical protein                             70.1    4e-10   
ref|XP_006421009.1|  hypothetical protein CICLE_v10006058mg           67.4    5e-10   
ref|WP_038276765.1|  molecular chaperone DnaJ                         70.1    5e-10   
ref|WP_012623444.1|  heat shock protein DnaJ domain-containing pr...  68.6    5e-10   
ref|XP_008438327.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  68.2    5e-10   
ref|WP_034422197.1|  molecular chaperone DnaJ                         69.3    7e-10   
ref|XP_006373558.1|  hypothetical protein POPTR_0016s00380g           65.5    7e-10   
ref|WP_009610824.1|  DnaJ domain protein                              68.2    7e-10   
gb|KEH20652.1|  chaperone DnaJ domain protein                         67.4    7e-10   
ref|XP_001699316.1|  hypothetical protein CHLREDRAFT_106711           65.1    8e-10   
ref|XP_009787628.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  67.0    8e-10   
dbj|GAJ99094.1|  LOW QUALITY PROTEIN: chaperone protein DnaJ          69.3    8e-10   
dbj|GAK06426.1|  LOW QUALITY PROTEIN: chaperone protein DnaJ          69.3    8e-10   
ref|XP_010913088.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...  67.4    9e-10   
gb|KHG22996.1|  Chaperone dnaJ 20, chloroplastic -like protein        67.0    9e-10   
ref|XP_004247877.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  66.6    9e-10   
emb|CDM81336.1|  unnamed protein product                              67.0    9e-10   
ref|WP_026549291.1|  molecular chaperone DnaJ                         69.3    9e-10   
ref|XP_007034239.1|  Chaperone protein dnaJ 20                        67.0    9e-10   
gb|KDP45299.1|  hypothetical protein JCGZ_15164                       67.0    1e-09   
gb|KFK36270.1|  hypothetical protein AALP_AA4G100700                  66.6    1e-09   
ref|XP_010040078.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  64.3    1e-09   
ref|WP_014849919.1|  molecular chaperone DnaJ                         68.9    1e-09   
gb|AAA23247.1|  dnaJ                                                  64.3    1e-09   
ref|NP_849376.1|  chaperone protein dnaJ 20                           65.9    1e-09   
ref|XP_007223442.1|  hypothetical protein PRUPE_ppa011527mg           66.6    1e-09   
ref|XP_008222817.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  66.6    1e-09   
ref|WP_015222946.1|  heat shock protein DnaJ domain-containing pr...  67.0    1e-09   
ref|XP_010109333.1|  Chaperone protein dnaJ 20                        66.6    1e-09   
ref|XP_009139583.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  66.6    1e-09   
gb|KDP45295.1|  hypothetical protein JCGZ_15160                       66.6    2e-09   
emb|CDY64790.1|  BnaCnng44960D                                        66.2    2e-09   
ref|WP_026533085.1|  molecular chaperone DnaJ                         68.6    2e-09   
ref|XP_006414851.1|  hypothetical protein EUTSA_v10026283mg           66.2    2e-09   
ref|WP_029089066.1|  molecular chaperone DnaJ                         68.6    2e-09   
ref|XP_009400148.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.5    2e-09   
ref|XP_004517297.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.9    2e-09   
ref|XP_006464976.1|  PREDICTED: uncharacterized protein LOC102629035  68.6    2e-09   
gb|ABI34703.1|  DnaJ-like protein isoform                             65.9    2e-09   
emb|CDY01162.1|  BnaA04g06570D                                        66.2    2e-09   
ref|XP_006489853.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  66.2    2e-09   
ref|XP_006360933.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.9    2e-09   
ref|XP_002870353.1|  hypothetical protein ARALYDRAFT_493532           65.9    2e-09   
ref|WP_028558698.1|  hypothetical protein                             65.1    2e-09   
ref|WP_039864329.1|  hypothetical protein                             64.7    2e-09   
ref|NP_193119.1|  chaperone protein dnaJ 20                           65.9    2e-09   
ref|WP_026534784.1|  molecular chaperone DnaJ                         68.2    2e-09   
ref|WP_013908138.1|  chaperone protein DnaJ                           68.2    2e-09   
gb|KHN39893.1|  Chaperone protein dnaJ 11, chloroplastic              63.5    2e-09   
ref|XP_011095819.1|  PREDICTED: dnaJ protein ERDJ3B-like              66.2    2e-09   
ref|XP_011012629.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.9    2e-09   
gb|AAF24498.1|AF214107_1  DnaJ-like protein                           65.9    2e-09   
ref|XP_006858307.1|  hypothetical protein AMTR_s00064p00089690        65.9    2e-09   
ref|WP_011025331.1|  molecular chaperone DnaJ                         68.2    2e-09   
ref|WP_013889976.1|  cobalamin ABC transporter permease               67.4    2e-09   
ref|WP_006017810.1|  DnaJ-class molecular chaperone CbpA              67.4    2e-09   
ref|XP_009594586.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.9    2e-09   
ref|WP_022587199.1|  molecular chaperone DnaJ                         68.2    2e-09   
ref|NP_001235176.1|  DnaJ-like protein                                65.5    2e-09   
gb|KDO50655.1|  hypothetical protein CISIN_1g028571mg                 65.9    2e-09   
ref|WP_006677003.1|  molecular chaperone DnaJ                         65.1    3e-09   
ref|WP_002798705.1|  molecular chaperone DnaJ                         67.0    3e-09   
ref|WP_007272121.1|  chaperone protein DnaJ                           67.8    3e-09   
ref|WP_002748290.1|  dnaJ domain protein                              67.0    3e-09   
gb|KDP45297.1|  hypothetical protein JCGZ_15162                       64.7    3e-09   
ref|XP_003568733.2|  PREDICTED: uncharacterized protein LOC100843156  68.6    3e-09   
ref|WP_002759132.1|  molecular chaperone DnaJ                         67.0    3e-09   
ref|XP_002531090.1|  chaperone protein DNAj, putative                 65.9    3e-09   
ref|WP_002790929.1|  molecular chaperone DnaJ                         67.0    3e-09   
ref|WP_016514712.1|  Curved DNA-binding protein                       67.0    3e-09   
ref|WP_002739212.1|  molecular chaperone DnaJ                         67.0    3e-09   
ref|WP_002781325.1|  Chaperone protein dnaJ 2                         67.0    3e-09   
ref|WP_025608733.1|  molecular chaperone DnaJ                         67.8    3e-09   
gb|KHN05413.1|  Chaperone protein dnaJ 11, chloroplastic              63.2    3e-09   
ref|WP_022853786.1|  molecular chaperone DnaJ                         67.4    3e-09   
ref|WP_041148333.1|  cobalamin ABC transporter permease               67.0    3e-09   
ref|WP_022729958.1|  molecular chaperone DnaJ                         67.0    3e-09   
ref|WP_026987388.1|  molecular chaperone DnaJ                         67.0    3e-09   
ref|XP_010435221.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.5    3e-09   
ref|WP_015220701.1|  heat shock protein DnaJ domain-containing pr...  65.9    3e-09   
ref|WP_011139119.1|  cobalamin ABC transporter permease               66.6    4e-09   
gb|ABK26419.1|  unknown                                               65.1    4e-09   
ref|XP_006432706.1|  hypothetical protein CICLE_v10003089mg           64.3    4e-09   
gb|EMT12124.1|  Chaperone protein dnaJ                                64.3    4e-09   
ref|WP_019482775.1|  MULTISPECIES: molecular chaperone DnaJ           67.4    4e-09   
ref|XP_002264154.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.5    4e-09   
ref|WP_013840331.1|  molecular chaperone DnaJ                         67.0    4e-09   
ref|WP_028267103.1|  molecular chaperone DnaJ                         67.4    4e-09   
ref|WP_026826871.1|  molecular chaperone DnaJ                         66.6    4e-09   
ref|XP_009381708.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  65.1    4e-09   
ref|XP_002279390.1|  PREDICTED: uncharacterized protein LOC100261...  67.4    5e-09   
ref|WP_013906642.1|  molecular chaperone DnaJ                         67.0    5e-09   
ref|WP_022852555.1|  molecular chaperone DnaJ                         67.0    5e-09   
ref|WP_003800829.1|  molecular chaperone DnaJ                         67.0    5e-09   
ref|WP_016483931.1|  DnaJ-class molecular chaperone with C-termin...  67.0    5e-09   
emb|CBI33724.3|  unnamed protein product                              67.4    5e-09   
ref|WP_028844274.1|  molecular chaperone DnaJ                         67.0    5e-09   
ref|WP_007786771.1|  molecular chaperone DnaJ                         67.0    5e-09   
ref|XP_010652739.1|  PREDICTED: uncharacterized protein LOC100261...  67.4    5e-09   
ref|XP_006284542.1|  hypothetical protein CARUB_v10005745mg           64.7    6e-09   
gb|EEF67981.1|  DnaJ domain protein                                   63.2    6e-09   
ref|WP_039309830.1|  molecular chaperone DnaJ                         66.6    6e-09   
ref|WP_041082797.1|  molecular chaperone DnaJ                         66.6    7e-09   
ref|WP_003371919.1|  molecular chaperone DnaJ                         66.6    7e-09   
ref|WP_012423771.1|  molecular chaperone DnaJ                         66.6    7e-09   
ref|XP_010450156.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  64.7    7e-09   
ref|WP_012463282.1|  molecular chaperone DnaJ                         66.2    7e-09   
ref|WP_022294886.1|  chaperone protein DnaJ                           66.6    7e-09   
ref|XP_010036781.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  64.7    7e-09   
gb|EHN77309.1|  DnaJ C terminal region domain protein                 63.2    7e-09   
ref|WP_020527216.1|  hypothetical protein                             66.6    7e-09   
ref|WP_002778897.1|  molecular chaperone DnaJ                         65.9    8e-09   
ref|WP_009526895.1|  molecular chaperone DnaJ                         66.6    8e-09   
ref|WP_015798709.1|  chaperone protein DnaJ                           66.6    8e-09   
gb|AJC84672.1|  co-chaperone-curved DNA binding protein A             65.9    8e-09   
ref|WP_022417150.1|  chaperone protein DnaJ                           66.2    8e-09   
ref|WP_014904741.1|  molecular chaperone DnaJ                         66.2    8e-09   
gb|KCW48423.1|  hypothetical protein EUGRSUZ_K02127                   64.3    8e-09   
ref|WP_019284620.1|  hypothetical protein                             63.5    8e-09   
ref|WP_012874951.1|  heat shock protein DnaJ domain-containing pr...  65.9    8e-09   
ref|WP_004011781.1|  molecular chaperone DnaJ                         66.6    8e-09   
ref|WP_035177132.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_034599756.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_026540775.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_012047516.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|XP_004239854.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  64.3    9e-09   
ref|WP_026546865.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_024816794.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_004016374.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_011774919.1|  MULTISPECIES: molecular chaperone DnaJ           66.2    9e-09   
ref|XP_009802274.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  63.5    9e-09   
ref|WP_018777704.1|  MULTISPECIES: molecular chaperone DnaJ           66.2    9e-09   
ref|XP_003524933.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  63.9    9e-09   
ref|WP_017197584.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_004017780.1|  molecular chaperone DnaJ                         66.2    9e-09   
ref|WP_007618679.1|  chaperone protein DnaJ                           66.2    9e-09   
ref|WP_027303988.1|  cobalamin ABC transporter permease               65.5    1e-08   
ref|WP_004277207.1|  cobalamin ABC transporter permease               65.5    1e-08   
gb|EDZ92786.1|  heat shock protein DnaJ domain protein                64.7    1e-08   
ref|WP_013119811.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_039647534.1|  integrase                                        65.5    1e-08   
ref|WP_009058869.1|  molecular chaperone DnaJ                         65.5    1e-08   
ref|WP_009528836.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_013488189.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_039663690.1|  cobalamin ABC transporter permease               65.1    1e-08   
gb|KGA04513.1|  molecular chaperone DnaJ                              65.9    1e-08   
ref|WP_009531159.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_011100191.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_009525622.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_022329689.1|  chaperone protein DnaJ                           65.9    1e-08   
ref|WP_015757545.1|  molecular chaperone DnaJ                         65.5    1e-08   
ref|WP_012903513.1|  molecular chaperone DnaJ                         65.9    1e-08   
gb|KHG21772.1|  Chaperone DnaJ                                        66.2    1e-08   
ref|WP_029018314.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|XP_010495839.1|  PREDICTED: chaperone protein dnaJ 20, chloro...  63.9    1e-08   
ref|WP_023439017.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_015144226.1|  DnaJ-class molecular chaperone with C-termin...  65.1    1e-08   
gb|KIC65598.1|  molecular chaperone DnaJ                              65.9    1e-08   
ref|WP_034585362.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_010964595.1|  molecular chaperone DnaJ                         65.9    1e-08   
ref|WP_018761393.1|  molecular chaperone DnaJ                         65.9    1e-08   
gb|KDO47055.1|  hypothetical protein CISIN_1g040219mg                 62.0    1e-08   
ref|WP_034142753.1|  molecular chaperone DnaJ                         65.5    1e-08   
ref|WP_018769275.1|  molecular chaperone DnaJ                         65.9    1e-08   
gb|EYU31495.1|  hypothetical protein MIMGU_mgv1a012898mg              64.3    1e-08   
ref|WP_018773105.1|  MULTISPECIES: molecular chaperone DnaJ           65.5    1e-08   
ref|WP_012086871.1|  molecular chaperone DnaJ                         65.5    2e-08   
ref|WP_028276700.1|  molecular chaperone DnaJ                         65.5    2e-08   
ref|WP_013553684.1|  cobalamin ABC transporter permease               65.1    2e-08   
ref|WP_012932286.1|  molecular chaperone DnaJ                         65.5    2e-08   
ref|WP_005870176.1|  cobalamin ABC transporter permease               65.1    2e-08   



>ref|XP_009801737.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
sylvestris]
Length=160

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 104/168 (62%), Gaps = 18/168 (11%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAE-VARPRCVSFR--RPVSVSASCATAERTAQTP----Q  721
            MA TS SFLLS+   GS  SA   +  P  VSFR  R  SVSA+ +TAERT  +     Q
Sbjct  1    MAFTSTSFLLSTSITGSNFSAGTPLTPPNSVSFRQQRSFSVSAAYSTAERTTTSSNIASQ  60

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLG++ GA+  EIK+AYR+LAR+LHPDV              S AEDFIRV +AY
Sbjct  61   SSLYEVLGLQAGATTHEIKSAYRKLARILHPDVV--------RFQQNSSAEDFIRVQSAY  112

Query  540  STLSDPEKRANYDRSLLRSRHP---AASVRGYSGRRSALRKWETDQCW  406
            +TLSDPEKR  YDR+L  +R     + S  G     +  RKWETDQCW
Sbjct  113  ATLSDPEKRTKYDRTLFGNRFGRPVSVSAAGARSHYTVRRKWETDQCW  160



>emb|CDP07388.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 103/164 (63%), Gaps = 27/164 (16%)
 Frame = -2

Query  852  LSSPFVGSAISAAEVARPRCVSFR----RPVSVSASCATAERTAQT-----PQSSLYDVL  700
            + S F G+A        P C  F+    +P  +SA+ A A RT+ +     PQ+SLY+VL
Sbjct  5    IGSTFAGAA--------PSCARFKHHLHQPSRISAAHAAAGRTSTSTSHIAPQTSLYEVL  56

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            GI  GA+ QEIK AYRRLARVLHPDVAS       +   ++ A++F+RVH AY+TLSDPE
Sbjct  57   GIPMGATCQEIKVAYRRLARVLHPDVASSHNTTRGSQDTSAAADEFMRVHKAYTTLSDPE  116

Query  519  KRANYDRSLLRSRHPA----ASVR--GYSGRRSALRKWETDQCW  406
            KRA+YDR+L R R PA    A+ R  GY  RR+    WETDQCW
Sbjct  117  KRADYDRTLFRLRRPAYVLSATNRGSGYYARRT----WETDQCW  156



>ref|XP_009779346.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
sylvestris]
Length=159

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 104/168 (62%), Gaps = 19/168 (11%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAE-VARPRCVSFR--RPVSVSASCATAERTAQTP----Q  721
            MASTS  F LS+   GS  SA   +  P  VSFR  R  SVSA+ +TAERT  +     Q
Sbjct  1    MASTSF-FFLSTSITGSKFSAGTPLTPPSSVSFRQQRSFSVSAAYSTAERTTASSNIASQ  59

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLG++ GA+  EIK+AYRRLAR+LHPDV              S A DFIRV +AY
Sbjct  60   SSLYEVLGLQAGATTHEIKSAYRRLARILHPDVV--------RFQQNSSAADFIRVQSAY  111

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL---RKWETDQCW  406
            +TLSDPEKRA YDR+L  +R   +     +G RS     RKWET+QCW
Sbjct  112  ATLSDPEKRAKYDRTLFGNRFGRSVGVSSAGARSHYTTRRKWETEQCW  159



>ref|NP_001234377.1| DNAJ-like protein [Solanum lycopersicum]
 gb|ABN03968.1| DNAJ-like protein [Solanum lycopersicum]
Length=155

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 106/167 (63%), Gaps = 27/167 (16%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRC-VSFR-RPVSVSASCATAERTAQTPQSS-------  715
            S+SFLLS+   GS +SAA  A PR  VSF+ RP SVSA+ +TAERT+    SS       
Sbjct  3    SSSFLLSTSITGSKLSAA--APPRSSVSFKQRPFSVSAAYSTAERTSTATTSSSTIASHT  60

Query  714  -LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
             LY+VLGIR GA+  EIK+AYR+LAR+LHPDV + S             EDFIRV +AY+
Sbjct  61   SLYEVLGIRFGANSHEIKSAYRKLARILHPDVRNSSA------------EDFIRVQSAYA  108

Query  537  TLSDPEKRANYDRSLLRSR--HPAA-SVRGYSGRRSALRKWETDQCW  406
            TLSDPEKRANYDR+L  +R   P   S  G     +  R WETDQCW
Sbjct  109  TLSDPEKRANYDRNLFGNRIARPVDFSTAGARSHYTVRRGWETDQCW  155



>ref|XP_009766377.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
sylvestris]
Length=161

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 95/154 (62%), Gaps = 18/154 (12%)
 Frame = -2

Query  837  VGSAISAAE-VARPRCVSFR--RPVSVSASCATAERTAQTP----QSSLYDVLGIRTGAS  679
             GS  SA   +A P  VSFR  R  SVSA+ +TAERT  +     QSSLY+VLG++ GA+
Sbjct  16   TGSKFSAGTPLAPPSSVSFRQQRSFSVSAAYSTAERTTTSSNIASQSSLYEVLGLQAGAT  75

Query  678  GQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDR  499
              EIK+AYRRLAR+LHPDVA             S AEDFIRV +AY+TLSDPEKRA YDR
Sbjct  76   THEIKSAYRRLARILHPDVA--------RFQQNSSAEDFIRVQSAYATLSDPEKRAKYDR  127

Query  498  SLLRS---RHPAASVRGYSGRRSALRKWETDQCW  406
            +L  +   R    S  G     +  R WETDQCW
Sbjct  128  TLFGNIFGRSVGVSSAGTRSHYTTCRNWETDQCW  161



>ref|XP_009625709.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
tomentosiformis]
 gb|AIL30481.1| DNAJ-like protein [Nicotiana tabacum]
Length=161

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 94/154 (61%), Gaps = 18/154 (12%)
 Frame = -2

Query  837  VGSAISAAE-VARPRCVSFR--RPVSVSASCATAERTAQTP----QSSLYDVLGIRTGAS  679
             GS  SA   +  P  VSFR  R  SVSA+ +TAERT  +     QSSLY+VLG++ GA+
Sbjct  16   TGSKFSAGTPLTPPSSVSFRQQRSFSVSAAYSTAERTTTSSNIASQSSLYEVLGLQAGAT  75

Query  678  GQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDR  499
              EIK+AYRRLAR+LHPDV              S  EDFIRV +AY+TLSDPEKRA YDR
Sbjct  76   THEIKSAYRRLARILHPDVV--------RFQQNSSVEDFIRVQSAYATLSDPEKRAKYDR  127

Query  498  SLLRS---RHPAASVRGYSGRRSALRKWETDQCW  406
            +L  +   R+   S  G     +  RKWETDQCW
Sbjct  128  TLFGNRFERYVGVSSAGTRSHYTTRRKWETDQCW  161



>ref|XP_002301971.1| hypothetical protein POPTR_0002s02240g [Populus trichocarpa]
 gb|EEE81244.1| hypothetical protein POPTR_0002s02240g [Populus trichocarpa]
Length=171

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 108/181 (60%), Gaps = 33/181 (18%)
 Frame = -2

Query  879  MASTS--ASFLLS-SPFVGSAISAAEVARPRC--VSFRRPVSVSASCA-TAERTAQ----  730
            MAST+   SF  S SPF+GS +S  +   P    VSFR P  VSA+CA TAER       
Sbjct  1    MASTTCLTSFSSSASPFIGSKVSTNQSHSPPPSRVSFR-PFRVSAACASTAERPTSCIAT  59

Query  729  -TPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRV  553
             T  SSLY+VLGI+ GA+ QEIK AYRRLAR+LHPDVA+    RE  A       +F+RV
Sbjct  60   ATSASSLYEVLGIQMGATCQEIKTAYRRLARILHPDVAANG-QREDKAY------EFMRV  112

Query  552  HAAYSTLSDPEKRANYDRSLLRSRHPAAS------------VRGYSGRRSALRKWETDQC  409
            H AY TLSDPEKRA+YDRSL R      S              G+SG  S  ++WETDQC
Sbjct  113  HEAYETLSDPEKRADYDRSLYRRGRQMGSPFVMSAATVTTMATGFSGYTS--QRWETDQC  170

Query  408  W  406
            W
Sbjct  171  W  171



>ref|XP_002274505.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Vitis 
vinifera]
Length=165

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 102/171 (60%), Gaps = 25/171 (15%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRC-VSFRRPVSVSASCATAERTAQ--TPQSSLYDVLG  697
            SA+   SS FV   ++  + A P   V FR+P   ++  ATAERT       +SLYDVLG
Sbjct  3    SAAPFSSSHFVVPKVAVNQRASPPTYVRFRQPKVSASYTATAERTMSHIANPASLYDVLG  62

Query  696  IRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEK  517
            I  GA+ QEIKAAYRRLARV HPDV + S          + A++FI++HAAY+TLSDPEK
Sbjct  63   INMGATCQEIKAAYRRLARVSHPDVVANS-------QKDTSADEFIKIHAAYATLSDPEK  115

Query  516  RANYDRSLLRSRHPAASVRGYSGR--------------RSALRKWETDQCW  406
            RA+YDR+L R R P +S    S                RS+LR WETDQCW
Sbjct  116  RADYDRTLFRRRRPVSSPFAMSASAATMGSSPASVFSGRSSLR-WETDQCW  165



>ref|XP_006342061.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Solanum 
tuberosum]
Length=156

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 104/172 (60%), Gaps = 36/172 (21%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARP-RCVSFR-RPVSVSAS---------CATAERTAQTPQ  721
            S+SFLLS+   GS +SAA  A P R VSFR RP SVSA+           T+  +     
Sbjct  3    SSSFLLSTSIAGSKLSAA--APPSRSVSFRQRPFSVSAAYSTAERTSTTTTSSSSTIASH  60

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VLGI+ GA+  EIK+AYR+LAR+LHPDV + S             EDFIRV +AY
Sbjct  61   TSLYEVLGIQIGANSHEIKSAYRKLARILHPDVQNSSA------------EDFIRVQSAY  108

Query  540  STLSDPEKRANYDRSLLRSR-------HPAASVRGYSGRRSALRKWETDQCW  406
            +TLSDPEKRANYDR L  +R        PA +   Y+ R    RKWETDQCW
Sbjct  109  ATLSDPEKRANYDRKLFGNRIARPVDFSPAGARSHYTVR----RKWETDQCW  156



>ref|XP_002265844.2| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Vitis vinifera]
Length=162

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 109/176 (62%), Gaps = 31/176 (18%)
 Frame = -2

Query  882  IMASTSASFLLSSP-FVGSAISAAEVARPRCVSFRRPVSVSASCATAERT-------AQT  727
            +++++S SFL  SP F G A S A    P  VS+R+P  VSA   + ER        A+T
Sbjct  1    MLSASSPSFLRPSPRFTGRAFSPA----PPRVSYRQPC-VSAVYTSTERARPSYLSLAET  55

Query  726  PQ-SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
               +SLY++LGIR GA+ QEIK+AYR+LARV HPDVA+ S          S A++F+R+H
Sbjct  56   ASCASLYEILGIRMGATSQEIKSAYRKLARVCHPDVAAIS-------RKDSSADEFMRIH  108

Query  549  AAYSTLSDPEKRANYDRSLLRSRHPAAS--------VRGYSGRRSALRKWETDQCW  406
            AAYSTLSDPEKRA+YDRSL   + P  S        + G+SG     R WETDQCW
Sbjct  109  AAYSTLSDPEKRADYDRSLFMRQQPIESYAGISSPTMSGFSGY--TRRNWETDQCW  162



>gb|ABK96283.1| unknown [Populus trichocarpa x Populus deltoides]
Length=169

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 100/169 (59%), Gaps = 38/169 (22%)
 Frame = -2

Query  843  PFVGSAISAAEVARPRCVSFR---RPVSVSASCA-TAER--TAQTPQSSLYDVLGIRTGA  682
            PF+GS  S  +   P  + FR   RP SVSASCA TAER  +    Q SLY+VLGI+ GA
Sbjct  16   PFIGSKFSTNQ---PHSLPFRASFRPFSVSASCAATAERPPSRNATQISLYEVLGIQMGA  72

Query  681  SGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYD  502
            + QEIKAAYR+LAR LHPDVA+ +V +E  A       +FI+VH AY TLSDP+KRA+YD
Sbjct  73   TCQEIKAAYRKLARTLHPDVAA-NVQKEDTAY------EFIKVHEAYETLSDPDKRADYD  125

Query  501  RSLLR-----------------SRHPAASVRGYSGRRSALRKWETDQCW  406
            RSL R                 +   AA    Y+ RR     WETDQCW
Sbjct  126  RSLFRPGRQMSSPFVMSAATMETNVVAAGFPAYTRRR-----WETDQCW  169



>ref|XP_002301970.1| hypothetical protein POPTR_0002s02220g [Populus trichocarpa]
 gb|EEE81243.1| hypothetical protein POPTR_0002s02220g [Populus trichocarpa]
Length=169

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 100/169 (59%), Gaps = 38/169 (22%)
 Frame = -2

Query  843  PFVGSAISAAEVARPRCVSFR---RPVSVSASCA-TAER--TAQTPQSSLYDVLGIRTGA  682
            PF+GS  S  +   P  + FR   RP SVSASCA TAER  +    Q SLY+VLGI+ GA
Sbjct  16   PFIGSKFSTNQ---PHSLPFRASFRPFSVSASCASTAERPPSRNATQISLYEVLGIQMGA  72

Query  681  SGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYD  502
            + QEIKAAYR+LAR LHPDVA+ +V +E  A       +FI+VH AY TLSDP+KRA+YD
Sbjct  73   TCQEIKAAYRKLARTLHPDVAA-NVQKEDTAY------EFIKVHEAYETLSDPDKRADYD  125

Query  501  RSLLR-----------------SRHPAASVRGYSGRRSALRKWETDQCW  406
            RSL R                 +   AA    Y+ RR     WETDQCW
Sbjct  126  RSLFRPGRQMSSPFVMSAATMETNVVAAGFPAYTRRR-----WETDQCW  169



>gb|KDP36913.1| hypothetical protein JCGZ_08204 [Jatropha curcas]
Length=167

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 96/159 (60%), Gaps = 22/159 (14%)
 Frame = -2

Query  840  FVGSAISAAE-VARPRCVSFRRPVSVSASCAT-AERTAQTPQS--SLYDVLGIRTGASGQ  673
              GS + A + ++ P  V FR P+ VSA CAT AERT     S  SLY++LGI+ GA+ Q
Sbjct  17   LFGSQLPAGKTLSLPSRVGFR-PLHVSAGCATTAERTKSHVASPGSLYEILGIQMGATCQ  75

Query  672  EIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSL  493
            EIK AYR+LARVLHPDVA+ S   E          +FI++H AY TLSDPEKRA+YDRSL
Sbjct  76   EIKTAYRKLARVLHPDVATTSQKEE-------KTHEFIKIHEAYETLSDPEKRADYDRSL  128

Query  492  L----RSRHP------AASVRGYSGRRSALRKWETDQCW  406
                 R   P      AA+   YS      R+WETDQCW
Sbjct  129  FWQGQRMSSPFVTSATAATAVRYSASGFTKRRWETDQCW  167



>ref|XP_007017815.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma 
cacao]
 gb|EOY15040.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma 
cacao]
Length=168

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 108/178 (61%), Gaps = 30/178 (17%)
 Frame = -2

Query  879  MASTSASFLL----SSPFVGSAISAAEVAR-PRCVSFRRPVSVSASCA-TAERTAQTPQS  718
            MASTS++F      S+ F+G  +S  E +  P  V FR P+ VSA+CA TAER      S
Sbjct  1    MASTSSAFACFGSSSAHFMGHKVSIKEPSSVPTSVQFR-PLRVSAACASTAERPVSHIAS  59

Query  717  --SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
              SLY+VLGI+ GA+ QEIKAAYRRLARVLHPDV+S            + A +FI+VH A
Sbjct  60   PASLYEVLGIQMGATCQEIKAAYRRLARVLHPDVSSSG-------QNNATAHEFIKVHEA  112

Query  543  YSTLSDPEKRANYDRSLL-RSR-----------HPAASVRGYSGRRSALRKWETDQCW  406
            Y+TLSDPEKRA+YDR+LL R R             + +  G+SG       WETDQCW
Sbjct  113  YATLSDPEKRADYDRTLLFRPRRSFAVSASAASMASPTSSGFSGYTRG--SWETDQCW  168



>ref|NP_001241283.1| uncharacterized protein LOC100800959 [Glycine max]
 gb|ACU17287.1| unknown [Glycine max]
Length=158

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 101/167 (60%), Gaps = 23/167 (14%)
 Frame = -2

Query  870  TSASFLLSSPFVGSAISAAEVARPRCVSFRRPV--SVSASCATAERTAQTPQ--------  721
            +S SF  S P V    S   +A P C    RP+    +A+     R++ T Q        
Sbjct  3    SSVSFPASLPAVN--FSGNAMASPSCRVKSRPIVAFATATATAEARSSWTEQPRPSYLNS  60

Query  720  --SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHA  547
              SSLYD+LGI  GAS QEIKAAYRRLARV HPDVA  ++ R+      S A++F+++HA
Sbjct  61   SCSSLYDILGIPAGASNQEIKAAYRRLARVCHPDVA--AIDRK-----NSSADEFMKIHA  113

Query  546  AYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            AYSTLSDP+KRANYDRSL R + P ++   +SG     R WETDQCW
Sbjct  114  AYSTLSDPDKRANYDRSLFRRQRPLSTAAVFSGY--TRRNWETDQCW  158



>ref|XP_007157915.1| hypothetical protein PHAVU_002G108600g [Phaseolus vulgaris]
 gb|ESW29909.1| hypothetical protein PHAVU_002G108600g [Phaseolus vulgaris]
Length=162

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 20/125 (16%)
 Frame = -2

Query  780  RPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMR  601
            RP  +++SC           SSLYD+LGI  GAS QEIKAAYRRLARV HPDVA  ++ R
Sbjct  58   RPSYLNSSC-----------SSLYDILGIPAGASSQEIKAAYRRLARVCHPDVA--AIDR  104

Query  600  EsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWE  421
            +      S A++F+++HAAYSTLSDP+KRANYDRSL R + P ++   +SG     R WE
Sbjct  105  K-----NSSADEFMKIHAAYSTLSDPDKRANYDRSLFRRQRPLSTAAVFSGY--TRRNWE  157

Query  420  TDQCW  406
            TDQCW
Sbjct  158  TDQCW  162



>gb|AAB36543.1| DnaJ-like protein [Phaseolus vulgaris]
Length=161

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 20/125 (16%)
 Frame = -2

Query  780  RPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMR  601
            RP  +++SC           SSLYD+LGI  GAS QEIKAAYRRLARV HPDVA  ++ R
Sbjct  57   RPSYLNSSC-----------SSLYDILGIPAGASSQEIKAAYRRLARVCHPDVA--AIDR  103

Query  600  EsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWE  421
            +      S A++F+++HAAYSTLSDP+KRANYDRSL R + P ++   +SG     R WE
Sbjct  104  K-----NSSADEFMKIHAAYSTLSDPDKRANYDRSLFRRQRPLSTAAVFSG--YTRRNWE  156

Query  420  TDQCW  406
            TDQCW
Sbjct  157  TDQCW  161



>ref|XP_003517172.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=158

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 100/167 (60%), Gaps = 23/167 (14%)
 Frame = -2

Query  870  TSASFLLSSPFVGSAISAAEVARPRCVSFRRPV--SVSASCATAERTAQTPQ--------  721
            +S SF  S P V    S   VA P C    RP+    +A+     R++ T Q        
Sbjct  3    SSVSFPASLPAVN--FSGNAVASPSCRVKSRPIVAFATATATAEARSSWTEQPRPSYLNS  60

Query  720  --SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHA  547
              SSLY+VLGI  GAS QEIKAAYRRLARV HPDVA  ++ R+      S A++F+++HA
Sbjct  61   SCSSLYEVLGIPAGASNQEIKAAYRRLARVFHPDVA--AIDRK-----NSSADEFMKIHA  113

Query  546  AYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            AYSTLSDP+KRANYD+ L R + P ++   +SG     R WETDQCW
Sbjct  114  AYSTLSDPDKRANYDQRLFRRQRPLSTAAVFSGY--TRRNWETDQCW  158



>gb|AET03791.2| chaperone DnaJ domain protein [Medicago truncatula]
Length=140

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 100/158 (63%), Gaps = 18/158 (11%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVL  700
            M STS      +P   +  +   ++ P   +  R V +SA+ +T E +     +SLY++L
Sbjct  1    MLSTS----FPAPLSTATFAGKTISSPPFHAKSRRVLISATASTTEPSC----TSLYEIL  52

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            G+   AS QEIKAAYRRLARV HPDVA  +V R+      S A++F+++HAAYSTL DPE
Sbjct  53   GVAAVASDQEIKAAYRRLARVSHPDVA--AVDRK-----VSSADEFMKIHAAYSTLLDPE  105

Query  519  KRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            KRA+YDRSL R + P  +V G+SG     RKWETDQCW
Sbjct  106  KRASYDRSLFRQQQP-LTVTGFSGY--GCRKWETDQCW  140



>ref|XP_004134859.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like isoform 
1 [Cucumis sativus]
 ref|XP_004158867.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like isoform 
1 [Cucumis sativus]
 gb|KGN48918.1| DnaJ-like protein [Cucumis sativus]
Length=164

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 12/108 (11%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLYDVLGI TGAS QEIK+AYRRLAR+ HPDVA+  + R+ ++A      DF+++HAAY
Sbjct  66   TSLYDVLGIPTGASFQEIKSAYRRLARLCHPDVAA--IHRKDSSAT-----DFMKIHAAY  118

Query  540  STLSDPEKRANYDRSLLRSRHPAASVR---GYSGRRSALRKWETDQCW  406
            STLSDPEKRA+YDR LLR   P AS R   G++G     R WETDQCW
Sbjct  119  STLSDPEKRADYDRKLLRRCRPVASARMASGFTG--YTRRNWETDQCW  164



>gb|KDO84881.1| hypothetical protein CISIN_1g030733mg [Citrus sinensis]
Length=172

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 103/176 (59%), Gaps = 31/176 (18%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRCVSFR-RPVSVSAS-CA-TAERTAQTPQ------SS  715
            S++ L+   F+ +   +   ++P  V FR RP+ VSAS CA TAERT            S
Sbjct  6    SSAHLIGPGFITNETHSQ--SQPTSVKFRPRPLRVSASACASTAERTRTHHHITSPGPGS  63

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LY++LGI+TGA+ QEIK AYR+LARVLHPDVA+ S    SA         F+++H AY T
Sbjct  64   LYEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAY-------KFMKLHEAYET  116

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-------------RKWETDQCW  406
            LSDP+KRA+YDR+L R R P+ S    SG  + +             R WETDQCW
Sbjct  117  LSDPKKRADYDRTLFRRRRPSGSPFAVSGVANTMATSSNSRFCAYSRRTWETDQCW  172



>ref|XP_008440823.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Cucumis 
melo]
Length=162

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 12/108 (11%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VLGI TGAS QEIK+AYRRLAR+ HPDVA+  V R+ ++A      DF+++HAAY
Sbjct  64   TSLYEVLGIPTGASFQEIKSAYRRLARLCHPDVAA--VDRKDSSAT-----DFMKIHAAY  116

Query  540  STLSDPEKRANYDRSLLRSRHPAASVR---GYSGRRSALRKWETDQCW  406
            STLSDPEKRA+YDR LLR   P AS R   G++G     R WETDQCW
Sbjct  117  STLSDPEKRADYDRKLLRRYRPVASARMASGFTG--YTRRNWETDQCW  162



>ref|XP_002306936.1| hypothetical protein POPTR_0005s26220g [Populus trichocarpa]
 gb|ABK95947.1| unknown [Populus trichocarpa]
 gb|ABK96714.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93932.1| hypothetical protein POPTR_0005s26220g [Populus trichocarpa]
Length=175

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 96/171 (56%), Gaps = 34/171 (20%)
 Frame = -2

Query  846  SPFVGSAISAAEV-ARPRCVSFRRPVSVSASCAT-AERTAQ-----TPQSSLYDVLGIRT  688
            SPF GS  S  +    P  VSFR P  V A+CAT AER        T  SSLY+VLGI+ 
Sbjct  15   SPFTGSKTSTNQPHTSPSRVSFR-PFRVRAACATTAERPTSYTATPTSASSLYEVLGIQM  73

Query  687  GASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRAN  508
            GA+  EIK AYRRLARVLHPDVA+     ++A        +FIRVH AY TLSDPEKRA+
Sbjct  74   GATCTEIKTAYRRLARVLHPDVAANGRREDTAY-------EFIRVHEAYETLSDPEKRAD  126

Query  507  YDRSLLRSRHPAAS-----------------VRGYSGRRSALRKWETDQCW  406
            YDRSL R     +S                   G+SG     R+WETDQCW
Sbjct  127  YDRSLYRRGRQMSSPFVMSAATATTMATGYAAAGFSG--YTRRRWETDQCW  175



>ref|XP_003612176.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|AES95134.1| chaperone protein DnaJ 11 [Medicago truncatula]
Length=165

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 95/163 (58%), Gaps = 27/163 (17%)
 Frame = -2

Query  840  FVGSAISAAEVARPRCVSFRRPVSVSASC-ATAE-RTAQTPQS----------------S  715
            +     S   V  P C    +P+ +++S  ATAE R+  T Q                 S
Sbjct  12   YAAGNFSGTSVTPPSCRVKSKPIVITSSATATAEARSTWTEQQRPSYLNMNSSSHSSPAS  71

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LY +LGI  GAS QEIKAAYRRLARV HPDVA  ++ R+      S A+DF+++H+AYST
Sbjct  72   LYQILGISAGASNQEIKAAYRRLARVCHPDVA--AIDRK-----NSSADDFMKIHSAYST  124

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDP+KRANYDRSL R +    S    SG  S  RKWETDQCW
Sbjct  125  LSDPDKRANYDRSLFRQQLRPLSTMVSSGYSS--RKWETDQCW  165



>ref|XP_011045071.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=175

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 96/170 (56%), Gaps = 34/170 (20%)
 Frame = -2

Query  843  PFVGSAISAAEV-ARPRCVSFRRPVSVSASCA-TAERTAQ-----TPQSSLYDVLGIRTG  685
            PF GS  S  +    P  VSFR P  V A+CA TAER        T  SSLY+VLGI+ G
Sbjct  16   PFTGSKTSTNQPHTSPSRVSFR-PFRVRAACASTAERPTSCTATPTSASSLYEVLGIQMG  74

Query  684  ASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANY  505
            A+  EIK AYRRLARVLHPDVA+ +  RE  A       +FIRVH AY TLSDPEKRA+Y
Sbjct  75   ATCTEIKTAYRRLARVLHPDVAA-NCQREDTAY------EFIRVHEAYETLSDPEKRADY  127

Query  504  DRSLLRSRHPAAS-----------------VRGYSGRRSALRKWETDQCW  406
            DRSL R     +S                   G+SG     R+WETDQCW
Sbjct  128  DRSLYRRGRQMSSPFVMSAATATTMATRYAAAGFSG--YTRRRWETDQCW  175



>ref|XP_009363492.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Pyrus 
x bretschneideri]
Length=155

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 103/163 (63%), Gaps = 12/163 (7%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQT--PQS--S  715
            +++++S++  L++P + +A S     R R    R   + SA       TA    PQ+  S
Sbjct  1    MLSASSSTTFLAAPILCAAASPKTSTRVRFQPIRAFATGSAYALPEAETASYLRPQTMTS  60

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LY++LGI   A+ QEIK+AYRRLARV HPDVA+  + R+  +A     ++F+++HAAYST
Sbjct  61   LYEILGIPAVATCQEIKSAYRRLARVCHPDVAA--IERKDTSA-----DEFMKIHAAYST  113

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDP+KRA+YDR  +R   P +S  GYSG  +  R WETDQCW
Sbjct  114  LSDPDKRADYDRQFMRRSRPLSSASGYSGYYTR-RNWETDQCW  155



>ref|XP_008241825.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Prunus mume]
Length=155

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 20/159 (13%)
 Frame = -2

Query  849  SSPFVGSAISAAEVARPRC---VSFRRPVSVSA--SCATAERTAQT----PQ--SSLYDV  703
            +S F  + I +A    P+    V FR P+S  A  S  T++ TA      PQ  +SLY++
Sbjct  6    TSTFFAAPILSATPPPPKTSTRVHFR-PISAFAAGSTCTSDETATASYLGPQKMTSLYEI  64

Query  702  LGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDP  523
            LGI   A+ QEIK+AYRRLARV HPDVA+  + R+  +A     ++F+++HAAYSTLSDP
Sbjct  65   LGIPAVATCQEIKSAYRRLARVCHPDVAA--IERKDTSA-----DEFMKIHAAYSTLSDP  117

Query  522  EKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            EKRA+YDR  +R   P ++  GYSG  +  R WETDQCW
Sbjct  118  EKRADYDRKFMRRSRPLSTASGYSGYYT-RRNWETDQCW  155



>ref|XP_006435191.1| hypothetical protein CICLE_v10002683mg [Citrus clementina]
 gb|ESR48431.1| hypothetical protein CICLE_v10002683mg [Citrus clementina]
Length=170

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 102/175 (58%), Gaps = 31/175 (18%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSAS-CA-TAERTAQTPQ------SSL  712
            S++ L+   F+ +   +   ++P  V FR P+ VSAS CA TAERT            SL
Sbjct  6    SSAHLIGPGFITNETHSQ--SQPTSVKFR-PLRVSASACASTAERTRTHHHITSPGPGSL  62

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y++LGI+TGA+ QEIK AYR+LARVLHPDVA+ S    SA         F+++H AY TL
Sbjct  63   YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAY-------KFMKLHEAYETL  115

Query  531  SDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-------------RKWETDQCW  406
            SDP+KRA+YDR+L R R P+ S    SG  + +             R WETDQCW
Sbjct  116  SDPKKRADYDRTLFRRRRPSGSPFAVSGVANTMATSSNSRFCAYSRRTWETDQCW  170



>ref|XP_007202710.1| hypothetical protein PRUPE_ppa012770mg [Prunus persica]
 gb|EMJ03909.1| hypothetical protein PRUPE_ppa012770mg [Prunus persica]
Length=155

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 20/159 (13%)
 Frame = -2

Query  849  SSPFVGSAISAAEVARPRC---VSFRRPVSVSA--SCATAERTAQT----PQ--SSLYDV  703
            +S F  + I +A    P+    V FR P+S  A  S  T++ TA      PQ  +SLY++
Sbjct  6    TSTFFAAPILSATPPPPKTSTRVHFR-PISAFAAGSTCTSDETATASYLGPQKMTSLYEI  64

Query  702  LGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDP  523
            LGI   A+ +EIK+AYRRLARV HPDVA+  + R+  +A     ++F+++HAAYSTLSDP
Sbjct  65   LGIPAVATCKEIKSAYRRLARVCHPDVAA--IERKDTSA-----DEFMKIHAAYSTLSDP  117

Query  522  EKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            EKRA+YDR  +R   P ++  GYSG  +  R WETDQCW
Sbjct  118  EKRADYDRKFMRRSRPLSTASGYSGYYTC-RNWETDQCW  155



>ref|XP_003629315.1| Chaperone protein dnaJ [Medicago truncatula]
Length=179

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 100/158 (63%), Gaps = 18/158 (11%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVL  700
            M STS      +P   +  +   ++ P   +  R V +SA+ +T E +     +SLY++L
Sbjct  1    MLSTS----FPAPLSTATFAGKTISSPPFHAKSRRVLISATASTTEPSC----TSLYEIL  52

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            G+   AS QEIKAAYRRLARV HPDVA  +V R+      S A++F+++HAAYSTL DPE
Sbjct  53   GVAAVASDQEIKAAYRRLARVSHPDVA--AVDRK-----VSSADEFMKIHAAYSTLLDPE  105

Query  519  KRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            KRA+YDRSL R + P  +V G+SG     RKWETDQCW
Sbjct  106  KRASYDRSLFRQQQP-LTVTGFSG--YGCRKWETDQCW  140



>ref|XP_008377137.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Malus 
domestica]
Length=153

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 92/144 (64%), Gaps = 26/144 (18%)
 Frame = -2

Query  807  ARPRCVSFRRPVSVSASCATAERTAQTPQS------SLYDVLGIRTGASGQEIKAAYRRL  646
            A P  VS+R P+ VSASCA+   T + P+S      SLYDVLGI  GA+ QEIK+AYR+L
Sbjct  26   APPSSVSYR-PLRVSASCAS---TVERPRSRIGSSSSLYDVLGIHAGATCQEIKSAYRKL  81

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL--RSRHPA  472
            ARVLHPDVA  S             ++F++VH AYSTL+D +KRA+YDR ++  R R   
Sbjct  82   ARVLHPDVAKSSA------------DEFMKVHEAYSTLTDEQKRADYDRKMMIGRPRTGV  129

Query  471  ASVRGYSGRRSAL--RKWETDQCW  406
            AS   Y+   S+   R+WETDQCW
Sbjct  130  ASSYAYATTMSSSXGRRWETDQCW  153



>gb|AFK38004.1| unknown [Medicago truncatula]
Length=165

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 95/163 (58%), Gaps = 27/163 (17%)
 Frame = -2

Query  840  FVGSAISAAEVARPRCVSFRRPVSVSASC-ATAE-RTAQTPQS----------------S  715
            +     S   V  P C    +P+ +++S  ATAE R+  T Q                 S
Sbjct  12   YAAGNFSGTSVTPPSCRVKSKPIVITSSATATAEARSTWTEQQRPSYLNMNSSSHSSLAS  71

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LY +LGI  GAS QEIKAAYRRLARV HPDVA  ++ R+      S A+DF+++H+AYST
Sbjct  72   LYQILGISAGASNQEIKAAYRRLARVCHPDVA--AIDRK-----NSSADDFMKIHSAYST  124

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDP+KRANYDRSL R +    S    SG  S  RKWETDQCW
Sbjct  125  LSDPDKRANYDRSLFRQQLRPLSTMVSSGYSS--RKWETDQCW  165



>ref|XP_009379401.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Pyrus 
x bretschneideri]
Length=155

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 101/164 (62%), Gaps = 21/164 (13%)
 Frame = -2

Query  867  SASF---LLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTP-------QS  718
            SASF    L++P + +  S     R R    R   S SA  A+AE  A+TP        +
Sbjct  3    SASFSTTFLTAPILSATASPKTSTRVRFQPIRAFASGSAY-ASAE--AETPSYLRPQTMT  59

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            SLY++LGI   A+ QEIK+AYR+L RV HPDVA+  + R+  +A     ++F+++HAAYS
Sbjct  60   SLYEILGIPAVATCQEIKSAYRKLVRVCHPDVAA--IERKDTSA-----DEFMKIHAAYS  112

Query  537  TLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            TLSDP+KRA+YDR  +R   P AS  GYSG  +  R WETDQCW
Sbjct  113  TLSDPQKRADYDRQFMRRSRPLASASGYSGYYTR-RNWETDQCW  155



>ref|XP_011029033.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=169

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 90/156 (58%), Gaps = 35/156 (22%)
 Frame = -2

Query  804  RPRCVSFR---RPVSVSASCA-TAERTAQ--TPQSSLYDVLGIRTGASGQEIKAAYRRLA  643
            +P  + FR   RP SVSASCA TAER       Q SLY+VLGI+ GA+ QEIKAAYR+LA
Sbjct  26   QPHSLPFRASFRPFSVSASCASTAERPPSRYATQISLYEVLGIQMGATCQEIKAAYRKLA  85

Query  642  RVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLR--------  487
            R LHPDVA  +V +E  A       +FI+VH AY TLSDP+KRA YD SL R        
Sbjct  86   RTLHPDVA-ANVQKEDTAY------EFIKVHEAYETLSDPDKRAEYDLSLFRPGRQMSSP  138

Query  486  ---------SRHPAASVRGYSGRRSALRKWETDQCW  406
                     +   AA    Y+ RR     WETDQCW
Sbjct  139  FVMSAATMETNVVAAGFPAYTRRR-----WETDQCW  169



>gb|EYU38799.1| hypothetical protein MIMGU_mgv1a015308mg [Erythranthe guttata]
Length=161

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 98/178 (55%), Gaps = 37/178 (21%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERT------------  736
            MASTS  F L + F G    AA     +  + R+ + VSA  ATAERT            
Sbjct  1    MASTS--FALPNQFTGRRFPAAPPQMSQ--NLRQTMRVSARYATAERTSSSSSASAAAGE  56

Query  735  ---AQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
               + +  +S YDVLGI+ GA+ QEIK+AYR LAR +HPDVA  S             ++
Sbjct  57   SGNSSSHTASFYDVLGIQAGATSQEIKSAYRNLARTVHPDVAPNSA------------DE  104

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR-----GYSGRRSALRKWETDQCW  406
            F+RVHAAY+TLSDPE+RA YD SL R R     V      GYS   S  R+WETDQCW
Sbjct  105  FMRVHAAYATLSDPEQRAVYDSSLFRMRRRTTVVSMGGGGGYS-EMSRGRRWETDQCW  161



>ref|XP_004512137.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cicer 
arietinum]
Length=158

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 13/106 (12%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SS Y++LG+  GAS +EIK AYRRLARV HPDVA+  + R++++A     +DF+++HAAY
Sbjct  65   SSFYEILGVPAGASIKEIKTAYRRLARVCHPDVAA--IDRKNSSA-----DDFMKIHAAY  117

Query  540  STLSDPEKRANYDRSLLRSRHPAASVR-GYSGRRSALRKWETDQCW  406
            STLSDP+KRANYDRS+ R   P ++V  GYS      RKWETDQCW
Sbjct  118  STLSDPDKRANYDRSIFRRHRPLSTVMSGYSS-----RKWETDQCW  158



>ref|XP_008394321.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Malus 
domestica]
Length=155

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 18/166 (11%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTP-------  724
            +++++S++  L++P + +        R   V F+   + +A    A   A+TP       
Sbjct  1    MLSASSSTTFLTAPILSATSCPKTSTR---VRFQPIRAFAAGSTYASAEAETPSYLRPRT  57

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
             +SLY++LGI   A+ QEIK+AYR+LARV HPDVA+  + R+  +A     ++F+++HAA
Sbjct  58   MTSLYEILGIPAVATCQEIKSAYRKLARVCHPDVAA--IERKDTSA-----DEFMKIHAA  110

Query  543  YSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            YSTLSDP+KRA+YDR  +R   P +S  GYSG  +  R WETDQCW
Sbjct  111  YSTLSDPQKRADYDRQFMRRSRPLSSASGYSGYYTR-RNWETDQCW  155



>ref|XP_010691874.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=184

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 101/176 (57%), Gaps = 39/176 (22%)
 Frame = -2

Query  831  SAISAAEVARPR-----CVSFRRPV-SVSASCATAERTAQT---------PQSSLYDVLG  697
            +++S+    RPR      V+FRRP  S+SA  ATA     T           +SLY+VLG
Sbjct  14   NSLSSTTFNRPRHSPASYVTFRRPTPSISAVYATATANETTSVGVASSSMKTTSLYEVLG  73

Query  696  IRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEK  517
            I+ GA+G+EIKAAYR+LARVLHPDV + +V +      A+ A+DFIRVH AY+TLSDP+K
Sbjct  74   IQAGATGKEIKAAYRKLARVLHPDVVACAVAKS---KDATSADDFIRVHEAYATLSDPKK  130

Query  516  RANYDRSL-LRSRH------------------PAASVRGYSGRRSALRKWETDQCW  406
            RA+YDR + L+ R                      S  G+SG     R WETDQCW
Sbjct  131  RADYDRMMWLQGRRLSYSPTYCTTSGTTKYGGGTTSCSGFSGY--TRRTWETDQCW  184



>ref|XP_004509362.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cicer 
arietinum]
Length=178

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 106/171 (62%), Gaps = 24/171 (14%)
 Frame = -2

Query  891  IQFIMASTSASFLLSSPFVGSAISAAEVARPRCVSFR-RPVSVSASCATAERTA--QTPQ  721
            + FIM STS      +P   +A  + +   P+    R R V +SA+ ATA R +  Q  Q
Sbjct  23   VVFIMISTS----FPTPLSTTATFSGKSISPQSCHVRSRQVLISAT-ATATRPSYLQLHQ  77

Query  720  S------SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFI  559
            S      + Y++LG+   AS +EIKAAYRRLARV HPDVA+  V R+ ++A     + F+
Sbjct  78   SMASCTSTHYEILGVAAVASNREIKAAYRRLARVSHPDVAA--VDRKDSSA-----DKFM  130

Query  558  RVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            ++HAAYSTLSDPEKRA+YDRSL R R P  + R +SG  +  R WETDQCW
Sbjct  131  KIHAAYSTLSDPEKRASYDRSLFRQRQPLMATR-FSGYHN--RNWETDQCW  178



>ref|XP_010104467.1| Chaperone protein dnaJ 11 [Morus notabilis]
 gb|EXC01000.1| Chaperone protein dnaJ 11 [Morus notabilis]
Length=162

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 94/165 (57%), Gaps = 18/165 (11%)
 Frame = -2

Query  861  SFLLSSPFVGSAISAAEVARPRCVSFR--RPVSVSASCA-TAERTAQ---TPQSSLYDVL  700
            S   SS F G  +       P+  SFR  RP+++SASCA T ER      T  SSLY+VL
Sbjct  3    SLTSSSSFFGPNVVVEGRRNPQYPSFRSVRPLTISASCASTVERPGSHIATGTSSLYEVL  62

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            GIR  A+  EIK AYRRLARV+HPDV      R       + A++F+++H AYSTLSDPE
Sbjct  63   GIRMEATCLEIKTAYRRLARVVHPDVVVARGQR-----GQASADEFLKIHEAYSTLSDPE  117

Query  519  KRANYDRSLLRSRHPAASVRGYSGRRSAL-------RKWETDQCW  406
            KRA+YDR L   +  A S    S   S         RKWETDQCW
Sbjct  118  KRADYDRRLFERQWQANSRFTMSSSSSNSGFSSFRPRKWETDQCW  162



>ref|XP_009334954.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Pyrus 
x bretschneideri]
Length=148

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 84/137 (61%), Gaps = 17/137 (12%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATA---ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            PR   F     VSASC++     R+     SSLY+VLGI  GA+ QEIK+AYR+LARV+H
Sbjct  24   PRAPPFSVSYRVSASCSSTVDKPRSRIGASSSLYEVLGIHAGATCQEIKSAYRKLARVVH  83

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL--RSRHPAASVRG  457
            PDVA  S             ++F++VH AYSTLSD +KRA+YDR +L  R R   AS   
Sbjct  84   PDVAKSSA------------DEFMKVHEAYSTLSDAQKRADYDRKMLIGRPRTGVASSYA  131

Query  456  YSGRRSALRKWETDQCW  406
            Y+   S  R+WETDQCW
Sbjct  132  YATTMSTGRRWETDQCW  148



>ref|XP_003612178.1| DnaJ-like protein [Medicago truncatula]
 gb|AES95136.1| chaperone protein DnaJ 11 [Medicago truncatula]
 gb|AFK38011.1| unknown [Medicago truncatula]
Length=165

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 15/107 (14%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            S Y++LGI  GAS QEIKAAYRRLARV HPDVA  ++ R+      S A+DF+++H+AYS
Sbjct  71   SHYEILGISAGASNQEIKAAYRRLARVCHPDVA--AIDRK-----NSSADDFMKIHSAYS  123

Query  537  TLSDPEKRANYDRSLLR-SRHPAASV--RGYSGRRSALRKWETDQCW  406
            TLSDP+KRANYDRSL R  R P +++   GYS      RKWETDQCW
Sbjct  124  TLSDPDKRANYDRSLFRQQRRPLSTMVSSGYSS-----RKWETDQCW  165



>gb|EYU36790.1| hypothetical protein MIMGU_mgv1a015569mg [Erythranthe guttata]
Length=153

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 83/128 (65%), Gaps = 8/128 (6%)
 Frame = -2

Query  783  RRPVSVSASCATAERTAQTPQ--SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGS  610
            R  +  SAS  TA+RT Q  +  +SLY VLG++TGA+ QEIK+AYR+LARVLHPDVAS  
Sbjct  32   RNQLRFSASYTTADRTCQAARQTASLYQVLGVQTGATCQEIKSAYRKLARVLHPDVASVG  91

Query  609  VMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALR  430
               +      S AE FI+VHAAY+TLSDPEKR  YD SL R R   A    YS      +
Sbjct  92   PEGD-----TSAAEKFIQVHAAYATLSDPEKRMVYDSSLFRQRRRTAGP-CYSELTRRGQ  145

Query  429  KWETDQCW  406
             WETDQCW
Sbjct  146  TWETDQCW  153



>ref|XP_010042756.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Eucalyptus 
grandis]
Length=168

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 91/144 (63%), Gaps = 21/144 (15%)
 Frame = -2

Query  798  RCVSFRRPVSVSASCA-TAERT------AQTPQSSLYDVLGIRTGASGQEIKAAYRRLAR  640
            RC   R    VSASCA TAER       A++  SSLY+VLGIR GA+GQEIK AYRRLAR
Sbjct  33   RCRPLR---VVSASCASTAERPRPMAAGARSQASSLYEVLGIRAGATGQEIKTAYRRLAR  89

Query  639  VLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRS------RH  478
            VLHPDVA+ +        AA+   +F+RVH AY+TLSDPE+RA+YDR+L R         
Sbjct  90   VLHPDVAAPAGA-----GAAAAGREFMRVHEAYATLSDPERRADYDRTLFRGPGRFAVSV  144

Query  477  PAASVRGYSGRRSALRKWETDQCW  406
              A+    +  R   RKWETDQCW
Sbjct  145  ATAAAAAGASARGPSRKWETDQCW  168



>ref|XP_008337119.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Malus 
domestica]
Length=155

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 101/163 (62%), Gaps = 12/163 (7%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQT--PQS--S  715
            +++++S++  L++P + +  S     R R    R   + SA       TA    PQ+  S
Sbjct  1    MLSASSSTAFLAAPILSATASPKTSTRVRFQPIRAFATGSAYALPEAETASYLRPQTMTS  60

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LY++LGI   A+ QEIK+AYRRLARV HPDVA+  + R+  +A     ++F+++HAAYST
Sbjct  61   LYEILGIPAVATCQEIKSAYRRLARVCHPDVAA--IERKDTSA-----DEFMKIHAAYST  113

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDP+KRA+YDR  +R   P +S   YSG  +  R WETDQCW
Sbjct  114  LSDPDKRADYDRQFMRRSRPLSSASRYSGYYTR-RNWETDQCW  155



>ref|XP_011029032.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=171

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 89/139 (64%), Gaps = 27/139 (19%)
 Frame = -2

Query  768  VSASCA-TAERTAQ---TPQS--SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSV  607
            VSA+CA TAER      TP S  SLY+VLGI+ GA+ QEIK AYRRLAR+LHPDVA+   
Sbjct  42   VSAACASTAERPTSYIATPTSAPSLYEVLGIQMGATCQEIKTAYRRLARILHPDVAANG-  100

Query  606  MREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRH--------PAASV----  463
             RE  A       +F+R+H AY TLSDPEKRA+YDRSL R            AA+V    
Sbjct  101  QREDTAY------EFMRIHEAYETLSDPEKRADYDRSLYRRGRRVGSPFVMSAATVTTMA  154

Query  462  RGYSGRRSALRKWETDQCW  406
             G+SG  S  ++WETDQCW
Sbjct  155  TGFSGYTS--QRWETDQCW  171



>ref|XP_008221249.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Prunus 
mume]
Length=155

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 91/139 (65%), Gaps = 20/139 (14%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATA---ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  +++R P+ VSASC +     RT     SSLY+VLGI TGA+ QEIK+AYR+LARV+H
Sbjct  30   PSSITYR-PLRVSASCTSTVDRPRTRTGSSSSLYEVLGIHTGATCQEIKSAYRKLARVVH  88

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL----RSRHPAASV  463
            PDVA+            + A++F+++H AYSTLSD +KRA+YDR +L    RS +  A+ 
Sbjct  89   PDVATDG---------QTSADEFMKIHEAYSTLSDAQKRADYDRMMLIRRPRSSYSYATT  139

Query  462  RGYSGRRSALRKWETDQCW  406
               S   +A R+WETDQCW
Sbjct  140  MSAS---AAGRRWETDQCW  155



>ref|XP_008366742.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Malus 
domestica]
Length=148

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 86/139 (62%), Gaps = 21/139 (15%)
 Frame = -2

Query  807  ARPRCVSFRRPVSVSASCATA---ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARV  637
            A P  VS+R    V+ASC +     R+     SSLY+VLGI  GA+ QEIK+AYR+LARV
Sbjct  26   APPSSVSYR----VAASCTSTVDKPRSRIGSNSSLYEVLGIHAGATCQEIKSAYRKLARV  81

Query  636  LHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL--RSRHPAASV  463
            +HPDVA  S             ++F++VH AYSTLSD +KRA+YDR +L  + R   AS 
Sbjct  82   VHPDVAKSSA------------DEFMKVHEAYSTLSDAQKRADYDRKMLIGQPRTGVASS  129

Query  462  RGYSGRRSALRKWETDQCW  406
              Y+   S  R+WETDQCW
Sbjct  130  YAYATTMSTGRRWETDQCW  148



>ref|XP_003547933.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=157

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 99/169 (59%), Gaps = 31/169 (18%)
 Frame = -2

Query  855  LLSSPFVGSAISAAE---VARPRCVSFRRPVSVSASCATAERTAQT-----PQ------S  718
            + ++PF  S ++ +     + PR V FR  VS + +  T E+  +      P       +
Sbjct  1    MFTAPFPTSTVTLSGESVTSPPRHVRFRSVVSFATATFTEEQQHKAAPYLRPHHGMALSA  60

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            +LYD+LGIR  ASG+EI+AAYRRLARV HPDVA   V R+ ++A      +F+++HAAY 
Sbjct  61   TLYDILGIRATASGEEIRAAYRRLARVCHPDVAP--VERKESSAG-----EFMKIHAAYC  113

Query  537  TLSDPEKRANYDRSLLRSRH-----PAASVRGYSGRRSALRKWETDQCW  406
            TLSDPEKR +YDRSL R +       ++   GY G     R WETDQCW
Sbjct  114  TLSDPEKRDSYDRSLFRRQQRPVKTTSSGASGYGG-----RNWETDQCW  157



>ref|XP_010069818.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Eucalyptus 
grandis]
Length=168

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 91/144 (63%), Gaps = 21/144 (15%)
 Frame = -2

Query  798  RCVSFRRPVSVSASCA-TAERT------AQTPQSSLYDVLGIRTGASGQEIKAAYRRLAR  640
            RC   R    VSASCA TAER       A++  SSLY+VLGIR GA+GQEIK AYRRLAR
Sbjct  33   RCRPLR---VVSASCASTAERPRPMAAGARSQASSLYEVLGIRAGATGQEIKTAYRRLAR  89

Query  639  VLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRS------RH  478
            VLHPDVA+ +        AA+   +F+RVH AY+TLSDP++RA+YDR+L R         
Sbjct  90   VLHPDVAAPAGA-----GAAAAGREFMRVHEAYATLSDPDRRADYDRTLFRGPGRFAVSV  144

Query  477  PAASVRGYSGRRSALRKWETDQCW  406
              A+    +  R   RKWETDQCW
Sbjct  145  ATAAAAAAASARGPSRKWETDQCW  168



>gb|EPS74128.1| hypothetical protein M569_00628, partial [Genlisea aurea]
Length=151

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = -2

Query  780  RPVSVSASCATAERTAQTPQS-SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVM  604
            RP S SA+  +  R+ + P + S Y+VLG+ T +S +EIK+AYR LARVLHPD A  S  
Sbjct  24   RPPSSSAAPISPRRSLRLPNTPSFYEVLGVETTSSTKEIKSAYRGLARVLHPDAAFCSAA  83

Query  603  REsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLR--SRHPAASVRGYSGRRSALR  430
             ++   A+S A++FIR+  AYSTLSDPEKRA YD SLLR  +R  + S   YSG     R
Sbjct  84   EDAGRGASSTADEFIRLRTAYSTLSDPEKRAAYDVSLLRRGNRTVSLSSGEYSGAARGRR  143

Query  429  KWETDQCW  406
             WETDQCW
Sbjct  144  NWETDQCW  151



>ref|XP_007223654.1| hypothetical protein PRUPE_ppa012765mg [Prunus persica]
 gb|EMJ24853.1| hypothetical protein PRUPE_ppa012765mg [Prunus persica]
Length=155

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 18/138 (13%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATA---ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  +++R P+ VSASC +     RT     SSLY+VLGI T A+ QEIK+AYR+LARV+H
Sbjct  30   PSSITYR-PLRVSASCTSTVDRPRTRTGSSSSLYEVLGIHTSATCQEIKSAYRKLARVVH  88

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA+            + A++F++VH AYSTLSD +KRA+YDR +L SR P +S   Y+
Sbjct  89   PDVATDG---------QTSADEFMKVHEAYSTLSDAQKRADYDRMMLISR-PRSSY-SYA  137

Query  450  GRRSAL---RKWETDQCW  406
               SA    R+WETDQCW
Sbjct  138  TTMSASAAGRRWETDQCW  155



>gb|KHN01597.1| Chaperone protein dnaJ 11, chloroplastic [Glycine soja]
Length=165

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 74/111 (67%), Gaps = 16/111 (14%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            ++LY++LGIR   S +EIKAAYRRLARV HPDVA             S   +F+++H AY
Sbjct  65   TTLYEILGIRVTTSDEEIKAAYRRLARVYHPDVAPAE-------RKESFTGEFMKIHTAY  117

Query  540  STLSDPEKRANYDRSLLRSRHP------AASVRGYSGRRSALRKWETDQCW  406
             TLSDPEKRANYDRSL+R RH       ++S+ G+SG  S   KWETDQCW
Sbjct  118  RTLSDPEKRANYDRSLIR-RHQKPLTMSSSSLWGFSGYTS--HKWETDQCW  165



>ref|XP_003612179.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|AES95137.1| chaperone protein DnaJ 11 [Medicago truncatula]
 gb|AFK41326.1| unknown [Medicago truncatula]
Length=168

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 77/107 (72%), Gaps = 17/107 (16%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            YD+LGI   AS QEIKAAYRRLAR+ HPDVAS  V R++++A     +DF+++  AYSTL
Sbjct  74   YDILGISAAASNQEIKAAYRRLARLCHPDVAS--VDRKNSSA-----DDFMKIQVAYSTL  126

Query  531  SDPEKRANYDRSL-LRSRHPAASV----RGYSGRRSALRKWETDQCW  406
            SDP+KRANYDRSL LR + P +S      GYSGR     KWETDQCW
Sbjct  127  SDPDKRANYDRSLFLRRQRPLSSSAIISSGYSGR-----KWETDQCW  168



>ref|XP_003548847.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=165

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 16/111 (14%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            ++LY++LGIR  AS +EIKAAYRRLARV HPDVA             S   +F+++H AY
Sbjct  65   TTLYEILGIRVTASDEEIKAAYRRLARVYHPDVAPAE-------RKESFTGEFMKIHTAY  117

Query  540  STLSDPEKRANYDRSLLRSRHP------AASVRGYSGRRSALRKWETDQCW  406
             TLSDPEKRANYDRSL+R RH       ++S+ G+SG  S   KW+TDQCW
Sbjct  118  RTLSDPEKRANYDRSLIR-RHQKPLTMSSSSLWGFSGYTS--HKWKTDQCW  165



>ref|XP_002521655.1| Chaperone protein dnaJ 11, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF40642.1| Chaperone protein dnaJ 11, chloroplast precursor, putative [Ricinus 
communis]
Length=144

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 85/141 (60%), Gaps = 21/141 (15%)
 Frame = -2

Query  801  PRCVSFRRP-VSVSASCATAERTAQ---TPQ---SSLYDVLGIRTGASGQEIKAAYRRLA  643
            PR  +FR P +S S +    +R++     PQ   SSLY+VLGI  GAS QEIK+AYRRLA
Sbjct  16   PRITTFRPPFISNSTTTTYKQRSSNLYINPQRMTSSLYEVLGIPIGASNQEIKSAYRRLA  75

Query  642  RVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP--AA  469
            R  HPDVA+            + A++F+++HAAYSTLSDP+KRA YD  L+    P   +
Sbjct  76   RTCHPDVAT-------LDRKDTSADEFMKIHAAYSTLSDPQKRAVYDLKLVTKNRPLTVS  128

Query  468  SVRGYSGRRSALRKWETDQCW  406
               GY G     R WETDQCW
Sbjct  129  YSGGYRG-----RSWETDQCW  144



>ref|XP_011083572.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Sesamum 
indicum]
Length=151

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 97/164 (59%), Gaps = 19/164 (12%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTA----QTPQSSL  712
            MASTS  F L +  +G   SA  +  P     R    VS+  ATAER +         + 
Sbjct  1    MASTS--FALPNRKLGRRFSA--IPPPHSPLLR----VSSGYATAERISVCRDGNDSPTA  52

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLGI+TGA+ QEIK+AYR LARVLHPDVA      +     AS A++F+RVHAAY+TL
Sbjct  53   YEVLGIQTGATCQEIKSAYRNLARVLHPDVAP-----KYGDDGASSADEFMRVHAAYATL  107

Query  531  SDPEKRANYDRSLLRSRHPAA--SVRGYSGRRSALRKWETDQCW  406
            SDP+KRA YD SL   R  AA  S  GYS      R WETDQCW
Sbjct  108  SDPDKRAVYDNSLFIRRRSAAAFSASGYSEASGRRRTWETDQCW  151



>ref|XP_002510545.1| Chaperone protein dnaJ 11, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF52732.1| Chaperone protein dnaJ 11, chloroplast precursor, putative [Ricinus 
communis]
Length=171

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 99/164 (60%), Gaps = 27/164 (16%)
 Frame = -2

Query  843  PFVGSAI-SAAEVARPRCVSFRRPVSVSASCATAERTAQ-----TPQSSLYDVLGIRTGA  682
            PF+G    + +  + P  VSFR+ + VSA+CAT           +   SLY+VLGI+ GA
Sbjct  17   PFIGPKFPTDSHRSPPSRVSFRQ-LRVSANCATTADRTAAAPHISSAGSLYEVLGIQMGA  75

Query  681  SGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYD  502
            + QEIKAAYRRLARVLHPD A+ +  +E      + A +FI+VH AY TLSDPEKRA+YD
Sbjct  76   TCQEIKAAYRRLARVLHPDAATDNGQKE------NKANEFIKVHEAYETLSDPEKRADYD  129

Query  501  RSLL-RSRHPAASV-----------RGYSGRRSALRKWETDQCW  406
            RSL  R R  +++             G+SG     R+WETDQCW
Sbjct  130  RSLFWRGRQLSSAFITSAMAASASGSGFSG--FPRRRWETDQCW  171



>ref|XP_010679930.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=155

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 82/141 (58%), Gaps = 24/141 (17%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDV  622
            P  V FRR  +VSA+      + +T  SSLY+VL I   A+ +EIKAAYRRLAR  HPDV
Sbjct  30   PESVKFRRASAVSATA-----SPETAASSLYEVLEISIAATNEEIKAAYRRLARSCHPDV  84

Query  621  ASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGR-  445
            A+G             A++FIRVHAAYS LSDPEKRA+YDR + +   P  S R + G  
Sbjct  85   AAGE--------ERQSADEFIRVHAAYSVLSDPEKRADYDRKMSQIIRP--STRQFPGLS  134

Query  444  --------RSALRKWETDQCW  406
                    R   R WETDQCW
Sbjct  135  ASPTSSFCRVPRRNWETDQCW  155



>ref|XP_010113343.1| Chaperone protein dnaJ 11 [Morus notabilis]
 gb|EXC35350.1| Chaperone protein dnaJ 11 [Morus notabilis]
Length=180

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 92/147 (63%), Gaps = 17/147 (12%)
 Frame = -2

Query  840  FVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKA  661
            F G A +A +  + +     +  S +AS    +  ++   +SLY++LGI  GA+ QEIKA
Sbjct  49   FAGGAATAEKQEQKK-----QNQSSTASFLNIDNPSRLMAASLYEILGIPRGATCQEIKA  103

Query  660  AYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSR  481
            AYRRLARV HPDVA  ++ R+      S A+DF ++HAAYSTLSDP KRA+YDR LLR R
Sbjct  104  AYRRLARVCHPDVA--AIDRK-----DSSADDFKKIHAAYSTLSDPAKRADYDRKLLR-R  155

Query  480  H--PAASVRGYSGRRSALRKWETDQCW  406
            H  P     G+SG     R WETDQCW
Sbjct  156  HGRPLTVATGFSG--FTRRNWETDQCW  180



>ref|XP_009386190.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=146

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 14/132 (11%)
 Frame = -2

Query  789  SFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGS  610
            S RR + +   CA+A       +++LYDVLG+ TGA+G EIK AYRRLAR  HPDVA+ +
Sbjct  25   SCRRRLLLPPRCASASPPVPASEATLYDVLGVPTGATGGEIKVAYRRLARECHPDVAAAT  84

Query  609  VMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS---  439
                        +++FIR+HAAY+TLSDPEKRA YD+ ++ +   AA+ R +S R S   
Sbjct  85   ----------ESSDEFIRLHAAYATLSDPEKRAEYDQRVMAATANAAAGRRWSPRLSYSC  134

Query  438  -ALRKWETDQCW  406
               R+WETDQCW
Sbjct  135  RPCRRWETDQCW  146



>ref|XP_007046689.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma 
cacao]
 gb|EOX90846.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma 
cacao]
Length=164

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 75/106 (71%), Gaps = 10/106 (9%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLGI  GAS QEIKAAYRRLARV HPDVA  ++ R+      S A++F+++HAAY
Sbjct  68   SSLYEVLGISVGASNQEIKAAYRRLARVCHPDVA--AIDRK-----DSSADEFMKIHAAY  120

Query  540  STLSDPEKRANYDRSL-LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            STLSDPEKRA YD  L  R + P  S   +SG R   R WETDQCW
Sbjct  121  STLSDPEKRAVYDSKLNWRRQRPLTSASRFSGYRG--RSWETDQCW  164



>ref|XP_002277590.3| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Vitis vinifera]
Length=157

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 11/109 (10%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLGI   ASG EIKAAYRRLARV HPDV + +          + A +F+++HAAY
Sbjct  56   SSLYEVLGIPVSASGNEIKAAYRRLARVCHPDVVAMN-------QKETSANEFMKIHAAY  108

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS----ALRKWETDQCW  406
            STLSDP+KRANYD+ L R R P  +    +G  S    + R WETDQCW
Sbjct  109  STLSDPDKRANYDQDLFRRRRPVMATAMRTGGSSFSGFSRRTWETDQCW  157



>ref|XP_006425455.1| hypothetical protein CICLE_v10026825mg [Citrus clementina]
 gb|ESR38695.1| hypothetical protein CICLE_v10026825mg [Citrus clementina]
Length=101

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 10/106 (9%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VLGI  GA+ Q+IK AYRRLAR LHPDV +            S A++FI++HAAY
Sbjct  5    ASLYEVLGIPMGATSQDIKTAYRRLARTLHPDVVA-------IEGKDSTADEFIKIHAAY  57

Query  540  STLSDPEKRANYDRSLLRS-RHPAASVRGYSGRRSALRKWETDQCW  406
            STLSDP KRA YD+ L ++ R P  +V GYSG     R WETDQCW
Sbjct  58   STLSDPLKRAVYDQRLFQTRRRPLTAVSGYSGYSG--RNWETDQCW  101



>ref|XP_008653416.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Zea 
mays]
 tpg|DAA44362.1| TPA: hypothetical protein ZEAMMB73_987137 [Zea mays]
Length=154

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 77/133 (58%), Gaps = 22/133 (17%)
 Frame = -2

Query  777  PVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMRE  598
            P+S S S            SS YDVLG+R GAS +EIKAAYRRLA  +HPD A       
Sbjct  35   PLSASFSTVATAAPGHAAASSFYDVLGLRPGASAREIKAAYRRLALAVHPDAAPHPT---  91

Query  597  saaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR---------GYSGR  445
                  S AEDFIRVHAAYSTLSDP+KRA+YDR LL S    A+VR          +   
Sbjct  92   ------SSAEDFIRVHAAYSTLSDPDKRADYDRRLLLS---GATVRRTVALGRSPSFPAH  142

Query  444  RSALRKWETDQCW  406
            RS  R WETDQCW
Sbjct  143  RSR-RTWETDQCW  154



>ref|XP_006383098.1| DnaJ-like family protein [Populus trichocarpa]
 gb|ERP60895.1| DnaJ-like family protein [Populus trichocarpa]
Length=139

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 88/143 (62%), Gaps = 22/143 (15%)
 Frame = -2

Query  807  ARPRCVSFRRPVSVSASCATA---ERTAQTPQ---SSLYDVLGIRTGASGQEIKAAYRRL  646
            A PR V+F+RP+  +++  T      + + PQ   SSLY++L I  GA+ QEIK AYRRL
Sbjct  10   APPR-VTFKRPLVTNSTTTTLPPRNLSLKKPQGMASSLYEILRIPVGATNQEIKTAYRRL  68

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSL-LRSRHPAA  469
            AR  HPDV +            + A++F+++HAAYSTLSDPEKRA YD  L +R + P  
Sbjct  69   ARTYHPDVVAED-------RKDTSADEFMKLHAAYSTLSDPEKRAVYDSKLFIRKQRPLT  121

Query  468  SV--RGYSGRRSALRKWETDQCW  406
            +V   GYSG     R WETDQCW
Sbjct  122  TVGFSGYSG-----RTWETDQCW  139



>ref|XP_011043186.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=139

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 22/143 (15%)
 Frame = -2

Query  807  ARPRCVSFRRPVSVSASCAT---AERTAQTPQ---SSLYDVLGIRTGASGQEIKAAYRRL  646
            A PR V+F+RP+  +++  T      + + PQ   SSLY++L I  GA+ QEIK AYR+L
Sbjct  10   APPR-VTFKRPLVTNSTTTTLPPPNLSLKKPQGMASSLYEILRIPVGATNQEIKTAYRKL  68

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSL-LRSRHPAA  469
            AR  HPDV +            + A++F+++HAAYSTLSDPEKRA YD  L +R + P  
Sbjct  69   ARTYHPDVVAED-------RKDTSADEFMKLHAAYSTLSDPEKRAVYDSKLFIRKQRPLT  121

Query  468  SV--RGYSGRRSALRKWETDQCW  406
            +V   GYSG     R WETDQCW
Sbjct  122  TVGFSGYSG-----RTWETDQCW  139



>ref|NP_179378.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK55668.1|AF378865_1 At2g17880 [Arabidopsis thaliana]
 gb|AAM10274.1| At2g17880/At2g17880 [Arabidopsis thaliana]
 gb|AAM64303.1| putative DnaJ protein [Arabidopsis thaliana]
 dbj|BAE99221.1| putative DnaJ protein [Arabidopsis thaliana]
 gb|AEC06698.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=160

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 19/130 (15%)
 Frame = -2

Query  774  VSVSASCA-TAERTAQTPQ-----SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASG  613
             + S +CA    R  Q PQ     +SLY++L I  G++ QEIK+AYRRLAR+ HPDVA  
Sbjct  43   TTASYTCAEDLPRLRQIPQRFSATASLYEILEIPVGSTSQEIKSAYRRLARICHPDVARN  102

Query  612  SVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYD-RSLLRSRHPAASVRGYSGRRSA  436
            S          S A+DF+++HAAY TLSDPEKRA YD R+LLRSR   A    Y G    
Sbjct  103  S-------RDNSSADDFMKIHAAYCTLSDPEKRAVYDRRTLLRSRPLTAGYGSYGG----  151

Query  435  LRKWETDQCW  406
             R WETDQCW
Sbjct  152  -RNWETDQCW  160



>dbj|BAJ96182.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=141

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 94/163 (58%), Gaps = 35/163 (21%)
 Frame = -2

Query  855  LLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTP----------QSSLYD  706
            ++S+P     +  + VARP    FR+    +ASC+++ RT +            + +LY+
Sbjct  1    MISAP----PVMQSSVARPALAGFRQ----AASCSSSRRTVRCAVAVASAAPAGRCTLYE  52

Query  705  VLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSD  526
            VLG+R GA+G EIKAAYRRLAR  HPDVA  +             +DFIR+H AY+TLSD
Sbjct  53   VLGLRAGATGGEIKAAYRRLARERHPDVAGAA------------GDDFIRLHDAYATLSD  100

Query  525  PEKRANYDRSLL---RSRHPAASVRGYSGRRSALRKWETDQCW  406
            P+ RA YDR ++    ++ PAA   G  GR    R WETDQCW
Sbjct  101  PDARARYDRDVVVQAYAQPPAARTNGVWGR--PRRTWETDQCW  141



>ref|XP_002305500.2| hypothetical protein POPTR_0004s17810g [Populus trichocarpa]
 gb|EEE86011.2| hypothetical protein POPTR_0004s17810g [Populus trichocarpa]
Length=158

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 93/174 (53%), Gaps = 31/174 (18%)
 Frame = -2

Query  882  IMASTSASFL--------LSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQT  727
            ++A+ + SFL         SSPF G +       +PR  SF        S  + +  A T
Sbjct  1    MLATPTTSFLQITTTKTPCSSPFSGESYPL----KPR-ASFTTASQAKKSQGSVDSMATT  55

Query  726  PQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHA  547
              SS Y+VLG+   ASG EIKAAYRRLAR  HPDV S              A +FI++ A
Sbjct  56   --SSFYEVLGLPMSASGHEIKAAYRRLARTCHPDVVS-------MNQKEMSATEFIKIRA  106

Query  546  AYSTLSDPEKRANYDRSLLRSRHP-------AASVRGYSGRRSALRKWETDQCW  406
            AYSTLSDP+KRA+YDR L R+  P       +A++   SG  S  R WETDQCW
Sbjct  107  AYSTLSDPDKRASYDRDLFRNSRPFGSSSMRSATMAAASGYTS--RNWETDQCW  158



>ref|XP_009401913.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=171

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 73/114 (64%), Gaps = 17/114 (15%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDV-ASGSVMREsaaaaaspAEDFIRVHAA  544
            SSLYDVLG+  GASGQEIKAAYR+LA   HPDV A+G           + AE F+RVHAA
Sbjct  66   SSLYDVLGVSPGASGQEIKAAYRQLALACHPDVIATG--------RKGASAEKFMRVHAA  117

Query  543  YSTLSDPEKRANYDRS------LLRSRHPAASV--RGYSGRRSALRKWETDQCW  406
            Y+TLSDP KRANYDR       L+R R PAA    R  S  R   R WETDQCW
Sbjct  118  YATLSDPGKRANYDRELAAAAMLVRHRWPAARTYARSTSFPRYGRRTWETDQCW  171



>emb|CAN73239.1| hypothetical protein VITISV_035335 [Vitis vinifera]
Length=479

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 87/138 (63%), Gaps = 10/138 (7%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRC-VSFRRPVSVSASCATAERTAQ--TPQSSLYDVLG  697
            SA+   SS FV   ++  + A P   V FR+P   ++  ATAERT       +SLYDVLG
Sbjct  240  SAAXFSSSHFVVPKVAVNQRASPPTYVRFRQPKVSASYTATAERTMSHIANPASLYDVLG  299

Query  696  IRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEK  517
            I  GA+ QEIKAAYRRLARV HPDV + S          + A++FI++HAAY+TLSDPEK
Sbjct  300  INMGATCQEIKAAYRRLARVSHPDVVANS-------QKDTSADEFIKIHAAYATLSDPEK  352

Query  516  RANYDRSLLRSRHPAASV  463
            RA YDR+L R R P   V
Sbjct  353  RAXYDRTLFRRRRPGKRV  370



>ref|XP_004291355.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=154

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 20/139 (14%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATAERTAQTP-------QSSLYDVLGIRTGASGQEIKAAYRRLA  643
            P  V FR P ++SAS A+   T   P         SLYDVLGI TGA+ QEIK AYRRLA
Sbjct  29   PSSVKFR-PATISASFAS---TVDRPRIHIGGSNPSLYDVLGIPTGATCQEIKTAYRRLA  84

Query  642  RVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASV  463
            R +HPDV + +          S +++F++VH AY+TLSDP+KRA+YD  +L  R P    
Sbjct  85   RTVHPDVTAAN--------GQSSSDEFMKVHEAYATLSDPQKRADYDHRML-FRRPVPMG  135

Query  462  RGYSGRRSALRKWETDQCW  406
              +S   S+ R+WETDQCW
Sbjct  136  SSFSMSSSSGRRWETDQCW  154



>ref|XP_009782440.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Nicotiana 
sylvestris]
Length=154

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 90/163 (55%), Gaps = 20/163 (12%)
 Frame = -2

Query  867  SASFLLSSP-FVGSAISAAE--VARPRCVSFRRPVSVSASCATAERTAQT------PQSS  715
            SASF  S P    +  S+ E     P CV FR+  S S + AT    A+         +S
Sbjct  3    SASFRQSPPPTAANTFSSGESSFLSPSCVRFRQYGSFSVAAATCGSVARCVPAVSASPAS  62

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
             Y++L I  GA+ +EIKAAYRRLARV HPDVA+            + A +F+++HAAY T
Sbjct  63   FYEILEIPMGATSEEIKAAYRRLARVCHPDVAA-------VDQKDTSAGEFMKIHAAYCT  115

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDPEKRA YDR L   R    SV  YSG     R WETDQCW
Sbjct  116  LSDPEKRAEYDRRLWNQRR--RSVGLYSGY--TCRNWETDQCW  154



>ref|XP_009611393.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 107/187 (57%), Gaps = 38/187 (20%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVA--RPRCVSFRRP---VSVSASCATAERTAQTPQ-  721
            ++++++ SFL + P   +  S+ + +   P  ++FR+     + +A+CA+ E  + T + 
Sbjct  1    MISTSTRSFLQTPPPPVNIFSSGDNSALSPSSLTFRQSGYFTAAAATCASVETESTTSRY  60

Query  720  ------------SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaas  577
                        +S Y++L I  GA+ QEIKAAYRRLARV HPDVA+            S
Sbjct  61   STLPRNLIPVSPASFYEILDIPMGATVQEIKAAYRRLARVCHPDVAA-------MDQKDS  113

Query  576  pAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSG--RRSAL--------RK  427
             A+DF+++HAAYSTLSDP+KRA+YDR L R R    S+  YSG    SA+        R 
Sbjct  114  SADDFMKIHAAYSTLSDPDKRADYDRRLSRRR---PSINLYSGGCSPSAMSGFTGYTPRN  170

Query  426  WETDQCW  406
            WETDQCW
Sbjct  171  WETDQCW  177



>ref|XP_010041102.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Eucalyptus 
grandis]
Length=151

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 70/106 (66%), Gaps = 5/106 (5%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLGI  GAS QEIK AYRRLAR  HPD A+ + +        + A++F+R+HAAY
Sbjct  50   SSLYEVLGIPVGASCQEIKVAYRRLARSCHPDAAAAATVDR----NGASADEFMRIHAAY  105

Query  540  STLSDPEKRANYDRSLLRSR-HPAASVRGYSGRRSALRKWETDQCW  406
            STLSDPEKRA YD SL R R  P  +V    G     R WETDQCW
Sbjct  106  STLSDPEKRAVYDSSLFRRRSRPLTAVATGGGGGYRGRNWETDQCW  151



>ref|XP_010437388.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Camelina 
sativa]
Length=166

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 83/136 (61%), Gaps = 21/136 (15%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P+ VSASC+      + R  Q P+      +SLYDVL +  GA+ Q+IK+AYRRLAR+ H
Sbjct  40   PLLVSASCSYTCAEDSPRLHQIPRRFTAATASLYDVLEVPLGATSQDIKSAYRRLARICH  99

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA             S AE+F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  100  PDVAGTD-------RTNSSAEEFMKIHAAYCTLSDPEKRSVYDRRMLRRSSPLTV--GTS  150

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  151  GLGSYVGRNWETDQCW  166



>ref|XP_010531087.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Tarenaya 
hassleriana]
Length=158

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 71/109 (65%), Gaps = 9/109 (8%)
 Frame = -2

Query  729  TPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
            +P +SLY++L +  GA+ QEIK AYRRLAR+ HPDVA             S A++FIR+H
Sbjct  58   SPSASLYEILEVPIGATSQEIKTAYRRLARICHPDVAG-------IDRKNSSADEFIRIH  110

Query  549  AAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS-ALRKWETDQCW  406
            AAY TLSDPEKRA YDR +LR   P  S  G SG  S   R WETDQCW
Sbjct  111  AAYCTLSDPEKRAVYDRRILRRSRPLTS-SGISGFGSYGGRNWETDQCW  158



>ref|XP_008788382.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Phoenix 
dactylifera]
Length=177

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 86/159 (54%), Gaps = 43/159 (27%)
 Frame = -2

Query  795  CVSFRRPVSVSASCATAER--------TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLAR  640
              S R P   +A  A AER         A +P +SLYDVLG+   A+GQEIKAAYRRLAR
Sbjct  33   ATSLRSPGISAAYTAAAERRPADALSPAAPSPVASLYDVLGLPADATGQEIKAAYRRLAR  92

Query  639  VLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLR---------  487
              HPDV +            + A++FIR+HAAYSTLSDP+KRA+YDR LL          
Sbjct  93   ASHPDVVA-------TDRKGTSADEFIRIHAAYSTLSDPDKRADYDRKLLLLGRHRRTVR  145

Query  486  ------------SRHPAASVRGYSGRRSALRKWETDQCW  406
                        SR P  S  GY GRR+    WETDQCW
Sbjct  146  RPTTQPSSSWAFSRSP--SFPGY-GRRT----WETDQCW  177



>gb|KDP46757.1| hypothetical protein JCGZ_06545 [Jatropha curcas]
Length=151

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 23/150 (15%)
 Frame = -2

Query  819  AAEVARPRCVSFRRPVSVSASCATAERTAQTPQS------------SLYDVLGIRTGASG  676
            + + A P    FR P  V+ + A  +R++ +  +            SLY++LG+  GA+ 
Sbjct  13   SVQTASPHRSKFRPPFIVNTATAYRQRSSSSSSTLYPNLQRMASCTSLYEILGLPVGATS  72

Query  675  QEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRS  496
            QEIK+AYRRLAR  HPDVA+           A+ A++F+++HAAYSTLSDPEKRA YD  
Sbjct  73   QEIKSAYRRLARSCHPDVAA-------LDRKATSADEFMKIHAAYSTLSDPEKRAVYDTK  125

Query  495  LLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            L   + P  +   YSG R   R WETDQCW
Sbjct  126  LFTRKRPLTA--NYSGYRG--RNWETDQCW  151



>ref|XP_002886134.1| hypothetical protein ARALYDRAFT_480688 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62393.1| hypothetical protein ARALYDRAFT_480688 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 19/130 (15%)
 Frame = -2

Query  774  VSVSASCAT-AERTAQTPQ-----SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASG  613
             + S +CA    R  Q PQ     +SLY++L I  G++ QEIK+AYRRLAR+ HPDVA  
Sbjct  41   TTASYTCADDPPRLRQIPQRFSATASLYEILEIPVGSTSQEIKSAYRRLARICHPDVAGN  100

Query  612  SVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYD-RSLLRSRHPAASVRGYSGRRSA  436
            S         +S A+DF+++HAAY TLSDPEKRA YD R+L RSR   A    Y G    
Sbjct  101  S-------RNSSSADDFMKIHAAYCTLSDPEKRAVYDRRNLRRSRPLTAGYGSYGG----  149

Query  435  LRKWETDQCW  406
             R WETDQCW
Sbjct  150  -RNWETDQCW  158



>ref|XP_006574675.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=102

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 11/107 (10%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            ++LY +LG+R  ASG+EIKAAYRRLARV HPDV              S A +F+++HAAY
Sbjct  5    ATLYQILGVRAVASGEEIKAAYRRLARVCHPDVVP-------LERRDSSAAEFMKIHAAY  57

Query  540  STLSDPEKRANYDRSLLRSRHPAASV--RGYSGRRSALRKWETDQCW  406
             TLSDPEKRA+YDRSL R R    ++   GY G     R WETDQCW
Sbjct  58   RTLSDPEKRASYDRSLFRRRQRTLTMSPSGYCG--YGGRNWETDQCW  102



>ref|XP_009618358.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=154

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 90/163 (55%), Gaps = 20/163 (12%)
 Frame = -2

Query  867  SASFLLSSP-FVGSAISAAE--VARPRCVSFRRPVSVSASCATAERTAQT------PQSS  715
            SASF  S P    +  S+ E     P CV FR+    S + AT    A+         +S
Sbjct  3    SASFRQSPPPTAANTFSSGENSFLSPSCVRFRQSGYFSVAAATCGSVARCVPAVSASPAS  62

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
             Y++LGI  GA+ + IKAAYRRLARV HPDVA+            + A++F+++HAAY  
Sbjct  63   FYEILGIPMGATSEVIKAAYRRLARVCHPDVAA-------VDQKDTSADEFMKIHAAYCI  115

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDPEKRA YDR L   R    SV  YSG  S  R WETDQCW
Sbjct  116  LSDPEKRAEYDRRLWNQRR--RSVGLYSGYTS--RNWETDQCW  154



>ref|XP_002528286.1| Chaperone protein dnaJ 11, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF34124.1| Chaperone protein dnaJ 11, chloroplast precursor, putative [Ricinus 
communis]
Length=105

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            SLY+VLGI   AS  EIKAAYRRLAR  HPDV S +            A +F+++HAAYS
Sbjct  6    SLYEVLGISASASCHEIKAAYRRLARSCHPDVVSMN-------QKEMSANEFMKIHAAYS  58

Query  537  TLSDPEKRANYDRSLL-RSRHP---AASVRGYSGRRSALRKWETDQCW  406
            TLSDP KRANYDR L  R R P   +A+V   SG  +  R WETDQCW
Sbjct  59   TLSDPNKRANYDRDLYSRHRRPSFSSATVFAASG-FTKTRNWETDQCW  105



>ref|XP_006422640.1| hypothetical protein CICLE_v10029600mg [Citrus clementina]
 gb|ESR35880.1| hypothetical protein CICLE_v10029600mg [Citrus clementina]
 gb|KDO67997.1| hypothetical protein CISIN_1g033459mg [Citrus sinensis]
Length=119

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 67/117 (57%), Gaps = 22/117 (19%)
 Frame = -2

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LYDVLGI   A G EIKAAYRRLAR  HPDV + +            A +FI++HAAYST
Sbjct  11   LYDVLGIPVSADGNEIKAAYRRLARTCHPDVVATN-------QKEMSANEFIKIHAAYST  63

Query  534  LSDPEKRANYDRSLLRSR--------------HPAASVRGYSGRRSALRKWETDQCW  406
            LSDP KRANYDR+L   R               P  S+  +SG  +  R WETDQCW
Sbjct  64   LSDPHKRANYDRALFVVRKRPVSSFSSSSLSSEPMGSMSRFSGNFTT-RNWETDQCW  119



>ref|XP_004292163.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=109

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 10/114 (9%)
 Frame = -2

Query  738  TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFI  559
            TA +P SSLY+VLG+   AS  EIKAAYRRLAR  HPDV + +          + A +F+
Sbjct  3    TAASPTSSLYEVLGLPMSASDHEIKAAYRRLARRCHPDVVAMN-------QKQTSATEFM  55

Query  558  RVHAAYSTLSDPEKRANYDRSLLRSRHP---AASVRGYSGRRSALRKWETDQCW  406
            + HAAY+TLSDP+KRANYDR L R   P   ++S+   +   +  R WETDQCW
Sbjct  56   KTHAAYATLSDPDKRANYDRDLYRCARPLRSSSSLSSSTAAANVYRNWETDQCW  109



>emb|CDY30342.1| BnaA09g09350D [Brassica napus]
Length=154

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 13/106 (12%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY++L I  G++GQEIK+AYRRLAR+ HPDVA               A++F+++HAAY
Sbjct  61   ASLYEILEIPVGSTGQEIKSAYRRLARICHPDVAGNG----------RSADEFVKIHAAY  110

Query  540  STLSDPEKRANYDRSLLRSRHP-AASVRGYSGRRSALRKWETDQCW  406
             TLSDPEKRA YDR +LR   P +  V G+ G       WETDQCW
Sbjct  111  CTLSDPEKRAVYDRRILRRSRPLSVGVSGFGGYVGG--NWETDQCW  154



>ref|XP_004985025.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Setaria 
italica]
Length=161

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 74/112 (66%), Gaps = 15/112 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SS YDVLG+R GAS +EIKAAYRRLA  +HPD A           ++S AEDFIRVHAAY
Sbjct  58   SSFYDVLGLRPGASPREIKAAYRRLALAVHPDAAPHPA-------SSSAAEDFIRVHAAY  110

Query  540  STLSDPEKRANYDRSLLRS--RHPAASVR-----GYSGRRSALRKWETDQCW  406
            STLSDP+KRA+YD  LL S  R  A SV       +  RRS  R WETDQCW
Sbjct  111  STLSDPDKRADYDLRLLLSAGRRRAQSVTLGRSPTFPARRSR-RTWETDQCW  161



>emb|CDX72573.1| BnaC07g45950D [Brassica napus]
Length=161

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 84/136 (62%), Gaps = 26/136 (19%)
 Frame = -2

Query  768  VSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDV  622
            VSASC+        R  Q P+      +SLY++L +  GA+GQ+IK+AYRRLAR+ HPDV
Sbjct  37   VSASCSYTCTEDPPRLHQIPRRTTPATASLYEILEVPRGATGQDIKSAYRRLARICHPDV  96

Query  621  ASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASVRGY  454
            A+G+        + S A++F+++HAAY TLSDPEKR+ YDR +LR   P     + +  Y
Sbjct  97   AAGT------DRSNSSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTVSTSGMGSY  150

Query  453  SGRRSALRKWETDQCW  406
             G     R WETDQCW
Sbjct  151  VG-----RNWETDQCW  161



>ref|NP_001236960.1| uncharacterized protein LOC100305807 [Glycine max]
 gb|ACU13674.1| unknown [Glycine max]
Length=101

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 70/108 (65%), Gaps = 11/108 (10%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLYDVLGI  GAS  EIKAAYR+LAR  HPDV + +          S A  F+ +H+AY
Sbjct  2    ASLYDVLGISVGASCIEIKAAYRKLARTYHPDVVAMN-------QKESSANQFMMIHSAY  54

Query  540  STLSDPEKRANYDRSLLRSRHPA---ASVRGYSGRRSALRKWETDQCW  406
            STLSDPEKRA YDR + R R  A   A  + +S   SA RKWETDQCW
Sbjct  55   STLSDPEKRAQYDREIYRYRRSANMEARNQTFSYAGSA-RKWETDQCW  101



>ref|XP_011002000.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=107

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 69/112 (62%), Gaps = 16/112 (14%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SS Y+VLG+   ASG EIKAAYRRLAR  HPDV S              A +FI++ AAY
Sbjct  5    SSFYEVLGLPMSASGHEIKAAYRRLARTCHPDVVS-------MNQKEMSATEFIKIRAAY  57

Query  540  STLSDPEKRANYDRSLLRSRHP-------AASVRGYSGRRSALRKWETDQCW  406
            STLSDP+KRA+YDR L R+  P       +A++   SG  S  R WETDQCW
Sbjct  58   STLSDPDKRASYDRDLFRNSRPFGSSSMGSATMAAASGYAS--RNWETDQCW  107



>gb|KFK30236.1| hypothetical protein AALP_AA7G235200 [Arabis alpina]
Length=167

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 9/129 (7%)
 Frame = -2

Query  771  SVSASCA-TAERTAQTP------QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASG  613
            S S +CA  + R  Q P       +SLY++L +  GA+ Q+IK+AYRRLAR+ HPDVA  
Sbjct  41   SCSYTCAEDSPRLHQIPRRLTSANASLYEILEVPHGATSQDIKSAYRRLARICHPDVA--  98

Query  612  SVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL  433
             + R ++ +++S AE+F+++HAAY TLSDPEKR+ YDR +LR   P   V          
Sbjct  99   GIDRTNSNSSSSSAEEFMKIHAAYCTLSDPEKRSVYDRRILRRNRPLTVVTNSGLGSYVG  158

Query  432  RKWETDQCW  406
            R WETDQCW
Sbjct  159  RNWETDQCW  167



>ref|XP_010446825.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Camelina 
sativa]
Length=164

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 82/136 (60%), Gaps = 21/136 (15%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P+ VSASC+      + R  Q P+      +SLYDVL +   A+ Q+IK+AYRRLAR+ H
Sbjct  38   PLLVSASCSYTCAEDSPRLHQIPRRFTAATASLYDVLEVPLDATSQDIKSAYRRLARICH  97

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA             S AE+F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  98   PDVAGTD-------RTNSSAEEFMKIHAAYCTLSDPEKRSVYDRRMLRRSSPLTV--GTS  148

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  149  GLGSYVGRNWETDQCW  164



>ref|XP_010268660.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Nelumbo 
nucifera]
Length=172

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 21/117 (18%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VLGI  GAS QEIKAAYRRLAR+ HPDV   ++ R+      +  ++FI++HAAY
Sbjct  65   ASLYEVLGIPVGASCQEIKAAYRRLARLCHPDVV--AIDRK-----ENSTDEFIKIHAAY  117

Query  540  STLSDPEKRANYDRSLL-RSRHP-----------AASVRGYSGRRSALRKWETDQCW  406
            STLSDP+KRA+YD  L  R + P           A+S+ G+SG   + R WETDQCW
Sbjct  118  STLSDPQKRADYDCMLFNRQQRPFRSPTSTSTYRASSMSGFSGY--SRRTWETDQCW  172



>ref|XP_010446837.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Camelina 
sativa]
Length=163

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 80/136 (59%), Gaps = 21/136 (15%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTP------QSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+      + R  Q P       +SLYDVL +  GA+ Q+IK+AYRRLAR+ H
Sbjct  37   PPLVSASCSYTCAEDSPRLHQIPRRFTAANASLYDVLEVPLGATSQDIKSAYRRLARICH  96

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDV              S AE+F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  97   PDVVG-------TDRTNSSAEEFMKIHAAYCTLSDPEKRSVYDRRMLRRSSPLTV--GTS  147

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  148  GLGSYVGRNWETDQCW  163



>ref|NP_195328.1| chaperone protein dnaJ 11 [Arabidopsis thaliana]
 sp|Q9FYB5.2|DNJ11_ARATH RecName: Full=Chaperone protein dnaJ 11, chloroplastic; Short=AtDjC11; 
Short=AtJ11; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA18498.1| DnaJ-like protein [Arabidopsis thaliana]
 emb|CAB81513.1| DnaJ-like protein [Arabidopsis thaliana]
 gb|ABF59038.1| At4g36040 [Arabidopsis thaliana]
 dbj|BAE98983.1| DnaJ like protein [Arabidopsis thaliana]
 gb|AEE86605.1| chaperone protein dnaJ 11 [Arabidopsis thaliana]
Length=161

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 84/136 (62%), Gaps = 20/136 (15%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+      + R  Q P+      +SLYDVL +  GA+ Q+IK+AYRRLAR+ H
Sbjct  34   PPLVSASCSYTYTEDSPRLHQIPRRLTTVPASLYDVLEVPLGATSQDIKSAYRRLARICH  93

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA           ++S A++F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  94   PDVAGTD------RTSSSSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTV--GTS  145

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  146  GLGSYVGRNWETDQCW  161



>ref|XP_008235989.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Prunus 
mume]
Length=117

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 69/117 (59%), Gaps = 19/117 (16%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            S+LYDVLG+  GASG EIKAAYRRLAR  HPDV + +          + A +F+++HAAY
Sbjct  8    STLYDVLGLTMGASGHEIKAAYRRLARSCHPDVVAMN-------QKQTSANEFMKIHAAY  60

Query  540  STLSDPEKRANYDRSLLRSRHP------------AASVRGYSGRRSALRKWETDQCW  406
            + LSDP+KRANYDR L R   P            AA+       R   R WETDQCW
Sbjct  61   AILSDPDKRANYDRDLYRCPQPFRSSSYSSASMAAAASAMAGSSRRTYRNWETDQCW  117



>emb|CAC03599.1| J11 protein [Arabidopsis thaliana]
Length=161

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 83/136 (61%), Gaps = 20/136 (15%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+      + R  Q P+      +SLYDVL +  GA+ Q+IK+AYRRLAR+ H
Sbjct  34   PPLVSASCSYTYTEDSPRLHQIPRRLTTVPASLYDVLEVPLGATSQDIKSAYRRLARICH  93

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA           ++S A++F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  94   PDVAGTD------RTSSSSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTV--GTS  145

Query  450  GR-RSALRKWETDQCW  406
            G  R   R WETDQCW
Sbjct  146  GLGRYVGRNWETDQCW  161



>ref|XP_006284661.1| hypothetical protein CARUB_v10005918mg [Capsella rubella]
 gb|EOA17559.1| hypothetical protein CARUB_v10005918mg [Capsella rubella]
Length=160

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 81/139 (58%), Gaps = 27/139 (19%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+      + R  Q P+      +SLYDVL +  GA+ Q+IK+AYRRLAR+ H
Sbjct  34   PPLVSASCSYTCAEDSPRLHQIPRRLTTATASLYDVLEVPLGATSQDIKSAYRRLARICH  93

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASV  463
            PDVA             S A++F+R+HAAY TLSDPEKR+ YDR +LR   P     + +
Sbjct  94   PDVAGTD-------RTNSSADEFMRIHAAYCTLSDPEKRSVYDRRMLRRSRPLSVSTSGL  146

Query  462  RGYSGRRSALRKWETDQCW  406
              Y G     R WETDQCW
Sbjct  147  GSYVG-----RNWETDQCW  160



>dbj|BAJ34233.1| unnamed protein product [Thellungiella halophila]
Length=162

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 84/136 (62%), Gaps = 19/136 (14%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+      + R  Q P+      +SLYD+L +  GA+ Q+IK+AYRRLAR  H
Sbjct  34   PPLVSASCSYTCAEDSPRLHQIPRRLKTATASLYDILEVPLGATSQDIKSAYRRLARTCH  93

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA+          ++S A++F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  94   PDVAATD-----RTNSSSSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTV--GTS  146

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  147  GLGSYVGRNWETDQCW  162



>ref|XP_009412902.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=140

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 89/148 (60%), Gaps = 17/148 (11%)
 Frame = -2

Query  825  ISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRL  646
            IS+  +A P+  SF RP    A+ A A   A     +LYDVLGI  GASG+EIKAAYRRL
Sbjct  2    ISSLCLASPK--SFLRPPRCVAASAAAAPPAVCSSVTLYDVLGIAAGASGREIKAAYRRL  59

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL------RS  484
            A   HPDVA  +V R  A+A      +F+RVHAAY TLSDPEKRA+YDRS++      R 
Sbjct  60   ALACHPDVA--AVERRGASAV-----EFMRVHAAYETLSDPEKRADYDRSVMTAVDAGRR  112

Query  483  RHPAAS--VRGYSGRRSALRKWETDQCW  406
              P  S     YS  R   R WETDQCW
Sbjct  113  WAPFRSQWTSSYSTGRRRPRTWETDQCW  140



>emb|CDP01896.1| unnamed protein product [Coffea canephora]
Length=171

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 72/115 (63%), Gaps = 16/115 (14%)
 Frame = -2

Query  729  TPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
            T  +S Y+VLGI  GA+  EIKAAYRRLA+  HPD+A            +S A++FI+VH
Sbjct  66   TAPTSFYEVLGIPMGATSGEIKAAYRRLAKGCHPDLAG-------TDEKSSSADEFIKVH  118

Query  549  AAYSTLSDPEKRANYDRSLLRSRH-------PAASVRGYSGRRSALRKWETDQCW  406
            AAYSTLSDPEKRA+YDR L RS         P+ +   YSG     R WETDQCW
Sbjct  119  AAYSTLSDPEKRADYDRRLFRSLRGVRLYSTPSPTKSRYSGYSG--RNWETDQCW  171



>ref|NP_001239933.1| uncharacterized protein LOC100798520 [Glycine max]
 gb|ACU20470.1| unknown [Glycine max]
Length=101

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 66/111 (59%), Gaps = 17/111 (15%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLYDVLGI  GAS  EIKAAYR+LAR  HPDV +            S A  F+ +H+AY
Sbjct  2    ASLYDVLGISVGASCIEIKAAYRKLARTHHPDVVA-------MDQKESSANQFMMIHSAY  54

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL------RKWETDQCW  406
            STLSDPEKRA YDR + R R  A      +GR          RKWETDQCW
Sbjct  55   STLSDPEKRAQYDREIYRYRRSA----NIAGRNQTFSYAGSGRKWETDQCW  101



>ref|XP_007041894.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
 gb|EOX97725.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
Length=113

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 66/120 (55%), Gaps = 26/120 (22%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VLGI   A+G EIKAAYRRLAR  HPDV S              A  F+++HAAY
Sbjct  5    TSLYEVLGIPMSANGNEIKAAYRRLARTCHPDVVS-------INQKEMSANQFMKIHAAY  57

Query  540  STLSDPEKRANYDRSLLRSRHPAAS---------------VRGYSGRRSALRKWETDQCW  406
            STLSDP+KRANYDR L R   P  S                  Y  RR+    WETDQCW
Sbjct  58   STLSDPDKRANYDRDLYRRNRPFHSSPLTSATKAAASAYEFSSYCSRRN----WETDQCW  113



>ref|XP_002465568.1| hypothetical protein SORBIDRAFT_01g041250 [Sorghum bicolor]
 gb|EER92566.1| hypothetical protein SORBIDRAFT_01g041250 [Sorghum bicolor]
Length=159

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 69/111 (62%), Gaps = 17/111 (15%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SS YDVLG+R GAS +EIKAAYRRLA  +HPD A+ +            AEDFIRVHAAY
Sbjct  60   SSFYDVLGLRPGASAREIKAAYRRLALAVHPDAAAAASS----------AEDFIRVHAAY  109

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL------RKWETDQCW  406
            STLSDP+KRA+YDR LL S           GR  +       R WETDQCW
Sbjct  110  STLSDPDKRADYDRRLLLSAAARRRTAAL-GRSPSFPAHRSRRTWETDQCW  159



>ref|XP_008457665.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cucumis 
melo]
Length=151

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 19/131 (15%)
 Frame = -2

Query  777  PVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMRE  598
            P+  SA+     R     +SS Y+VLGI   AS +EIKAAYR+LAR+ HPDV + +    
Sbjct  33   PLVASATGVRFARDLSVSRSSFYEVLGIPMTASCREIKAAYRKLARICHPDVVAEN----  88

Query  597  saaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAAS-------VRGYSGRRS  439
                    AE+FI++  AYSTLSDP+KRA+YDR + R++  + S       V GYSG  +
Sbjct  89   -------SAEEFIKIQTAYSTLSDPDKRADYDREICRAQLVSVSGLSSRTPVSGYSGYYT  141

Query  438  ALRKWETDQCW  406
              R WE+DQCW
Sbjct  142  R-RNWESDQCW  151



>gb|KDP20408.1| hypothetical protein JCGZ_06367 [Jatropha curcas]
Length=108

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 70/117 (60%), Gaps = 25/117 (21%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLGI T AS  EIKAAYRRLAR  HPDV S +            A +F ++HAAY
Sbjct  5    SSLYEVLGIPTSASCHEIKAAYRRLARTCHPDVVSVNYKE-------ISANEFKKIHAAY  57

Query  540  STLSDPEKRANYDRSL------------LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            STLSDP+KRANYDR L            L S   AA+  GY+G     + WETDQCW
Sbjct  58   STLSDPDKRANYDRDLYSHGRRFGSSSSLNSATMAAAY-GYAG-----KNWETDQCW  108



>ref|XP_010228886.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Brachypodium 
distachyon]
Length=167

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 78/134 (58%), Gaps = 20/134 (15%)
 Frame = -2

Query  786  FRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSV  607
            F R  S S S +     A    S  YDVLG++ GAS +EIKAAYRRLAR +HPDVA  + 
Sbjct  47   FSRAASFSRSASGTAVAAPDHASCFYDVLGLQAGASYEEIKAAYRRLARAVHPDVAPHA-  105

Query  606  MREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL------RSRHPA-ASVRGYSG  448
                       A+DFIRV AAYSTLSDP KRA+YDR ++      R R P+ A    + G
Sbjct  106  ----------SADDFIRVQAAYSTLSDPSKRADYDRRVVVPSAVGRRRAPSLARSPSFPG  155

Query  447  RRSALRKWETDQCW  406
             R   R WETDQCW
Sbjct  156  FRR--RTWETDQCW  167



>ref|XP_002867039.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43298.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=160

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 83/136 (61%), Gaps = 21/136 (15%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTPQ------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+      + R  Q P+      +SLY++L +  GA+ Q+IK+AYRRLAR+ H
Sbjct  34   PPLVSASCSYTCAEDSPRLHQIPRRLTTAPASLYEILEVPLGATSQDIKSAYRRLARICH  93

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA            +S A++F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  94   PDVAGTD-------RTSSSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTV--GTS  144

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  145  GLGSYVGRNWETDQCW  160



>ref|XP_006409224.1| hypothetical protein EUTSA_v10022892mg [Eutrema salsugineum]
 gb|ESQ50677.1| hypothetical protein EUTSA_v10022892mg [Eutrema salsugineum]
Length=158

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  789  SFRRPVSVSASCA-TAERTAQTPQ-----SSLYDVLGIRTGASGQEIKAAYRRLARVLHP  628
            SF    + S +CA    R  Q P      +SLY++L I  G++ QEIK+AYRRLAR+ HP
Sbjct  33   SFSTTTASSYTCAEDPPRLRQIPHRFPATASLYEILEIPVGSTSQEIKSAYRRLARICHP  92

Query  627  DVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSG  448
            DVA             S A+DF+++HAAY TLSDPEKRA YDR +LR   P  +V G   
Sbjct  93   DVAETG-------RNPSSADDFMKIHAAYCTLSDPEKRAVYDRRMLRRSRP-LTVGGSGF  144

Query  447  RRSALRKWETDQCW  406
                   WETDQCW
Sbjct  145  GSYGGGNWETDQCW  158



>emb|CDY26834.1| BnaC09g09610D [Brassica napus]
Length=158

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 75/124 (60%), Gaps = 18/124 (15%)
 Frame = -2

Query  759  SCATAERTAQTPQ-----SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREs  595
            +CA      Q PQ     +SLY++L I  G++ QEIK+AYRRLAR+ HPDVA        
Sbjct  47   TCADDPPRRQIPQRLSAAASLYEILEIPVGSTSQEIKSAYRRLARICHPDVAGNG-----  101

Query  594  aaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-RKWET  418
                   A +F+++HAAY TLSDPEKRA YDR +LR   P ++  G SG  S +   WET
Sbjct  102  -----RSAGEFVKIHAAYCTLSDPEKRAVYDRRILRRSRPLSA--GVSGFDSCVGGNWET  154

Query  417  DQCW  406
            DQCW
Sbjct  155  DQCW  158



>ref|XP_010034692.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Eucalyptus 
grandis]
Length=170

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 70/105 (67%), Gaps = 4/105 (4%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLGI  GA+ QEIK AYRRLAR  HPD A+ + +    A+A    ++F+R+HAAY
Sbjct  70   SSLYEVLGIPVGATCQEIKVAYRRLARSCHPDAAAAAAVDRKGASA----DEFMRIHAAY  125

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            STLSDPEKRA YD SL R R    +V    G     R WETDQCW
Sbjct  126  STLSDPEKRAVYDSSLFRRRSRPLTVVTSGGGGYRGRNWETDQCW  170



>ref|XP_009147799.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Brassica 
rapa]
Length=159

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 22/136 (16%)
 Frame = -2

Query  777  PVSVSASCA--TAERT---------AQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P  VSASC+    E T         + T  +SLY++L +  GA+ Q+IK+AYRRLAR+ H
Sbjct  34   PTLVSASCSYTCTEDTPRLHKIPLRSTTATASLYEILEVPRGATSQDIKSAYRRLARICH  93

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDVA             + A++F+++HAAY TLSDPEKR+ YDR +LR   P     G S
Sbjct  94   PDVAG--------TDRTTSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTV--GNS  143

Query  450  GRRSAL-RKWETDQCW  406
            G  S + R WETDQCW
Sbjct  144  GMGSYVGRNWETDQCW  159



>ref|XP_007131691.1| hypothetical protein PHAVU_011G033800g [Phaseolus vulgaris]
 gb|ESW03685.1| hypothetical protein PHAVU_011G033800g [Phaseolus vulgaris]
Length=105

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 68/112 (61%), Gaps = 15/112 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLYDVLGI  GAS  EIKAAYR+LAR  HPDV +            S A  F+ +H+AY
Sbjct  2    ASLYDVLGISIGASCVEIKAAYRKLARTYHPDVVA-------MNQKESSAHQFMIIHSAY  54

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-------RKWETDQCW  406
            STLSDPEKRA YD  + R R  +A++   +GR           RKWETDQCW
Sbjct  55   STLSDPEKRAQYDTEIYRYRR-SANMASMAGRNHTFSCAGGSGRKWETDQCW  105



>ref|XP_008781007.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Phoenix 
dactylifera]
Length=179

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 96/190 (51%), Gaps = 42/190 (22%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTA---------Q  730
            +M +TS+ FL       +  S A  +     S R P   +A  A AER           Q
Sbjct  1    MMITTSSQFLGLRITPSTPRSVAPSSPRSATSLRSPGISAAYTAAAERQPTAAALPPALQ  60

Query  729  TPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
            +  +SLYDVLG+ +GA+GQEIKAAYRRLA   HPDV +            + A++FIR+H
Sbjct  61   SSFASLYDVLGLPSGATGQEIKAAYRRLALARHPDVVA-------TDRKGTSADEFIRIH  113

Query  549  AAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS----------------------GRRSA  436
            AAYSTLSDPEKRA+YDR LL       +VR  S                      GRR+ 
Sbjct  114  AAYSTLSDPEKRADYDRKLLLLGRHRRTVRHSSPPTPSSSSSFRPFSRSPSFPSYGRRT-  172

Query  435  LRKWETDQCW  406
               WETDQCW
Sbjct  173  ---WETDQCW  179



>ref|XP_010029676.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW56627.1| hypothetical protein EUGRSUZ_I02342 [Eucalyptus grandis]
Length=157

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 69/105 (66%), Gaps = 14/105 (13%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y++LGI  GA+ +EIKAAYRRLARVLHPD A  S         ++  + FIR+H AYSTL
Sbjct  64   YEILGIPAGATSKEIKAAYRRLARVLHPDAAKDS---------SAADDRFIRLHDAYSTL  114

Query  531  SDPEKRANYDRSLLRSRH---PAASVRGYSGRRSALRKWETDQCW  406
             DPEKRA YDR +L +R    PAA+V G S      R WETDQCW
Sbjct  115  LDPEKRAVYDRRVLLARKRKRPAAAVAGVSA--YGGRNWETDQCW  157



>ref|NP_001173344.1| Os03g0244950 [Oryza sativa Japonica Group]
 dbj|BAH92072.1| Os03g0244950 [Oryza sativa Japonica Group]
Length=165

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 75/128 (59%), Gaps = 13/128 (10%)
 Frame = -2

Query  774  VSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREs  595
             S S S    +  A    +S YDVLG+  GAS +EIK AYRRLAR +HPD +        
Sbjct  46   FSPSTSVVAPDHVAAAAAASFYDVLGLHAGASAREIKDAYRRLARAVHPDASPHPA----  101

Query  594  aaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL---RSRHPAASVRGYSGRRSALRK-  427
                A+ ++DFIRVHAAYSTLSDP+KRA+YDR LL     R  A    G S    A R+ 
Sbjct  102  ----AASSDDFIRVHAAYSTLSDPDKRADYDRRLLLLAAGRRRATPSLGRSPTFPARRRR  157

Query  426  -WETDQCW  406
             WETDQCW
Sbjct  158  TWETDQCW  165



>ref|XP_004287809.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=153

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 88/160 (55%), Gaps = 28/160 (18%)
 Frame = -2

Query  855  LLSSPFVGSAISAAEVARPRCVSFRRPVSVS-ASCA-----TAERTAQTPQ--SSLYDVL  700
            + ++P   +  S   + R   V F  P + S A+CA     TA      P   +SLYD+L
Sbjct  12   IFTAPLFSATPSPKSLPR---VRFHPPRAFSSAACASDQTATASYLVSAPHHPTSLYDIL  68

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            GI   ++  EIK AYRRLARV HPDVA+            S A++F+++H AYSTLSDPE
Sbjct  69   GIPASSTCHEIKTAYRRLARVCHPDVAAED----------SSADEFMKIHDAYSTLSDPE  118

Query  519  KRANYDRSLLRSRHPAAS--VRGYSGRRSALRKWETDQCW  406
            KRA YD+   R   P +S   R ++G     R WETDQCW
Sbjct  119  KRAEYDQKTFRRIRPLSSDYSRYFTG-----RNWETDQCW  153



>ref|XP_007200212.1| hypothetical protein PRUPE_ppa015688mg [Prunus persica]
 gb|EMJ01411.1| hypothetical protein PRUPE_ppa015688mg [Prunus persica]
Length=117

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 68/117 (58%), Gaps = 19/117 (16%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            S+LY+VLG+  GASG EIKAAYRRLAR  HPDV + +          + A +F+++HAAY
Sbjct  8    STLYEVLGLTMGASGHEIKAAYRRLARSCHPDVVATN-------QKQTSANEFMKIHAAY  60

Query  540  STLSDPEKRANYDRSLLRSRHP------------AASVRGYSGRRSALRKWETDQCW  406
            + LSDP+KRANYDR   R   P            AA+       R   R WETDQCW
Sbjct  61   AILSDPDKRANYDRDFYRCPQPFRSSSYSSASMAAAASAMAGSSRRTYRNWETDQCW  117



>gb|EAZ07898.1| hypothetical protein OsI_30153 [Oryza sativa Indica Group]
Length=146

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 92/162 (57%), Gaps = 28/162 (17%)
 Frame = -2

Query  855  LLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASG  676
            ++S+P VG A +          S+R   +    CA A   A  P  +LYDVLG+R GA+ 
Sbjct  1    MISAPSVGIAFAPKPPPAAAVGSYR---ARKVRCAVAVAPAPAPAGTLYDVLGLRAGATV  57

Query  675  QEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDR-  499
            +EIKAAYRRLAR  HPDVA+ +            A+DF+R+H AY+TLSDP+ RA YDR 
Sbjct  58   REIKAAYRRLARERHPDVAASA-----------GADDFVRLHDAYATLSDPDSRARYDRD  106

Query  498  -----SLLRSRH------PAASVRGYSGRRSALRKWETDQCW  406
                 S+ R  H      PAA+ R Y GRR   R WETDQCW
Sbjct  107  VVAIASMARGAHHRTMAAPAAAPRWY-GRRP-RRTWETDQCW  146



>dbj|BAJ95160.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 66/111 (59%), Gaps = 22/111 (20%)
 Frame = -2

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
             YDVLG+  GASG EIKAAYRRLAR +HPDV+                +DFIRVHAAYST
Sbjct  77   FYDVLGLDAGASGGEIKAAYRRLARAVHPDVSPHPA------------DDFIRVHAAYST  124

Query  534  LSDPEKRANYDRSLL--------RSRHPAASVRGYSGRRSALRKWETDQCW  406
            LSDP KRA+YDR ++        RS    A    + G R   R WETDQCW
Sbjct  125  LSDPSKRADYDRRMIIIPSAISRRSAPNLARSPSFPGCRR--RTWETDQCW  173



>ref|NP_001062435.2| Os08g0548400 [Oryza sativa Japonica Group]
 dbj|BAD10757.1| dnaJ protein homolog-like [Oryza sativa Japonica Group]
 dbj|BAD09951.1| dnaJ protein homolog-like [Oryza sativa Japonica Group]
 gb|EEE69112.1| hypothetical protein OsJ_28187 [Oryza sativa Japonica Group]
 dbj|BAF24349.2| Os08g0548400 [Oryza sativa Japonica Group]
Length=146

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 92/162 (57%), Gaps = 28/162 (17%)
 Frame = -2

Query  855  LLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASG  676
            ++S+P VG A +          S+R   +    CA A   A  P  +LYDVLG+R GA+ 
Sbjct  1    MISAPSVGIAFAPKPPPAAAVGSYR---ARKVRCAVAVAPAPAPAGTLYDVLGLRAGATV  57

Query  675  QEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDR-  499
            +EIKAAYRRLAR  HPDVA+ +            A+DF+R+H AY+TLSDP+ RA YDR 
Sbjct  58   REIKAAYRRLARERHPDVAASA-----------GADDFVRLHDAYATLSDPDSRARYDRD  106

Query  498  -----SLLRSRH------PAASVRGYSGRRSALRKWETDQCW  406
                 S+ R  H      PAA+ R Y GRR   R WETDQCW
Sbjct  107  VVAVASMARGAHHRTMAAPAAAPRWY-GRRP-RRTWETDQCW  146



>gb|EEC74856.1| hypothetical protein OsI_10727 [Oryza sativa Indica Group]
Length=162

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 70/110 (64%), Gaps = 13/110 (12%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +S YDVLG+  GAS +EIK AYRRLAR +HPD +            A+ ++DFIRVHAAY
Sbjct  61   ASFYDVLGLHAGASAREIKDAYRRLARAVHPDASPHPA--------AASSDDFIRVHAAY  112

Query  540  STLSDPEKRANYDRSLL---RSRHPAASVRGYSGRRSALRK--WETDQCW  406
            STLSDP+KRA+YDR LL     R  A    G S    A R+  WETDQCW
Sbjct  113  STLSDPDKRADYDRRLLLLAAGRRRATPSLGRSPTFPARRRRTWETDQCW  162



>ref|XP_009138405.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Brassica 
rapa]
Length=161

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 82/136 (60%), Gaps = 26/136 (19%)
 Frame = -2

Query  768  VSASCA-----TAERTAQTP------QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDV  622
            VSASC+        R  Q P       +SLY++L +  GA+ Q+IK+AYRRLAR+ HPDV
Sbjct  37   VSASCSYTCTGAPPRLHQIPRRTTPANASLYEILEVPRGATSQDIKSAYRRLARICHPDV  96

Query  621  ASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASVRGY  454
            A+G+        + S A++F+++HAAY TLSDP+KR+ YDR +LR   P     + +  Y
Sbjct  97   AAGT------DRSNSSADEFMKIHAAYCTLSDPDKRSVYDRRMLRRSRPLTVSTSGMGSY  150

Query  453  SGRRSALRKWETDQCW  406
             G     R WETDQCW
Sbjct  151  VG-----RNWETDQCW  161



>gb|AFC01202.1| heat shock protein, partial [Ammopiptanthus mongolicus]
Length=191

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 71/114 (62%), Gaps = 10/114 (9%)
 Frame = -2

Query  738  TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFI  559
            T  T  +SLY+VLGI TGAS  EIK+A R+LAR  HPDV + +          + A  F 
Sbjct  85   TKMTSPASLYEVLGISTGASCHEIKSACRKLARTCHPDVVTMN-------QKENSANQFT  137

Query  558  RVHAAYSTLSDPEKRANYDRSLLRSRHPA--ASVRG-YSGRRSALRKWETDQCW  406
            ++H+AYSTLSDP+KRA YDR +   R  A  AS+ G Y     A RKWETDQCW
Sbjct  138  KIHSAYSTLSDPDKRAQYDREIYGYRRSAKMASMSGRYQTFSQAGRKWETDQCW  191



>ref|XP_006299674.1| hypothetical protein CARUB_v10015866mg [Capsella rubella]
 gb|EOA32572.1| hypothetical protein CARUB_v10015866mg [Capsella rubella]
Length=165

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 72/106 (68%), Gaps = 8/106 (8%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY++L I  G++ +EIK+AYRRLAR+ HPDVA             S A+DF+++HAAY
Sbjct  67   ASLYEILEIPAGSTSKEIKSAYRRLARICHPDVAGNGRNNN-----NSSADDFMKIHAAY  121

Query  540  STLSDPEKRANYDRSLL-RSRHPAASVRGYSGRRSALRKWETDQCW  406
             TLSDPEKRA YDR +L R+R     V G++G   A R WETDQCW
Sbjct  122  CTLSDPEKRAVYDRRILGRTRPLTVGVSGFAG--YAGRNWETDQCW  165



>ref|XP_010920182.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Elaeis 
guineensis]
Length=180

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 75/131 (57%), Gaps = 34/131 (26%)
 Frame = -2

Query  732  QTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRV  553
            Q+P +SLYDVLG+   A+GQEIKA+YRRLAR  HPDV +            + A++FIR+
Sbjct  62   QSPFASLYDVLGLHADATGQEIKASYRRLARACHPDVVA-------TDRKGTSADEFIRI  114

Query  552  HAAYSTLSDPEKRANYDRSLLRSRHPAASVR----------------------GYSGRRS  439
            H AYSTLSDP+KRA+YDR LL       SVR                      GY GRR+
Sbjct  115  HHAYSTLSDPDKRADYDRKLLLLGRQRRSVRHATPPQPSSSSFRPFSRSPSFPGY-GRRT  173

Query  438  ALRKWETDQCW  406
                WETDQCW
Sbjct  174  ----WETDQCW  180



>emb|CDX69193.1| BnaC01g02600D [Brassica napus]
Length=162

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 80/137 (58%), Gaps = 23/137 (17%)
 Frame = -2

Query  777  PVSVSASCA-----TAERTAQTP-------QSSLYDVLGIRTGASGQEIKAAYRRLARVL  634
            P  VSASC+        R  Q P        +SLY++L +  GA+ Q+IK+AYRRLAR+ 
Sbjct  36   PPLVSASCSYTCTEDTPRLHQIPLRSTTAATASLYELLEVPLGATSQDIKSAYRRLARIC  95

Query  633  HPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGY  454
            HPDVA             + A++F+++HAAY TLSDPEKR+ YDR +LR   P     G 
Sbjct  96   HPDVAG--------TDRTTSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTV--GN  145

Query  453  SGRRSAL-RKWETDQCW  406
            SG  S + R WETDQCW
Sbjct  146  SGMGSYVGRNWETDQCW  162



>ref|XP_010934179.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Elaeis 
guineensis]
Length=190

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 89/160 (56%), Gaps = 43/160 (27%)
 Frame = -2

Query  792  VSFRRPVSVSASCATAER----TAQTPQS----SLYDVLGIRTGASGQEIKAAYRRLARV  637
             S R P   +A  A AER     A +P S    SLYDVLG+ +GA+GQEIKAAYRRLAR 
Sbjct  43   TSLRSPRISAAYTAAAERRPPPAALSPASNSFASLYDVLGLPSGATGQEIKAAYRRLARA  102

Query  636  LHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRS--LLRSRH-----  478
             HPDV +            + A++FIR+HAAYSTLSDP+KRA+YDR   LL  RH     
Sbjct  103  CHPDVLA-------TDRKGTSADEFIRIHAAYSTLSDPDKRADYDRKLLLLLGRHRRTIR  155

Query  477  --PAA--------------SVRGYSGRRSALRKWETDQCW  406
              P A              S  GY GRR+    WETDQCW
Sbjct  156  HSPQATPSSSSFQPFSRSPSFPGY-GRRT----WETDQCW  190



>gb|EEE58684.1| hypothetical protein OsJ_10115 [Oryza sativa Japonica Group]
Length=211

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 75/127 (59%), Gaps = 13/127 (10%)
 Frame = -2

Query  771  SVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsa  592
            S S S    +  A    +S YDVLG+  GAS +EIK AYRRLAR +HPD +         
Sbjct  93   SPSTSVVAPDHVAAAAAASFYDVLGLHAGASAREIKDAYRRLARAVHPDASPHPA-----  147

Query  591  aaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL---RSRHPAASVRGYSGRRSALRK--  427
               A+ ++DFIRVHAAYSTLSDP+KRA+YDR LL     R  A    G S    A R+  
Sbjct  148  ---AASSDDFIRVHAAYSTLSDPDKRADYDRRLLLLAAGRRRATPSLGRSPTFPARRRRT  204

Query  426  WETDQCW  406
            WETDQCW
Sbjct  205  WETDQCW  211



>ref|XP_009784395.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Nicotiana 
sylvestris]
Length=177

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 103/186 (55%), Gaps = 37/186 (20%)
 Frame = -2

Query  879  MASTSA-SFLLSSPFVGSAISAAEVA--RPRCVSFRRP---VSVSASCATAERTAQT---  727
            M STS  SFL + P   +  S+ + +   P  ++FR+     + +A+CA+ E  + T   
Sbjct  1    MISTSTRSFLQTPPPPVNIFSSGDSSALSPSSLTFRQSGYFTAAAATCASVETESTTSRY  60

Query  726  --------PQS--SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaas  577
                    P S  S Y++L I  GA+ QEIKAAYRRLARV HPDVA+            S
Sbjct  61   STLPRNLIPASPASFYEILDIPMGATVQEIKAAYRRLARVCHPDVAA-------IDQKDS  113

Query  576  pAEDFIRVHAAYSTLSDPEKRANYDR---------SLLRSRHPAASVRGYSGRRSALRKW  424
             A+DF+++H+AYSTLSDP+KRA+YDR         +L       +++ G++G     R W
Sbjct  114  SADDFMKIHSAYSTLSDPDKRADYDRRLSRRRRSINLYSGGCSPSAMSGFTGYTP--RNW  171

Query  423  ETDQCW  406
            ETDQCW
Sbjct  172  ETDQCW  177



>ref|XP_010028702.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Eucalyptus 
grandis]
Length=169

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 86/154 (56%), Gaps = 35/154 (23%)
 Frame = -2

Query  810  VARPRCVS------FRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRR  649
            + RP+ V+      FRRP S     A +        SSLY+VLGI T AS  ++K AYRR
Sbjct  32   LPRPKTVAAYTSTEFRRPPSAKTEMAASA-------SSLYEVLGIPTSASFNDVKVAYRR  84

Query  648  LARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP--  475
            LARV HPDV  G   +E++A       +F ++H AYSTLSDP++RANYD+ L R   P  
Sbjct  85   LARVCHPDVV-GMTHKETSAT------EFKKIHEAYSTLSDPDRRANYDQHLFRRNRPYG  137

Query  474  -----------AASVRGYSGRRSALRKWETDQCW  406
                       AAS+  +SG     +KWETDQCW
Sbjct  138  SSLSSATMAAAAASMSQFSGY--TCKKWETDQCW  169



>ref|XP_004147068.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cucumis 
sativus]
Length=117

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 70/116 (60%), Gaps = 25/116 (22%)
 Frame = -2

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
            +SS Y+VLGI   AS +EIKAAYR+LAR  HPDV + +            AE+FI++  A
Sbjct  17   RSSFYEVLGIPMTASSREIKAAYRKLARTCHPDVVAEN-----------SAEEFIKIQTA  65

Query  543  YSTLSDPEKRANYDRSLLR----------SRHPAASVRGYSGRRSALRKWETDQCW  406
            YSTLSDP+KRA+YDR + R          SR P +   GY  RR+    WE+DQCW
Sbjct  66   YSTLSDPDKRADYDREICRAQLLSVSGLSSRTPVSGYSGYYTRRN----WESDQCW  117



>ref|XP_006851919.1| hypothetical protein AMTR_s00041p00168770 [Amborella trichopoda]
 gb|ERN13386.1| hypothetical protein AMTR_s00041p00168770 [Amborella trichopoda]
Length=146

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 86/153 (56%), Gaps = 16/153 (10%)
 Frame = -2

Query  849  SSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERT-----AQTPQSSLYDVLGIRTG  685
            S P    ++S    + PR     RP+ +SA+  +AER+          +SLY+VL + +G
Sbjct  5    SLPTFSRSLSFPSPSTPRINGRSRPMRISATYTSAERSPCDCLKAGGTTSLYEVLSLPSG  64

Query  684  ASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANY  505
            AS  EIKAAYRRL R+ HPDVA  +             + FIR+++AY+TLSDP+KRA+Y
Sbjct  65   ASTAEIKAAYRRLVRLCHPDVAKDT-----------STDAFIRINSAYTTLSDPQKRADY  113

Query  504  DRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            DR  +  +  ++ +   +      R WETDQCW
Sbjct  114  DRKFVFRQFYSSPLSPQTSSFRVRRTWETDQCW  146



>ref|XP_009112461.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Brassica 
rapa]
Length=154

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 73/118 (62%), Gaps = 18/118 (15%)
 Frame = -2

Query  741  RTAQTPQ-----SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaas  577
            R  Q PQ     +SLY++L I  G++ QEIK++YRRLAR+ HPDVA              
Sbjct  49   RLRQIPQRLSAAASLYEILEIPVGSTSQEIKSSYRRLARICHPDVAGNG----------R  98

Query  576  pAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-RKWETDQCW  406
             A++F+++HAAY TLSDPEKRA YDR +LR   P +   G SG  S +   WETDQCW
Sbjct  99   SADEFVKIHAAYCTLSDPEKRAVYDRRILRRSRPLSV--GVSGFGSYVGGNWETDQCW  154



>ref|XP_010935074.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Elaeis guineensis]
Length=162

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 94/177 (53%), Gaps = 48/177 (27%)
 Frame = -2

Query  855  LLSSPFVGSAI---SAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTG  685
            L  S FVG+ I   S + +++ RC         S  CA A  TA  P+++LYDVLG+  G
Sbjct  7    LACSQFVGARIPSPSFSPISKLRC---------SPRCAAATATAPVPEATLYDVLGLTAG  57

Query  684  ASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANY  505
            A+  EIKAAYRRLAR  HPDV +            + A++F+R+HAAYS LSDPEKRA+Y
Sbjct  58   ATSGEIKAAYRRLARGCHPDVVAAE-------RKGASADEFMRIHAAYSALSDPEKRADY  110

Query  504  DRSLL--------RSRHPAASVR----------------GYSGRRSALRKWETDQCW  406
            DR L+        R R P    R                G+ GRR+    WETDQCW
Sbjct  111  DRRLMAPKPATFGRQRWPPRGPRPFSSSASTTSAATSFSGF-GRRT----WETDQCW  162



>emb|CDY24828.1| BnaA08g14820D [Brassica napus]
Length=161

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 25/139 (18%)
 Frame = -2

Query  777  PVSVSASCATA-----------ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P+  SASC+             +R   T  +SLY++L +  GAS Q+IK+AYRRLAR+ H
Sbjct  33   PLLASASCSYTCAEDSPRLHQLQRRLTTATASLYEILEVPHGASPQDIKSAYRRLARICH  92

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASV  463
            PDVA          +++S  ++F+++HAAY TLSDPEKR+ YDR +LR   P     + +
Sbjct  93   PDVAGTD-----RTSSSSSGDEFMKIHAAYCTLSDPEKRSLYDRRMLRRSRPLTVSTSGM  147

Query  462  RGYSGRRSALRKWETDQCW  406
              Y G     R WETDQCW
Sbjct  148  GSYVG-----RNWETDQCW  161



>gb|KGN61913.1| hypothetical protein Csa_2G264570 [Cucumis sativus]
Length=145

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 72/113 (64%), Gaps = 19/113 (17%)
 Frame = -2

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
            +SS Y+VLGI   AS +EIKAAYR+LAR  HPDV + +            AE+FI++  A
Sbjct  45   RSSFYEVLGIPMTASSREIKAAYRKLARTCHPDVVAEN-----------SAEEFIKIQTA  93

Query  543  YSTLSDPEKRANYDRSLLRSRHPAAS-------VRGYSGRRSALRKWETDQCW  406
            YSTLSDP+KRA+YDR + R++  + S       V GYSG  +  R WE+DQCW
Sbjct  94   YSTLSDPDKRADYDREICRAQLLSVSGLSSRTPVSGYSGYYTR-RNWESDQCW  145



>gb|KFK40165.1| hypothetical protein AALP_AA3G339100 [Arabis alpina]
Length=145

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 66/106 (62%), Gaps = 11/106 (10%)
 Frame = -2

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
             +SLY++L I  G++ QEIK+AYRRLA + HPDVA  S +          A+DF+++H A
Sbjct  51   NASLYEILEIPIGSTRQEIKSAYRRLALICHPDVAKNSSL----------ADDFMKIHGA  100

Query  543  YSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            Y TLSDPEKRA YDR +   R P  SV G        R WETDQCW
Sbjct  101  YCTLSDPEKRAVYDRMIFSRRRP-LSVGGNGYGGYVGRNWETDQCW  145



>gb|KCW55495.1| hypothetical protein EUGRSUZ_I01393 [Eucalyptus grandis]
Length=231

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 86/154 (56%), Gaps = 35/154 (23%)
 Frame = -2

Query  810  VARPRCVS------FRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRR  649
            + RP+ V+      FRRP S     A +        SSLY+VLGI T AS  ++K AYRR
Sbjct  94   LPRPKTVAAYTSTEFRRPPSAKTEMAASA-------SSLYEVLGIPTSASFNDVKVAYRR  146

Query  648  LARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP--  475
            LARV HPDV  G   +E++A       +F ++H AYSTLSDP++RANYD+ L R   P  
Sbjct  147  LARVCHPDVV-GMTHKETSAT------EFKKIHEAYSTLSDPDRRANYDQHLFRRNRPYG  199

Query  474  -----------AASVRGYSGRRSALRKWETDQCW  406
                       AAS+  +SG     +KWETDQCW
Sbjct  200  SSLSSATMAAAAASMSQFSGY--TCKKWETDQCW  231



>ref|XP_009109258.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Brassica 
rapa]
Length=161

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 25/139 (18%)
 Frame = -2

Query  777  PVSVSASCATA-----------ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P+  SASC+             +R   T  +SLY++L +  GAS Q+IK+AYRRLAR+ H
Sbjct  33   PLLASASCSYTCAEDSPRLHQLQRRLTTATASLYEILEVPHGASPQDIKSAYRRLARICH  92

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASV  463
            PDVA          +++S  ++F+++HAAY TLSDPEKR+ YDR +LR   P     + +
Sbjct  93   PDVAGLD-----RTSSSSSGDEFMKIHAAYCTLSDPEKRSLYDRRMLRRSRPLTVSTSGM  147

Query  462  RGYSGRRSALRKWETDQCW  406
              Y G     R WETDQCW
Sbjct  148  GSYVG-----RNWETDQCW  161



>ref|XP_008375105.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Malus 
domestica]
 ref|XP_009377675.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009377695.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Pyrus 
x bretschneideri]
Length=117

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 66/114 (58%), Gaps = 18/114 (16%)
 Frame = -2

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LY+VLG+  GASG EIKAAYR+LAR  HPDV +            +   +F+++HAAY+T
Sbjct  11   LYEVLGLPMGASGHEIKAAYRKLARRCHPDVVAMD-------QKQNSTNEFMKIHAAYAT  63

Query  534  LSDPEKRANYDRSLLRSRHP-----------AASVRGYSGRRSALRKWETDQCW  406
            LSDP+KRANYDR L R   P           AA+       R   R WETDQCW
Sbjct  64   LSDPDKRANYDRDLYRCPQPFQSSYSSANMAAAASAMAGSSRRTNRNWETDQCW  117



>ref|XP_010413346.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Camelina 
sativa]
Length=164

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = -2

Query  726  PQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHA  547
            P +SLY++L I  G++ QEIK+AYRRLAR+ HPDVA  S         +S A+DF+++HA
Sbjct  62   PTASLYEILEIPAGSTSQEIKSAYRRLARIYHPDVAGNSRSSN-----SSAADDFMKIHA  116

Query  546  AYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS-ALRKWETDQCW  406
            AY TLSDPEKRA YDR  +          G SG  S   R WETDQCW
Sbjct  117  AYCTLSDPEKRAVYDRRRMLLSRRRPLTVGVSGCGSYGGRNWETDQCW  164



>emb|CDX75547.1| BnaA01g01550D [Brassica napus]
Length=160

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 72/116 (62%), Gaps = 17/116 (15%)
 Frame = -2

Query  741  RTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDF  562
            R+     +SLY++L +  GA+ Q+IK+AYRRLAR+ HPDVA             + A++F
Sbjct  58   RSTTATTASLYEILEVPRGATSQDIKSAYRRLARICHPDVAGTD--------RTTSADEF  109

Query  561  IRVHAAYSTLSDPEKRANYDRSLLRSRHP-AASVRG---YSGRRSALRKWETDQCW  406
            +++HAAY TLSDPEKR+ YDR +LR   P  AS  G   Y G     R WETDQCW
Sbjct  110  MKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTASTSGMGSYVG-----RNWETDQCW  160



>ref|XP_004232493.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Solanum 
lycopersicum]
Length=183

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 71/114 (62%), Gaps = 20/114 (18%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            S Y++LGI  GA+ QEIKAAYRRLARV HPDVA+            + A+DF+++H+AYS
Sbjct  80   SFYEILGIPIGATIQEIKAAYRRLARVCHPDVAA-------IDQKDTSADDFMKIHSAYS  132

Query  537  TLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS----------ALRKWETDQCW  406
            TLSDP+KRA+YDR L R      +V  YSG  S            R WETDQCW
Sbjct  133  TLSDPDKRADYDRRLFRR---RRNVNLYSGGCSPSAMSAFTGYTTRNWETDQCW  183



>ref|XP_002313725.1| hypothetical protein POPTR_0009s13440g [Populus trichocarpa]
 gb|EEE87680.1| hypothetical protein POPTR_0009s13440g [Populus trichocarpa]
Length=107

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 70/115 (61%), Gaps = 22/115 (19%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SS Y+VLG+    +  EIKAAYR+LAR  HPD  S   M +   +A     +FI++HAAY
Sbjct  5    SSFYEVLGLPMNTTSHEIKAAYRKLARTCHPDAVS---MHKKEMSAC----EFIKIHAAY  57

Query  540  STLSDPEKRANYDRSLLRSRHP--AASVR--------GYSGRRSALRKWETDQCW  406
            STLSDP+KR  YDR L R+R P  ++SVR        GY+      R WETDQCW
Sbjct  58   STLSDPDKRERYDRDLYRNRRPFGSSSVRSATMAAASGYTS-----RNWETDQCW  107



>gb|KHN41895.1| Chaperone protein dnaJ 11, chloroplastic [Glycine soja]
Length=141

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 90/168 (54%), Gaps = 42/168 (25%)
 Frame = -2

Query  870  TSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAE-RTAQTPQ---------  721
            +S SF  S P V    S   +A P C    RP+    + ATAE R++ T Q         
Sbjct  3    SSVSFPASLPAVN--FSGNAMASPSCRVKSRPI---VAFATAEARSSWTEQLRPSPSYLN  57

Query  720  ---SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
               SSLYD+LGI  GAS QEIKAAYRRLARV   DVA  ++ R+        A++F+++H
Sbjct  58   SSCSSLYDILGIPAGASNQEIKAAYRRLARVCQTDVA--AIDRK-----NLSADEFMKIH  110

Query  549  AAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            AAYSTLSDP   ANYD S            GY+      R WETDQCW
Sbjct  111  AAYSTLSDPNMCANYDFS------------GYTR-----RNWETDQCW  141



>ref|XP_010271559.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nelumbo 
nucifera]
Length=178

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 83/153 (54%), Gaps = 30/153 (20%)
 Frame = -2

Query  795  CVSFRRPVSVSASCATAERT--------AQTPQSSLYDVLGIRTGASGQEIKAAYRRLAR  640
            CV FR P   +A  ++AERT             +S Y++LG+  GA+ QEIK AYRRLAR
Sbjct  33   CVRFRSPRFSAAYTSSAERTRPPRLSSTKMASSASFYEMLGLPMGATYQEIKTAYRRLAR  92

Query  639  VLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRH------  478
            V HPDV   +V R+      + A++F+++HAAYSTLSDPEKRA+YDR L  S        
Sbjct  93   VCHPDVV--AVDRK-----NTSADEFMKIHAAYSTLSDPEKRADYDRKLFFSTQQRPFRS  145

Query  477  ---------PAASVRGYSGRRSALRKWETDQCW  406
                      A +         + R WETDQCW
Sbjct  146  PSSTSASTASAGASSMSGFSGFSRRTWETDQCW  178



>emb|CDY34072.1| BnaC03g62600D [Brassica napus]
Length=161

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 14/117 (12%)
 Frame = -2

Query  744  ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
            +R   T  +SLY++L +  GAS Q+IK+AYRRLAR+ HPDVA           ++S  ++
Sbjct  55   QRRLTTATASLYEILEVPHGASPQDIKSAYRRLARICHPDVAGLD-----RTNSSSSGDE  109

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASVRGYSGRRSALRKWETDQCW  406
            F+++HAAY TLSD EKR+ YDR +LR   P     + + GY G     R WETDQCW
Sbjct  110  FMKIHAAYCTLSDLEKRSVYDRRMLRRSRPLTVSTSGMGGYVG-----RNWETDQCW  161



>gb|ACN28370.1| unknown [Zea mays]
 gb|AFW65660.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=140

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 70/108 (65%), Gaps = 16/108 (15%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            +LY+VLG+R GA+G+EIKAAYRRLAR  HPDVA+              A +F+R+H AY+
Sbjct  45   TLYEVLGLRAGATGREIKAAYRRLARERHPDVATAP----------GAAAEFVRLHDAYA  94

Query  537  TLSDPEKRANYDRS----LLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            TLSDP+ RA YDRS    +  ++ P  S  G  GR   LR WETDQCW
Sbjct  95   TLSDPDSRARYDRSAVAAVAVAQRPWRSGVGVYGR--PLRTWETDQCW  140



>ref|XP_006847076.1| hypothetical protein AMTR_s00017p00209650 [Amborella trichopoda]
 gb|ERN08657.1| hypothetical protein AMTR_s00017p00209650 [Amborella trichopoda]
Length=132

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 68/115 (59%), Gaps = 16/115 (14%)
 Frame = -2

Query  750  TAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspA  571
            T  +T   P + LYD LG+   AS  +IKAAYR+L R  HPDV S     +SA       
Sbjct  34   THTKTTSGPINCLYDDLGLSYHASKADIKAAYRKLVRTCHPDVVSPDQRNKSA-------  86

Query  570  EDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            +DFIR+H+AY+TLSDP+KRA+YDR          S   +S + +  R WETDQCW
Sbjct  87   DDFIRIHSAYATLSDPQKRADYDRK---------SQMSFSSKMTIRRTWETDQCW  132



>ref|XP_010467587.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Camelina 
sativa]
Length=164

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 9/107 (8%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY++L I  G++ QEIK+AYRRLAR+ HPD A  S       + +S A++F+++HAAY
Sbjct  65   ASLYEILDIPAGSTIQEIKSAYRRLARIYHPDAAGSS------RSNSSTADEFMKIHAAY  118

Query  540  STLSDPEKRANYD-RSLLRSRHPAASVRGYSGRRS-ALRKWETDQCW  406
             TLSDPEKRA YD R++L SR    +V G SG  S   R WETDQCW
Sbjct  119  CTLSDPEKRAVYDRRTMLLSRRRPLTV-GVSGCGSYGGRNWETDQCW  164



>ref|XP_010526799.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Tarenaya 
hassleriana]
Length=165

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 76/114 (67%), Gaps = 10/114 (9%)
 Frame = -2

Query  741  RTAQTPQS-SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
            R    PQS SLY++L +  GA+ +EIKAAYRRLAR+ HPDVA   + RE+++A     ++
Sbjct  60   RRVSVPQSASLYEILEVPIGATSREIKAAYRRLARICHPDVAG--IDRENSSA-----DE  112

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSG-RRSALRKWETDQCW  406
            F+R+HAAY TL DP+KRA YDR + R R    +  G SG  R   R WETDQCW
Sbjct  113  FMRIHAAYCTLLDPDKRAVYDRRI-RQRSRPMTTAGTSGFGRYGGRNWETDQCW  165



>ref|XP_006361931.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Solanum 
tuberosum]
Length=153

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 76/138 (55%), Gaps = 18/138 (13%)
 Frame = -2

Query  801  PRCVSFRRPVSVSA------SCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLAR  640
            P CV FR+  S S       S AT    + +P +S Y++LGI  GA+ +EIKAAYRRL R
Sbjct  28   PSCVRFRQSGSFSVAATSYTSVATCVPVSASP-ASFYEILGISIGATIEEIKAAYRRLVR  86

Query  639  VLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR  460
            V HPDVA+            S  ++F+++ AAY TLSDP KRA YD SL   R       
Sbjct  87   VYHPDVAA-------IDQKDSYTDEFMKIRAAYCTLSDPNKRAEYDPSLYPRRRTGNLYS  139

Query  459  GYSGRRSALRKWETDQCW  406
                RR+    WETDQCW
Sbjct  140  AAYTRRN----WETDQCW  153



>emb|CBI37900.3| unnamed protein product [Vitis vinifera]
Length=141

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 64/93 (69%), Gaps = 8/93 (9%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY+VLGI   ASG EIKAAYRRLARV HPDV + +          + A +F+++HAAY
Sbjct  56   SSLYEVLGIPVSASGNEIKAAYRRLARVCHPDVVAMN-------QKETSANEFMKIHAAY  108

Query  540  STLSDPEKRANYDRSLLRSRHP-AASVRGYSGR  445
            STLSDP+KRANYD+ L R R P   +  GY+ R
Sbjct  109  STLSDPDKRANYDQDLFRRRRPHLINQSGYNTR  141



>tpg|DAA64525.1| TPA_inf: DnaJ (chloroplast) [Selaginella moellendorffii]
Length=156

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 11/107 (10%)
 Frame = -2

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
            Q SLYDVLG+   +  ++I++AYR LAR+ HPDVA+     E         ++F+++HAA
Sbjct  60   QQSLYDVLGVAQQSDVKDIRSAYRHLARITHPDVAATENKEE-------STKEFLKIHAA  112

Query  543  YSTLSDPEKRANYDRSL-LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            Y+TL DPE+RA YD  L L+S     S RG+SG     R WETDQCW
Sbjct  113  YTTLCDPERRARYDLQLSLQSLPRFGSPRGFSG---IGRSWETDQCW  156



>ref|XP_008788620.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Phoenix 
dactylifera]
Length=160

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 72/127 (57%), Gaps = 34/127 (27%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            +LYDVLG+  GA+  EIKAAYRRLAR  HPDV +  +         + A++F+R+HAAYS
Sbjct  45   TLYDVLGLTAGATSGEIKAAYRRLARACHPDVVAADL-------KGASADEFMRIHAAYS  97

Query  537  TLSDPEKRANYDRSLL--------RSRHPAASVRGYS---------------GRRSALRK  427
            TL+DPEKRA+YDR L+        R R P    R +                GRR+    
Sbjct  98   TLADPEKRADYDRRLMAATPAAFGRQRWPPRGPRPFYSSASSTSAATSFSGFGRRT----  153

Query  426  WETDQCW  406
            WETDQCW
Sbjct  154  WETDQCW  160



>ref|XP_003574898.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Brachypodium 
distachyon]
Length=147

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 66/113 (58%), Gaps = 18/113 (16%)
 Frame = -2

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
            + +LY+VLG+R GA+G+EIKAAYRRLAR  HPD A                E+FIR+H A
Sbjct  46   RCTLYEVLGLRAGATGREIKAAYRRLARERHPDAAGAG-----------GDEEFIRLHHA  94

Query  543  YSTLSDPEKRANYDRSLLRSRHPAASVRGYS-------GRRSALRKWETDQCW  406
            Y+TLSDP+ RA YDRS++   +                GRR   R WETDQCW
Sbjct  95   YATLSDPDARARYDRSVVAHAYYGGGGSSTGGDDGGVWGRRRPRRTWETDQCW  147



>ref|XP_002974218.1| hypothetical protein SELMODRAFT_100874 [Selaginella moellendorffii]
 ref|XP_002985592.1| hypothetical protein SELMODRAFT_122625 [Selaginella moellendorffii]
 gb|EFJ13170.1| hypothetical protein SELMODRAFT_122625 [Selaginella moellendorffii]
 gb|EFJ24440.1| hypothetical protein SELMODRAFT_100874 [Selaginella moellendorffii]
Length=108

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 11/107 (10%)
 Frame = -2

Query  723  QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
            Q SLYDVLG+   +  ++I++AYR LAR+ HPDVA+     E         ++F+++HAA
Sbjct  12   QQSLYDVLGVAQQSDVKDIRSAYRHLARITHPDVAATENKEE-------STKEFLKIHAA  64

Query  543  YSTLSDPEKRANYDRSL-LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            Y+TL DPE+RA YD  L L+S     S RG+SG     R WETDQCW
Sbjct  65   YTTLCDPERRARYDLQLSLQSLPRFGSPRGFSG---IGRSWETDQCW  108



>emb|CDY29205.1| BnaA06g25520D [Brassica napus]
Length=159

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 69/117 (59%), Gaps = 18/117 (15%)
 Frame = -2

Query  744  ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
            +R + TP  SLY++L I  G++ Q IK+AYRRLAR+ HPDVA             S A+ 
Sbjct  57   QRLSATP--SLYEILEIPVGSTSQVIKSAYRRLARICHPDVAGND-------RKCSSADT  107

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASVRGYSGRRSALRKWETDQCW  406
            F+++HAAY TLSDPEKRA YDR +L  R P     +    Y G       WETDQCW
Sbjct  108  FMKIHAAYCTLSDPEKRAVYDRKILCGRRPLTVGVSRFGSYGG-----GNWETDQCW  159



>ref|XP_010489427.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Camelina 
sativa]
Length=164

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 9/109 (8%)
 Frame = -2

Query  726  PQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHA  547
            P +SLY++L I  G++ QEIK+AYR LAR+ HPDVA  S       + +S A+DF+++ A
Sbjct  63   PTASLYEILEIPAGSTIQEIKSAYRGLARIYHPDVAGNS------RSNSSAADDFMKIRA  116

Query  546  AYSTLSDPEKRANYD-RSLLRSRHPAASVRGYSGRRS-ALRKWETDQCW  406
            AY TLSDPEKRA YD R +L SR    +V G SG  S   R WETDQCW
Sbjct  117  AYCTLSDPEKRAVYDRRRMLLSRIRPLTV-GVSGFGSYGGRNWETDQCW  164



>ref|XP_003533165.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=133

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 26/128 (20%)
 Frame = -2

Query  840  FVGSAISAAEVARPRCVSFRRPVSVSASCATAE-RTAQTPQ----------SSLYDVLGI  694
            F G+A++++      C    RP+    + ATAE R++ T Q           SLYD+LGI
Sbjct  16   FSGNAMASSS-----CRVKSRPI---VAFATAEARSSWTEQLRPSYLNSSYFSLYDILGI  67

Query  693  RTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKR  514
             + AS QEIKAAY+RLARV HPD+A  ++ R+      S A++F+++HAAYSTLSDP+KR
Sbjct  68   PSDASNQEIKAAYQRLARVYHPDMA--AIDRK-----NSSADEFMKIHAAYSTLSDPDKR  120

Query  513  ANYDRSLL  490
            ANYDRSL 
Sbjct  121  ANYDRSLF  128



>emb|CBI19879.3| unnamed protein product [Vitis vinifera]
Length=233

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 88/157 (56%), Gaps = 32/157 (20%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRC-VSFRRPVSVSASCATAERTAQ--TPQSSLYDVLG  697
            SA+   SS FV   ++  + A P   V FR+P   ++  ATAERT       +SLYDVLG
Sbjct  106  SAAPFSSSHFVVPKVAVNQRASPPTYVRFRQPKVSASYTATAERTMSHIANPASLYDVLG  165

Query  696  IRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEK  517
            I  GA+ QEIKAAYRRLARV HPDV + S          + A++FI++HAAY+TLS    
Sbjct  166  INMGATCQEIKAAYRRLARVSHPDVVANS-------QKDTSADEFIKIHAAYATLS----  214

Query  516  RANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
                         PA+   G    RS+LR WETDQCW
Sbjct  215  -------------PASVFSG----RSSLR-WETDQCW  233



>gb|KHN36030.1| Chaperone protein dnaJ 11, chloroplastic [Glycine soja]
Length=133

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 83/138 (60%), Gaps = 23/138 (17%)
 Frame = -2

Query  870  TSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAE-RTAQTPQ---------  721
            +S SF  S P V    S   +A P C    RP+    + ATAE R++ T Q         
Sbjct  3    SSVSFPASLPAVN--FSGNAMASPSCRVKSRPI---VAFATAEARSSWTEQLRPSYLNSS  57

Query  720  -SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
              SLYD+LGI + AS QEIKAAYRRLARV   DVA  ++ R+        A++F+++HAA
Sbjct  58   YFSLYDILGIPSDASNQEIKAAYRRLARVCQTDVA--AIDRK-----NLSADEFMKIHAA  110

Query  543  YSTLSDPEKRANYDRSLL  490
            YSTLSDP+KRANYDRSL 
Sbjct  111  YSTLSDPDKRANYDRSLF  128



>ref|XP_007156132.1| hypothetical protein PHAVU_003G261300g [Phaseolus vulgaris]
 gb|ESW28126.1| hypothetical protein PHAVU_003G261300g [Phaseolus vulgaris]
Length=151

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 83/144 (58%), Gaps = 22/144 (15%)
 Frame = -2

Query  807  ARPRCVSFRRPVSVSASCATAERT-AQTPQS-----SLYDVLGIRTGASGQEIKAAYRRL  646
            +R R + FR  VS +A+ ATA      +PQS     +LY+VLG+R  AS  EIKAAYR+L
Sbjct  20   SRQRHIKFRSTVSFAAATATATSIDVLSPQSMASCTTLYEVLGVRPAASEGEIKAAYRQL  79

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL-RSR---H  478
             RV HPDVA             S A  F+++H AY TL +PEKRA YDRSL  R R    
Sbjct  80   VRVCHPDVAP-------VGQKESSAGKFMKIHNAYRTLLNPEKRAKYDRSLFPRGRVVST  132

Query  477  PAASVRGYSGRRSALRKWETDQCW  406
             A+ V  Y GRR     WETDQCW
Sbjct  133  AASRVSSYGGRR-----WETDQCW  151



>ref|XP_009383308.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=155

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 70/114 (61%), Gaps = 23/114 (20%)
 Frame = -2

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LYDVLGI   A+ +EIKAAYRRLARV HPDVA+ S          +PA++FIRVHAAY+T
Sbjct  54   LYDVLGIPASATVEEIKAAYRRLARVCHPDVAAASRA--------APADEFIRVHAAYAT  105

Query  534  LSDPEKRANYDRSLLR-----------SRHPAASVRGYSGRRSALRKWETDQCW  406
            L+DPEKRA YDR ++             R PA      S R    R WETDQCW
Sbjct  106  LTDPEKRAEYDRRVMAAAAPSMASATVGRRPAGPFYSSSPR----RMWETDQCW  155



>ref|NP_001151820.1| chaperone protein dnaJ 11 [Zea mays]
 gb|ACG44453.1| chaperone protein dnaJ 11 [Zea mays]
Length=139

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 16/107 (15%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            +LY+VLG+R GA+G+EIKAAYRRLAR  HPDVA+              A +F+R+H AY+
Sbjct  45   TLYEVLGLRAGATGREIKAAYRRLARERHPDVATAP----------GAAAEFVRLHDAYA  94

Query  537  TLSDPEKRANYDRS----LLRSRHPAASVRGYSGRRSALRKWETDQC  409
            TLSDP+ RA YDRS    +  ++ P  S  G  GR   LR WETDQC
Sbjct  95   TLSDPDSRARYDRSAVAAVAVAQRPWRSGVGVYGR--PLRTWETDQC  139



>emb|CDY07811.1| BnaC03g48110D [Brassica napus]
Length=162

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 72/132 (55%), Gaps = 24/132 (18%)
 Frame = -2

Query  765  SASCA-TAERTAQTPQ-------SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGS  610
            S SCA    R  Q PQ        SLY++L I  G++ Q IK+AYRRLAR+ HPDVA   
Sbjct  43   SYSCAEDPPRLRQIPQRLSASVTPSLYEILEIPVGSTSQVIKSAYRRLARICHPDVAGN-  101

Query  609  VMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASVRGYSGRR  442
                      + ++ F+++HAAY TLSDPEKRA YDR +L  R P     +    Y G  
Sbjct  102  ------RRNCASSDAFMKIHAAYCTLSDPEKRAVYDRKILCGRRPLTVGVSRFGSYGG--  153

Query  441  SALRKWETDQCW  406
                 WETDQCW
Sbjct  154  ---GNWETDQCW  162



>ref|XP_009124576.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Brassica 
rapa]
Length=160

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 68/117 (58%), Gaps = 18/117 (15%)
 Frame = -2

Query  744  ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
            +R + TP  SLY++L I  G++ Q IK+AYRRLAR+ HPDVA             S A+ 
Sbjct  58   QRLSATP--SLYEILEIPVGSTSQVIKSAYRRLARICHPDVAGND-------RKCSSADA  108

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHP----AASVRGYSGRRSALRKWETDQCW  406
            F ++HAAY TLSDPEKRA YDR +L  R P     +    Y G       WETDQCW
Sbjct  109  FTKIHAAYCTLSDPEKRAVYDRKILCGRRPLTVGVSRFGSYGG-----GNWETDQCW  160



>ref|XP_004233983.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Solanum 
lycopersicum]
Length=154

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 75/137 (55%), Gaps = 19/137 (14%)
 Frame = -2

Query  795  CVSFRR-------PVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARV  637
            CV FR+         S S S AT      +P +S Y++LGI  GA+ +E+KAAYRRL RV
Sbjct  30   CVRFRQSGSFSVAATSYSTSVATCVPVYVSP-ASFYEILGIPIGATIEEVKAAYRRLVRV  88

Query  636  LHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRG  457
             HPDVA+            S A++F+++ AAY TL DP KRA YDRSL   R        
Sbjct  89   YHPDVAA-------IDQKDSYADEFMKIRAAYCTLFDPNKRAQYDRSLYPRRRTGNLYSA  141

Query  456  YSGRRSALRKWETDQCW  406
               RR+    WETDQCW
Sbjct  142  AHTRRN----WETDQCW  154



>dbj|BAJ95674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=140

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 82/161 (51%), Gaps = 30/161 (19%)
 Frame = -2

Query  864  ASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTG  685
            A+F  S+  V  +     VA PR     R  S  A+ AT          + Y+VLG+  G
Sbjct  2    ATFATSTAAVMGSAGPGRVAGPRRCMVARASSTMAAPATV-----AVGWTHYEVLGLGAG  56

Query  684  ASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANY  505
            AS  EIKAAYRRLAR +HPD   G              E FIR+HAAY+TL+DP++RA Y
Sbjct  57   ASRGEIKAAYRRLAREVHPDAVGGG-----------DDEGFIRLHAAYATLADPDERARY  105

Query  504  DRSLLRSRHPAASVRGYSGRRSA--------LRKWETDQCW  406
            DRS+      A    G + RR+A         R WETDQCW
Sbjct  106  DRSV------ACRAAGMTMRRAASTSAPAFRRRTWETDQCW  140



>ref|XP_003544555.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=142

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 72/135 (53%), Gaps = 15/135 (11%)
 Frame = -2

Query  789  SFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGS  610
            + R P  +S    TA        +SLY+VL I+  AS  EIK+AYR LA+V HPD    S
Sbjct  16   TLRPPFRISIRAFTATAIDSRRAASLYEVLRIKQNASAVEIKSAYRNLAKVYHPD----S  71

Query  609  VMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHP-------AASVRGYS  451
             +R     + S   DFI +H AY TLSDP  RA YD SL+ +R          A+  G S
Sbjct  72   ALRR----SESDERDFIEIHDAYETLSDPSARALYDLSLMAARDDNRSFSSLVAAPNGSS  127

Query  450  GRRSALRKWETDQCW  406
            G     RKWETDQCW
Sbjct  128  GFYYQTRKWETDQCW  142



>ref|XP_004974140.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Setaria 
italica]
Length=150

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 70/109 (64%), Gaps = 15/109 (14%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            +LYDVLG+R GA+ +EIKAAYRRLAR  HPDVA  +            A +F+R+H AY+
Sbjct  52   TLYDVLGLRAGATVREIKAAYRRLARERHPDVAGAAPG---------AAAEFVRLHDAYA  102

Query  537  TLSDPEKRANYDR-SLLRSRHPAASVRGY----SGRRSALRKWETDQCW  406
            TLSDP+ RA YDR ++  ++ P A  R      SGRR   R WETDQCW
Sbjct  103  TLSDPDSRARYDRVAVAVAQRPCAYTRWAAATGSGRRP-RRTWETDQCW  150



>ref|XP_010941292.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Elaeis 
guineensis]
Length=163

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 68/122 (56%), Gaps = 26/122 (21%)
 Frame = -2

Query  714  LYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYST  535
            LYDVLGI  GA+G E+KAAYRRLAR  HPDV +            + A++F+R+HAAY+T
Sbjct  49   LYDVLGIAAGATGGEVKAAYRRLARECHPDVVAAD-------RKGASADEFMRIHAAYAT  101

Query  534  LSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-------------------RKWETDQ  412
            LS+PEKRA+YDR L  +   A   + +S R                       R WETDQ
Sbjct  102  LSNPEKRADYDRRLAAAAATAIGRQQWSPRGPRPFPSSSSSPSVATSFSGFRRRTWETDQ  161

Query  411  CW  406
            CW
Sbjct  162  CW  163



>ref|NP_001058589.1| Os06g0716100 [Oryza sativa Japonica Group]
 dbj|BAF20503.1| Os06g0716100 [Oryza sativa Japonica Group]
 gb|EEE66364.1| hypothetical protein OsJ_22667 [Oryza sativa Japonica Group]
Length=133

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 65/108 (60%), Gaps = 26/108 (24%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+  GAS  EIKAAYRRLAR +HPD  +            +  EDFIR+HAAY+TL
Sbjct  46   YEVLGVGAGASRGEIKAAYRRLAREVHPDAGA------------TGDEDFIRLHAAYATL  93

Query  531  SDPEKRANYDRSLLRS------RHPAASVRGYSGRRSALRKWETDQCW  406
            +DP++RA YDR++         R PA+S R         R WETDQCW
Sbjct  94   ADPDERARYDRAMAGPAASAFRRAPASSFR--------RRTWETDQCW  133



>ref|XP_009400352.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=154

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 67/116 (58%), Gaps = 26/116 (22%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VLG+   ASG+EIKAAYR LA   HPDV + +             E+F+RV AAY
Sbjct  54   TSLYEVLGVPAWASGREIKAAYRGLALKCHPDVGASA-------------EEFMRVQAAY  100

Query  540  STLSDPEKRANYDRSLLRSRHPAASV-----------RGYSGRRSALRKWETDQCW  406
             TLSDP++RA+YDR L+ S   AA +             + G R   R WETDQCW
Sbjct  101  CTLSDPQQRADYDRQLMASSAAAAPLGRRYRSTYSRTASFPGNRR--RTWETDQCW  154



>ref|XP_010090310.1| Chaperone protein dnaJ 11 [Morus notabilis]
 gb|EXB39280.1| Chaperone protein dnaJ 11 [Morus notabilis]
Length=116

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 66/120 (55%), Gaps = 26/120 (22%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            SLY+VLGI   ASG EIK AYRRLAR  HPDV +            + A +F+++ AAYS
Sbjct  7    SLYEVLGIPMSASGHEIKLAYRRLARTCHPDVVA-------FEQKETSASEFMKIRAAYS  59

Query  537  TLSDPEKRANYDRSLLRSRHPAASVRGYSGR----------------RSALRKWETDQCW  406
            TLSDP+KRA+YDR L   R P     GYS                  + + R WETDQCW
Sbjct  60   TLSDPDKRADYDRDLFSRRRPPF---GYSPSPASAAEAAANAATRFSQYSRRCWETDQCW  116



>ref|NP_001147476.1| chaperone protein dnaJ 11 [Zea mays]
 gb|ACG27652.1| chaperone protein dnaJ 11 [Zea mays]
Length=128

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 78/135 (58%), Gaps = 21/135 (16%)
 Frame = -2

Query  801  PRCVSFR--RPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHP  628
            P C + R  R V+  AS      TA+T     Y++LG+  GAS  EIKAAYRRLAR +HP
Sbjct  12   PSCAARRGGRCVARRASAVATPATART----HYELLGVGAGASQCEIKAAYRRLAREVHP  67

Query  627  DVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDR-SLLRSRHPAASVRGYS  451
            D                  E FIR+HAAY+TL+DP++RA YDR + +RSR  AA     +
Sbjct  68   DCGG------------RGDEGFIRLHAAYATLADPDERARYDRAAAVRSRIRAAPSGSGA  115

Query  450  GRRSALRKWETDQCW  406
            G R   R+WETDQCW
Sbjct  116  GFRP--RRWETDQCW  128



>gb|ABR18263.1| unknown [Picea sitchensis]
Length=188

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 89/180 (49%), Gaps = 26/180 (14%)
 Frame = -2

Query  900  ISTIQF--IMASTSASFLLSSPFVGSAISAAEVARPRCVSF--RRPVSV--------SAS  757
            IS  QF  +++S+     L     G  +S  ++   R   +  +R +SV          S
Sbjct  20   ISAQQFNSLVSSSDHQDSLRLRLGGQWVSPLKIHHKRKFQYGDKRGISVIYAHVQTSMGS  79

Query  756  CATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaas  577
                 RT      +LY VLG+  GAS +EIKA+YRRLAR+ HPD A              
Sbjct  80   DQLKTRTVNCSSINLYHVLGLSFGASKEEIKASYRRLARLHHPDAAP-------PDGKDK  132

Query  576  pAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRG---YSGRRSALRKWETDQCW  406
             A+DF+ +H AY+TL +P  RA+YDR L+ S      VR    Y G++   R WETDQCW
Sbjct  133  SAQDFMDIHTAYTTLYNPHSRADYDRRLMTS----MKVRNGGIYGGQQWKGRSWETDQCW  188



>ref|XP_004134860.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like isoform 
2 [Cucumis sativus]
 ref|XP_004158868.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like isoform 
2 [Cucumis sativus]
Length=148

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 22/105 (21%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLYDVLGI TGAS QEIK+AYRRLAR+ HPDVA  ++ R+ ++A      DF+++HAAY
Sbjct  66   TSLYDVLGIPTGASFQEIKSAYRRLARLCHPDVA--AIHRKDSSAT-----DFMKIHAAY  118

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            STLSDP   A            A+   GY+      R WETDQCW
Sbjct  119  STLSDPVASARM----------ASGFTGYTR-----RNWETDQCW  148



>ref|XP_010552334.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Tarenaya 
hassleriana]
Length=159

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 68/125 (54%), Gaps = 13/125 (10%)
 Frame = -2

Query  780  RPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMR  601
            R +S  A+    E   + P  SLY+VL ++  AS  EIK AYR LA+V HPD AS S  R
Sbjct  48   RTLSSEAATEAGEWVRRRPAESLYEVLKVKETASLTEIKTAYRSLAKVYHPDAASESDGR  107

Query  600  EsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWE  421
                       DF+ +H AY+TLSDP  R  YD SL   R     + G +GR    R+WE
Sbjct  108  -----------DFMEIHKAYATLSDPTARTLYDLSLGARRRRV--IVGRAGRVYTTRRWE  154

Query  420  TDQCW  406
            TDQCW
Sbjct  155  TDQCW  159



>ref|XP_009392102.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=133

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 69/126 (55%), Gaps = 13/126 (10%)
 Frame = -2

Query  783  RRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVM  604
            RRP S S +  ++  T       LYDVLG+   A+G EIK AYRRLAR  HPDV +    
Sbjct  21   RRPPSCSVAVGSSSAT-------LYDVLGVAADATGVEIKVAYRRLARSCHPDVVAAQ--  71

Query  603  REsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKW  424
                   AS A++F+RV AAY  LSDPEKR +YDR +      A      S +    R W
Sbjct  72   ----GKGASAADEFMRVRAAYEILSDPEKRVDYDRRVKAVVFSALRTSWCSSQDRRPRTW  127

Query  423  ETDQCW  406
            ETDQCW
Sbjct  128  ETDQCW  133



>ref|XP_002445743.1| hypothetical protein SORBIDRAFT_07g024945 [Sorghum bicolor]
 gb|EES15238.1| hypothetical protein SORBIDRAFT_07g024945 [Sorghum bicolor]
Length=165

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 66/107 (62%), Gaps = 18/107 (17%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            +LY+VLG+R GA+G+EIKAAYRRLAR  HPDVA               A +F+R+H AY+
Sbjct  74   TLYEVLGLRAGATGREIKAAYRRLARERHPDVAPAP----------GAAAEFVRLHDAYA  123

Query  537  TLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRK---WETDQCW  406
            TLSDP+ RA YDR  +     A + R +SG     R    WETDQCW
Sbjct  124  TLSDPDTRARYDRGAV-----AVAQRPWSGGGGGGRPRRTWETDQCW  165



>ref|NP_001147752.1| chaperone protein dnaJ 11 [Zea mays]
 gb|ACG28561.1| chaperone protein dnaJ 11 [Zea mays]
 gb|ACG30639.1| chaperone protein dnaJ 11 [Zea mays]
Length=132

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 15/103 (15%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+  GAS  EIKAAYRRLAR +HPD                  E FIR+HAAY+TL
Sbjct  44   YEVLGVGAGASRCEIKAAYRRLAREVHPDCGG------------RGDEGFIRLHAAYATL  91

Query  531  SDPEKRANYDR-SLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            +DP++RA YDR + +RSR  AA     +G R   R+WETDQCW
Sbjct  92   ADPDERARYDRAAAVRSRIRAAPSGSGAGFRP--RRWETDQCW  132



>gb|AFW69512.1| chaperone protein dnaJ 11 [Zea mays]
Length=130

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 15/103 (15%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+  GAS  EIKAAYRRLAR +HPD                  E FIR+HAAY+TL
Sbjct  42   YEVLGVGAGASRCEIKAAYRRLAREVHPDCGG------------RGDEGFIRLHAAYATL  89

Query  531  SDPEKRANYDR-SLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            +DP++RA YDR + +RSR  AA     +G R   R+WETDQCW
Sbjct  90   ADPDERARYDRAAAVRSRIRAAPSGSGAGFRP--RRWETDQCW  130



>ref|XP_006474793.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Citrus 
sinensis]
Length=146

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 69/144 (48%), Gaps = 26/144 (18%)
 Frame = -2

Query  831  SAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYR  652
             A+S      PR VS   PV           TA     SLY+VL +   A+  EIK AYR
Sbjct  27   GAVSGKNKRSPRAVSVEMPV-----------TAPGTGGSLYEVLRVEPTATISEIKTAYR  75

Query  651  RLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPA  472
             LA+V HPD++                 DFI +H AY TLSDP  RA YD SL+  R   
Sbjct  76   SLAKVYHPDLSGNG-------------RDFIEIHNAYETLSDPTARAVYDMSLVGRRTTR  122

Query  471  ASVRGYSGRRS--ALRKWETDQCW  406
             +  G SGR      R+WETDQCW
Sbjct  123  TASFGCSGRSGFHPTRRWETDQCW  146



>gb|AFG54479.1| hypothetical protein 0_11756_01, partial [Pinus taeda]
Length=129

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 14/107 (13%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
             LY VLG+  GAS +EIKA+YRRLAR+ HPD A               A+DF+ +H AY+
Sbjct  34   DLYHVLGLSFGASKEEIKASYRRLARLHHPDAAP-------PGGKDKSAQDFMDIHTAYT  86

Query  537  TLSDPEKRANYDRSLLRSRHPAASVRG---YSGRRSALRKWETDQCW  406
            TL +P  RA+YDR L+ S      VR    Y G++   R WETDQCW
Sbjct  87   TLYNPRSRADYDRRLMTS----MKVRNGGFYGGQQLRARSWETDQCW  129



>ref|XP_010272528.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nelumbo 
nucifera]
Length=159

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 84/151 (56%), Gaps = 23/151 (15%)
 Frame = -2

Query  825  ISAAEVARP-RCVSF--RRP--VSVSASCATAERT---AQTPQSSLYDVLGIRTGASGQE  670
            ISA  V+R  R +SF  R P   ++ A   TA RT   A    ++LY +L ++  AS  E
Sbjct  21   ISAIGVSRSHRSISFTSRGPSKTAIQAFAQTATRTRADAVKKSANLYQILRVKETASPIE  80

Query  669  IKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL  490
            IKAAYR LA+  HPD +  S            A DFI +H AY+TLSDP  RA YD S+ 
Sbjct  81   IKAAYRSLAKQYHPDASFSS---------EPDASDFIEIHNAYATLSDPMARARYDLSIG  131

Query  489  RSR---HPAASVRGYSGRRSALRKWETDQCW  406
             +R   + AA   G+SG+    R+WETDQCW
Sbjct  132  STRRFSYAAAMATGFSGQ---TRRWETDQCW  159



>ref|XP_003563273.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Brachypodium 
distachyon]
Length=132

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 61/105 (58%), Gaps = 23/105 (22%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+  GAS  EIKAAYRRLAR +HPD  SG              E FIR+HAAY+TL
Sbjct  48   YEVLGVGAGASRGEIKAAYRRLAREVHPDAGSGD------------GEGFIRLHAAYATL  95

Query  531  SDPEKRANYDR---SLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            SD ++RA YDR   +L R     AS R         R WETDQCW
Sbjct  96   SDTDQRARYDREVAALFRRAAAPASFR--------RRTWETDQCW  132



>ref|XP_006851920.1| hypothetical protein AMTR_s00041p00169040 [Amborella trichopoda]
 gb|ERN13387.1| hypothetical protein AMTR_s00041p00169040 [Amborella trichopoda]
Length=146

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = -2

Query  777  PVSVSASCATAERTAQT-----PQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASG  613
            P+ +SA+  +AER           SSLY+VL + +GAS  EIKAAYRRL ++ HPDVA  
Sbjct  29   PMHISATYTSAERPPCDCRKVGTTSSLYEVLSLPSGASTAEIKAAYRRLVKLCHPDVAKD  88

Query  612  SVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL  433
            +               FI++H+A +TLSDP+K A+YDR        ++ +   +      
Sbjct  89   T-----------STNAFIKIHSADTTLSDPQKSADYDRKFALRPFDSSPLSPQTSSFRVR  137

Query  432  RKWETDQCW  406
            R WETDQCW
Sbjct  138  RTWETDQCW  146



>gb|EPS66636.1| hypothetical protein M569_08141, partial [Genlisea aurea]
Length=115

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = -2

Query  735  AQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIR  556
            A   + SLY+VL +R GAS  EIK AYR LA++ HPD A    +  S A +A    DFI 
Sbjct  1    ATVDRRSLYEVLRVRRGASQTEIKTAYRTLAKLYHPD-AKSRFLDSSLAMSADAGGDFIE  59

Query  555  VHAAYSTLSDPEKRANYDRSL-LRSRHPAA--SVRGYS---GRRSALRKWETDQCW  406
            +H AY+TLSDP+ RA YD  L +RS  PAA  SVR  S    R    R+WETDQCW
Sbjct  60   IHEAYATLSDPDARALYDCKLDVRSSRPAAVDSVRIRSPAGARFPPYRRWETDQCW  115



>ref|XP_004966466.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Setaria 
italica]
Length=129

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 19/102 (19%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+   AS  EIKAAYRRLAR +HPD                  E FIR+HAAY+TL
Sbjct  47   YEVLGVGAAASRGEIKAAYRRLAREVHPDAGG------------RGDEGFIRLHAAYATL  94

Query  531  SDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            +DP++RA YDRS+ R   PA +V G+  RR     WETDQCW
Sbjct  95   ADPDERARYDRSVARP-APARAV-GFRPRR-----WETDQCW  129



>dbj|BAJ97507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=136

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 72/137 (53%), Gaps = 18/137 (13%)
 Frame = -2

Query  807  ARP-RCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            ARP R    RR V V AS   A    +T     Y+VLG+  GAS  EIKAAYRRLAR +H
Sbjct  15   ARPGRVAGVRRSVVVRASSTVAVAIGRTH----YEVLGLGAGASRGEIKAAYRRLAREVH  70

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL--RSRHPAASVRG  457
            PD   G              E FIR+HAAY+TL+DP++RA YDR +    +         
Sbjct  71   PDAVGGG-----------GDEGFIRLHAAYATLADPDERARYDRDVTCRAAGMTMRRRAA  119

Query  456  YSGRRSALRKWETDQCW  406
             +G     R WETDQCW
Sbjct  120  AAGPAFRRRTWETDQCW  136



>ref|XP_007142460.1| hypothetical protein PHAVU_008G282500g [Phaseolus vulgaris]
 gb|ESW14454.1| hypothetical protein PHAVU_008G282500g [Phaseolus vulgaris]
Length=141

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 75/137 (55%), Gaps = 16/137 (12%)
 Frame = -2

Query  795  CVSFRRPVSVSASCA-TAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVA  619
              + R P SV+   A TA   ++ P +S Y+VL I+  AS  EIK+AYR LA+V HPD  
Sbjct  14   ATTIRSPPSVTTIRAFTATIDSRRP-ASFYEVLRIKQNASSVEIKSAYRNLAKVYHPD--  70

Query  618  SGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASV------RG  457
              S +R     + S   DFI++H AY TLSDP  RA YD SL+  R    S        G
Sbjct  71   --SSLRR----SESDERDFIQIHDAYETLSDPSARAVYDLSLMAVRGGNGSFSSLVAPNG  124

Query  456  YSGRRSALRKWETDQCW  406
             SG     RKWETDQCW
Sbjct  125  SSGLYYQTRKWETDQCW  141



>ref|XP_004500165.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cicer 
arietinum]
Length=161

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 77/134 (57%), Gaps = 19/134 (14%)
 Frame = -2

Query  783  RRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVM  604
            RR VS+ A  A  +   + P +SLY+VL ++ GAS  EIK+AYR LA+V HPD A+  + 
Sbjct  39   RRRVSIRAVAAVVD--TRRPATSLYEVLRLKPGASMTEIKSAYRSLAKVYHPDTAARRL-  95

Query  603  REsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL-----RSRH---PAASVRGYSG  448
                        DFI +  AY TLSDP  RA YD SL+     R+R    PA   R YSG
Sbjct  96   ------PECDDGDFIEIRNAYETLSDPSARAIYDMSLMAAHGGRNRRFTAPATQKR-YSG  148

Query  447  RRSALRKWETDQCW  406
              ++ R+WETDQCW
Sbjct  149  YYTS-RRWETDQCW  161



>ref|NP_001144979.1| uncharacterized protein LOC100278133 [Zea mays]
 gb|ACG44171.1| hypothetical protein [Zea mays]
 tpg|DAA48755.1| TPA: hypothetical protein ZEAMMB73_787136 [Zea mays]
Length=138

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 14/108 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            ++LY+VLG+R GA+G+EIKAAYRRLAR  HPDVA               A +F R+H AY
Sbjct  42   ATLYEVLGLRAGATGREIKAAYRRLARERHPDVAHAP----------GAAAEFARLHDAY  91

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSG---RRSALRKWETDQCW  406
            +TLSDP+ RA YD         A + R +SG    R   R WETDQCW
Sbjct  92   ATLSDPDSRARYDGGGAAPAA-AVARRPWSGAVYGRPRRRTWETDQCW  138



>ref|XP_006377981.1| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|ERP55778.1| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=171

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 90/180 (50%), Gaps = 17/180 (9%)
 Frame = -2

Query  924  YTFIHNSEISTIQFIMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATA  745
            YT    S ++ +  ++ + + S  +  P + S +     A   C  F+   SVS    + 
Sbjct  2    YTTFAPSPLTAVTSVITAAATSNTVQKPILLSPVKT--TAGRSCRGFQIKASVSTFPDST  59

Query  744  ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
               ++    SLYDVL +   AS  EIK+AYR LA++ HPD A  S  R+     +    D
Sbjct  60   RVDSRYSTLSLYDVLRVNPAASQVEIKSAYRSLAKIYHPD-AFLSHDRDHDDEQSDGG-D  117

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR-------GYSGRRSALRKWETDQCW  406
            FI +H+AY TLSDP  RA YD SL      +A+ R       GYSG     R+WETDQCW
Sbjct  118  FIEIHSAYETLSDPTARAVYDLSL------SAAARCFYRRAAGYSGGDYTTRRWETDQCW  171



>ref|XP_003600440.1| Chaperone protein dnaJ [Medicago truncatula]
 ref|XP_003638707.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|AES70691.1| chaperone DnaJ domain protein [Medicago truncatula]
 gb|AFK46742.1| unknown [Medicago truncatula]
Length=161

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 78/148 (53%), Gaps = 20/148 (14%)
 Frame = -2

Query  822  SAAEVARPRC-VSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRL  646
            SA  +A+P   +S RR +S+ A  A  E   + P +SLY+VL +  GAS  EIK+AYR L
Sbjct  25   SARFIAKPSSNISNRRRISIRAVTAAVE--TRRPATSLYEVLRLNPGASAMEIKSAYRSL  82

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL-----RSR  481
            A+V HPD A+  +             DFI +  AY TLSDP  R  YD SL+       R
Sbjct  83   AKVYHPDAAARRLQE-------CNDGDFIEIRNAYETLSDPSSRQIYDLSLMVHGGRNRR  135

Query  480  HPAASVRGYSGRRSAL---RKWETDQCW  406
              AA V     R S     R+WETDQCW
Sbjct  136  FTAAPV--MQKRNSGFYTNRRWETDQCW  161



>ref|XP_009418213.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=127

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 73/135 (54%), Gaps = 25/135 (19%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATAERTAQTPQS---SLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            P C+S R P SV A  A AE T +T +    SLY+VL +R  A+  EIKAAYR +A+  H
Sbjct  15   PVCISVR-PRSVVA-LAAAEGTPETAERRARSLYEVLRVRETATAGEIKAAYRSMAKRFH  72

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYS  451
            PDV +G              +DF+ +  AY  LSDP  RA YD S+ R R  A    G S
Sbjct  73   PDVTAG-----------RGGDDFVEIRRAYEALSDPAARARYDLSIGRWRQGAC---GLS  118

Query  450  GRRSALRKWETDQCW  406
            GR      WETDQCW
Sbjct  119  GR------WETDQCW  127



>ref|XP_009391200.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=148

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 66/117 (56%), Gaps = 32/117 (27%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+   ASGQEIKAAYRRLA   HPDV + +             + F+RVHAAYSTL
Sbjct  49   YEVLGVPASASGQEIKAAYRRLALECHPDVGASA-------------DQFLRVHAAYSTL  95

Query  531  SDPEKRANYDRSLLRSRHPAASVR---------------GYSGRRSALRKWETDQCW  406
            SDP+KRA+YDR L+ S   AA+                    GRR+    WETDQCW
Sbjct  96   SDPDKRADYDRRLVDSAASAAAAALDRRRRSTYSRSTSFSCGGRRT----WETDQCW  148



>ref|XP_008808640.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Phoenix 
dactylifera]
Length=120

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 64/122 (52%), Gaps = 24/122 (20%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
             +LYDVLG+   A+G +IKAAYRRLAR  HPDV              + A++F R+HAAY
Sbjct  6    GTLYDVLGLTARATGGDIKAAYRRLARACHPDVVGAD-------RKGASADEFKRIHAAY  58

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS-----------------ALRKWETDQ  412
            +TLSDPEKRA+YDR L  +           G R                  A R WETDQ
Sbjct  59   ATLSDPEKRADYDRRLAAATAIGRQQWSPRGPRPFSSSASSPSAATSFSGFARRTWETDQ  118

Query  411  CW  406
            CW
Sbjct  119  CW  120



>ref|XP_003551367.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=151

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 75/137 (55%), Gaps = 13/137 (9%)
 Frame = -2

Query  798  RCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVA  619
            R  SF R  SV A  A A  T Q P +SLY+VL +   AS  EIK+AYR LA++ HPD A
Sbjct  22   RSASFPRRSSVRAVAAEAVDT-QRPAASLYEVLRVERDASPTEIKSAYRSLAKLYHPDAA  80

Query  618  SGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL-----RSRHPAASV-RG  457
               V R           DFI++  AY TLSDP  RA YDR+L      R R  + S+ R 
Sbjct  81   ---VQRSPETDGDG---DFIQLRNAYETLSDPSARAMYDRTLAAAHGGRHRRFSTSLSRN  134

Query  456  YSGRRSALRKWETDQCW  406
            +S      R+WETDQCW
Sbjct  135  HSSAFYTTRRWETDQCW  151



>ref|XP_010500313.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Camelina 
sativa]
Length=164

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 65/108 (60%), Gaps = 15/108 (14%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  69   SSLYELLKVNESASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  116

Query  540  STLSDPEKRANYDRSLLRS--RHPAASVRGYSGRRSA-LRKWETDQCW  406
            +TL+DP  RA YD +LLR+  R   A   G SGR  A  R+WETDQCW
Sbjct  117  ATLADPTTRAIYDSTLLRAPRRRVHAGAMGRSGRVYATTRRWETDQCW  164



>ref|XP_010253033.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nelumbo 
nucifera]
Length=140

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 75/144 (52%), Gaps = 14/144 (10%)
 Frame = -2

Query  825  ISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRL  646
             +   V R RC    RP+   A   T  RT      +LY +L ++  AS  EIKAAYRRL
Sbjct  7    FTVGTVLRIRCQH--RPIRALAQ-HTTTRTRTVDAVNLYQILRVKETASPVEIKAAYRRL  63

Query  645  ARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRS-RHPAA  469
            A+  HPDV SG                F+ +  AY+TLSDP  RA YD ++ +  R+ AA
Sbjct  64   AKRYHPDVMSG------FDDDDDEGRGFMEIQNAYATLSDPMTRACYDLTITKGRRYKAA  117

Query  468  SVRGYSGR---RSALRKWETDQCW  406
             V G SGR    S  R+WETDQCW
Sbjct  118  CVLG-SGRGRTMSTTRRWETDQCW  140



>ref|XP_010487083.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Camelina 
sativa]
Length=165

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 65/108 (60%), Gaps = 15/108 (14%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  70   SSLYELLKVNETASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  117

Query  540  STLSDPEKRANYDRSLLRS--RHPAASVRGYSGRRSA-LRKWETDQCW  406
            +TL+DP  RA YD +LLR+  R   A   G SGR  A  R+WETDQCW
Sbjct  118  ATLADPTTRAIYDSTLLRAPRRRVHAGAMGRSGRVYATTRRWETDQCW  165



>ref|XP_003528478.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=141

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 74/134 (55%), Gaps = 20/134 (15%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEV-ARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDV  703
            MAS+S   + S P V  A   A V A    +   RP  +++SC           S LY +
Sbjct  21   MASSSCR-VKSQPIVAFATVTATVEAHSSWIEQPRPSYLNSSC-----------SLLYGI  68

Query  702  LGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDP  523
            LGI  GAS QEIKAAYRRLA+V HPD+A+            S A++F+++H  Y T SDP
Sbjct  69   LGIPVGASNQEIKAAYRRLAKVCHPDMAA-------IDQKNSSADEFMKIHTTYFTFSDP  121

Query  522  EKRANYDRSLLRSR  481
             KRANYD++L   +
Sbjct  122  NKRANYDQNLFWQQ  135



>ref|XP_010465160.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Camelina 
sativa]
Length=164

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 65/108 (60%), Gaps = 15/108 (14%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  69   SSLYELLKVNETASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  116

Query  540  STLSDPEKRANYDRSLLRS--RHPAASVRGYSGRRSA-LRKWETDQCW  406
            +TL+DP  RA YD +LLR+  R   A   G SGR  A  R+WETDQCW
Sbjct  117  ATLADPTTRAIYDSTLLRAPRRRVHAGAMGRSGRVYATTRRWETDQCW  164



>gb|EMT12125.1| Chaperone protein dnaJ 11, chloroplastic [Aegilops tauschii]
Length=106

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 60/104 (58%), Gaps = 13/104 (13%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            YDVLG+  GAS  EIKAAYRR AR +HPD A G              E FI++HAAY+TL
Sbjct  14   YDVLGVSAGASRGEIKAAYRRRAREVHPDAAGG-----------VGDEGFIQLHAAYATL  62

Query  531  SDPEKRANYDRSLLRSRHPAASVR--GYSGRRSALRKWETDQCW  406
            +DP++RA YD  +         +R  G +G     R WETDQCW
Sbjct  63   ADPDERARYDSDMACRAAGTMMMRRAGAAGPSFRRRTWETDQCW  106



>ref|XP_006407237.1| hypothetical protein EUTSA_v10021681mg [Eutrema salsugineum]
 gb|ESQ48690.1| hypothetical protein EUTSA_v10021681mg [Eutrema salsugineum]
Length=159

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 89/170 (52%), Gaps = 25/170 (15%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQ------  721
            I+  ++ + L  SP  G++++  + AR R    R P   ++  A+A+     P       
Sbjct  4    ILVYSAGNSLRFSP--GNSLTQPKTARSRNGKARFPTGATSFRASAQTLNAEPAVMESVR  61

Query  720  ---SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
               SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H
Sbjct  62   RRVSSLYELLKVNETASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIH  109

Query  549  AAYSTLSDPEKRANYDRSL-LRSRHPAASVRGYSGR-RSALRKWETDQCW  406
             AY+TL+DP  RA YD +L  R R   A   G +GR  +  R+WETDQCW
Sbjct  110  KAYATLADPTTRAIYDSTLGARRRRVHAGAMGRAGRVYTTTRRWETDQCW  159



>ref|XP_002437597.1| hypothetical protein SORBIDRAFT_10g030200 [Sorghum bicolor]
 gb|EER88964.1| hypothetical protein SORBIDRAFT_10g030200 [Sorghum bicolor]
Length=137

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 64/107 (60%), Gaps = 19/107 (18%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            Y+VLG+  GAS  EIKAAYRRLAR +HPD                  E FIR+H AY+TL
Sbjct  45   YEVLGVGAGASRCEIKAAYRRLAREVHPDAGG------------RGDEGFIRLHDAYATL  92

Query  531  SDPEKRANYDRSL-----LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            +DP++RA YDR++     +RS   AA     SG R   R+WETDQCW
Sbjct  93   ADPDERARYDRAVAVAAPVRSGSWAAPSGSGSGFRP--RRWETDQCW  137



>ref|XP_010092380.1| Chaperone protein dnaJ 11 [Morus notabilis]
 gb|EXB51056.1| Chaperone protein dnaJ 11 [Morus notabilis]
Length=168

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            +SLY+VL ++  AS  EIK AYR LA+V HPD +S S       +      DFI +H AY
Sbjct  65   NSLYEVLRVKRNASQTEIKTAYRNLAKVYHPDTSSCS------ESEFDDGLDFIAIHNAY  118

Query  540  STLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL-----RKWETDQCW  406
            +TLSDP  RA YD SL     P+A    +S     L     R+WETDQCW
Sbjct  119  ATLSDPAARAKYDLSLGPQYSPSAYSYSFSSGGLGLGFCPTRRWETDQCW  168



>ref|XP_002530622.1| chaperone protein DNAj, putative [Ricinus communis]
 gb|EEF31765.1| chaperone protein DNAj, putative [Ricinus communis]
Length=168

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 62/107 (58%), Gaps = 13/107 (12%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            SLY++L I+  AS  EIK AYR LA++ HPD A    +RE          DF+ +H AY 
Sbjct  72   SLYEILRIKRTASLMEIKTAYRSLAKLYHPDAA----VREDVETDG---RDFMEIHNAYE  124

Query  537  TLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            TLSDP  RA YD SL    R R PA    G++G     R+WETDQCW
Sbjct  125  TLSDPAARALYDLSLDAASRRRRPAV---GFTGGYYPTRRWETDQCW  168



>ref|XP_003519866.1| PREDICTED: uncharacterized protein LOC100780051 [Glycine max]
Length=204

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 68/119 (57%), Gaps = 19/119 (16%)
 Frame = -2

Query  801  PRCVSFRRPVSVSASCATAERTAQT-----PQSS------LYDVLGIRTGASGQEIKAAY  655
            PR V FR  VS + +  T E+  +T     P         LY++LGIR  ASG EIKAAY
Sbjct  81   PRQVRFRLTVSFAIATCTEEQRHKTASYLGPHHGMASCAMLYEILGIRAAASGMEIKAAY  140

Query  654  RRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRH  478
            R LAR+ HPDVA             S A +F+++H AY TL DPEKRA+ DRSL R RH
Sbjct  141  RWLARMCHPDVAP-------MERKESSASEFMKIHVAYCTLLDPEKRASSDRSLFR-RH  191



>ref|XP_008775970.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Phoenix 
dactylifera]
Length=127

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 76/145 (52%), Gaps = 27/145 (19%)
 Frame = -2

Query  834  GSAISAAEVARPRCVSFRRPVSV--SASCATAERTAQTPQSSLYDVLGIRTGASGQEIKA  661
            G   S   +A PR    R+PV     A  ATA R A+    SLY+VL ++  AS  EIKA
Sbjct  8    GGLSSCPHLASPR---RRKPVGAVAMAEVATAVRRAK----SLYEVLRVKETASAVEIKA  60

Query  660  AYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSR  481
            AYR +A+  HPDVA  +              DF+ +H AY TLSDP  RA YD S+ R  
Sbjct  61   AYRSMAKRFHPDVAPAA-----------GGADFLEIHRAYKTLSDPTARARYDISIGRLG  109

Query  480  HPAASVRGYSGRRSALRKWETDQCW  406
             PAA        RS  R+WETDQCW
Sbjct  110  FPAAGP-----LRS--RRWETDQCW  127



>ref|XP_006346096.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Solanum 
tuberosum]
Length=161

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 87/169 (51%), Gaps = 26/169 (15%)
 Frame = -2

Query  867  SASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSAS------CATAERTAQTPQS----  718
            S + + SSPF  S   ++  A     S RR + +  S      CA+A   A+ P      
Sbjct  4    SLNLISSSPFPFSVHKSSYSAAAPVGSNRRSLFIGKSNRRGTICASA--VAEAPMMMERR  61

Query  717  --SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAA  544
              SLY+VL ++  AS +EIKAAYR LA++ HPD AS           +S   DFI +H A
Sbjct  62   SVSLYEVLRVKRDASPKEIKAAYRNLAKLYHPDSAS-------LPEESSDGRDFIEIHDA  114

Query  543  YSTLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            Y TLSDP  RA YD  L    R R  A SV G+  R    R+WETDQCW
Sbjct  115  YVTLSDPSARALYDLKLSVGSRRRGFARSVDGF--RIYPTRRWETDQCW  161



>ref|XP_007146684.1| hypothetical protein PHAVU_006G060700g [Phaseolus vulgaris]
 gb|ESW18678.1| hypothetical protein PHAVU_006G060700g [Phaseolus vulgaris]
Length=152

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 70/127 (55%), Gaps = 13/127 (10%)
 Frame = -2

Query  759  SCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMR---Esaa  589
            + AT     + P  SLY VL I   AS  EIK+AYR LA+V HPD    +V+R   ++  
Sbjct  30   AVATEAVQVRLPAPSLYQVLRIERDASPTEIKSAYRSLAKVYHPD----AVVRHSTDNDR  85

Query  588  aaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL------RSRHPAASVRGYSGRRSALRK  427
            A  +  EDFI++ +AY TLSDP  RA YD +L         R P    R +S    A R+
Sbjct  86   AGEAADEDFIQIRSAYETLSDPSARAMYDLTLTAVHGGRHRRFPVPLSRNHSSTFYATRR  145

Query  426  WETDQCW  406
            WETDQCW
Sbjct  146  WETDQCW  152



>gb|KHN21275.1| Chaperone protein dnaJ 11, chloroplastic [Glycine soja]
Length=113

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 77/130 (59%), Gaps = 22/130 (17%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVL  700
            MAS+S   + S P V  A + AE AR   +   RP  +++SC           SS YD+L
Sbjct  1    MASSSCC-VKSWPIV--AFATAE-ARSSWMEQPRPSYLNSSC-----------SSPYDIL  45

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            GI  GAS QEIKAAYRRLARV   DVA  ++ R+        A++F+++HAAYSTLSDP 
Sbjct  46   GIPVGASNQEIKAAYRRLARVCQTDVA--AIDRK-----NLSADEFMKIHAAYSTLSDPN  98

Query  519  KRANYDRSLL  490
              ANYD SL 
Sbjct  99   MCANYDWSLF  108



>ref|XP_006387084.1| hypothetical protein POPTR_1909s00200g [Populus trichocarpa]
 gb|ABK95649.1| unknown [Populus trichocarpa]
 gb|ERP45998.1| hypothetical protein POPTR_1909s00200g [Populus trichocarpa]
Length=171

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 89/180 (49%), Gaps = 17/180 (9%)
 Frame = -2

Query  924  YTFIHNSEISTIQFIMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATA  745
            YT    S ++ +  ++ + + S  +  P + S +     A   C   +   SVS    + 
Sbjct  2    YTTFAPSPLTAVTSVITAAATSNTVQKPILLSPVKT--TAGRSCRGLQIKASVSTFPDST  59

Query  744  ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
               ++    SLYDVL +   AS  EIK+AYR LA++ HPD A  S  R+     +    D
Sbjct  60   RVDSRYSTLSLYDVLRVNPAASQVEIKSAYRSLAKIYHPD-AFLSHDRDHDDEQSDGG-D  117

Query  564  FIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR-------GYSGRRSALRKWETDQCW  406
            FI +H+AY TLSDP  RA YD SL      +A+ R       GYSG     R+WETDQCW
Sbjct  118  FIEIHSAYETLSDPTARAVYDLSL------SAAARCFYRRAAGYSGGDYTTRRWETDQCW  171



>ref|XP_006452722.1| hypothetical protein CICLE_v10009810mg [Citrus clementina]
 gb|ESR65962.1| hypothetical protein CICLE_v10009810mg [Citrus clementina]
 gb|KDO74035.1| hypothetical protein CISIN_1g042521mg [Citrus sinensis]
Length=147

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 69/145 (48%), Gaps = 27/145 (19%)
 Frame = -2

Query  831  SAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYR  652
             A+S      PR VS   PV           TA     SLY+VL +   A+  EIK AYR
Sbjct  27   GAVSGKNKRSPRAVSVEMPV-----------TAPGTGGSLYEVLRVEPTATISEIKTAYR  75

Query  651  RLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLL-RSRHP  475
             LA+V HPD++                 DFI +H AY TLSDP  RA YD SL+ R R  
Sbjct  76   SLAKVYHPDLSGNG-------------RDFIEIHNAYETLSDPTARAVYDMSLVGRRRTT  122

Query  474  AASVRGYSGRRS--ALRKWETDQCW  406
              +  G SG       R+WETDQCW
Sbjct  123  RTASFGCSGGSGFHPTRRWETDQCW  147



>emb|CDY43357.1| BnaA01g29880D [Brassica napus]
Length=159

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 88/170 (52%), Gaps = 25/170 (15%)
 Frame = -2

Query  882  IMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQ------  721
            I+ +++A+ L  SP  G+++   +  R    S R P   ++  A+A+     P       
Sbjct  4    ILVNSAANSLRFSP--GASLPHPKPTRSHNGSARFPTGANSFRASAQTLNAEPTVTESVR  61

Query  720  ---SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVH  550
               SSLYD+L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H
Sbjct  62   RRASSLYDLLKVNETASLPEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIH  109

Query  549  AAYSTLSDPEKRANYDRSL-LRSRHPAASVRGYSGR-RSALRKWETDQCW  406
             AY+TL+DP  RA YD +L  R R       G +GR  S  R+WETDQCW
Sbjct  110  KAYATLADPTTRAIYDSTLGARRRRVQVGAMGRAGRVYSTTRRWETDQCW  159



>gb|ACN40652.1| unknown [Picea sitchensis]
Length=177

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 81/163 (50%), Gaps = 30/163 (18%)
 Frame = -2

Query  843  PFVGSAISAAEVARPRCVSFRR-PVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEI  667
            P  GS+  +  +   RC   R    SV A  A +++       +LY+VL I   A+ ++I
Sbjct  28   PPAGSSTRSTNLRFRRCFKMRAVQASVGAEAAISDQR-HMESRNLYEVLAISPAATAKDI  86

Query  666  KAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLR  487
            K AYR+LAR  HPD A+    +          + F+R+H AY TLSDP  RA YDR LL 
Sbjct  87   KRAYRKLAREFHPDHAASPQDKN------ESTQMFLRIHNAYVTLSDPHDRAQYDRQLL-  139

Query  486  SRHPAASVRGYSGR--------RSAL--------RKWETDQCW  406
                 ASV+G++G+        RS          R WE+DQCW
Sbjct  140  -----ASVQGFTGQTWSKATNGRSPTYKYYGHMGRSWESDQCW  177



>ref|XP_011022963.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=142

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 73/131 (56%), Gaps = 12/131 (9%)
 Frame = -2

Query  783  RRPVSVSASCAT--AERTAQTP---QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVA  619
            RR VS+ A+ +T  AE     P     SLY++L ++  AS  EIK A+R LA+V HPDV 
Sbjct  19   RRGVSIKAAVSTLAAESFRVDPGRKSLSLYEILQVKRTASLTEIKGAFRSLAKVYHPDV-  77

Query  618  SGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS  439
            SGS   E          DF+ +  AY TLSDP  RA YD SL  S      VR +SG  S
Sbjct  78   SGSDGGEQLDGL-----DFVEICNAYETLSDPAARAMYDLSLGYSSSRQRPVR-FSGGYS  131

Query  438  ALRKWETDQCW  406
              R+WETDQCW
Sbjct  132  MNRRWETDQCW  142



>ref|XP_003551346.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=132

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 77/130 (59%), Gaps = 22/130 (17%)
 Frame = -2

Query  879  MASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVL  700
            MAS+S   + S P V  A + AE AR   +   RP  +++SC           SS YD+L
Sbjct  20   MASSSCC-VKSWPIV--AFATAE-ARSSWMEQPRPSYLNSSC-----------SSPYDIL  64

Query  699  GIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPE  520
            GI  GAS QEIKAAYRRLARV   DVA  ++ R+        A++F+++HAAYSTLSDP 
Sbjct  65   GIPVGASNQEIKAAYRRLARVCQTDVA--AIDRK-----NLSADEFMKIHAAYSTLSDPN  117

Query  519  KRANYDRSLL  490
              ANYD SL 
Sbjct  118  MCANYDWSLF  127



>ref|XP_002309904.1| hypothetical protein POPTR_0007s03990g [Populus trichocarpa]
 gb|EEE90354.1| hypothetical protein POPTR_0007s03990g [Populus trichocarpa]
Length=142

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 73/131 (56%), Gaps = 12/131 (9%)
 Frame = -2

Query  783  RRPVSVSASCAT--AERTAQTP---QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVA  619
            RR VS+ A+ +T  AE     P     SLY++L ++  AS  EIK A+R LA+V HPDV 
Sbjct  19   RRGVSIKAAVSTLAAESFRVDPGRKSLSLYEILQVKRTASLTEIKGAFRSLAKVYHPDV-  77

Query  618  SGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRS  439
            SGS   E          DF+ +  AY TLSDP  RA YD SL  S      VR +SG  S
Sbjct  78   SGSDGGEQLDGL-----DFVEICNAYETLSDPAARAMYDLSLGYSSSRKRPVR-FSGGYS  131

Query  438  ALRKWETDQCW  406
              R+WETDQCW
Sbjct  132  LNRRWETDQCW  142



>gb|EYU27496.1| hypothetical protein MIMGU_mgv1a017725mg [Erythranthe guttata]
Length=127

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 76/126 (60%), Gaps = 6/126 (5%)
 Frame = -2

Query  768  VSASCATAERTAQTP-QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsa  592
            V AS A+    +  P +  LY+VL +R  AS  EIK AYR LA++ HPD A+   +  SA
Sbjct  3    VRASVASVAHPSAAPDRRCLYEVLRVRRNASPVEIKTAYRTLAKLYHPD-ATSRFLDSSA  61

Query  591  aaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGY----SGRRSALRKW  424
            AA++S   DFI +H AY+TLSDP+ RA YD +L  +     S  GY     GR  + R+W
Sbjct  62   AASSSDGGDFIEIHNAYATLSDPDARAAYDFNLNVNSQRRFSTGGYRSPGRGRFQSTRRW  121

Query  423  ETDQCW  406
            ETDQCW
Sbjct  122  ETDQCW  127



>ref|XP_009780405.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
sylvestris]
Length=162

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 68/115 (59%), Gaps = 13/115 (11%)
 Frame = -2

Query  732  QTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRV  553
            +T  +SLY+VL ++  AS +EIKAAYR LA++ HPD AS   + E ++       +FI +
Sbjct  55   RTRPASLYEVLRVKRDASAKEIKAAYRNLAKLYHPDAAS---LPEESSDGL----NFIEI  107

Query  552  HAAYSTLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRSAL---RKWETDQCW  406
            H AY+TLSDP  RA YD  L    R R    S  GY   RS     R+WETDQCW
Sbjct  108  HDAYATLSDPSSRALYDLKLSVGSRRRGFGHSSNGYRISRSEFYPTRRWETDQCW  162



>emb|CDP13660.1| unnamed protein product [Coffea canephora]
Length=232

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = -2

Query  732  QTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRV  553
            +T   +LY VL ++  AS  EIK AYR LA++ HPDVA  +      +       DFI +
Sbjct  119  RTKPGNLYQVLRVKQNASQVEIKTAYRTLAKIYHPDVAPVAAKHPEESLDGC---DFIEI  175

Query  552  HAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSG----RRS----ALRKWETDQCW  406
            H AYSTLSDP+ RA YD +L     P      YS     RR     A R+WETDQCW
Sbjct  176  HKAYSTLSDPDSRAVYDLTLTIGSQPQPLGVNYSAPGGFRRHAGFYATRRWETDQCW  232



>emb|CDY23588.1| BnaC05g40060D [Brassica napus]
Length=161

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 64/107 (60%), Gaps = 14/107 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  67   SSLYELLKVNETASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  114

Query  540  STLSDPEKRANYDRSLL-RSRHPAASVRGYSGR-RSALRKWETDQCW  406
            +TL+DP  RA YD +L+ R R   A   G +GR  +  R+WETDQCW
Sbjct  115  ATLADPTTRAIYDSTLVTRRRRVHAGAMGRAGRVYTTTRRWETDQCW  161



>ref|XP_011000339.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=171

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 86/176 (49%), Gaps = 9/176 (5%)
 Frame = -2

Query  924  YTFIHNSEISTIQFIMASTSASFLLSSPFVGSAISAAEVARPRCVSFRRPVSVSASCATA  745
            YT    S ++    ++ + + S  +  P + S +     A   C  F+   SVS    + 
Sbjct  2    YTAFAPSPLTAATSVITAAATSNTVQKPILLSPVKT--TADRSCRRFQIKASVSTFPDST  59

Query  744  ERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAED  565
               ++    SLYD+L +   AS  EIK+AYR LA++ HPDV              S   D
Sbjct  60   RVDSRYSTLSLYDILRVNPAASQVEIKSAYRSLAKIYHPDVFLS--HDRDHDDEQSDGGD  117

Query  564  FIRVHAAYSTLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRSALRKWETDQCW  406
            FI +H+AY TLSDP  RA YD SL    R  +  A+V  YSG     R+WETDQCW
Sbjct  118  FIEIHSAYETLSDPAARAVYDLSLSAAARCFYRRAAV--YSGGDYTTRRWETDQCW  171



>ref|XP_002300579.2| hypothetical protein POPTR_0001s47360g [Populus trichocarpa]
 gb|EEE85384.2| hypothetical protein POPTR_0001s47360g [Populus trichocarpa]
Length=164

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 67/128 (52%), Gaps = 7/128 (5%)
 Frame = -2

Query  786  FRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSV  607
            FR   SVS    T    ++    SLY++L +   AS  EIK AYR LA+V HPD     +
Sbjct  43   FRIKASVSTFPDTIRVDSRNSSLSLYEILRVNPTASQVEIKTAYRSLAKVYHPD---AML  99

Query  606  MREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSL-LRSRHPAASVRGYSGRRSALR  430
             R+   +      DFI +H AY TLSDP  RA YD SL   +R       GYSG     R
Sbjct  100  DRDDEPSEGV---DFIEIHNAYETLSDPAARAVYDMSLSAAARDFYRRAVGYSGGYYTTR  156

Query  429  KWETDQCW  406
            +WETDQCW
Sbjct  157  RWETDQCW  164



>ref|XP_006432056.1| hypothetical protein CICLE_v10003690mg, partial [Citrus clementina]
 gb|ESR45296.1| hypothetical protein CICLE_v10003690mg, partial [Citrus clementina]
Length=127

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 66/125 (53%), Gaps = 19/125 (15%)
 Frame = -2

Query  765  SASCATAERTAQTP--QSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsa  592
            S    + E +  TP  + SLY+VL + T     EIK AY+ LA+V HPD++S        
Sbjct  17   SPCVVSVEMSVTTPGTRGSLYEVLRVETTMMISEIKMAYQSLAKVYHPDLSSND------  70

Query  591  aaaaspAEDFIRVHAAYSTLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRSALRKWE  421
                   +DFI++H AY TLSDP  RA YD SL   +R+R  +    G SG     R WE
Sbjct  71   -------QDFIKIHYAYETLSDPTARAVYDMSLVSRMRTRTASFGCSGRSGFHPTHR-WE  122

Query  420  TDQCW  406
            T QCW
Sbjct  123  THQCW  127



>gb|KDP32638.1| hypothetical protein JCGZ_13188 [Jatropha curcas]
Length=158

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 68/132 (52%), Gaps = 14/132 (11%)
 Frame = -2

Query  783  RRPVSVSASCATAER---TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASG  613
            RR ++V AS +T       +     SLY++L ++  AS  EIK AYR LA+V HPD    
Sbjct  35   RRRINVKASVSTFADPIPVSSGKTMSLYEILKVKQTASQMEIKTAYRNLAKVYHPDAIHE  94

Query  612  SVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR---GYSGRR  442
             V  +          DFI +H AY TLSDP  RA YD SL  + +     R   G++   
Sbjct  95   EVQSD--------GRDFIEIHNAYETLSDPAARAMYDLSLEAASNYCQRRRTGFGFTDGY  146

Query  441  SALRKWETDQCW  406
               R+WETDQCW
Sbjct  147  YPTRRWETDQCW  158



>ref|XP_004500166.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cicer 
arietinum]
Length=161

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 67/115 (58%), Gaps = 17/115 (15%)
 Frame = -2

Query  726  PQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHA  547
            P +SLY+VL +  GAS  EIK+AYR LA+V HPD A+  +             DFI +  
Sbjct  56   PATSLYEVLRLEPGASMTEIKSAYRSLAKVYHPDTAARRL-------PECDDGDFIEIRN  108

Query  546  AYSTLSDPEKRANYDRSLL-----RSRH---PAASVRGYSGRRSALRKWETDQCW  406
            AY TLSDP  RA YD SL+     R+R    PA   R YSG  ++ R+WETDQCW
Sbjct  109  AYKTLSDPSARAIYDLSLMAVHGGRNRRFTAPATQKR-YSGYYTS-RRWETDQCW  161



>gb|ABK26231.1| unknown [Picea sitchensis]
Length=177

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 81/172 (47%), Gaps = 35/172 (20%)
 Frame = -2

Query  852  LSSPFVGSAISAAEVA-RPRCVSFRRPVSVSA--SCATAERTAQTP----QSSLYDVLGI  694
            LS+  VG     AE + R R V FRR   V A  + A AE     P      +LY+VL I
Sbjct  18   LSAGHVGRQTPPAEWSTRSRNVRFRRCFKVRAMQASAGAEAVISEPGHMESKNLYEVLEI  77

Query  693  RTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKR  514
             T A+ ++IK AYR+LAR  HPD A     +          + F+R+H AY TLSDP  R
Sbjct  78   STAATAKDIKRAYRKLAREFHPDQAISPEGKN------ERTQMFLRIHNAYVTLSDPHDR  131

Query  513  ANYDRSLLRSRHPAASVRGYSGRRSAL----------------RKWETDQCW  406
            A YD  L         VRG++G+  +                 R WETDQCW
Sbjct  132  AQYDVQLW------GQVRGFAGQTWSKVTNGRAPAYRYCGRMGRSWETDQCW  177



>gb|EPS72425.1| hypothetical protein M569_02347, partial [Genlisea aurea]
Length=110

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = -2

Query  717  SLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYS  538
            SLY+VL ++  AS  EIK AYR LA++ HPD AS   +   +++      DFI +H AY+
Sbjct  13   SLYEVLRVKRDASQTEIKTAYRTLAKLYHPD-ASSRFLDSISSSPDDGGGDFIEIHNAYA  71

Query  537  TLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSALRKWETDQCW  406
            TLSDP+ RA YD  L++S     S++         R+WETDQCW
Sbjct  72   TLSDPDARAVYDCDLMKS-----SIQNRGRGPFRFRRWETDQCW  110



>gb|ABK21524.1| unknown [Picea sitchensis]
 gb|ABK23896.1| unknown [Picea sitchensis]
Length=177

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 81/160 (51%), Gaps = 30/160 (19%)
 Frame = -2

Query  834  GSAISAAEVARPRCVSFRR-PVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAA  658
            GS+  +  +   RC   R    SV A  A +++  +    +LY+VL I   A+ ++IK A
Sbjct  31   GSSTRSTNLRFRRCFKMRAVQASVGAEAAISDQR-RMESRNLYEVLAISPAATAKDIKRA  89

Query  657  YRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRH  478
            YR+LAR  HPD A+    +          + F+R+H AY TLSDP  RA YDR LL    
Sbjct  90   YRKLAREFHPDHAASPQGKN------ESTQMFLRIHNAYVTLSDPHDRAQYDRQLL----  139

Query  477  PAASVRGYSGR--------RSAL--------RKWETDQCW  406
              ASV+G++G+        RS          R WE+DQCW
Sbjct  140  --ASVQGFTGQTWSKATNGRSPTYKYYGHMGRSWESDQCW  177



>ref|XP_011097800.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Sesamum 
indicum]
Length=143

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 70/124 (56%), Gaps = 15/124 (12%)
 Frame = -2

Query  753  ATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaasp  574
            A  E +    + SLY+VL ++  AS  EIK AYR LA++ HPD  S          +++ 
Sbjct  27   AVPEVSPAVDRRSLYEVLRVKRNASQTEIKTAYRTLAKLYHPDATS------RFMDSSAD  80

Query  573  AEDFIRVHAAYSTLSDPEKRANYDRSL-LRSRHPAASV-------RGYSGRRSALRKWET  418
              DFI +H AY+TLSDP+ RA YD SL + SR P ++V        G  G  S  R+WET
Sbjct  81   GSDFIEIHNAYATLSDPDARAVYDFSLNVDSRRPWSTVGASEFPSPGLGGCYST-RRWET  139

Query  417  DQCW  406
            DQCW
Sbjct  140  DQCW  143



>ref|XP_009632020.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=165

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 65/115 (57%), Gaps = 13/115 (11%)
 Frame = -2

Query  732  QTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRV  553
            +T  +SLY+VL ++  AS +EIK AYR LA++ HPD AS           +S   +FI +
Sbjct  58   RTRPASLYEVLRVKRDASAKEIKVAYRNLAKLYHPDAAS-------LPEESSNDRNFIEI  110

Query  552  HAAYSTLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRSAL---RKWETDQCW  406
            H AY+TLSDP  RA YD  L    R R    S  G+   RS     R+WETDQCW
Sbjct  111  HDAYATLSDPSARALYDLKLSVVSRRRDFGHSSDGFRINRSEFYPTRRWETDQCW  165



>ref|XP_009146535.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Brassica 
rapa]
Length=159

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 14/107 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  65   SSLYELLKVNETASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  112

Query  540  STLSDPEKRANYDRSLL-RSRHPAASVRGYSGR-RSALRKWETDQCW  406
            +TL+DP  RA YD +L+ R R       G +GR  +  R+WETDQCW
Sbjct  113  ATLADPTTRAIYDSTLVTRRRRVHGGAMGRAGRVYTTTRRWETDQCW  159



>ref|XP_004296124.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=151

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 68/128 (53%), Gaps = 12/128 (9%)
 Frame = -2

Query  774  VSVSASCATAER--TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMR  601
            VSV A   T  R   A    +SLY+VL +RT AS  EIK+AYR LA++ HPD +S S   
Sbjct  31   VSVRAFAETERRPMIASPTPASLYEVLRVRTNASQTEIKSAYRSLAKLHHPDASSSS---  87

Query  600  EsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVRGYSGRRSAL---R  430
                   S   +FI +H AY+TLSDP  RA YD SL         +     R +     R
Sbjct  88   ----ETESDGREFIEIHNAYATLSDPAARAMYDLSLSGRVEFDRGISAVGFRPNGFYSTR  143

Query  429  KWETDQCW  406
            +WETDQCW
Sbjct  144  RWETDQCW  151



>ref|XP_009413778.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=176

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 65/124 (52%), Gaps = 34/124 (27%)
 Frame = -2

Query  711  YDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTL  532
            YD LG+  GASGQEIK +YRRLA   HPDV +            + A++F+RVHAAY+TL
Sbjct  65   YDTLGVSPGASGQEIKTSYRRLALECHPDVVA-------TGRRGASADEFMRVHAAYATL  117

Query  531  SDPEKRANYDRSL-----LRSRH-----------------PAASVRGYSGRRSALRKWET  418
            SDP KRA YDR L     +   H                    S  GY GRR+    WET
Sbjct  118  SDPVKRAYYDRELTAAAAILVHHRRSEPAPSPSPSPLAYARCTSYPGY-GRRT----WET  172

Query  417  DQCW  406
            DQCW
Sbjct  173  DQCW  176



>ref|XP_002307840.1| hypothetical protein POPTR_0006s00340g [Populus trichocarpa]
 gb|EEE91363.1| hypothetical protein POPTR_0006s00340g [Populus trichocarpa]
Length=150

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 20/133 (15%)
 Frame = -2

Query  780  RPVSVSASCATAER---TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGS  610
            R   V+AS AT       A++ +++LY++L +   AS  EIKAAYR LA++ HPD+    
Sbjct  30   RAFVVTASAATISPDSVKAKSSRNTLYEILCVDQTASQAEIKAAYRSLAKLHHPDITPSD  89

Query  609  VMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR-----GYSGR  445
                         +DFI +H AY+TLSDP  RA+YD S +R+  P    R      + G 
Sbjct  90   ----------RDGQDFIDIHNAYATLSDPAARASYDLS-IRASAPCYRFRYSTSNTFQGH  138

Query  444  RSALRKWETDQCW  406
            R   R+WETDQCW
Sbjct  139  RPT-RRWETDQCW  150



>ref|XP_006300220.1| hypothetical protein CARUB_v10016456mg [Capsella rubella]
 gb|EOA33118.1| hypothetical protein CARUB_v10016456mg [Capsella rubella]
Length=155

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 63/107 (59%), Gaps = 14/107 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  61   SSLYELLKVNETASLPEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  108

Query  540  STLSDPEKRANYDRSLLRSRHPA-ASVRGYSGR-RSALRKWETDQCW  406
            +TL+DP  RA YD SL   R    A   G SGR  ++ R+WETDQCW
Sbjct  109  ATLADPTTRAIYDSSLRTPRRRVHAGAMGRSGRVYTSTRRWETDQCW  155



>ref|XP_011005773.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Populus 
euphratica]
Length=150

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 72/129 (56%), Gaps = 20/129 (16%)
 Frame = -2

Query  768  VSASCATAER---TAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMRE  598
            V+AS AT       A++ +++LY++L +   AS  EIKAAYR LA++ HPD+        
Sbjct  34   VTASAATISPDPVKAKSSRNTLYEILCVDQTASQAEIKAAYRSLAKLHHPDITPSD----  89

Query  597  saaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSRHPAASVR-----GYSGRRSAL  433
                     +DFI +H AY+TLSDP  RA+YD S +R+  P    R      + G R   
Sbjct  90   ------RDGQDFIDIHNAYATLSDPAARASYDLS-IRASAPCYRFRYSTSNTFQGHRPT-  141

Query  432  RKWETDQCW  406
            R+WETDQCW
Sbjct  142  RRWETDQCW  150



>ref|XP_004244015.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Solanum 
lycopersicum]
Length=161

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 72/131 (55%), Gaps = 12/131 (9%)
 Frame = -2

Query  789  SFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGS  610
            S RR    +++ A A    +    SLY++L ++  AS +EIKAAYR LA++ HPD AS  
Sbjct  40   SNRRGRICASAVAEAPMMMEKRSVSLYEILRVKRDASPKEIKAAYRNLAKLYHPDSAS--  97

Query  609  VMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSL---LRSRHPAASVRGYSGRRS  439
                     +S   +FI +H AY TLSDP  RA YD  L    R R  A SV G+  R  
Sbjct  98   -----LPEESSDGRNFIEIHDAYVTLSDPSARALYDLKLSVGSRRRGFARSVDGF--RIY  150

Query  438  ALRKWETDQCW  406
              R+WETDQCW
Sbjct  151  PTRRWETDQCW  161



>ref|XP_009339274.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Pyrus x 
bretschneideri]
Length=144

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 80/154 (52%), Gaps = 24/154 (16%)
 Frame = -2

Query  840  FVGSAISAAEVARPRCVSFRRPVSVSASCATAERTAQTPQSSLYDVLGIRTGASGQEIKA  661
            F  +A    ++ +P+  SF+   S + +   A+        SLYDVL +   AS  EIK+
Sbjct  6    FPPTANPLPKMPQPQRRSFQIKASSAQAFTEAKLRPGAAAGSLYDVLRVTANASQSEIKS  65

Query  660  AYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRSR  481
            AYR LA+  HPD ASGS          S  +DFI++H AY+TLSDP  RA YD SL    
Sbjct  66   AYRGLAKEYHPD-ASGS---------ESDGQDFIQIHNAYATLSDPAARAVYDMSL----  111

Query  480  HPAASVRGYSGRRS---------ALRKWETDQCW  406
              AA +     RRS         + R+WETDQCW
Sbjct  112  -GAAHIDFNRRRRSVGFRADGFYSTRRWETDQCW  144



>ref|XP_002884960.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61219.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=157

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 74/138 (54%), Gaps = 25/138 (18%)
 Frame = -2

Query  783  RRPVSVSASCATAERTAQTPQ---------SSLYDVLGIRTGASGQEIKAAYRRLARVLH  631
            R P  VS+  A+A+     P          SSLY++L +   AS  EIK AYR LA+V H
Sbjct  33   RFPTGVSSFKASAQTLNAEPAVTESVRRRVSSLYELLKVNETASLTEIKTAYRSLAKVYH  92

Query  630  PDVASGSVMREsaaaaaspAEDFIRVHAAYSTLSDPEKRANYDRSLLRS--RHPAASVRG  457
            PD AS S  R           DF+ +H AY+TL+DP  RA YD S LR+  R   A   G
Sbjct  93   PD-ASESDGR-----------DFMEIHKAYATLADPTTRAIYD-STLRAPRRRVHAGAMG  139

Query  456  YSGR-RSALRKWETDQCW  406
             SGR  +  R+WETDQCW
Sbjct  140  RSGRVYTTTRRWETDQCW  157



>ref|NP_187939.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
 dbj|BAB02800.1| DnaJ-like protein [Arabidopsis thaliana]
 gb|AAM64632.1| DnaJ protein, putative [Arabidopsis thaliana]
 gb|AAP88343.1| At3g13310 [Arabidopsis thaliana]
 gb|AEE75332.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
Length=157

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 63/107 (59%), Gaps = 14/107 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  63   SSLYELLKVNETASLTEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  110

Query  540  STLSDPEKRANYDRSL-LRSRHPAASVRGYSGRRSA-LRKWETDQCW  406
            +TL+DP  RA YD +L +  R   A   G SGR  A  R+WETDQCW
Sbjct  111  ATLADPTTRAIYDSTLRVPRRRVHAGAMGRSGRVYATTRRWETDQCW  157



>emb|CDY24196.1| BnaC01g37760D [Brassica napus]
Length=159

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 62/107 (58%), Gaps = 14/107 (13%)
 Frame = -2

Query  720  SSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMREsaaaaaspAEDFIRVHAAY  541
            SSLY++L +   AS  EIK AYR LA+V HPD AS S  R           DF+ +H AY
Sbjct  65   SSLYELLKVNETASLPEIKTAYRSLAKVYHPD-ASESDGR-----------DFMEIHKAY  112

Query  540  STLSDPEKRANYDRSL-LRSRHPAASVRGYSGR-RSALRKWETDQCW  406
            +TL+DP  RA YD +L  R R       G +GR  S  R+WETDQCW
Sbjct  113  ATLADPTTRAIYDSTLGARRRRVQVGAMGRAGRAYSTTRRWETDQCW  159



>ref|XP_003530823.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine 
max]
Length=156

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 68/126 (54%), Gaps = 13/126 (10%)
 Frame = -2

Query  753  ATAERTAQT--PQSSLYDVLGIRTGASGQEIKAAYRRLARVLHPDVASGSVMR--Esaaa  586
            A AE   +T  P +SLYDVL +   AS  EIK+AYR LA++LHPD A   V R  E+   
Sbjct  34   AVAEEAVETRRPAASLYDVLRVERDASPTEIKSAYRSLAKLLHPDAA---VRRSPETDGG  90

Query  585  aaspAEDFIRVHAAYSTLSDPEKRANYDRSLL------RSRHPAASVRGYSGRRSALRKW  424
                  DFI++  AY TLSDP  +A YD +L         R     +R +S      R+W
Sbjct  91   GGYVDGDFIQLRNAYETLSDPSAKAIYDMTLAAPHGGRHRRFSTPLIRNHSSAFYTTRRW  150

Query  423  ETDQCW  406
            ETDQCW
Sbjct  151  ETDQCW  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295101849455