BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31676_g1_i1 len=939 path=[1:0-938]

Length=939
                                                                      Score     E

ref|XP_009626892.1|  PREDICTED: expansin-like B1                        317   3e-104   
ref|XP_006359263.1|  PREDICTED: expansin-like B1-like                   315   1e-103   
ref|XP_004241981.1|  PREDICTED: expansin-like B1                        313   1e-102   
ref|XP_009785593.1|  PREDICTED: expansin-like B1                        298   3e-96    
ref|XP_004245822.1|  PREDICTED: expansin-like B1                        256   3e-80    
ref|XP_006359218.1|  PREDICTED: expansin-like B1-like                   251   1e-78    
emb|CDP08340.1|  unnamed protein product                                246   1e-76    
emb|CDP08341.1|  unnamed protein product                                244   8e-76    
ref|XP_002531220.1|  Major pollen allergen Ory s 1 precursor, put...    240   2e-74    Ricinus communis
ref|XP_011070248.1|  PREDICTED: expansin-like B1                        236   1e-72    
gb|AFK45939.1|  unknown                                                 236   1e-72    
ref|XP_002531221.1|  Major pollen allergen Ory s 1 precursor, put...    236   1e-72    Ricinus communis
ref|XP_009378390.1|  PREDICTED: expansin-like B1                        236   1e-72    
ref|XP_011031969.1|  PREDICTED: expansin-like B1                        234   7e-72    
ref|XP_007209504.1|  hypothetical protein PRUPE_ppa010376mg             234   1e-71    
ref|XP_006385562.1|  Expansin-related protein 1 precursor               233   3e-71    
ref|XP_006470179.1|  PREDICTED: expansin-like B1-like                   232   3e-71    
gb|KDP39949.1|  hypothetical protein JCGZ_03480                         232   3e-71    
ref|XP_006431472.1|  hypothetical protein CICLE_v10002142mg             233   7e-71    
ref|XP_008340760.1|  PREDICTED: expansin-like B1                        231   2e-70    
ref|XP_002273896.1|  PREDICTED: expansin-like B1                        230   3e-70    Vitis vinifera
ref|XP_008238372.1|  PREDICTED: expansin-like B1                        229   4e-70    
ref|XP_007039691.1|  Expansin-like B1, BETA 3.1,EXLB1                   229   5e-70    
ref|XP_010246083.1|  PREDICTED: expansin-like B1 isoform X1             229   6e-70    
ref|XP_002269095.2|  PREDICTED: expansin-like B1                        229   7e-70    Vitis vinifera
ref|XP_006368949.1|  Expansin-related protein 1 precursor               228   1e-69    
ref|XP_002270175.2|  PREDICTED: expansin-like B1                        228   2e-69    Vitis vinifera
emb|CDY09659.1|  BnaC07g34020D                                          228   2e-69    
ref|XP_009136814.1|  PREDICTED: expansin-like B1                        227   3e-69    
ref|XP_003635563.2|  PREDICTED: expansin-like B1                        226   7e-69    
emb|CAN78704.1|  hypothetical protein VITISV_028656                     226   7e-69    Vitis vinifera
ref|XP_009801873.1|  PREDICTED: expansin-like B1                        226   8e-69    
ref|XP_010434732.1|  PREDICTED: expansin-like B1                        226   1e-68    
emb|CDY42954.1|  BnaA01g18000D                                          225   2e-68    
ref|NP_001288835.1|  expansin-like B1 precursor                         225   2e-68    
ref|XP_009136818.1|  PREDICTED: expansin-like B1                        225   3e-68    
ref|XP_010449686.1|  PREDICTED: expansin-like B1                        224   3e-68    
ref|XP_010440069.1|  PREDICTED: expansin-like B1                        224   4e-68    
ref|XP_007039694.1|  Expansin-like B1, BETA 3.1,EXLB1                   224   5e-68    
ref|XP_006284415.1|  hypothetical protein CARUB_v10005585mg             224   7e-68    
emb|CDY35606.1|  BnaC01g21280D                                          223   9e-68    
ref|XP_002868090.1|  hypothetical protein ARALYDRAFT_915018             222   3e-67    
ref|XP_004300332.1|  PREDICTED: expansin-like B1-like                   222   5e-67    
ref|XP_009371043.1|  PREDICTED: expansin-like B1                        221   6e-67    
ref|XP_006440179.1|  hypothetical protein CICLE_v10021884mg             221   6e-67    
ref|XP_009608881.1|  PREDICTED: expansin-like B1                        221   1e-66    
ref|XP_004511738.1|  PREDICTED: expansin-like B1-like                   220   2e-66    
ref|NP_193436.2|  expansin-like B1                                      220   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011047565.1|  PREDICTED: expansin-like B1                        220   2e-66    
gb|KDO38685.1|  hypothetical protein CISIN_1g025810mg                   218   7e-66    
gb|KHG25116.1|  Expansin-like B1                                        218   2e-65    
ref|XP_006477088.1|  PREDICTED: expansin-like B1-like                   218   2e-65    
ref|XP_010933564.1|  PREDICTED: expansin-like B1                        217   3e-65    
ref|XP_008786197.1|  PREDICTED: expansin-like B1                        216   5e-65    
ref|XP_006414282.1|  hypothetical protein EUTSA_v10026076mg             216   6e-65    
ref|XP_010104849.1|  Expansin-like protein                              216   9e-65    
ref|XP_006477090.1|  PREDICTED: expansin-like B1-like                   215   1e-64    
ref|XP_010246084.1|  PREDICTED: expansin-like B1 isoform X2             215   1e-64    
gb|AFK42530.1|  unknown                                                 215   2e-64    
gb|KDO57054.1|  hypothetical protein CISIN_1g025837mg                   214   4e-64    
ref|XP_006359217.1|  PREDICTED: expansin-like B1-like                   214   5e-64    
ref|XP_008373652.1|  PREDICTED: expansin-like B1                        214   6e-64    
ref|XP_007156590.1|  hypothetical protein PHAVU_002G001700g             213   1e-63    
ref|XP_004148383.1|  PREDICTED: expansin-like B1-like                   213   2e-63    
ref|XP_003549947.1|  PREDICTED: expansin-like B1-like                   212   2e-63    
ref|XP_003517398.1|  PREDICTED: expansin-like B1-like                   212   3e-63    
ref|XP_008465892.1|  PREDICTED: expansin-like B1                        212   3e-63    
ref|XP_004245823.1|  PREDICTED: expansin-like B1                        212   3e-63    
ref|XP_006440176.1|  hypothetical protein CICLE_v10024449mg             211   4e-63    
ref|XP_003538757.1|  PREDICTED: expansin-like B1-like                   211   5e-63    
gb|KHN28473.1|  Expansin-like B1                                        211   6e-63    
ref|XP_006477094.1|  PREDICTED: expansin-like B1-like                   211   8e-63    
ref|XP_003524166.1|  PREDICTED: expansin-like B1-like isoform X1        209   3e-62    
ref|XP_006440178.1|  hypothetical protein CICLE_v10024410mg             209   3e-62    
gb|AFK34658.1|  unknown                                                 209   4e-62    
ref|XP_003611388.1|  Expansin-like protein                              209   4e-62    
emb|CDP08337.1|  unnamed protein product                                209   4e-62    
emb|CDP08339.1|  unnamed protein product                                209   5e-62    
ref|XP_007155710.1|  hypothetical protein PHAVU_003G224800g             208   1e-61    
gb|EYU17878.1|  hypothetical protein MIMGU_mgv1a026243mg                206   3e-61    
gb|KHN34892.1|  Expansin-like B1                                        206   4e-61    
ref|XP_006477089.1|  PREDICTED: expansin-like B1-like                   206   7e-61    
dbj|BAO45906.1|  hypothetical protein                                   205   1e-60    
gb|KEH31624.1|  expansin-B1-like protein                                205   2e-60    
gb|KHG10161.1|  Expansin-like B1                                        204   2e-60    
ref|XP_006838532.1|  hypothetical protein AMTR_s00002p00195390          202   1e-59    
ref|XP_003549943.1|  PREDICTED: expansin-like B1-like                   200   8e-59    
ref|XP_003549945.1|  PREDICTED: expansin-like B1-like                   194   3e-56    
ref|XP_010533848.1|  PREDICTED: expansin-like B1                        193   4e-56    
ref|XP_010677136.1|  PREDICTED: expansin-like B1                        193   7e-56    
gb|ACU24607.1|  unknown                                                 192   1e-55    Glycine max [soybeans]
ref|XP_010677135.1|  PREDICTED: expansin-like B1                        191   2e-55    
ref|XP_007211070.1|  hypothetical protein PRUPE_ppa017982mg             191   3e-55    
gb|EPS74160.1|  hypothetical protein M569_00601                         189   4e-55    
ref|XP_008229527.1|  PREDICTED: expansin-like B1 isoform X1             190   7e-55    
pir||F71438  probable allergen - Arabidopsis thaliana                   190   1e-54 
ref|NP_001242114.1|  uncharacterized protein LOC100813628 precursor     189   2e-54    
ref|XP_003524157.1|  PREDICTED: expansin-like B1-like                   189   3e-54    
gb|KHN28471.1|  Expansin-like B1                                        188   4e-54    
ref|XP_003549946.1|  PREDICTED: expansin-like B1-like                   187   8e-54    
gb|KDP45947.1|  hypothetical protein JCGZ_11850                         187   1e-53    
ref|XP_010055416.1|  PREDICTED: expansin-like B1                        187   2e-53    
ref|XP_007039592.1|  Expansin-like B1                                   187   2e-53    
emb|CDP08338.1|  unnamed protein product                                186   2e-53    
ref|XP_010533847.1|  PREDICTED: expansin-like B1                        186   2e-53    
ref|XP_008229528.1|  PREDICTED: expansin-like B1 isoform X2             186   4e-53    
ref|XP_010055418.1|  PREDICTED: expansin-like B1                        185   6e-53    
gb|KDP45948.1|  hypothetical protein JCGZ_11851                         184   2e-52    
ref|XP_007155708.1|  hypothetical protein PHAVU_003G224600g             183   3e-52    
ref|XP_010055415.1|  PREDICTED: expansin-like B1                        182   5e-52    
ref|XP_010531686.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-lik...    182   5e-52    
ref|XP_009341228.1|  PREDICTED: expansin-like B1                        182   9e-52    
ref|XP_010110506.1|  Expansin-like protein                              181   2e-51    
ref|XP_002528780.1|  Major pollen allergen Ory s 1 precursor, put...    181   3e-51    Ricinus communis
gb|EYU21911.1|  hypothetical protein MIMGU_mgv1a019174mg                181   3e-51    
emb|CAN79420.1|  hypothetical protein VITISV_025068                     181   4e-51    Vitis vinifera
ref|XP_002281851.1|  PREDICTED: expansin-like A2                        181   5e-51    Vitis vinifera
ref|XP_004300282.1|  PREDICTED: expansin-like B1-like                   180   5e-51    
ref|XP_002278917.1|  PREDICTED: expansin-like B1                        180   6e-51    Vitis vinifera
emb|CBI33924.3|  unnamed protein product                                179   7e-51    
ref|XP_011032021.1|  PREDICTED: expansin-like B1                        181   8e-51    
ref|XP_010055378.1|  PREDICTED: expansin-like B1                        180   8e-51    
ref|XP_006385603.1|  hypothetical protein POPTR_0003s08530g             179   2e-50    
ref|XP_010269911.1|  PREDICTED: expansin-like B1                        179   2e-50    
ref|XP_009596665.1|  PREDICTED: expansin-like B1                        179   2e-50    
ref|XP_011081880.1|  PREDICTED: expansin-like B1                        179   3e-50    
ref|XP_010266113.1|  PREDICTED: expansin-like A2                        178   3e-50    
ref|XP_010695687.1|  PREDICTED: expansin-like B1                        178   4e-50    
ref|XP_008373753.1|  PREDICTED: expansin-like B1                        178   4e-50    
ref|XP_004245860.1|  PREDICTED: expansin-like B1                        178   4e-50    
ref|XP_009804317.1|  PREDICTED: expansin-like B1                        177   7e-50    
gb|KDP40448.1|  hypothetical protein JCGZ_03948                         177   7e-50    
ref|XP_006362493.1|  PREDICTED: expansin-like B1-like                   177   7e-50    
ref|XP_006436816.1|  hypothetical protein CICLE_v10032508mg             177   9e-50    
gb|KHN01661.1|  Expansin-like B1                                        177   1e-49    
ref|XP_011018644.1|  PREDICTED: expansin-like B1                        177   1e-49    
ref|XP_002528779.1|  Major pollen allergen Ory s 1 precursor, put...    176   2e-49    Ricinus communis
ref|XP_006368460.1|  hypothetical protein POPTR_0001s03010g             176   3e-49    
dbj|BAA05476.1|  tumor-related protein                                  173   3e-49    Nicotiana glauca x Nicotiana langsdorffii
ref|XP_007155744.1|  hypothetical protein PHAVU_003G228000g             176   3e-49    
ref|XP_003524361.1|  PREDICTED: expansin-like B1-like                   176   3e-49    
ref|XP_004508990.1|  PREDICTED: expansin-like B1-like                   176   4e-49    
gb|KHG18742.1|  Expansin-like A1                                        176   4e-49    
ref|XP_010274616.1|  PREDICTED: expansin-like B1                        175   6e-49    
ref|XP_006358602.1|  PREDICTED: expansin-like B1-like                   174   1e-48    
ref|XP_004163761.1|  PREDICTED: expansin-like B1-like                   174   1e-48    
emb|CAN66372.1|  hypothetical protein VITISV_009464                     172   1e-48    Vitis vinifera
ref|XP_011045305.1|  PREDICTED: expansin-like A2                        174   2e-48    
ref|XP_004148502.1|  PREDICTED: expansin-like B1-like                   174   2e-48    
ref|NP_001241909.1|  uncharacterized protein LOC100791557 precursor     174   2e-48    
ref|XP_007041678.1|  Expansin-like protein isoform 1                    173   3e-48    
ref|XP_008465922.1|  PREDICTED: expansin-like B1                        173   4e-48    
gb|KEH31567.1|  expansin-B1-like protein                                172   4e-48    
ref|XP_010943941.1|  PREDICTED: expansin-like A2                        173   5e-48    
gb|AFK41420.1|  unknown                                                 172   7e-48    
ref|XP_004144877.1|  PREDICTED: expansin-like A3-like                   172   7e-48    
ref|XP_009792536.1|  PREDICTED: expansin-like B1                        172   8e-48    
ref|XP_010028810.1|  PREDICTED: expansin-like A2                        172   1e-47    
ref|XP_010690269.1|  PREDICTED: expansin-like A2                        172   1e-47    
gb|AFK41484.1|  unknown                                                 172   1e-47    
gb|KHG30719.1|  Expansin-like A2                                        172   1e-47    
ref|XP_009768114.1|  PREDICTED: expansin-like A2                        172   1e-47    
gb|ACJ84296.1|  unknown                                                 172   1e-47    Medicago truncatula
ref|XP_009628233.1|  PREDICTED: expansin-like B1                        172   1e-47    
ref|XP_010242840.1|  PREDICTED: expansin-like A1                        171   2e-47    
ref|NP_001275349.1|  expansin-like protein precursor                    171   2e-47    
gb|ABM69039.1|  expansin-like protein                                   171   2e-47    Cunninghamia lanceolata [China fir]
ref|XP_004167721.1|  PREDICTED: expansin-like A3-like                   171   3e-47    
ref|XP_002313682.2|  expansin-like family protein                       171   3e-47    Populus trichocarpa [western balsam poplar]
gb|ABK21763.1|  unknown                                                 171   3e-47    Picea sitchensis
gb|KHG06156.1|  Expansin-like A2                                        171   3e-47    
ref|XP_010918218.1|  PREDICTED: expansin-like A1                        171   3e-47    
ref|XP_006590253.1|  PREDICTED: uncharacterized protein LOC100305...    171   3e-47    
ref|XP_004505673.1|  PREDICTED: expansin-like A2-like                   170   5e-47    
ref|XP_006431473.1|  hypothetical protein CICLE_v10002142mg             168   7e-47    
ref|XP_002534094.1|  Beta-expansin 1a precursor, putative               169   9e-47    Ricinus communis
ref|XP_007156627.1|  hypothetical protein PHAVU_002G004100g             169   1e-46    
ref|XP_003517382.1|  PREDICTED: expansin-like B1-like                   169   1e-46    
ref|XP_006422480.1|  hypothetical protein CICLE_v10029088mg             169   2e-46    
ref|XP_006486648.1|  PREDICTED: expansin-like A1-like                   168   2e-46    
ref|XP_003538767.1|  PREDICTED: expansin-like B1-like                   168   3e-46    
ref|XP_008447888.1|  PREDICTED: expansin-like A3 isoform X3             168   3e-46    
ref|XP_003540432.1|  PREDICTED: expansin-like A2-like                   168   3e-46    
ref|XP_004153445.1|  PREDICTED: expansin-like A1-like                   167   3e-46    
gb|AFK24456.1|  expansin-like 1                                         167   5e-46    
gb|KHN05483.1|  Expansin-like A1                                        167   5e-46    
ref|XP_004144935.1|  PREDICTED: expansin-like A1-like                   167   5e-46    
ref|XP_008447892.1|  PREDICTED: expansin-like A2                        167   8e-46    
ref|XP_004290040.1|  PREDICTED: expansin-like A1-like                   167   1e-45    
ref|NP_001234736.1|  expansin-like protein precursor                    166   1e-45    
gb|EYU38011.1|  hypothetical protein MIMGU_mgv1a011722mg                166   2e-45    
ref|XP_008791985.1|  PREDICTED: expansin-like A2                        166   2e-45    
ref|XP_009606813.1|  PREDICTED: expansin-like A2                        166   2e-45    
emb|CDP21630.1|  unnamed protein product                                165   3e-45    
ref|XP_006284347.1|  hypothetical protein CARUB_v10005519mg             166   3e-45    
ref|XP_010548815.1|  PREDICTED: expansin-like B1                        165   4e-45    
emb|CDP12935.1|  unnamed protein product                                165   5e-45    
ref|XP_009371879.1|  PREDICTED: expansin-like B1                        164   5e-45    
ref|XP_011088678.1|  PREDICTED: expansin-like A2                        164   8e-45    
gb|KEH31627.1|  expansin-B1-like protein                                161   1e-44    
ref|XP_009797268.1|  PREDICTED: expansin-like A2                        164   1e-44    
ref|XP_008811008.1|  PREDICTED: expansin-like A1                        164   1e-44    
ref|XP_011046305.1|  PREDICTED: expansin-like A2                        164   2e-44    
ref|XP_008382466.1|  PREDICTED: expansin-like A1                        163   2e-44    
gb|ABK93417.1|  unknown                                                 163   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_010103314.1|  Expansin-like A1                                   163   2e-44    
ref|XP_009401889.1|  PREDICTED: expansin-like A2                        163   3e-44    
ref|XP_009388354.1|  PREDICTED: expansin-like A2                        163   3e-44    
ref|XP_004153444.1|  PREDICTED: expansin-like A1-like                   163   3e-44    
ref|XP_004161038.1|  PREDICTED: expansin-like A1-like                   163   4e-44    
ref|XP_009594036.1|  PREDICTED: expansin-like A2 isoform X1             162   5e-44    
ref|XP_009341550.1|  PREDICTED: expansin-like A2                        162   5e-44    
gb|KDO57055.1|  hypothetical protein CISIN_1g025837mg                   161   6e-44    
ref|XP_003562133.1|  PREDICTED: expansin-like A1                        162   7e-44    
ref|XP_002305545.2|  expansin-like family protein                       162   7e-44    Populus trichocarpa [western balsam poplar]
ref|NP_001048868.1|  Os03g0132200                                       162   8e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008447884.1|  PREDICTED: expansin-like A2                        163   9e-44    
emb|CDP14520.1|  unnamed protein product                                162   1e-43    
ref|XP_008380966.1|  PREDICTED: expansin-like A2                        160   2e-43    
gb|ACC61048.1|  expansin-like 1 protein                                 161   2e-43    
ref|XP_003563074.1|  PREDICTED: expansin-like B1                        160   3e-43    
ref|XP_010555195.1|  PREDICTED: expansin-like A2                        160   3e-43    
ref|XP_009382059.1|  PREDICTED: expansin-like A2                        160   4e-43    
ref|XP_009384618.1|  PREDICTED: expansin-like A3                        160   4e-43    
ref|XP_009411148.1|  PREDICTED: expansin-like A2                        161   5e-43    
ref|XP_008448110.1|  PREDICTED: expansin-like A1                        160   1e-42    
ref|XP_009400330.1|  PREDICTED: expansin-like A1                        159   1e-42    
ref|XP_008447887.1|  PREDICTED: expansin-like A2 isoform X2             158   2e-42    
gb|AFK46747.1|  unknown                                                 158   2e-42    
sp|Q850K7.2|EXLB1_ORYSJ  RecName: Full=Expansin-like B1; AltName:...    158   2e-42    Oryza sativa Japonica Group [Japonica rice]
gb|AFK37951.1|  unknown                                                 157   3e-42    
ref|XP_008784689.1|  PREDICTED: expansin-like B1                        157   4e-42    
ref|XP_006651010.1|  PREDICTED: expansin-like A1-like                   157   4e-42    
ref|XP_006292201.1|  hypothetical protein CARUB_v10018414mg             157   4e-42    
ref|XP_008447886.1|  PREDICTED: expansin-like A1 isoform X1             157   4e-42    
ref|XP_004144934.1|  PREDICTED: expansin-like A1-like                   157   4e-42    
ref|XP_006828980.1|  hypothetical protein AMTR_s00001p00240270          156   1e-41    
ref|XP_004985830.1|  PREDICTED: expansin-like A1-like isoform X2        156   1e-41    
ref|XP_003562134.2|  PREDICTED: expansin-like A1                        156   1e-41    
ref|XP_004957766.1|  PREDICTED: expansin-like B1-like                   156   2e-41    
gb|KCW55628.1|  hypothetical protein EUGRSUZ_I01493                     156   2e-41    
ref|XP_006422510.1|  hypothetical protein CICLE_v10029905mg             155   2e-41    
ref|XP_010426024.1|  PREDICTED: expansin-like A3                        155   3e-41    
ref|XP_004144933.1|  PREDICTED: expansin-like A1-like                   155   3e-41    
ref|XP_010690271.1|  PREDICTED: expansin-like A1                        155   3e-41    
ref|XP_006657721.1|  PREDICTED: expansin-like B1-like                   155   3e-41    
emb|CAE12163.1|  expansin-like protein                                  155   4e-41    Quercus robur [English oak]
ref|XP_010919842.1|  PREDICTED: expansin-like B1                        154   5e-41    
ref|XP_010514920.1|  PREDICTED: expansin-like A3                        154   5e-41    
ref|XP_010690676.1|  PREDICTED: expansin-like A3                        154   8e-41    
ref|XP_010690270.1|  PREDICTED: expansin-like A2                        154   8e-41    
dbj|BAJ88228.1|  predicted protein                                      154   1e-40    
gb|ACU24512.1|  unknown                                                 151   1e-40    Glycine max [soybeans]
ref|XP_002468570.1|  hypothetical protein SORBIDRAFT_01g048190          154   1e-40    Sorghum bicolor [broomcorn]
ref|XP_010503206.1|  PREDICTED: expansin-like A3                        153   1e-40    
ref|XP_006291686.1|  hypothetical protein CARUB_v10017847mg             153   2e-40    
ref|XP_008447889.1|  PREDICTED: expansin-like A1                        153   2e-40    
emb|CDY64278.1|  BnaCnng43640D                                          152   3e-40    
ref|XP_010690272.1|  PREDICTED: expansin-like A1                        152   3e-40    
emb|CDY52801.1|  BnaCnng23400D                                          152   4e-40    
ref|XP_008236108.1|  PREDICTED: expansin-like A2                        152   4e-40    
ref|XP_010531681.1|  PREDICTED: expansin-like B1                        150   4e-40    
gb|AAM52409.1|  expansin-like protein A                                 150   4e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124092.1|  PREDICTED: expansin-like A2                        152   5e-40    
ref|XP_007201894.1|  hypothetical protein PRUPE_ppa010171mg             151   6e-40    
gb|AGM16372.1|  alpha-expansin-like protein 2                           151   7e-40    
emb|CDY72634.1|  BnaCnng78620D                                          151   8e-40    
ref|XP_010436933.1|  PREDICTED: expansin-like A2                        151   9e-40    
gb|KGN43310.1|  hypothetical protein Csa_7G019900                       152   9e-40    
gb|ADM74681.1|  expansin-like protein                                   149   1e-39    
ref|XP_002868845.1|  hypothetical protein ARALYDRAFT_490602             150   2e-39    
ref|XP_010431775.1|  PREDICTED: expansin-like A2                        149   2e-39    
ref|XP_010503212.1|  PREDICTED: expansin-like A1                        150   2e-39    
ref|XP_010446345.1|  PREDICTED: expansin-like A2                        150   2e-39    
ref|XP_010503208.1|  PREDICTED: expansin-like A3                        150   2e-39    
ref|XP_010426026.1|  PREDICTED: expansin-like A1                        150   3e-39    
ref|XP_010502136.1|  PREDICTED: expansin-like A3                        149   4e-39    
ref|XP_010502137.1|  PREDICTED: expansin-like A1                        149   6e-39    
gb|ADM74640.1|  expansin-like protein                                   147   6e-39    
gb|ADM74638.1|  expansin-like protein                                   147   7e-39    
ref|XP_010690673.1|  PREDICTED: expansin-like A3                        149   8e-39    
ref|NP_195553.1|  expansin-like A2                                      148   1e-38    
gb|AFB77226.1|  expansin L                                              146   1e-38    
gb|ADM74637.1|  expansin-like protein                                   146   1e-38    
ref|XP_006662562.1|  PREDICTED: expansin-like A2-like                   148   1e-38    
gb|ADM74639.1|  expansin-like protein                                   146   1e-38    
ref|XP_006838466.1|  hypothetical protein AMTR_s00002p00146900          146   1e-38    
ref|XP_010514921.1|  PREDICTED: expansin-like A1                        148   1e-38    
ref|XP_004144878.1|  PREDICTED: expansin-like A1-like                   148   1e-38    
ref|XP_009385952.1|  PREDICTED: expansin-like B1                        147   2e-38    
gb|ADM74663.1|  expansin-like protein                                   145   2e-38    
gb|ADM74661.1|  expansin-like protein                                   145   2e-38    
ref|NP_190182.2|  expansin-like A3                                      146   2e-38    
ref|NP_001065194.1|  Os10g0542400                                       147   3e-38    
gb|EMS62680.1|  Expansin-like A1                                        147   4e-38    
ref|NP_001152206.1|  LOC100285844 precursor                             147   4e-38    
ref|XP_008447893.1|  PREDICTED: expansin-like A2                        147   4e-38    
ref|NP_001030815.1|  expansin-like A3                                   146   5e-38    
ref|NP_001238193.1|  uncharacterized protein LOC100305884 precursor     145   6e-38    
gb|KHF99032.1|  Expansin-like B1                                        144   8e-38    
ref|XP_009101947.1|  PREDICTED: expansin-like A2                        145   1e-37    
dbj|BAC21379.1|  putative beta-expansin 2 precursor-like protein        145   1e-37    
ref|XP_006579653.1|  PREDICTED: expansin-like B1-like isoform X2        144   2e-37    
ref|XP_006411626.1|  hypothetical protein EUTSA_v10025976mg             144   3e-37    
gb|EAZ16854.1|  hypothetical protein OsJ_32328                          144   4e-37    
gb|EMT13216.1|  hypothetical protein F775_20259                         144   4e-37    
ref|XP_002875760.1|  hypothetical protein ARALYDRAFT_484976             144   4e-37    
gb|AAN86683.1|  beta expansin EXPB2.1                                   144   5e-37    
ref|XP_004144876.1|  PREDICTED: expansin-like A1-like                   144   6e-37    
ref|XP_008447890.1|  PREDICTED: expansin-like A2 isoform X1             144   6e-37    
gb|AAC02086.1|  hairy root 2                                            140   6e-37    
ref|XP_010690142.1|  PREDICTED: expansin-like A3                        143   9e-37    
ref|XP_009383014.1|  PREDICTED: expansin-like B1                        142   2e-36    
gb|EAY79387.1|  hypothetical protein OsI_34514                          142   2e-36    
ref|NP_001288686.1|  expansin-like A1 precursor                         142   2e-36    
ref|XP_008670393.1|  PREDICTED: expansin-like A3                        142   3e-36    
ref|XP_003563137.1|  PREDICTED: expansin-like A3                        142   3e-36    
ref|XP_003525584.1|  PREDICTED: expansin-like B1-like                   141   3e-36    
ref|XP_004957673.1|  PREDICTED: expansin-like A3-like                   142   5e-36    
ref|XP_008450281.1|  PREDICTED: expansin-like A1                        140   1e-35    
gb|EMT13217.1|  hypothetical protein F775_20260                         140   2e-35    
ref|NP_190183.1|  expansin-like A1                                      140   2e-35    
gb|AAM63819.1|  Expansin-like 1 precursor (At-EXPL1) (Ath-ExpBeta...    140   2e-35    
tpg|DAA43194.1|  TPA: hypothetical protein ZEAMMB73_783155              140   3e-35    
gb|KFK30445.1|  hypothetical protein AALP_AA7G262000                    138   6e-35    
ref|XP_002462849.1|  hypothetical protein SORBIDRAFT_02g033070          138   7e-35    
ref|XP_004171096.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-lik...    138   8e-35    
ref|XP_008650747.1|  PREDICTED: expansin-like A1 isoform X1             138   1e-34    
ref|NP_001059621.1|  Os07g0475400                                       137   2e-34    
ref|XP_006290296.1|  hypothetical protein CARUB_v10018653mg             136   4e-34    
ref|NP_001147432.1|  expansin-like 3 precursor                          136   5e-34    
gb|EEC81335.1|  hypothetical protein OsI_24510                          137   5e-34    
gb|EEE66384.1|  hypothetical protein OsJ_22705                          136   1e-33    
ref|NP_001058621.1|  Os06g0725300                                       135   1e-33    
ref|XP_006657686.1|  PREDICTED: expansin-like A3-like                   135   2e-33    
ref|XP_004139145.1|  PREDICTED: expansin-like A1-like                   134   2e-33    
ref|XP_004172098.1|  PREDICTED: expansin-like A1-like                   134   2e-33    
gb|AAC05149.1|  pollen allergen                                         134   3e-33    
gb|KEH30619.1|  expansin A1                                             131   4e-33    
ref|XP_009400589.1|  PREDICTED: expansin-like B1                        133   5e-33    
ref|XP_008658904.1|  PREDICTED: hypothetical protein isoform X1         133   5e-33    
ref|XP_004986846.1|  PREDICTED: expansin-like A2-like                   136   8e-33    
gb|KDO68254.1|  hypothetical protein CISIN_1g024895mg                   130   1e-32    
ref|XP_008447891.1|  PREDICTED: expansin-like A2 isoform X2             131   1e-32    
gb|EMS54929.1|  Expansin-like A1                                        131   4e-32    
ref|XP_010468412.1|  PREDICTED: expansin-like A3                        129   5e-32    
ref|XP_008447894.1|  PREDICTED: expansin-like A3                        130   1e-31    
ref|XP_003572024.2|  PREDICTED: expansin-like A2                        130   5e-31    
ref|XP_006657358.1|  PREDICTED: expansin-like A4-like                   128   7e-31    
ref|XP_010541745.1|  PREDICTED: expansin-like B1                        125   2e-30    
emb|CDX90493.1|  BnaA03g42880D                                          121   4e-30    
gb|KGN43303.1|  hypothetical protein Csa_7G019830                       124   5e-30    
ref|XP_009594038.1|  PREDICTED: expansin-like A1 isoform X3             122   6e-30    
ref|XP_004966496.1|  PREDICTED: expansin-like A4-like                   125   9e-30    
gb|AAO33384.1|AF466188_1  expansin-like protein B                       122   9e-30    
emb|CBI29574.3|  unnamed protein product                                120   1e-29    
ref|XP_010538358.1|  PREDICTED: expansin-like B1                        122   4e-29    
ref|XP_009594037.1|  PREDICTED: expansin-like A1 isoform X2             121   5e-29    
ref|NP_001150293.1|  beta-expansin 2 precursor                          122   6e-29    
gb|AFW59251.1|  beta-expansin 2                                         122   8e-29    
ref|XP_010543806.1|  PREDICTED: expansin-like B1                        121   1e-28    
gb|ACU24510.1|  unknown                                                 117   3e-28    
ref|XP_003580287.1|  PREDICTED: expansin-B5-like                        120   4e-28    
dbj|BAK03724.1|  predicted protein                                      119   5e-28    
gb|KGN43304.1|  hypothetical protein Csa_7G019840                       117   4e-27    
gb|EMT05034.1|  hypothetical protein F775_13827                         116   7e-27    
ref|XP_010229338.1|  PREDICTED: major pollen allergen Hol l 1           116   7e-27    
ref|XP_004983734.1|  PREDICTED: expansin-B9-like                        116   8e-27    
ref|XP_009388154.1|  PREDICTED: expansin-B18-like                       115   2e-26    
ref|XP_003578832.1|  PREDICTED: putative expansin-B14                   115   2e-26    
dbj|BAJ91103.1|  predicted protein                                      115   3e-26    
ref|XP_009389750.1|  PREDICTED: expansin-B15-like                       114   4e-26    
ref|XP_002446907.1|  hypothetical protein SORBIDRAFT_06g024660          115   5e-26    
dbj|BAJ94846.1|  predicted protein                                      114   7e-26    
emb|CDM81207.1|  unnamed protein product                                114   7e-26    
gb|EMT25042.1|  hypothetical protein F775_28155                         113   9e-26    
gb|EMT25044.1|  hypothetical protein F775_42751                         112   2e-25    
gb|EMS67855.1|  Expansin-B15                                            112   3e-25    
ref|XP_011084266.1|  PREDICTED: putative expansin-B2                    111   4e-25    
gb|AFW90642.1|  expansin-like B1 precursor protein                      108   4e-25    
tpg|DAA43196.1|  TPA: hypothetical protein ZEAMMB73_783155              110   4e-25    
ref|XP_009613842.1|  PREDICTED: expansin-B4-like                        112   4e-25    
sp|O04701.1|MPAC1_CYNDA  RecName: Full=Major pollen allergen Cyn ...    110   7e-25    
gb|ACO87676.1|  expansin protein                                        110   7e-25    
tpg|DAA40796.1|  TPA: hypothetical protein ZEAMMB73_187022              109   8e-25    
ref|XP_004978168.1|  PREDICTED: expansin-B5-like                        111   8e-25    
gb|AFW87930.1|  LOW QUALITY PROTEIN: lo1 pI allergen-like protein       110   8e-25    
ref|XP_009774408.1|  PREDICTED: expansin-B4-like                        110   9e-25    
ref|XP_003577577.1|  PREDICTED: pollen allergen Phl p 1-like            110   1e-24    
ref|XP_009407811.1|  PREDICTED: expansin-B18-like                       110   1e-24    
gb|EEE58167.1|  hypothetical protein OsJ_09093                          110   1e-24    
ref|NP_001048689.1|  Os03g0106900                                       110   1e-24    
gb|EYU20202.1|  hypothetical protein MIMGU_mgv1a011553mg                110   2e-24    
ref|NP_001048688.1|  Os03g0106800                                       110   2e-24    
pdb|2HCZ|X  Chain X, Crystal Structure Of Expb1 (Zea M 1), A Beta...    109   2e-24    
ref|NP_001105209.1|  expansin-B9 precursor                              109   2e-24    
gb|KHN41722.1|  Expansin-like B1                                        109   2e-24    
gb|EMS57928.1|  Expansin-B5                                             110   2e-24    
ref|XP_006649234.1|  PREDICTED: expansin-B10-like                       109   3e-24    
gb|EMT16315.1|  Putative expansin-B14                                   109   3e-24    
ref|XP_004976444.1|  PREDICTED: expansin-B5-like                        109   3e-24    
gb|AAL14077.1|  acidic Cyn d 1 isoallergen isoform 2 precursor          108   4e-24    
gb|EMS49032.1|  Expansin-B7                                             110   4e-24    
sp|P58738.2|EXPB1_MAIZE  RecName: Full=Expansin-B1; AltName: Full...    108   4e-24    
ref|NP_001288510.1|  expansin-B1 precursor                              108   4e-24    
gb|EEC74348.1|  hypothetical protein OsI_09651                          108   5e-24    
gb|EMT24613.1|  hypothetical protein F775_16451                         108   5e-24    
ref|XP_009372851.1|  PREDICTED: expansin-B15-like                       108   5e-24    
ref|NP_001053502.1|  Os04g0552200                                       108   5e-24    
ref|XP_008658390.1|  PREDICTED: expansin-B2-like                        108   6e-24    
ref|XP_008664286.1|  PREDICTED: expansin-B5-like                        108   6e-24    
ref|XP_004953360.1|  PREDICTED: expansin-B11-like                       108   6e-24    
ref|XP_008643641.1|  PREDICTED: beta-expansin 4 isoform X1              108   6e-24    
emb|CDM85349.1|  unnamed protein product                                108   6e-24    
ref|XP_002464945.1|  hypothetical protein SORBIDRAFT_01g029270          108   7e-24    
ref|XP_004243343.1|  PREDICTED: expansin-B3                             108   7e-24    
ref|NP_001148284.1|  beta-expansin 4 precursor                          108   7e-24    
gb|AAF80379.2|  acidic Cyn d 1 isoallergen isoform 1 precursor          107   7e-24    
gb|AAK96255.1|AF177030_1  acidic allergen Cyn d 1 precursor             107   7e-24    
ref|XP_008234425.1|  PREDICTED: expansin-B15-like                       108   7e-24    
ref|XP_009389749.1|  PREDICTED: expansin-B15-like                       108   8e-24    
gb|AEW90964.1|  expansin B1 M1                                          108   8e-24    
gb|AAS21274.1|  beta-expansin 1                                         108   8e-24    
ref|NP_001288508.1|  uncharacterized protein LOC103638966 precursor     108   9e-24    
ref|XP_002452339.1|  hypothetical protein SORBIDRAFT_04g023980          108   9e-24    
ref|XP_006649233.1|  PREDICTED: expansin-B10-like                       107   1e-23    
ref|XP_006357491.1|  PREDICTED: expansin-B16-like                       107   1e-23    
gb|AEP25122.1|  expansin B1                                             107   1e-23    
ref|XP_010056439.1|  PREDICTED: putative expansin-B2                    107   1e-23    
ref|NP_001148695.1|  beta-expansin 1a precursor                         107   1e-23    
ref|XP_006665160.1|  PREDICTED: expansin-B13-like isoform X1            107   1e-23    
ref|XP_002446905.1|  hypothetical protein SORBIDRAFT_06g024640          107   1e-23    
ref|XP_004982325.1|  PREDICTED: expansin-B12-like isoform X2            108   1e-23    
ref|XP_008232568.1|  PREDICTED: putative expansin-B2                    107   1e-23    
ref|XP_008659972.1|  PREDICTED: expansin-B1-like                        107   1e-23    
ref|XP_009389752.1|  PREDICTED: expansin-B15-like                       107   2e-23    
ref|XP_004982324.1|  PREDICTED: expansin-B12-like isoform X1            108   2e-23    
dbj|BAK05841.1|  predicted protein                                      107   2e-23    
gb|AAF72986.1|AF261273_1  beta-expansin                                 107   2e-23    
ref|XP_004979706.1|  PREDICTED: expansin-B3-like                        107   2e-23    
gb|EMS67854.1|  Putative expansin-B14                                   106   2e-23    
ref|XP_004983688.1|  PREDICTED: expansin-B3-like                        107   2e-23    
ref|XP_008803823.1|  PREDICTED: expansin-B11-like                       107   2e-23    
ref|XP_010919653.1|  PREDICTED: expansin-B5-like                        106   2e-23    
ref|NP_001065351.1|  Os10g0555900                                       106   3e-23    
gb|EYU31945.1|  hypothetical protein MIMGU_mgv1a019518mg                106   3e-23    
gb|AFW59252.1|  hypothetical protein ZEAMMB73_987729                    110   3e-23    
ref|XP_008376387.1|  PREDICTED: expansin-B15-like                       106   3e-23    
ref|XP_003570032.1|  PREDICTED: expansin-B11-like                       107   3e-23    
ref|XP_010919651.1|  PREDICTED: expansin-B5-like                        106   3e-23    
ref|XP_004248556.1|  PREDICTED: expansin-B4-like                        106   3e-23    
ref|XP_002464943.1|  hypothetical protein SORBIDRAFT_01g029250          106   4e-23    
gb|EMS46139.1|  Expansin-B7                                             106   4e-23    
ref|XP_004983686.1|  PREDICTED: expansin-B3-like                        106   4e-23    
ref|XP_010229347.1|  PREDICTED: expansin-B7-like                        107   4e-23    
ref|XP_004953362.1|  PREDICTED: expansin-B11-like                       106   4e-23    
gb|AIL01317.1|  Sor h 1.0200                                            106   4e-23    
dbj|BAK08243.1|  predicted protein                                      107   4e-23    
ref|NP_001152049.1|  beta-expansin 1a                                   106   4e-23    
gb|EAY88202.1|  hypothetical protein OsI_09650                          107   4e-23    
gb|AAL24476.1|AF391106_1  beta-expansin OsEXPB13                        106   4e-23    
gb|AFW69566.1|  hypothetical protein ZEAMMB73_929697                    107   4e-23    
gb|ACF83087.1|  unknown                                                 105   5e-23    
dbj|BAK01231.1|  predicted protein                                      105   5e-23    
ref|XP_004292301.1|  PREDICTED: putative expansin-B2-like               106   5e-23    
ref|XP_002452804.1|  hypothetical protein SORBIDRAFT_04g032820          106   5e-23    
ref|XP_004983691.1|  PREDICTED: expansin-B2-like                        105   5e-23    
prf||2118271A  allergen PhI p I                                         105   5e-23 
ref|NP_001148577.1|  LOC100282193 precursor                             105   5e-23    
emb|CAH67408.1|  OSIGBa0143N19.2                                        105   6e-23    
gb|KEH15561.1|  expansin-like protein B1                                105   6e-23    
pdb|1N10|A  Chain A, Crystal Structure Of Phl P 1, A Major Timoth...    105   6e-23    
ref|XP_010919650.1|  PREDICTED: expansin-B18-like                       105   6e-23    
gb|ACG27717.1|  beta-expansin 4 precursor                               106   6e-23    
ref|XP_006650949.1|  PREDICTED: expansin-B7-like                        106   6e-23    
gb|EMS50834.1|  Expansin-B9                                             105   6e-23    
ref|XP_009775666.1|  PREDICTED: expansin-B3                             105   7e-23    
gb|AAS48881.1|  expansin EXPB3                                          105   7e-23    
gb|KGN43302.1|  hypothetical protein Csa_7G019330                       104   7e-23    
emb|CAA81613.1|  pollen allergen Phl pI                                 105   7e-23    
ref|XP_010241973.1|  PREDICTED: expansin-B16-like                       105   8e-23    
ref|XP_009372849.1|  PREDICTED: expansin-B15-like                       105   8e-23    
gb|AAT99293.1|  beta-expansin TaEXPB2                                   105   8e-23    
gb|AAS21275.1|  beta-expansin 2                                         105   8e-23    
tpg|DAA48584.1|  TPA: alpha-expansin 3                                  105   8e-23    
ref|XP_009370443.1|  PREDICTED: expansin-B15-like                       105   9e-23    
emb|CDP14756.1|  unnamed protein product                                105   9e-23    
ref|NP_001141406.1|  uncharacterized protein LOC100273516 precursor     105   9e-23    
gb|EMT29297.1|  hypothetical protein F775_28478                         105   9e-23    
gb|AAL14079.1|AF177380_1  acidic Cyn d 1 isoallergen isoform 4 pr...    105   9e-23    
ref|XP_004983690.1|  PREDICTED: expansin-B3-like                        105   9e-23    
ref|XP_010227220.1|  PREDICTED: uncharacterized protein LOC100836606    107   9e-23    
sp|P43213.1|MPAP1_PHLPR  RecName: Full=Pollen allergen Phl p 1; A...    105   9e-23    
ref|XP_007052177.1|  F1E22.6                                            105   9e-23    
ref|NP_001105643.1|  beta-expansin 7 precursor                          105   1e-22    
gb|AAS48879.1|  expansin EXPB1                                          105   1e-22    
gb|AAL14078.1|  acidic Cyn d 1 isoallergen isoform 3 precursor          104   1e-22    
ref|XP_002454532.1|  hypothetical protein SORBIDRAFT_04g032830          105   1e-22    
ref|XP_002267127.2|  PREDICTED: expansin-B3 isoform X2                  104   1e-22    
ref|XP_006662047.1|  PREDICTED: expansin-B3-like                        105   1e-22    



>ref|XP_009626892.1| PREDICTED: expansin-like B1 [Nicotiana tomentosiformis]
Length=248

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = -1

Query  780  NFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKS  601
            N+ SRA+YY T D MG P GACGYG+ G++ N GEVCA S RL+KNGA CGACYQVRCK 
Sbjct  25   NYVSRAAYYSTPDGMGIPTGACGYGENGKDVNNGEVCAASKRLYKNGAGCGACYQVRCKD  84

Query  600  SGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN  421
             GLCSD G KV+ TD  EG  TDFILSYRA+  LAKQP M + L  KG V+VE+RRVSC 
Sbjct  85   KGLCSDEGTKVVVTDTGEGHGTDFILSYRAYAKLAKQPNMTQHLFAKGVVEVEYRRVSCK  144

Query  420  SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
                L +KIH++S+YPHYL+I++ NQGGA+DI AVE+Y+EET +WISMRRA+GAV+DL++
Sbjct  145  Y-GNLMLKIHEHSKYPHYLAIVVMNQGGATDILAVEVYKEETKEWISMRRAYGAVFDLSS  203

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            PPSGEL VRFL S+ A  +WV+S+KA+IPAEWKAG TIET+I
Sbjct  204  PPSGELNVRFLTSAGAETKWVQSDKAVIPAEWKAGATIETDI  245



>ref|XP_006359263.1| PREDICTED: expansin-like B1-like [Solanum tuberosum]
Length=251

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 178/223 (80%), Gaps = 0/223 (0%)
 Frame = -1

Query  783  QNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            Q   S+AS+Y T+D MG P+GACGYGDYG++ N GEVC  S RL++NG  CGACYQVRCK
Sbjct  26   QTLVSKASFYSTSDGMGTPSGACGYGDYGKDVNNGEVCTASRRLYRNGVGCGACYQVRCK  85

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
            ++ LCS+ G KV+ TD  +GQETD ILS++A+  LAK P +A  L  KG VD+E+RRVSC
Sbjct  86   NNALCSEEGTKVVVTDSADGQETDLILSFKAYAKLAKTPSLAAHLCGKGVVDIEYRRVSC  145

Query  423  NSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLA  244
                 L VKIH++S+Y  YL+I++ NQGGA+DI AVEIYEEE+ QWISMR+A+GAVWDL+
Sbjct  146  GYGGNLMVKIHEHSKYADYLAIVVLNQGGATDIHAVEIYEEESQQWISMRKAYGAVWDLS  205

Query  243  NPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            NPP G+L+VRFL S+S  ++WV+S+KA+IPA+WK GLTIET+I
Sbjct  206  NPPCGDLKVRFLTSTSVESKWVQSDKAVIPAQWKVGLTIETDI  248



>ref|XP_004241981.1| PREDICTED: expansin-like B1 [Solanum lycopersicum]
Length=248

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 180/224 (80%), Gaps = 1/224 (0%)
 Frame = -1

Query  783  QNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
             N+ S  SYY T D MG P+GACGYGDYG++ N+G+VC  S RL+KNGAACGACYQVRCK
Sbjct  22   NNYVSTVSYYTTPDGMGTPSGACGYGDYGKDVNSGDVCTTSKRLYKNGAACGACYQVRCK  81

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
               +CSD G KV+ TD  EG  TDFILS RA+  +AKQP MA+ L  KG V+VE+RRVSC
Sbjct  82   DKEMCSDEGTKVVVTDNGEGHGTDFILSSRAYAKMAKQPNMAQHLFAKGVVEVEYRRVSC  141

Query  423  N-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
                  L VK++++S++P+YL+I++ NQGGA+DI +VE++EEET +WISMRRA+GAV+DL
Sbjct  142  KYGGGNLMVKVNEHSKHPNYLAIVVMNQGGATDIHSVEVFEEETKEWISMRRAYGAVFDL  201

Query  246  ANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +NPPSGEL+VRFL S+ A  +WVES+KA+IPAEWKAG+TIET+I
Sbjct  202  SNPPSGELKVRFLTSAGAETKWVESDKAVIPAEWKAGITIETDI  245



>ref|XP_009785593.1| PREDICTED: expansin-like B1 [Nicotiana sylvestris]
Length=307

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 170/216 (79%), Gaps = 4/216 (2%)
 Frame = -1

Query  780  NFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKS  601
            N+ SR +YY T D MG P GACGYG+ G++ N GEVCA S RL+KNGAACGACYQVRCK 
Sbjct  73   NYVSRTAYYTTPDGMGIPTGACGYGENGKDVNNGEVCAASKRLYKNGAACGACYQVRCKD  132

Query  600  SGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN  421
             GLCSD G KV+ TD  EG  TDFILSYRA+  LAKQP MA+ L  KG V+VE+RRVSC 
Sbjct  133  KGLCSDEGTKVVVTDTGEGHGTDFILSYRAYAKLAKQPNMAQQLFAKGVVEVEYRRVSCK  192

Query  420  SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
                L +KIH++S+YPHYL+I++ NQGGA+DI AV   +EET +WISMRR +GAV+DL++
Sbjct  193  -YGNLMLKIHEHSKYPHYLAIVVMNQGGATDILAV---QEETKEWISMRRVYGAVFDLSS  248

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGL  133
            PPSGEL VRFL S+ A  +WV+S+KA+IPAEWKAGL
Sbjct  249  PPSGELNVRFLTSAGAETKWVQSDKAVIPAEWKAGL  284



>ref|XP_004245822.1| PREDICTED: expansin-like B1 [Solanum lycopersicum]
Length=251

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 157/223 (70%), Gaps = 1/223 (0%)
 Frame = -1

Query  783  QNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            +N+ S+A++YKT+D  G P GACGYG++GR  N G V A S +L+KNG  CGACYQVRCK
Sbjct  27   ENYYSKATFYKTSDGKGTPTGACGYGEHGRYVNDGLVTAASWKLYKNGVGCGACYQVRCK  86

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
               LCS+ G KV+ TD  EG  TDFILS  AF  +AK P++A  L  KG VDV+++RVSC
Sbjct  87   DEALCSNEGVKVLVTDSGEGPGTDFILSSDAFAKMAKHPKLAHMLFPKGVVDVDYKRVSC  146

Query  423  NSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLA  244
                 L++KI+++S Y  YL+I L N GG +DI A+EIY+ +TY+WI MRR++GAV+DLA
Sbjct  147  -KYGNLKIKINEHSNYHGYLAIFLFNNGGYADIIAIEIYDVKTYKWIPMRRSYGAVFDLA  205

Query  243  NPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            NPP G+L++R  +      +W+ S+K +IP  WK G   ET++
Sbjct  206  NPPKGDLKLRIQIKEGEKTKWINSDKTVIPDYWKPGSIYETDV  248



>ref|XP_006359218.1| PREDICTED: expansin-like B1-like [Solanum tuberosum]
Length=251

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 156/223 (70%), Gaps = 1/223 (0%)
 Frame = -1

Query  783  QNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            +N+ S+A++YKT+D  G P GACGYG++GR  N G V A S +L+KNG  CGACYQVRCK
Sbjct  27   ENYYSKATFYKTSDGKGTPTGACGYGEHGRYVNDGLVTAASWKLYKNGVGCGACYQVRCK  86

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
               LCS+ G KV+ TD  EG  TDFILS  AF  +AK P++A  L  KG VDV+++RVSC
Sbjct  87   DEALCSNEGVKVVVTDSGEGPGTDFILSSDAFAKMAKHPKLAHMLFPKGVVDVDYKRVSC  146

Query  423  NSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLA  244
                 L++KI+++S Y  YL+I L N GG +DI A+EIY+ ++Y+WI MRR++GAV+DL 
Sbjct  147  -KYGNLKIKINEHSNYHGYLAIFLFNNGGYADIIAIEIYDVKSYKWIPMRRSYGAVFDLE  205

Query  243  NPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            NPP G+L+++  +      +W+ S+K +IP  WK G   ET+I
Sbjct  206  NPPKGDLKLKIQIKEGEKTKWIHSDKTVIPDYWKPGSIYETDI  248



>emb|CDP08340.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 156/221 (71%), Gaps = 4/221 (2%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            ++RA+YY + D +G P GACGYG+YGR  N  +VC VS RL+KNG+ CGACYQVRCK   
Sbjct  30   TTRATYYGSPDCLGTPFGACGYGEYGRTVNNAQVCGVS-RLYKNGSGCGACYQVRCKHPQ  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G KV+ATDY +G +TDFILS RA+  LAK   +AE     G ++VE+RR+ C+  
Sbjct  89   YCSEEGTKVVATDYGQGHDTDFILSVRAYAKLAKPNVVAELFA-AGVIEVEYRRIPCSYP  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L VK+H++S+YP YL+I++  QGG SDI AVE YEE   QW  +RRA+GAVWD+ANP
Sbjct  148  GYNLLVKVHEHSKYPFYLAIVILYQGGTSDIVAVEAYEESCKQWRGLRRAYGAVWDIANP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L  RF VS SA  +WV+    ++P+EW+AG+  +T I
Sbjct  208  PKGTLAFRFQVSGSAGVQWVQP-NTVLPSEWRAGVAYDTAI  247



>emb|CDP08341.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   244 bits (623),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 154/222 (69%), Gaps = 4/222 (2%)
 Frame = -1

Query  777  FSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSS  598
             S+RA++Y +   +G P+GACG+G+YG+  N GEVC VS +L++NG  CGACYQVRCK  
Sbjct  29   LSARATFYGSAGALGTPSGACGFGEYGKTVNNGEVCGVS-KLYQNGTGCGACYQVRCKHP  87

Query  597  GLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-  421
              C++ G  V+ TD+  G  TDF+LS+ AF  LA+   M   L   G +D E++RV C  
Sbjct  88   QYCTEEGTTVVVTDFAIGHGTDFVLSFEAFVKLART-NMGRLLIALGVIDAEYKRVPCQY  146

Query  420  SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
                ++VK+H+ S+YP YL+I++  QGG SDI AVEIYEE + +W +MRRAFGAVWD++N
Sbjct  147  PGTNVKVKVHEKSRYPDYLAIVILYQGGESDITAVEIYEESSKKWKAMRRAFGAVWDISN  206

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            PP G L  RF  S SA  +WVE +K +IP+EW+AG+ I+T +
Sbjct  207  PPKGALTFRFQASGSAGVKWVEPKK-VIPSEWRAGIIIDTAV  247



>ref|XP_002531220.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
 gb|EEF31156.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
Length=247

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 157/227 (69%), Gaps = 4/227 (2%)
 Frame = -1

Query  792  YCQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            Y Q    SRA+YY + D +G P GACG+G+YGR  N   V  VS RL+KNG  CG CYQV
Sbjct  21   YSQDFTGSRATYYGSPDCLGTPTGACGFGEYGRTVNDANVAGVS-RLYKNGTGCGGCYQV  79

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK+  +CSD G  V+ TDY EG +TDFILS RA+  LA+ P MA  L   G VD+E+RR
Sbjct  80   RCKAPQICSDDGVNVVVTDYGEGDKTDFILSSRAYARLAR-PNMAAELFAYGVVDIEYRR  138

Query  432  VSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            +SC  A   +  K+H++S++P YL+I++  QGG +DI AV+I++E+  +WI MR+A+GAV
Sbjct  139  ISCRYAGYNVMFKVHEHSRFPEYLAIVVLYQGGQNDILAVQIWQEDCKEWIGMRKAYGAV  198

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ NPP G + +RF VS SA   WV+++ A IP+EWK G+  ++ I
Sbjct  199  WDMPNPPKGYITLRFQVSGSAGLTWVQAKNA-IPSEWKVGVAYDSAI  244



>ref|XP_011070248.1| PREDICTED: expansin-like B1 [Sesamum indicum]
Length=255

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 157/228 (69%), Gaps = 6/228 (3%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q+++  SRA+YY + D  GNP GACG+G+YGR  N GEV  VS RL++NG  CGACYQ
Sbjct  27   YGQESYVCSRATYYGSPDCYGNPTGACGFGEYGRTVNNGEVSGVS-RLYRNGTGCGACYQ  85

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRCK    CSD G KV+ TDY EG  TDFIL+ RA+  LA+ P MA  L   G VDVE+R
Sbjct  86   VRCKIPSHCSDEGTKVVVTDYGEGDNTDFILNLRAYANLAR-PNMAADLFAYGVVDVEYR  144

Query  435  RVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            R+ C  +  L  K+H++S++P+YL+I+   Q G  DI AVE+++E+  +W  MRRA+GAV
Sbjct  145  RIPCGYSNNLMFKVHEHSKFPNYLAIVPIYQAGIYDITAVELWQEDCKEWRGMRRAYGAV  204

Query  255  WDLANPPSGELRVRFLVSSSA--AARWVESEKAIIPAEWKAGLTIETN  118
            WD+ANPP G L +RF VS  A    +WV+   A IP+EWKAG+  +T+
Sbjct  205  WDMANPPVGALSMRFQVSGGAYGEGKWVQIASA-IPSEWKAGVAYDTS  251



>gb|AFK45939.1| unknown [Medicago truncatula]
Length=251

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 157/227 (69%), Gaps = 3/227 (1%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C++ ++ SRASYY T+D  GNP GACG+GDYG+  N G V AVS++L+KNG  CGACYQV
Sbjct  24   CKEYYTKSRASYYGTSDGYGNPRGACGFGDYGKTVNDGSVTAVSAKLWKNGGGCGACYQV  83

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK    C D G  V+ TDY EG  TDFI+S RAF+ L +    +E L + G +DVE++R
Sbjct  84   RCKIPQYCDDNGALVVVTDYGEGDRTDFIMSPRAFSGLGRNAAASEKLKKYGVLDVEYKR  143

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC      +  +I+++SQ P Y++I++   GG  D+ AVE++++E ++W  MRR++GAV
Sbjct  144  VSCTFKGNNIVYQINEHSQNPGYIAIVILYVGGTYDVNAVEMWQKEQHKWEYMRRSYGAV  203

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +D ANPP GE+R+RF VSS+    WVES  A IPA WKAG T  T I
Sbjct  204  FDYANPPKGEIRLRFQVSSNVGVNWVESRFA-IPAGWKAGATYSTKI  249



>ref|XP_002531221.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
 gb|EEF31157.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
Length=248

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 155/228 (68%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            Y Q   SSRA+YY + D +G P GACG+G+YGR  N   V  VS RL++NG  CG CYQV
Sbjct  23   YSQDFTSSRATYYGSPDRLGTPTGACGFGEYGRTVNNANVAGVS-RLYRNGTGCGGCYQV  81

Query  612  RCKSS-GLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            RCK+  G+C+D G  V+ TDY EG +TDFILS RA+  LA+ P MA  L   G VDV++R
Sbjct  82   RCKAPHGICNDDGVNVVVTDYGEGDKTDFILSSRAYARLAR-PNMAAELFAYGVVDVQYR  140

Query  435  RVSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            R+SC  A   L  KIH+ S++P YL+I++  QGG +DI AV+I++E+  +WI MR+A+GA
Sbjct  141  RISCRYAGYNLIFKIHEYSRFPEYLAIVVLYQGGQNDILAVQIWQEDCKEWIGMRKAYGA  200

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            VWD+ NPP G + +RF VS SA   WV+++ A IP EWK G+     +
Sbjct  201  VWDMPNPPKGYITLRFQVSGSAGLTWVQAKNA-IPREWKVGVAYNIQL  247



>ref|XP_009378390.1| PREDICTED: expansin-like B1 [Pyrus x bretschneideri]
Length=251

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 149/221 (67%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  G P GACG+G+YGR  N G+V AVS RL++NG  CGACYQVRCK   
Sbjct  30   SSRATYYGSPDCYGTPTGACGFGEYGRKINDGQVTAVS-RLWRNGTGCGACYQVRCKVPQ  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             CS  G   + TDY EG  TDFI S RA+  LA  P  +  L   G V++E+RR+ C  S
Sbjct  89   HCSSDGVTAVVTDYGEGDRTDFIFSARAYAKLATNPASSAVLFASGVVEIEYRRIPCKFS  148

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               +  K+H+ S+YPHYL+I++ +  G +DI AVE+++E+  QW  MRRA+GAVWDL  P
Sbjct  149  GYNIVFKVHEQSKYPHYLAIVIQDVAGVNDITAVEVWQEDCQQWRPMRRAYGAVWDLPTP  208

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RF VS SA  +WV++ K +IPA+WKAG   +++I
Sbjct  209  PMGSLSLRFQVSGSAEVKWVQANK-VIPADWKAGAAYQSDI  248



>ref|XP_011031969.1| PREDICTED: expansin-like B1 [Populus euphratica]
Length=250

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 154/227 (68%), Gaps = 4/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C Q+++ SRA+YY + D +G P+GACG+G+YGR  N   V  VS RL+KNG  CG CYQV
Sbjct  23   CSQDYTFSRATYYGSPDCLGTPSGACGFGEYGRTVNDANVAGVS-RLYKNGTGCGGCYQV  81

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK+  LC+D G  V+ TDY EG +TDFILS RA+  +A+ P MA  L   G VDVEFRR
Sbjct  82   RCKAPNLCTDDGVNVVVTDYGEGDKTDFILSPRAYARMAR-PNMAVELIAYGVVDVEFRR  140

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            + C  S   L  K+H++S++P YL+I+L  Q G ++I AVE+++E+  +W  MRRA+GAV
Sbjct  141  IPCRYSGYNLMFKVHEHSRFPDYLAIILLYQAGQNEILAVELWQEDCKEWRGMRRAYGAV  200

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ NPP G + +RF VS SA   +      +IP +WKAG+  ++ +
Sbjct  201  WDMPNPPKGAISLRFQVSGSAGVTYWAHAANVIPGDWKAGIAYDSTV  247



>ref|XP_007209504.1| hypothetical protein PRUPE_ppa010376mg [Prunus persica]
 gb|EMJ10703.1| hypothetical protein PRUPE_ppa010376mg [Prunus persica]
Length=252

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 153/222 (69%), Gaps = 4/222 (2%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  G P GACGYG+YGR  N G+V AV+ RL++NG  CGACYQVRC+   
Sbjct  30   SSRATYYGSPDCYGTPTGACGYGEYGRTVNDGQVAAVA-RLYRNGTGCGACYQVRCREPQ  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC--N  421
             CS  G   + TDY EG  TDFI S RA+  LA  P  AE L   G V++E+RR+ C  +
Sbjct  89   HCSSDGVNAVVTDYGEGDRTDFIFSRRAYAKLASNPAAAERLFAYGVVEIEYRRIPCRFS  148

Query  420  SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
              A L  K+H+ S+YP YL+I++    G +DI +VE+++E+  QW +MRRA+GAV+D  N
Sbjct  149  GRANLEFKVHEQSRYPDYLAIVIQYVAGQNDIISVELWQEDCKQWRAMRRAYGAVFDTPN  208

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            PPSG L +RFLVS SA  ++V++ + +IP +WKAG++ ET+I
Sbjct  209  PPSGSLNLRFLVSGSAGVKFVQANQ-VIPGDWKAGVSYETDI  249



>ref|XP_006385562.1| Expansin-related protein 1 precursor [Populus trichocarpa]
 gb|ERP63359.1| Expansin-related protein 1 precursor [Populus trichocarpa]
Length=250

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 151/227 (67%), Gaps = 3/227 (1%)
 Frame = -1

Query  792  YCQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            Y Q    SRA+YY + D +G P+GACG+G+YGR  N   V  VS RL+KNG  CG CYQV
Sbjct  23   YSQDYTFSRATYYGSPDCLGTPSGACGFGEYGRTVNDANVAGVS-RLYKNGTGCGGCYQV  81

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK+  LC+D G  V+ TDY EG +TDFILS RA+  +A  P MA  L   G VDVEFRR
Sbjct  82   RCKAPNLCTDDGVNVVVTDYGEGDKTDFILSPRAYARMA-HPNMAVELIAYGVVDVEFRR  140

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            + C  S   L  K+H++S++P YL+I+L  Q G ++I AVE+++E+  +W  MRRA+GAV
Sbjct  141  IPCRYSGYNLMFKVHEHSRFPDYLAIILLYQAGQNEILAVELWQEDCKEWRGMRRAYGAV  200

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ NPP G + +RF VS SA   +      +IP++WKAG+  ++ +
Sbjct  201  WDMPNPPKGAISLRFQVSGSAGVTYWAQAANVIPSDWKAGIAYDSTV  247



>ref|XP_006470179.1| PREDICTED: expansin-like B1-like [Citrus sinensis]
 gb|KDO52050.1| hypothetical protein CISIN_1g025808mg [Citrus sinensis]
Length=247

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D +G P GACG+G+YGR  N   V  VS RL+KNG  CGACYQVRCK   L
Sbjct  28   SRATYYGSPDSLGTPTGACGFGEYGRTVNDANVAGVS-RLWKNGTGCGACYQVRCKVPQL  86

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC-NSA  415
            C+D G  V+ TDY EG +TDFILS RA+  +A   + AE L   G V+VEFRRV C    
Sbjct  87   CTDYGVYVVVTDYGEGDKTDFILSPRAYGRMALPDKSAE-LYSYGVVNVEFRRVPCWYKG  145

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L+ K+H+NS+YPHYL+I +    G +D+ AVEI++E+  +W++MRRAFGAV+D+++PP
Sbjct  146  YNLQFKVHENSRYPHYLAIAILYVAGQNDVLAVEIWQEDYQEWVAMRRAFGAVFDISSPP  205

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G + +RF VS SA   WV +  A IP++WKAG+  E+ I
Sbjct  206  EGAISLRFQVSGSAGLTWVVANNA-IPSDWKAGVAYESEI  244



>gb|KDP39949.1| hypothetical protein JCGZ_03480 [Jatropha curcas]
Length=247

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 153/225 (68%), Gaps = 5/225 (2%)
 Frame = -1

Query  783  QNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRC  607
            Q+F+ SRA+YY + D +G P GACG+G+YGR  N   V  VS RL++NG  CG CYQVRC
Sbjct  23   QDFTYSRATYYGSPDCLGTPTGACGFGEYGRTVNNANVAGVS-RLYRNGTGCGGCYQVRC  81

Query  606  KSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
            K+  +C+D G  V+ TDY EG  TDFILS RA+  LA QP M   L   G VDVE+RRV 
Sbjct  82   KAPNICTDDGVNVVVTDYGEGDRTDFILSTRAYARLA-QPNMVLELFAYGVVDVEYRRVP  140

Query  426  CN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C  S   +  K+H+NS++P YL+I++  QGG +DI AV+I++E+  +W  MR+A+G VWD
Sbjct  141  CRYSGYNVMFKVHENSRFPEYLAIVILYQGGLNDILAVQIWQEDCKEWTGMRKAYGGVWD  200

Query  249  LANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            + NPP G + +RF VS S   +WV++   ++P+EWK G+  ++ I
Sbjct  201  MPNPPKGYISLRFQVSGSEGLKWVQASN-VLPSEWKVGVAYDSAI  244



>ref|XP_006431472.1| hypothetical protein CICLE_v10002142mg [Citrus clementina]
 gb|ESR44712.1| hypothetical protein CICLE_v10002142mg [Citrus clementina]
Length=273

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D +G P GACG+G+YGR  N   V  VS RL+KNG  CGACYQVRCK   L
Sbjct  54   SRATYYGSPDSLGTPTGACGFGEYGRTVNDANVAGVS-RLWKNGTGCGACYQVRCKVPQL  112

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC-NSA  415
            C+D G  V+ TDY EG +TDFILS RA+  +A   + AE L   G V+VEFRRV C    
Sbjct  113  CTDYGVYVVVTDYGEGDKTDFILSPRAYGRMALPDKSAE-LYSYGVVNVEFRRVPCWYKG  171

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L+ K+H+NS+YPHYL+I +    G +D+ AVEI++E+  +W++MRRAFGAV+D+++PP
Sbjct  172  YNLQFKVHENSRYPHYLAIAILYVAGQNDVLAVEIWQEDYQEWVAMRRAFGAVFDISSPP  231

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G + +RF VS SA   WV +  A IP++WKAG+  E+ I
Sbjct  232  EGAISLRFQVSGSAGLTWVVANNA-IPSDWKAGVAYESEI  270



>ref|XP_008340760.1| PREDICTED: expansin-like B1 [Malus domestica]
Length=251

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 147/221 (67%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  G P GACG+G+YGR  N G+V AVS  L++NG  CGACYQVRCK   
Sbjct  30   SSRATYYGSPDCYGTPTGACGFGEYGRKINDGQVTAVSG-LWRNGTGCGACYQVRCKVXQ  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             CS  G     TDY EG  TDFI S RA+  LA  P  +E L   G V++E+RR+ C  S
Sbjct  89   HCSSDGVTAAVTDYGEGDRTDFIFSARAYAKLATNPASSEVLFASGVVEIEYRRIPCKFS  148

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               +  K+H++S+YP YL+I++ +  G +DI AVE+++E+  QW  MRRA+GAVWDL  P
Sbjct  149  GNNIVFKVHEHSKYPQYLAIVIQDVAGVNDITAVEVWQEDCQQWRPMRRAYGAVWDLPTP  208

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RF V  SA  +WV++ K +IPA+WKAG   +++I
Sbjct  209  PMGSLSLRFQVXGSAEVKWVQANK-VIPADWKAGAAYQSDI  248



>ref|XP_002273896.1| PREDICTED: expansin-like B1 [Vitis vinifera]
 emb|CBI38517.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 156/225 (69%), Gaps = 5/225 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F+ SRA+YY + D +G P GACG+G+YGR+ N G V AVS RL++NG  CGACYQV
Sbjct  24   CEDTFTYSRATYYGSPDCLGTPTGACGFGEYGRSVNGGNVGAVS-RLYRNGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D G KV+ TD+ EG  TDFILS R F+ LA+ P MA  L   G V +E+RR
Sbjct  83   RCKVPNLCADNGMKVVVTDHGEGDYTDFILSPRGFSMLAR-PNMAADLFAYGVVGIEYRR  141

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + +  K+H++S++P YL+I++  Q G SDI AV+I++E+  +W  MR+++GAV
Sbjct  142  VPCQYPGSNIFFKVHEHSRFPDYLAIVMLYQAGLSDITAVDIWQEDCQEWKGMRKSYGAV  201

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIET  121
            WD+ANPP G + +RF VS     +WV+    +IP++WKAG+  ++
Sbjct  202  WDMANPPKGPVGLRFQVSGRGGQKWVQLMN-VIPSDWKAGVAYDS  245



>ref|XP_008238372.1| PREDICTED: expansin-like B1 [Prunus mume]
Length=252

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 155/227 (68%), Gaps = 5/227 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q  F+ SRA+YY + D  G P GACGYG+YGR  N G+V AV+ RL++NG  CGACYQVR
Sbjct  25   QDTFTCSRATYYGSPDCYGTPTGACGYGEYGRTVNDGQVTAVA-RLYRNGTGCGACYQVR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            C+    CS  G   + TDY EG  TDFI S RA+  LA  P  AE L   G V++E+RR+
Sbjct  84   CREPQHCSSDGVNAVVTDYGEGDRTDFIFSQRAYAKLASNPAAAERLFAYGVVEIEYRRI  143

Query  429  SC--NSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
             C  +  A L +K+H++S+YP YL+I++    G +DI +VE+++E+  QW +MRRA GAV
Sbjct  144  PCRYSGRANLVLKVHEHSKYPEYLAIVIQYVAGQNDIISVELWQEDYKQWRAMRRADGAV  203

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +D  NPPSG L VRF VS SA  ++V++ +A IP +WKAG++ ET+I
Sbjct  204  FDTPNPPSGSLNVRFQVSGSAGVKFVQANQA-IPGDWKAGVSYETDI  249



>ref|XP_007039691.1| Expansin-like B1, BETA 3.1,EXLB1 [Theobroma cacao]
 gb|EOY24192.1| Expansin-like B1, BETA 3.1,EXLB1 [Theobroma cacao]
Length=250

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 155/228 (68%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F  SRA+YY + D +G P+GACG+G+YGR  N   V  VS RL+KNG  CGACYQ
Sbjct  23   YSQDYFVRSRATYYGSPDCLGTPSGACGFGEYGRTVNDANVAGVS-RLYKNGTGCGACYQ  81

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC +  LC D G  ++ TDY EG  TDFILS RA+T +A+    A+ L   G VDVE++
Sbjct  82   VRCTNPQLCDDNGVNIVVTDYGEGDHTDFILSPRAYTRMARSNTAAQ-LFAYGVVDVEYQ  140

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            R+ C     KL+ K+H++S+YP YL+I++    G ++I A+EIY E+  QWI MRRA+GA
Sbjct  141  RIPCGYGGKKLQFKVHEHSRYPSYLAIVILYPAGRNEIQAIEIYREDCKQWIGMRRAYGA  200

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D+ANPP G + +RF VS SA   WV++  A IP+ W+AG+  E++I
Sbjct  201  VYDMANPPQGSISLRFQVSGSAGLTWVQAPNA-IPSNWEAGVAYESDI  247



>ref|XP_010246083.1| PREDICTED: expansin-like B1 isoform X1 [Nelumbo nucifera]
Length=250

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 154/227 (68%), Gaps = 5/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            CQ  F+ SRA+YY + D +G P GACG+G++GR  N G+V AV  RL+KNG  CGACYQV
Sbjct  24   CQGTFTCSRATYYGSPDCLGTPRGACGFGEFGRIVNGGDVGAVH-RLYKNGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D G  ++ TD+ EG  TDFILS RAFT LA+ P  A  L   G VD+EFRR
Sbjct  83   RCKRPELCTDDGVNIVVTDHGEGDYTDFILSPRAFTKLAR-PSRAYDLMAYGVVDIEFRR  141

Query  432  VSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            +SC      L +K+H++S+YP+YL+I++  Q G  DI AV++++EE  +W  MR A+GAV
Sbjct  142  ISCQYPGYNLMIKVHEHSRYPYYLAIVIIYQSGQKDITAVDVWQEEYKEWRCMRNAYGAV  201

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ANPP   + +R  +S     +WV+   ++IP +WKAG+  ++ I
Sbjct  202  WDMANPPKDAVSLRLQISGDDGQKWVQL-NSVIPTDWKAGVAYDSAI  247



>ref|XP_002269095.2| PREDICTED: expansin-like B1 [Vitis vinifera]
 emb|CBI29509.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 155/227 (68%), Gaps = 5/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F+ SRA+YY T+D +G P GACG+G+YGRN N G V AVS RL+++G  CGACYQV
Sbjct  24   CEDTFTYSRATYYGTSDGLGTPTGACGFGEYGRNVNGGNVGAVS-RLYRDGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D+G KV+ TD+  G +TDFILS   F+ LA+ P  A  L   G V +E+RR
Sbjct  83   RCKIPKLCADVGMKVVVTDHGGGDDTDFILSRHGFSMLAR-PNKAADLFAYGVVGIEYRR  141

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + +  K+H+NS++P YL++++  Q G SDI AV+I++E++  W  MR+++GAV
Sbjct  142  VPCQYPGSNIFFKVHENSRFPDYLALVMLYQAGLSDITAVDIWQEDSQAWKGMRKSYGAV  201

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ANPP G + +RF VS     +WV+    +IP+ WKAG+  ++  
Sbjct  202  WDMANPPKGPVSLRFQVSGRRGQKWVQLMN-VIPSHWKAGVAYDSKF  247



>ref|XP_006368949.1| Expansin-related protein 1 precursor [Populus trichocarpa]
 gb|ERP65518.1| Expansin-related protein 1 precursor [Populus trichocarpa]
Length=251

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 151/225 (67%), Gaps = 4/225 (2%)
 Frame = -1

Query  786  QQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRC  607
            Q    SRA+Y+ + D +G P GACG+G YGR  N   V  VS RLFKNG  CG CYQVRC
Sbjct  27   QDYTCSRATYFGSPDCLGTPTGACGFGGYGRTVNDANVAGVS-RLFKNGTGCGGCYQVRC  85

Query  606  KSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
            K+S LCSD G  V+ TDY EG +TDFILS RA+  +A+ P MA  L   G VDVEFRR+ 
Sbjct  86   KASNLCSDDGVNVVVTDYGEGDKTDFILSTRAYARMAR-PNMALELFAYGVVDVEFRRIP  144

Query  426  CN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C  +   L  K+H++S++P YL+I+L  Q G ++I AVE+ +E+  +W  MRRA+GAVWD
Sbjct  145  CRYNGYNLMFKVHEHSRFPEYLAIVLLYQAGQNEILAVELRQEDCKEWRGMRRAYGAVWD  204

Query  249  LANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            + NPP G + ++  V  SA   WV+++  ++P++WKAG+  ++ I
Sbjct  205  IPNPPKGAISLKLQVCGSAGVTWVQADN-VLPSDWKAGVAYDSAI  248



>ref|XP_002270175.2| PREDICTED: expansin-like B1 [Vitis vinifera]
 emb|CBI29507.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 155/227 (68%), Gaps = 5/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F+ SRA+YY T D +G P GACG+G+YGR+ N G V AVS RL+++G  CGACYQV
Sbjct  24   CEDAFTYSRATYYGTPDGLGTPTGACGFGEYGRSVNGGNVGAVS-RLYRDGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D+G KV+ TD+  G +TDFILS R F+ LA+ P  A  L   G V +E+RR
Sbjct  83   RCKMPNLCADVGMKVVVTDHGGGDDTDFILSRRGFSMLAR-PNKAADLFAYGVVGIEYRR  141

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + +  K+H+NS++P YL++++  Q G SDI AV+I++E++  W  MR++ GAV
Sbjct  142  VPCQYPGSNIFFKVHENSRFPDYLALVMLYQAGLSDITAVDIWQEDSQAWKGMRKSHGAV  201

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ NPP G + +RF VS     +WV+    +IP++WKAG+  ++N 
Sbjct  202  WDMPNPPKGPVSLRFQVSGRRGQKWVQLMN-VIPSDWKAGVAYDSNF  247



>emb|CDY09659.1| BnaC07g34020D [Brassica napus]
Length=250

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 148/221 (67%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACGYG+ GR+ N GEV  VSSRL+KNGA CGACYQV+CK   
Sbjct  29   SSRATYYGSPDCKGNPQGACGYGELGRDINDGEVSGVSSRLWKNGAGCGACYQVKCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             C++ G  V+ATDY EG  TDFI S +A+ ++A+ P     L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDYGEGDGTDFIFSPKAYGSMAR-PGTEFQLYSFGVVDVEYQRVPCRYG  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  KIH+ S  PH+L+IL+   GG +DI AVEI++E+  +W  MRR FGAV D  NP
Sbjct  148  GYNLVYKIHEKSYNPHHLAILILYVGGVNDILAVEIWQEDCKEWKRMRRVFGAVHDYQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WVES+ A +PA+W AG T  +NI
Sbjct  208  PRGTLSLRFLVYGSAGLNWVESQNA-LPADWTAGATYNSNI  247



>ref|XP_009136814.1| PREDICTED: expansin-like B1 [Brassica rapa]
Length=250

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACGYG+ GR+ N GEV  VSSRL+KNGA CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCKGNPRGACGYGELGRDINDGEVSGVSSRLWKNGAGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             C++ G  V+ATDY EG  TDFI S +A+  +A+ P     L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDYGEGDGTDFIFSPKAYGRMAR-PGTEFQLYSFGVVDVEYQRVPCRYG  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  KIH+ S  PHYL+IL+   GG +DI AVE+++E+  +W  MRR FGAV D  NP
Sbjct  148  GYNLVYKIHEKSYNPHYLAILILYVGGVNDILAVEVWQEDCKEWKRMRRVFGAVHDYQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WVES+   +PA+W AG T  +NI
Sbjct  208  PRGTLSLRFLVYGSAGLNWVESQNP-LPADWTAGATYNSNI  247



>ref|XP_003635563.2| PREDICTED: expansin-like B1 [Vitis vinifera]
Length=251

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 155/225 (69%), Gaps = 5/225 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F+ SRA+YY + D +G P GACG+G+YGR+ N G V AVS RL++NG  CGACYQV
Sbjct  24   CEDTFTYSRATYYGSPDCLGTPTGACGFGEYGRSVNGGNVGAVS-RLYRNGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D G KV+ TD+ EG  TDFILS R F+ LA+ P MA  L   G V +E+RR
Sbjct  83   RCKVPNLCADNGMKVVVTDHGEGDYTDFILSPRGFSMLAR-PNMAADLFAYGVVGIEYRR  141

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + +  K+H++S++P YL+I++  Q G SDI AV+I++E+  +W  MR+++GAV
Sbjct  142  VPCQYPGSNIFFKVHEHSRFPDYLAIVMLYQAGLSDITAVDIWQEDCQEWKGMRKSYGAV  201

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIET  121
            WD+ANPP G + +RF VS     +WV+    I+ ++WKAG+  ++
Sbjct  202  WDMANPPKGPVGLRFQVSGRGGQKWVQLMNVIL-SDWKAGVAYDS  245



>emb|CAN78704.1| hypothetical protein VITISV_028656 [Vitis vinifera]
Length=251

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 154/227 (68%), Gaps = 5/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F+ SRA+YY T+D +G P GACG+G+YGRN N G V AVS RL+++G  CGACYQV
Sbjct  24   CEDTFTYSRATYYGTSDGLGTPTGACGFGEYGRNVNGGNVGAVS-RLYRDGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D+G KV+ TD+  G +TDFILS   F+ LA+ P  A  L   G V +E+ R
Sbjct  83   RCKIPKLCADVGMKVVVTDHGGGDDTDFILSRHGFSMLAR-PNKAADLFAYGVVGIEYXR  141

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + +  K+H+NS++P YL++++  Q G SDI AV+I++E++  W  MR+++GAV
Sbjct  142  VPCQYPGSNIFFKVHENSRFPDYLALVMLYQAGLSDITAVDIWQEDSQAWKGMRKSYGAV  201

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ANPP G + +RF VS     +WV+    +IP+ WKAG+  ++  
Sbjct  202  WDMANPPKGPVSLRFQVSGRRGQKWVQLMN-VIPSHWKAGVAYDSKF  247



>ref|XP_009801873.1| PREDICTED: expansin-like B1 [Nicotiana sylvestris]
Length=252

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 154/229 (67%), Gaps = 6/229 (3%)
 Frame = -1

Query  792  YCQQ--NFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACY  619
            YC++  +  +RA+YY + D  G P+GACG+G+YGR    G+V  VS RL+KNG  CGACY
Sbjct  24   YCEEANSLYTRATYYGSPDCYGTPSGACGFGEYGRKIYDGKVSGVS-RLYKNGTGCGACY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRCK +G C+D G K++ TDY EG  TDFILS RA++ +A Q  MA  L   G VDVE+
Sbjct  83   QVRCKIAGHCTDEGTKIVVTDYGEGDHTDFILSVRAYSEMASQG-MANHLLAYGVVDVEY  141

Query  438  RRVSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            RR+ C      L +K+H+NS++ +YL+I+   Q GA D+ AVE+++ +  +W  MR+A+G
Sbjct  142  RRIPCRYYGYNLMIKVHENSRFSNYLAIVPIYQSGAFDVEAVEVWQADCKEWRGMRKAYG  201

Query  261  AVWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            AVWD+ NPP G L  R  VS S   +WV+    ++P EWKAG+  +TN+
Sbjct  202  AVWDMPNPPKGSLTFRVQVSVSGEVKWVQLAD-VLPDEWKAGIAYDTNL  249



>ref|XP_010434732.1| PREDICTED: expansin-like B1 [Camelina sativa]
Length=250

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D   NP G CGYG++GR+ N GEV  VS RL+ NG  CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCKANPRGHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G  V+ATD  EG  TDFILS +A+  +A+ P     L   G VDVE++R+ C  A
Sbjct  89   HCSEEGVYVVATDSGEGHGTDFILSPKAYGRMAR-PGTENQLYSFGVVDVEYQRIPCRYA  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL+IL+   GG +DI AVE+++E+  +WI MRR FGAV DL NP
Sbjct  148  GYNLVFKVHEKSYNPHYLAILVLYVGGVNDILAVEVWQEDCKEWIRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WV+S  A IPA+W AG T ++NI
Sbjct  208  PRGALTLRFLVYGSAGINWVQSPNA-IPADWTAGATYDSNI  247



>emb|CDY42954.1| BnaA01g18000D [Brassica napus]
Length=250

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACGYG++GR+ N GEV  VSSRL+ NG  CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCTGNPRGACGYGEFGRDINNGEVSGVSSRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             C++ G  V+ATDY EG  TDF+ S +A+  +A+ P   + L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDYGEGHGTDFVFSPKAYGRMAR-PGTEDQLYSFGVVDVEYQRVPCKYD  147

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL++L+   GG +DI AVE ++E+  +W  MRR FGAV DL NP
Sbjct  148  GYNLVYKVHEKSYNPHYLAVLILYVGGVNDILAVEAWQEDCKEWRRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   W++S  A +PA+W AG T  +NI
Sbjct  208  PRGTLTLRFLVYGSAGINWIQSPNA-LPADWTAGATYNSNI  247



>ref|NP_001288835.1| expansin-like B1 precursor [Brassica rapa]
 gb|AGM16373.1| beta-expansin-like protein 1 [Brassica rapa]
Length=250

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACGYG++GR+ N GEV  VSSRL+ NG  CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCKGNPRGACGYGEFGRDINNGEVSGVSSRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             C++ G  V+ATDY EG  TDF+ S +A+  +A+ P   + L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDYGEGHGTDFVFSPKAYGRMAR-PGTEDQLYSFGVVDVEYQRVPCKYD  147

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL++L+   GG +DI AVE ++E+  +W  MRR FGAV DL NP
Sbjct  148  GYNLVYKVHEKSYNPHYLAVLILYVGGVNDILAVEAWQEDCKEWRRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   W++S  A +PA+W AG T  +NI
Sbjct  208  PRGTLTLRFLVYGSAGINWIQSPNA-LPADWTAGATYNSNI  247



>ref|XP_009136818.1| PREDICTED: expansin-like B1 [Brassica rapa]
 emb|CDY65447.1| BnaA03g58070D [Brassica napus]
Length=250

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GN  GACGYG++GR+ N GEV  VSSRL+KNGA CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCKGNSRGACGYGEFGRDINDGEVSGVSSRLWKNGAGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             C++ G  V+ATDY EG  TDFI S +A+  +A+ P     L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDYGEGDGTDFIFSPKAYGRMAR-PGTEFQLYSFGVVDVEYQRVPCRYG  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  KIH+ S  PHYL++L+   GG +DI AVE ++E+  +W  MRR FGAV D  NP
Sbjct  148  GYNLVYKIHEKSYNPHYLAVLILYVGGVNDILAVEFWQEDCKEWKRMRRVFGAVHDYQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WVES+ A +PA+W AG T  +NI
Sbjct  208  PRGTLSLRFLVYGSAGLNWVESQNA-LPADWTAGATYNSNI  247



>ref|XP_010449686.1| PREDICTED: expansin-like B1 [Camelina sativa]
Length=249

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D   NP G CGYG++GR+ N G+V  VS RL+ NG  CGACYQVRCK   
Sbjct  28   SSRATYYGSPDCKANPRGHCGYGEFGRDINNGDVSGVSWRLWNNGTGCGACYQVRCKIPP  87

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G  V+ATD  EG  TDFILS +A+  +A+ P     L   G VDVE++R+ C  A
Sbjct  88   HCSEEGVYVVATDSGEGHGTDFILSPKAYGRMAR-PGTENQLYSFGVVDVEYQRIPCRYA  146

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL+IL+   GG +DI AVE+++E+  +WI MRR FGAV DL NP
Sbjct  147  GYNLVFKVHEKSYNPHYLAILVLYVGGVNDILAVEVWQEDCKEWIRMRRVFGAVHDLQNP  206

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WV+S  A IPA+W AG T ++NI
Sbjct  207  PRGALTLRFLVYGSAGINWVQSPNA-IPADWTAGATYDSNI  246



>ref|XP_010440069.1| PREDICTED: expansin-like B1 [Camelina sativa]
Length=250

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 145/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D   NP G CGYG++GR+ N GEV  VS RL+ NG  CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCKANPRGHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G  V+ATD  EG  TDFILS +A+  +A+ P     L   G VDVE++R+ C  A
Sbjct  89   HCSEEGVYVVATDSGEGHGTDFILSPKAYGRMAR-PGTENQLYSFGVVDVEYQRIPCRYA  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL+IL+   GG +DI AVE+++E   +WI MRR FGAV DL NP
Sbjct  148  GYNLVYKVHEKSYNPHYLAILVLYVGGVNDILAVEVWQEGCKEWIRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WV+S  A IPA+W AG T ++NI
Sbjct  208  PRGALTLRFLVYGSAGINWVQSPNA-IPADWTAGATYDSNI  247



>ref|XP_007039694.1| Expansin-like B1, BETA 3.1,EXLB1 [Theobroma cacao]
 gb|EOY24195.1| Expansin-like B1, BETA 3.1,EXLB1 [Theobroma cacao]
Length=252

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 154/228 (68%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F  SRA+YY + D +G P+GACG+G+YGR  N   V  VS RL+KNGA CGACYQ
Sbjct  25   YSQDYFVRSRATYYGSPDCLGTPSGACGFGEYGRTVNDANVAGVS-RLYKNGAGCGACYQ  83

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC +  LC   G  V+ TDY EG  TDFILS RA+T +A+    A+ L   G VDVEF+
Sbjct  84   VRCTNPQLCDGNGVNVVVTDYGEGDHTDFILSPRAYTRMARSNTAAQ-LFAYGVVDVEFQ  142

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            R+ C     KL+ K+ + S+YP YL+I++  Q G +DI AV+I+ E+  QWI MRRA+GA
Sbjct  143  RIPCRYGGHKLQFKVQEQSRYPSYLAIVILYQTGKNDIQAVDIWREDCKQWIGMRRAYGA  202

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D+A+PP G + +R  VS SA   WV++   +IP++WKAG+  E++I
Sbjct  203  VFDMASPPQGAVSLRLQVSGSAGLTWVQAPN-VIPSDWKAGVAYESDI  249



>ref|XP_006284415.1| hypothetical protein CARUB_v10005585mg [Capsella rubella]
 gb|EOA17313.1| hypothetical protein CARUB_v10005585mg [Capsella rubella]
Length=250

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + +   NP G CGYG++GR+ N GEV  VS RL+ NG  CGACYQVRCK   
Sbjct  29   SSRATYYGSPECKANPRGHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G  V+ATD  EG  TDFILS +A+  +A+ P     L   G VDVE++R+ C  A
Sbjct  89   HCSEEGVYVVATDSGEGDGTDFILSPKAYGRMAR-PGTENQLYSFGVVDVEYQRIPCRYA  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  KIH+ S  PHYL+IL+   GG +DI AVE+++E+  +WI MRR FGAV DL NP
Sbjct  148  GYNLVYKIHEKSYNPHYLAILVLYVGGINDILAVEVWQEDCKEWIRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WV+S  A IPA+W AG T ++NI
Sbjct  208  PRGTLTLRFLVYGSAGINWVQSPNA-IPADWTAGATYDSNI  247



>emb|CDY35606.1| BnaC01g21280D [Brassica napus]
Length=250

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 145/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACGYG++GR+ N GEV  VSSRL+ NG  CGACYQVRCK   
Sbjct  29   SSRATYYGSPDCKGNPRGACGYGEFGRDINNGEVSGVSSRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             C++ G  V+ATDY EG  TDF+ S +A+  +A+ P   + L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDYGEGHGTDFVFSPKAYGRMAR-PGTEDQLYSFGVVDVEYQRVPCKYD  147

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL++L+   GG +DI AVE ++E+  +W  MRR FG V DL NP
Sbjct  148  GYNLVYKVHEKSYNPHYLAVLILYVGGVNDILAVEAWQEDCKEWRRMRRVFGTVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   W++S  A +PA+W AG T  +NI
Sbjct  208  PRGTLTLRFLVYGSAGINWIQSPNA-LPADWTAGATYNSNI  247



>ref|XP_002868090.1| hypothetical protein ARALYDRAFT_915018 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44349.1| hypothetical protein ARALYDRAFT_915018 [Arabidopsis lyrata subsp. 
lyrata]
Length=250

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 145/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            +SRA+YY + D   NP G CGYG++GR+ N GEV  VS RL+ NG  CGACYQVRCK   
Sbjct  29   NSRATYYGSPDCQANPRGHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G  V+ATD  EG  TDFILS +A+  +A+ P     L   G VDVE++R+ C  A
Sbjct  89   HCSEEGVYVVATDSGEGDGTDFILSPKAYGRMAR-PGTENQLYSFGVVDVEYQRIPCRYA  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  K+H+ S  PHYL+ILL   GG +DI AVE+++E+  +W  MRR FGAV DL NP
Sbjct  148  GYNLVYKVHEKSYNPHYLAILLLYVGGVNDILAVEVWQEDCKEWRRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   W++S  A IPA+W AG T ++NI
Sbjct  208  PRGTLTLRFLVYGSAGINWIQSPNA-IPADWTAGATYDSNI  247



>ref|XP_004300332.1| PREDICTED: expansin-like B1-like [Fragaria vesca subsp. vesca]
Length=249

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 148/226 (65%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q  F+ SRA+YY + D  GNP GACGYG++GR  N G+V AV+ RL++NG  CG CY+VR
Sbjct  23   QDTFTRSRATYYGSPDCYGNPTGACGYGEFGRTVNDGQVSAVA-RLYRNGTGCGGCYKVR  81

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            C     CS+ G  V+ TDY EG  TDFI + +A+  LA  P   E L   G VD+EFRR+
Sbjct  82   CIYPPHCSNEGVNVVVTDYGEGDRTDFIFTPKAYGKLANSPASTEILFAYGVVDIEFRRI  141

Query  429  SCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C      L  K+H++S+ P YL+I++    G +DI AVE+++E+  +W  MRR FGAVW
Sbjct  142  PCQYPTPNLVFKVHEHSKAPLYLAIVMQYVAGQNDITAVELWQEDCKEWRGMRRVFGAVW  201

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D  +PPSG + +RF VS SA  +WV++ KA IP++WKAG    ++I
Sbjct  202  DTQSPPSGSIDMRFQVSGSAGVKWVQAPKA-IPSDWKAGAAYTSDI  246



>ref|XP_009371043.1| PREDICTED: expansin-like B1 [Pyrus x bretschneideri]
Length=254

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 149/224 (67%), Gaps = 6/224 (3%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACGYG+YGR  N G+V AVS RL++NG  CGACYQVRCK   
Sbjct  30   SSRATYYGSPDCYGNPTGACGYGEYGRKVNDGQVSAVS-RLYRNGTGCGACYQVRCKIPQ  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             C+  G   + TD+ EG  TDFI S R++  LA  P  +E L   G V++E+RRV+C  S
Sbjct  89   HCNSDGVTTVVTDHGEGDRTDFIFSPRSYAKLANSPASSEVLFASGVVEIEYRRVACRFS  148

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
              +L  K+H+ S+YP Y ++++    G +DI AVE++EE+  QW  MRR +GAVWDL NP
Sbjct  149  GYRLVFKVHEGSKYPFYFALVIQYLSGINDITAVEVWEEDREQWRPMRRVYGAVWDLQNP  208

Query  237  PSGELRVRFLVSS---SAAARWVESEKAIIPAEWKAGLTIETNI  115
            P+G L +RF + S   +A   W+++ K +IPA+W+AG    ++I
Sbjct  209  PTGPLSLRFQIVSGRATAEVDWMQATK-VIPADWEAGAAYPSDI  251



>ref|XP_006440179.1| hypothetical protein CICLE_v10021884mg [Citrus clementina]
 gb|ESR53419.1| hypothetical protein CICLE_v10021884mg [Citrus clementina]
Length=247

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 148/228 (65%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F SSRA+YY + D +G P GACG+G YGR  N   V  VS RL+ NG  CG CYQ
Sbjct  20   YSQYTFTSSRATYYGSPDGLGTPTGACGFGGYGRTVNDANVAGVS-RLWNNGTGCGTCYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY EG +TDFILS RA+  +A   + +E L   G VDVEF 
Sbjct  79   VRCTVPEVCTDYGVSVVVTDYGEGDDTDFILSPRAYGRMAITDK-SEKLYSYGVVDVEFE  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RVSC      +  K+H+NS+YP YL++ +   GG +D+ AVEI+ ++ ++W++MRRAFGA
Sbjct  138  RVSCRFRGYNVMFKVHENSRYPQYLAVSMLYVGGQNDVLAVEIWRKDRHEWVAMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D+ NPP G + +RF VS SA   WV +  A IP  WKAG+  E+ I
Sbjct  198  VFDIPNPPPGAINLRFQVSGSAGLTWVVANNA-IPKIWKAGVAYESAI  244



>ref|XP_009608881.1| PREDICTED: expansin-like B1 [Nicotiana tomentosiformis]
Length=254

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 154/231 (67%), Gaps = 8/231 (3%)
 Frame = -1

Query  792  YCQQ--NFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACY  619
            YC++  +  +RA+YY + D  G P+GACG+G+YGR    G+V  VS RL++NG  CGACY
Sbjct  24   YCEEANSLYTRATYYGSPDCYGTPSGACGFGEYGRKIYDGKVSGVS-RLYRNGTGCGACY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRCK  G C+D G K++ TDY EG  TDFILS RA++ +A  P MA  L   G VDVE+
Sbjct  83   QVRCKVPGHCTDEGTKIVVTDYGEGDHTDFILSVRAYSEMA-SPGMASHLLAYGVVDVEY  141

Query  438  RRVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            RR+ C        +K+H+NS++P+YL+I+     GA D+ AVE+++ +  +W  MR+A+G
Sbjct  142  RRIPCRYYGYNFMIKVHENSRFPNYLAIVPIYLSGAFDVQAVEVWQADCKEWRGMRKAYG  201

Query  261  AVWDLANPPSGEL--RVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            AVWD+ NPP+G L  RV+   S+    +WV+    ++P EWKAG+  +TN+
Sbjct  202  AVWDMPNPPTGSLTFRVQLSFSAYGEVKWVQLAD-VLPDEWKAGIAYDTNL  251



>ref|XP_004511738.1| PREDICTED: expansin-like B1-like [Cicer arietinum]
Length=251

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 148/220 (67%), Gaps = 3/220 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D  GNP GACGYGDYG+  N G V  VS  L+KNG+ CGACYQVRCK   L
Sbjct  31   SRATYYGSPDCYGNPRGACGYGDYGQTVNDGNVAGVS-WLWKNGSGCGACYQVRCKIPQL  89

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C + G  V+ TDY  G  TDFI+S R ++ L K    +  L + G VDVE++RV C  + 
Sbjct  90   CDENGAYVIVTDYGVGDRTDFIMSPRGYSKLGKNGDASVELFKYGVVDVEYKRVPCKYNG  149

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              + +K+HD S+ PHYL+IL+   GG +D+ AV++++E+  +W +MRRAFG V+D  NPP
Sbjct  150  YNVLLKVHDRSKNPHYLAILVLYVGGTNDVIAVQLWQEDCQEWRTMRRAFGTVFDAENPP  209

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             GE+++RF VS SA   WVES K +I ++W+AG   ++ I
Sbjct  210  RGEIKLRFQVSGSAGLSWVES-KNVISSDWQAGAVYDSEI  248



>ref|NP_193436.2| expansin-like B1 [Arabidopsis thaliana]
 sp|O23547.2|EXLB1_ARATH RecName: Full=Expansin-like B1; Short=At-EXPR1; Short=AtEXLB1; 
Short=AtEXPR1; AltName: Full=Ath-ExpBeta-3.1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO64802.1| At4g17030 [Arabidopsis thaliana]
 dbj|BAF00176.1| Expansin-like protein [Arabidopsis thaliana]
 gb|AEE83841.1| expansin-like B1 [Arabidopsis thaliana]
Length=250

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 145/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            +SRA+YY + D   NP G CGYG++GR+ N GEV  VS RL+ NG  CGACYQVRCK   
Sbjct  29   NSRATYYGSPDCKANPRGHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS+ G  V+ATD  EG  TDFILS +A+  +A+ P     L   G V+VE++R+ C  A
Sbjct  89   HCSEEGVYVVATDSGEGDGTDFILSPKAYGRMAR-PGTENQLYSFGVVNVEYQRIPCRYA  147

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L  KIH+ S  PHYL+IL+   GG +DI AVE+++E+  +W  MRR FGAV DL NP
Sbjct  148  GYNLVYKIHEKSYNPHYLAILVLYVGGVNDILAVEVWQEDCKEWRRMRRVFGAVHDLQNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   W++S  A IPA+W AG T ++NI
Sbjct  208  PRGTLTLRFLVYGSAGINWIQSPNA-IPADWTAGATYDSNI  247



>ref|XP_011047565.1| PREDICTED: expansin-like B1 [Populus euphratica]
Length=255

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 149/226 (66%), Gaps = 5/226 (2%)
 Frame = -1

Query  786  QQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRC  607
            Q    SRA+Y+ + D +G P GACG+G YG   N   V  VS RLFKNG  CG CYQV C
Sbjct  30   QDYTCSRATYFGSPDCLGTPTGACGFGGYGTTVNDANVAGVS-RLFKNGTGCGGCYQVSC  88

Query  606  KSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
            K+  LCSD G  V+ TDY EG +TDFILS RA+  +A+ P MA  L   G VDVEFRR+ 
Sbjct  89   KAPNLCSDDGVNVVVTDYGEGDKTDFILSTRAYARMAR-PNMALELFAYGVVDVEFRRIP  147

Query  426  CN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C  S   L  K+H++S++P YL+I+L  Q G ++I AVE+ +E+  +W  MRRA+GAVWD
Sbjct  148  CRYSGYNLMFKVHEHSRFPEYLAIVLLYQAGQNEILAVELRQEDCKEWRGMRRAYGAVWD  207

Query  249  LANPPSGELRVRFLVSSSAAA-RWVESEKAIIPAEWKAGLTIETNI  115
            + NPP G + ++  V  SAA   WV+++  ++P++WKAG+  ++ I
Sbjct  208  MPNPPKGAISLKLQVCGSAAGVTWVQADN-VLPSDWKAGVAYDSAI  252



>gb|KDO38685.1| hypothetical protein CISIN_1g025810mg [Citrus sinensis]
Length=247

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 148/228 (65%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F SSRAS+Y + D +G P GACG+G YG+  N   V  VS RL+ NG  CGACYQ
Sbjct  20   YSQFTFTSSRASFYGSPDGLGTPAGACGFGAYGKTVNDANVAGVS-RLWNNGTGCGACYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY EG +TDF+LS RAF  +A   +  E  T  G VDVEF 
Sbjct  79   VRCNVPEVCTDYGVYVVVTDYGEGDDTDFVLSPRAFGRMALVDKSEELYT-FGVVDVEFL  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      L+ K+H+NS+YP YL++ +   GG +D+ AVE+++E+   W++MRRAFGA
Sbjct  138  RVPCRFRGYNLKFKVHENSKYPQYLAVSMLYVGGQNDVLAVEMWQEDCKDWVAMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D++NPP G + +RF VS SA   WV +  A IP  WKAG+  E+ I
Sbjct  198  VFDISNPPPGAINLRFQVSGSAGLTWVVANNA-IPQIWKAGVAYESAI  244



>gb|KHG25116.1| Expansin-like B1 [Gossypium arboreum]
Length=249

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 152/225 (68%), Gaps = 7/225 (3%)
 Frame = -1

Query  780  NFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            NF  SRA+YY   D +G P+GACG+G+YGRN + G V  V  RL+ NG  CGACYQVRC 
Sbjct  27   NFDKSRATYYSRPDGLGTPSGACGFGEYGRNISDGNVAGVY-RLYNNGIGCGACYQVRCT  85

Query  603  SSG-LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
            +S  +C+D G  ++ TDY +G  TDFILS+ AF A+A QP  A+ L   G VDVE++RV 
Sbjct  86   TSPQICTDKGVNIVVTDYGQGDNTDFILSHHAFEAMA-QPGTADRLFAYGVVDVEYQRVP  144

Query  426  CNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C     K++VK+H+ S+ P YL+I++  Q G SDI +V+I+++   +W+ MRR+FGAV++
Sbjct  145  CQYVGHKIQVKVHEYSRNPDYLAIIMLYQAGKSDIVSVDIWQQG--KWVEMRRSFGAVFN  202

Query  249  LANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            ++NPP G + +RF V  S  ++W      +IP  WKAG+  +TNI
Sbjct  203  MSNPPLGAISLRFNVQDSTGSKWAVEAPDVIPPNWKAGVAYDTNI  247



>ref|XP_006477088.1| PREDICTED: expansin-like B1-like [Citrus sinensis]
Length=247

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 147/228 (64%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F SSRA++Y + D +G P GACG+G YGR  N   V  VS RL+ NG  CGACYQ
Sbjct  20   YSQFTFTSSRATFYGSPDGLGTPAGACGFGAYGRTVNDANVAGVS-RLWNNGTGCGACYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY EG +TDF+LS RA+  +A   +  E  T  G VDVEF 
Sbjct  79   VRCNVPEVCTDYGVYVVVTDYGEGDDTDFVLSPRAYGRMALTDKSEELYT-FGVVDVEFL  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      L+ K+H+NS+YP YL++ +   GG +D+ AVEI++E+   W+ MRRAFGA
Sbjct  138  RVPCRFRGYNLKFKVHENSKYPQYLAVSMLYVGGQNDVQAVEIWQEDCKDWVPMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D++NPP G + +RF VS SA   WV +  A IP  WKAG+  E+ I
Sbjct  198  VFDISNPPPGAINLRFQVSGSAGLTWVVANNA-IPKVWKAGVAYESAI  244



>ref|XP_010933564.1| PREDICTED: expansin-like B1 [Elaeis guineensis]
Length=249

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 142/220 (65%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D  G P GACGYG+ GR+ N G+V AVS RL++NG  CGACYQVRC     
Sbjct  30   SRATYYGSPDCSGTPRGACGYGELGRSLNGGDVGAVS-RLYRNGTGCGACYQVRCTHPQF  88

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C++ G K++ TDY +G  TDFILS R F  LA+   MA  L   G +DVE+RR+ C    
Sbjct  89   CNEDGAKIVVTDYGQGDNTDFILSARGFVKLARS-NMANELMAFGVIDVEYRRIPCQYPG  147

Query  411  -KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              + VK+ ++S++P YL++++  Q G  DI AVE+++EE  +W  MR+A+G VWD+ANPP
Sbjct  148  YNMMVKVTEHSKFPDYLALIIIYQAGQKDILAVELWQEECQEWKGMRKAYGGVWDMANPP  207

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G +  R L    +   WV+    +IP+ WKAG+  +T I
Sbjct  208  RGPMNARILTGDDSGQNWVQL-NGVIPSGWKAGVAYDTAI  246



>ref|XP_008786197.1| PREDICTED: expansin-like B1 [Phoenix dactylifera]
Length=249

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/255 (42%), Positives = 157/255 (62%), Gaps = 13/255 (5%)
 Frame = -1

Query  873  FSLSKMTVFPIYFFTSlclilllpplCYCQQNFS-SRASYYKTNDEMGNPNGACGYGDYG  697
            F+L+   +  ++FF  +            Q  F+ SRA+YY + D  G P GACGYG++G
Sbjct  3    FTLTFSCLLSLFFFFPMLSSS--------QSTFTRSRATYYGSPDCSGTPRGACGYGEFG  54

Query  696  RNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQETDFILSY  517
            R+ N G+V AVS RL++NG  CGACYQVRC     C++ G K++ TDY +G  TDFILS 
Sbjct  55   RSLNGGDVGAVS-RLYRNGTGCGACYQVRCTHPQFCNEDGVKIVVTDYGQGDNTDFILSA  113

Query  516  RAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA-KLRVKIHDNSQYPHYLSILLTNQG  340
            R F  LA+   MA  L   G +DVE+RR+ C      + +++  +S++P+YL++++  Q 
Sbjct  114  RGFAKLARS-NMANELMAFGVIDVEYRRIPCRYPGYNMMLQVTQHSKFPNYLALIVIYQA  172

Query  339  GASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARWVESEKAI  160
            G  DI AVE+++E+  +W  MRRA+G VWD+ANPP G++  R L        WV +   +
Sbjct  173  GQKDILAVELWQEDCQEWKRMRRAYGGVWDMANPPRGQMNARILTGDDGGQSWV-ALNGV  231

Query  159  IPAEWKAGLTIETNI  115
            IP++WKAG+  +T I
Sbjct  232  IPSDWKAGVAYDTAI  246



>ref|XP_006414282.1| hypothetical protein EUTSA_v10026076mg [Eutrema salsugineum]
 gb|ESQ55735.1| hypothetical protein EUTSA_v10026076mg [Eutrema salsugineum]
Length=249

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 144/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA++Y + D   NP GACGYG++GR+ N GEV  VSSRL+ NG  CGACYQVRCK   
Sbjct  29   SSRATFYGSPDCKANPRGACGYGEFGRDINNGEVSGVSSRLWNNGTGCGACYQVRCKIPP  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             C++ G  V+ATDY  G   DFI S  A+  +A+ P   + L   G VDVE++RV C   
Sbjct  89   HCNEEGVYVVATDY-GGAGGDFIFSLEAYGRMAR-PGTEDQLYSFGVVDVEYKRVPCRYG  146

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             + L  K+H+ S  PHYL++L+   GG +DI AVE+++E+  +W  MRR FGAV DL NP
Sbjct  147  GSNLVYKVHEKSYNPHYLAVLILYVGGVNDILAVEVWQEDCKEWRRMRRVFGAVHDLENP  206

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RFLV  SA   WV+S  A +PA+W AG T  +NI
Sbjct  207  PRGTLSLRFLVYGSAGINWVQSPNA-LPADWTAGATYNSNI  246



>ref|XP_010104849.1| Expansin-like protein [Morus notabilis]
 gb|EXC02085.1| Expansin-like protein [Morus notabilis]
Length=251

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 150/225 (67%), Gaps = 5/225 (2%)
 Frame = -1

Query  783  QNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            Q   SRA+YY + D  G P GACG+G++GR  N G+V  VS +L++NG  CG CYQVRC 
Sbjct  26   QYTPSRATYYGSPDCYGTPRGACGFGEFGRTVNDGKVAGVS-KLYRNGTGCGTCYQVRCT  84

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
            +  LC+  G  ++ TDY EG  TDFILS R ++ LA     AE L   G VDVE++RVSC
Sbjct  85   NPQLCNYDGVTIVVTDYGEGDNTDFILSPRGYSNLALPNAEAE-LFAYGVVDVEYKRVSC  143

Query  423  N-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
              S   ++ K+H++S+YPHY ++++T   G +DI +VE+++E+  +W+ MRRAFGAVWD+
Sbjct  144  QYSGYNVKYKVHEHSKYPHYFALVITYAAGQNDITSVELWQEDCKEWVPMRRAFGAVWDM  203

Query  246  ANPPSGELRVRFLVSSSAA-ARWVESEKAIIPAEWKAGLTIETNI  115
            ANPP G + +RF V SSA    WV+S  A IP  W+AG   ++ I
Sbjct  204  ANPPRGYITLRFQVISSAGNTYWVQSTNA-IPENWEAGAVYDSKI  247



>ref|XP_006477090.1| PREDICTED: expansin-like B1-like [Citrus sinensis]
Length=247

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 149/228 (65%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q +F+ SRA+YY + D +G P GACG+G YG+  N G V  VSS L+ NG ACGACYQ
Sbjct  20   YSQYSFTNSRATYYGSPDGLGTPTGACGFGAYGKTVNDGNVAGVSS-LWNNGTACGACYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ATDY E  +T+FILS RA+  +A   +  E  T  G VDVEF 
Sbjct  79   VRCNVPEVCTDYGVYVLATDYGEEDDTEFILSPRAYGRMALTDKSEELYT-FGVVDVEFL  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      +  K+H+NS+YP YL++ +   GG +D+ AVEI++E+  +W++MRRAFGA
Sbjct  138  RVPCRFRGYNVMFKVHENSKYPQYLAVSMLYVGGQNDVLAVEIWQEDCKEWVAMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D+ NPP G + +R  VS SA  RWV +   +IP  WKAG+   + I
Sbjct  198  VFDIFNPPPGAINLRMQVSGSAGLRWVVANN-VIPKVWKAGVAYGSAI  244



>ref|XP_010246084.1| PREDICTED: expansin-like B1 isoform X2 [Nelumbo nucifera]
Length=241

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 149/227 (66%), Gaps = 14/227 (6%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            CQ  F+ SRA+YY          GACG+G++GR  N G+V AV  RL+KNG  CGACYQV
Sbjct  24   CQGTFTCSRATYY---------GGACGFGEFGRIVNGGDVGAVH-RLYKNGTGCGACYQV  73

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK   LC+D G  ++ TD+ EG  TDFILS RAFT LA+ P  A  L   G VD+EFRR
Sbjct  74   RCKRPELCTDDGVNIVVTDHGEGDYTDFILSPRAFTKLAR-PSRAYDLMAYGVVDIEFRR  132

Query  432  VSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            +SC      L +K+H++S+YP+YL+I++  Q G  DI AV++++EE  +W  MR A+GAV
Sbjct  133  ISCQYPGYNLMIKVHEHSRYPYYLAIVIIYQSGQKDITAVDVWQEEYKEWRCMRNAYGAV  192

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ANPP   + +R  +S     +WV+   ++IP +WKAG+  ++ I
Sbjct  193  WDMANPPKDAVSLRLQISGDDGQKWVQL-NSVIPTDWKAGVAYDSAI  238



>gb|AFK42530.1| unknown [Lotus japonicus]
Length=245

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 7/220 (3%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRASYY T+D  G P+GACG+G YGR  N G V AVS++L+KNG  CGACYQVRCK +  
Sbjct  31   SRASYYGTSDGYGTPSGACGFGGYGRTVNGGNVAAVSAKLWKNGGGCGACYQVRCKIAQY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C   G  V+ATDY EG  TDFILS RAF+ L +    +E L + G +DVE++RV C    
Sbjct  91   CDYNGAYVVATDYGEGDRTDFILSPRAFSKLGRNKNASEALKKYGVLDVEYKRVPCTFKG  150

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              +  +I+++S  P Y +I++   GG SDI AVEI  +E   W  +RR++GAV+D+ANPP
Sbjct  151  NNIVFQINEHSSNPGYFAIVILYVGGTSDITAVEILRKEYRPWEPLRRSYGAVFDIANPP  210

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +GE+R++F VS           K  IPA WKAG T  T +
Sbjct  211  TGEIRLKFQVSDGT------EPKIAIPANWKAGTTYSTKL  244



>gb|KDO57054.1| hypothetical protein CISIN_1g025837mg [Citrus sinensis]
Length=247

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 147/228 (64%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q +F+ SRA+YY + D +G P GACG+G YGRN N   V  VS RL+ NGA CG CYQ
Sbjct  20   YSQYSFTNSRATYYGSPDGLGTPTGACGFGGYGRNVNDANVAGVS-RLWNNGAGCGTCYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY EG +TDFILS RA+  +A   + +E L   G VDVEF 
Sbjct  79   VRCTVPEICTDEGVSVVVTDYGEGDDTDFILSPRAYGRMAVADK-SEELYSHGVVDVEFE  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      +  K+H+NS+YP YL++ +    G +D+ AVEI++++   W+ MRRAFGA
Sbjct  138  RVPCRFRGYNVMFKVHENSRYPQYLAVSMLYVSGQNDVLAVEIWQKDCRDWVPMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D++NP  GE+ +RF VS SA   WV +  A IP  WKAG+   + I
Sbjct  198  VFDISNPSPGEINLRFQVSGSAGFTWVVANNA-IPRAWKAGVAYGSAI  244



>ref|XP_006359217.1| PREDICTED: expansin-like B1-like [Solanum tuberosum]
Length=253

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 160/265 (60%), Gaps = 23/265 (9%)
 Frame = -1

Query  909  NTHCFSCSQMEIFSLSKMTVFPIYFFTSlclilllpplCYCQQNFSSRASYYKTNDEMGN  730
            N+HC       IF L  + ++P   +                 +  +RA+YY + D  G 
Sbjct  5    NSHCI------IFLLVTIIIYPAICYGQEA------------NSLYTRATYYGSPDCYGT  46

Query  729  PNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYV  550
            P+GACG+G+YGR    G+V  VS RL++NG  CGACYQVRCK  G C+D G K++ TD+ 
Sbjct  47   PSGACGFGEYGRKIYDGKVSGVS-RLYRNGTGCGACYQVRCKVPGHCTDEGTKIVVTDHG  105

Query  549  EGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA-KLRVKIHDNSQYP  373
            EG  TDFILS RA++ +A    MA  L   G VDVE+RRV C      L +K+H++S++ 
Sbjct  106  EGDHTDFILSVRAYSDMATS-GMANHLLAYGVVDVEYRRVPCTYYGYNLMIKVHEHSRFC  164

Query  372  HYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVS-SS  196
            +YL+I+   Q GA DI AVE+++ +  +W  MR+A+GAVWD+ NPP G L  R  VS + 
Sbjct  165  NYLAIVPIYQSGAFDIEAVEVWQADCKEWRGMRKAYGAVWDMPNPPKGSLTFRVQVSLNG  224

Query  195  AAARWVESEKAIIPAEWKAGLTIET  121
             AA+WV+    ++P EWKAG+  +T
Sbjct  225  EAAKWVQLAD-VLPDEWKAGIAYDT  248



>ref|XP_008373652.1| PREDICTED: expansin-like B1 [Malus domestica]
Length=254

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 146/224 (65%), Gaps = 6/224 (3%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRA+YY + D  GNP GACG+G+YG   N G+V AVS RL++NG  CGACYQVRCK   
Sbjct  30   SSRATYYGSPDCYGNPTGACGFGEYGTKVNDGQVSAVS-RLYRNGTGCGACYQVRCKIPQ  88

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
             CS  G   + TD+ EG  TDFI S R++  LA  P  +E L   G V++E+RRV+C  +
Sbjct  89   HCSSDGVTTVVTDHGEGDRTDFIFSPRSYAKLANSPASSEVLFASGVVEIEYRRVACRFS  148

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             K L  K+H+ S+YP Y ++++    G ++I AVE+ +E+  QW  MRR +GAVWDL NP
Sbjct  149  GKGLVFKVHEGSKYPFYFALVIQYVSGINEITAVEVLQEDNQQWRPMRRVYGAVWDLQNP  208

Query  237  PSGELRVRFLVSS---SAAARWVESEKAIIPAEWKAGLTIETNI  115
            P+G   +RF + S   +A   W+++ K +IPA+W+AG    ++I
Sbjct  209  PTGAFSLRFQIVSGRATAEVDWMQATK-VIPADWEAGAAYPSDI  251



>ref|XP_007156590.1| hypothetical protein PHAVU_002G001700g [Phaseolus vulgaris]
 gb|ESW28584.1| hypothetical protein PHAVU_002G001700g [Phaseolus vulgaris]
Length=251

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 147/226 (65%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  GNP GACG+G+YG+  N G V  VS  L+KNG+ CGACYQVR
Sbjct  25   QDSFTCSRATYYGSADCYGNPRGACGFGEYGKTVNDGSVAGVSW-LWKNGSGCGACYQVR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S R ++ L +    +  L + G VDVE+RRV
Sbjct  84   CKIPQFCDENGAYVVVTDYGEGDRTDFIMSPRGYSKLGRNTYASAELFKYGVVDVEYRRV  143

Query  429  SCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C      L VK+H++S+ PHYL+IL+   GG  DI AVE+++EE  +W  MRRAFG V+
Sbjct  144  PCRYGGYNLLVKVHEHSRNPHYLAILILYIGGTHDITAVELWQEECQEWRRMRRAFGTVF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D  NPP G++++RF +S +A   WV+S K +I   W+ G   ++ I
Sbjct  204  DAENPPRGDIKLRFQLSGNAEQYWVQS-KNVISGNWEGGAVYDSEI  248



>ref|XP_004148383.1| PREDICTED: expansin-like B1-like [Cucumis sativus]
 ref|XP_004165952.1| PREDICTED: expansin-like B1-like [Cucumis sativus]
 gb|KGN60459.1| hypothetical protein Csa_3G912910 [Cucumis sativus]
Length=254

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 150/230 (65%), Gaps = 7/230 (3%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q NF  SRA+YY + D  G P+GACG+G++GR  N G V AVS  L++NG+ CGACYQ
Sbjct  25   YSQDNFVYSRATYYGSPDCYGTPSGACGFGEFGRTVNDGNVAAVS-YLYRNGSGCGACYQ  83

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC +   CS  G  V+ TD+ EG  TDFILS RA+  +A  P  A  L   G VDVEFR
Sbjct  84   VRCTNPKYCSGSGAIVVVTDHGEGDYTDFILSPRAYAKMA-HPNTALQLFSYGVVDVEFR  142

Query  435  RVSCNSA--AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            RVSC     + L+ K+H++S++P YL+IL+    G +DI AVE+++E+  +W  MRR+ G
Sbjct  143  RVSCQYPYYSTLKFKVHEHSRFPDYLAILIIYVAGKNDITAVELWQEDCKEWKGMRRSHG  202

Query  261  AVWDLANPPSGELRVRFLVSSSAA-ARWVESEKAIIPAEWKAGLTIETNI  115
            AVWD+ANPP   +++RF VS S     WV +  A +P  WK G+  +T+I
Sbjct  203  AVWDMANPPKDNIKLRFQVSGSMGYGNWVVANNA-LPNYWKPGVAYDTDI  251



>ref|XP_003549947.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN01624.1| Expansin-like B1 [Glycine soja]
Length=251

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 152/226 (67%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  GNP GACG+G+YGR  N G V  VS RL++NG+ CGACYQ R
Sbjct  25   QDSFTDSRATYYGSPDCYGNPRGACGFGEYGRTVNDGSVAGVS-RLWRNGSGCGACYQAR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S RA++ L +    +  L + G VD+E+RRV
Sbjct  84   CKIPQYCDENGAYVVVTDYGEGDRTDFIMSPRAYSRLGRNADASAELFKYGVVDIEYRRV  143

Query  429  SCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C+ +   +  K+H++S+ P Y ++++    G  D+ AVE+++++  +W  MRRAFGA++
Sbjct  144  PCSYTGYNVVFKVHEHSRNPDYFAVVVLYVDGTYDVTAVELFQQDCQEWKPMRRAFGAMF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D +NPP+GE+ +RF VS SA   WV+S+ A I  +WKAG T +TN+
Sbjct  204  DYSNPPNGEIYLRFQVSGSAGLYWVQSKNA-ISGDWKAGATYDTNV  248



>ref|XP_003517398.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN42655.1| Expansin-like B1 [Glycine soja]
Length=251

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 150/226 (66%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  GNP GACG+G+YG+  N G V  VS  L+KNG+ CGACYQVR
Sbjct  25   QDSFTCSRATYYGSPDCYGNPRGACGFGEYGKTVNDGSVAGVSW-LWKNGSGCGACYQVR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S RA++ L +    +  L + G +DVE+RRV
Sbjct  84   CKIPQFCDENGAYVVVTDYGEGDRTDFIMSPRAYSRLGRNADASAELFKYGVMDVEYRRV  143

Query  429  SCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C      L VK+H++S+ PHYL+I++   GG  D+ AVE+++E+  +W  MRRAFG V+
Sbjct  144  PCRYGGYNLLVKVHEHSRNPHYLAIVILYLGGTYDVTAVELWQEDCQEWRRMRRAFGTVF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D  NPP G++++RF +S +A   WV+SE  +I ++W+ G   ++ I
Sbjct  204  DAENPPRGDIKLRFQLSGNAEKYWVQSEN-VISSDWEGGAVFDSEI  248



>ref|XP_008465892.1| PREDICTED: expansin-like B1 [Cucumis melo]
Length=254

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 150/230 (65%), Gaps = 7/230 (3%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q NF  SRA+YY + D  G P+GACG+G++GR  N G V AVS  L++NG+ CGACYQ
Sbjct  25   YSQDNFVYSRATYYGSPDCYGTPSGACGFGEFGRTVNDGNVAAVS-YLYRNGSGCGACYQ  83

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC +   CS  G  V+ TD+ EG  TDFILS RA+  +A  P  A  L   G VDVEFR
Sbjct  84   VRCTNPKYCSGSGAIVVVTDHGEGDYTDFILSPRAYAKMA-HPNTALQLFSYGVVDVEFR  142

Query  435  RVSCNSA--AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            RVSC       L+ K+H++S++P YL+IL+    G +DI AVE+++E+  +W  MRR+ G
Sbjct  143  RVSCQYPYYNTLKFKVHEHSRFPDYLAILIIYVAGKNDITAVELWQEDCNEWKGMRRSHG  202

Query  261  AVWDLANPPSGELRVRFLVSSSAA-ARWVESEKAIIPAEWKAGLTIETNI  115
            AVWD+ANPP   +++RF VS S     W+ +  A +P+ WK G+  +T+I
Sbjct  203  AVWDMANPPKDNIKLRFQVSGSMGYGNWIVANNA-LPSYWKPGVAYDTDI  251



>ref|XP_004245823.1| PREDICTED: expansin-like B1 [Solanum lycopersicum]
Length=253

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 159/265 (60%), Gaps = 23/265 (9%)
 Frame = -1

Query  909  NTHCFSCSQMEIFSLSKMTVFPIYFFTSlclilllpplCYCQQNFSSRASYYKTNDEMGN  730
            N+HC       IF L  + ++P   +                 +  SRA+YY + D  G 
Sbjct  5    NSHCI------IFLLVTIIIYPSICYGQEA------------NSLYSRATYYGSPDCYGT  46

Query  729  PNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYV  550
            P+GACG+G+YGR    G+V  VS RL++NG  CGACYQVRCK  G C+D G K++ TD+ 
Sbjct  47   PSGACGFGEYGRKIYDGKVSGVS-RLYRNGTGCGACYQVRCKVPGHCTDEGTKIVVTDHG  105

Query  549  EGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA-KLRVKIHDNSQYP  373
            EG  TDFILS RA++ +A    MA  L   G VDVE+RRV C      L +K+H++S++ 
Sbjct  106  EGDHTDFILSVRAYSDMATS-GMANHLLAYGVVDVEYRRVPCTYYGYNLMIKVHEHSRFC  164

Query  372  HYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSA  193
            +YL+I+   Q GA DI AVE+++ +  +W  MR+A+GAVWD+ NPP G L  R  VS + 
Sbjct  165  NYLAIVPIYQSGAFDIEAVEVWQADCKEWKGMRKAYGAVWDMPNPPKGSLTFRVQVSVNG  224

Query  192  -AARWVESEKAIIPAEWKAGLTIET  121
             A +WV+    ++P +WKAG+  +T
Sbjct  225  EATKWVQLAD-VLPDQWKAGIAYDT  248



>ref|XP_006440176.1| hypothetical protein CICLE_v10024449mg, partial [Citrus clementina]
 gb|ESR53416.1| hypothetical protein CICLE_v10024449mg, partial [Citrus clementina]
Length=235

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 145/230 (63%), Gaps = 7/230 (3%)
 Frame = -1

Query  792  YCQQNF---SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGAC  622
            YC   F   SSRAS+Y + D +G P+GACG+G YG+  N   V  VSS L+ NG ACG C
Sbjct  6    YCYSQFTFTSSRASFYGSPDGLGTPSGACGFGTYGKTVNDANVAGVSS-LWNNGTACGTC  64

Query  621  YQVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVE  442
            YQVRC    +C+D G  V+ TDY EG +TDF+LS RA+  +A   +  E  T  G VDVE
Sbjct  65   YQVRCNVPDVCTDYGVFVVVTDYGEGDDTDFVLSPRAYGRMALADKSEELYT-FGVVDVE  123

Query  441  FRRVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAF  265
            F RV C      +  K+H+NS+YP YL++     GG +D+ AVE+++E+  +W+ M+RAF
Sbjct  124  FLRVPCRFRGYNVMFKVHENSKYPQYLAVATLYVGGQNDVLAVEMWQEDCKEWMPMKRAF  183

Query  264  GAVWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            GAV+D+  PP G + +RF VS SA   WV +  A IP  WKAG+  E+ I
Sbjct  184  GAVFDIFYPPPGPMNLRFQVSGSAGLTWVVANNA-IPKIWKAGVAYESAI  232



>ref|XP_003538757.1| PREDICTED: expansin-like B1-like [Glycine max]
Length=251

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 146/226 (65%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  GNP GACG+G+YG+  N G V  VS  L+KNG+ CGACYQVR
Sbjct  25   QDSFTCSRATYYGSTDCYGNPRGACGFGEYGKTVNDGSVAGVSW-LWKNGSGCGACYQVR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S RA++ L      +  L + G VDVE+RRV
Sbjct  84   CKIPQFCDENGAYVVVTDYGEGDRTDFIMSPRAYSRLGSNADASAELFKYGVVDVEYRRV  143

Query  429  SCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C      L VK+H+ S+ PHYL+I++   GG  D+ AVE+++E+  +W  MRRAFG V+
Sbjct  144  PCRYGGYNLLVKVHEQSRNPHYLAIVILYLGGTYDVTAVELWQEDCQEWRRMRRAFGTVF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D  NPP G++++RF +   A   WV+S K +I   W+AG+  ++ I
Sbjct  204  DAENPPRGDIKLRFQLGGDAQQYWVQS-KNVISGNWEAGVVYDSEI  248



>gb|KHN28473.1| Expansin-like B1 [Glycine soja]
Length=251

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 151/226 (67%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  GNP GACG+G+YGR  N G V  VS RL++NG+ CGACYQ R
Sbjct  25   QDSFTDSRATYYGSPDCYGNPRGACGFGEYGRTVNDGSVAGVS-RLWRNGSGCGACYQAR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S RAF+ L      +  L + G VD+E+RRV
Sbjct  84   CKIPQYCDENGAYVVVTDYGEGDRTDFIMSPRAFSRLGGNADASAELFKYGVVDIEYRRV  143

Query  429  SCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C+ +   +  K+H++S+ P Y ++++    G  D+ AVE+++E+  +W  MRRAFGA++
Sbjct  144  PCSYTGYNVVFKVHEHSRNPDYFAVVVLYVDGTYDVTAVELFQEDCQEWKPMRRAFGAMF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D ++PP GE+ +RF VS SA   WV+S+ A I ++WKAG T +TN+
Sbjct  204  DYSSPPRGEIYLRFQVSGSAGLYWVQSKNA-ISSDWKAGATYDTNV  248



>ref|XP_006477094.1| PREDICTED: expansin-like B1-like [Citrus sinensis]
Length=247

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 147/228 (64%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q +F+ SRA+YY + D +G P GACG+G YGRN N   V  VS RL+ NGA CG CYQ
Sbjct  20   YSQYSFTNSRATYYGSPDGLGTPTGACGFGGYGRNVNDANVAGVS-RLWNNGAGCGTCYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ATDY E  +T+FILS RA+  +A   + +E L   G VDVEF 
Sbjct  79   VRCNVPEVCTDYGVYVLATDYGEEDDTEFILSPRAYGRMAVADK-SEELYSHGVVDVEFE  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      +  K+H+NS+YP YL++ +    G +D+ AVEI++++   W+ MRRAFGA
Sbjct  138  RVPCRFRGYNVMFKVHENSRYPQYLAVSMLYVSGQNDVLAVEIWQKDCRDWVPMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D++NP  GE+ +RF VS SA   WV +  A IP  WKAG+   + I
Sbjct  198  VFDISNPSPGEINLRFQVSGSAGFTWVVANNA-IPRAWKAGVAYGSAI  244



>ref|XP_003524166.1| PREDICTED: expansin-like B1-like isoform X1 [Glycine max]
Length=251

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 150/226 (66%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  GNP GACG+G+YGR  N G V  VS RL++NG+ CGACYQ R
Sbjct  25   QDSFTDSRATYYGSPDCYGNPRGACGFGEYGRTVNDGSVAGVS-RLWRNGSGCGACYQAR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S RAF+ L      +  L + G VD+E+RRV
Sbjct  84   CKIPQYCDENGAYVVVTDYGEGDRTDFIMSPRAFSRLGGNADASAELFKYGVVDIEYRRV  143

Query  429  SCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C+ +   +  K+H++S+ P Y ++++    G  D+ AVE+++E+  +W  MRRAFGA++
Sbjct  144  PCSYTGYNVVFKVHEHSRNPDYFAVVVLYVDGTYDVTAVELFQEDCQEWKPMRRAFGAMF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D ++PP GE+ +RF VS  A   WV+S+ A I ++WKAG T +TN+
Sbjct  204  DYSSPPRGEIYLRFQVSGRAGLYWVQSKNA-ISSDWKAGATYDTNV  248



>ref|XP_006440178.1| hypothetical protein CICLE_v10024410mg [Citrus clementina]
 gb|ESR53418.1| hypothetical protein CICLE_v10024410mg [Citrus clementina]
Length=247

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 147/228 (64%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F SSRA++Y + D +G P GACG+G+YG+  N   V  VSS L+ NG ACGACYQ
Sbjct  20   YSQFTFTSSRATFYGSADGLGTPAGACGFGEYGKTVNDANVAGVSS-LWTNGTACGACYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY E  +T+FILS RA+  +A   +  E  T  G +DVEF 
Sbjct  79   VRCNVPEVCTDYGVYVVVTDYGEEYDTEFILSPRAYGRMALTDKSEELYT-FGVIDVEFL  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      +  K+H+NS+YP YL++ +   GG +D+ AVEI++E+  +W++MRRAFGA
Sbjct  138  RVPCRFRGYNVMFKVHENSKYPQYLAVSMLYVGGQNDVLAVEIWQEDCKEWMAMRRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D+ NPP G + +R  VS SA  RWV +  A IP  WKAG+   + I
Sbjct  198  VFDIFNPPPGAINLRMQVSGSAGLRWVVANNA-IPKVWKAGVAYGSAI  244



>gb|AFK34658.1| unknown [Medicago truncatula]
 gb|AES94346.2| expansin-B1-like protein [Medicago truncatula]
Length=252

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 144/220 (65%), Gaps = 3/220 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D   NP GACGYGDYG+  N G V  VS  L+KNG+ CGACYQVRCK   L
Sbjct  32   SRATYYGSPDCYANPKGACGYGDYGQTVNDGNVAGVS-WLWKNGSGCGACYQVRCKIPEL  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C + G  V+ TD+  G  TDFI+S R ++ L K    +  L + G VD+E++R+ C  + 
Sbjct  91   CDENGAYVVVTDFGVGDRTDFIMSPRGYSKLGKNGDASAELFKYGVVDIEYKRIPCKYNG  150

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              +  K+H+ S+ PHYL+IL+   GG +D+ AV++++E+  +W  MRRAFG V+D  NPP
Sbjct  151  YNILFKVHERSKNPHYLAILILYVGGTNDVTAVQLWQEDCKEWRPMRRAFGTVFDAENPP  210

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             GE+++R  VS SA   WVES K +I ++W+AG   ++ I
Sbjct  211  RGEIKLRLQVSGSAGLYWVES-KNVISSDWEAGSVYDSQI  249



>ref|XP_003611388.1| Expansin-like protein [Medicago truncatula]
Length=251

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 144/220 (65%), Gaps = 3/220 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D   NP GACGYGDYG+  N G V  VS  L+KNG+ CGACYQVRCK   L
Sbjct  31   SRATYYGSPDCYANPKGACGYGDYGQTVNDGNVAGVS-WLWKNGSGCGACYQVRCKIPEL  89

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C + G  V+ TD+  G  TDFI+S R ++ L K    +  L + G VD+E++R+ C  + 
Sbjct  90   CDENGAYVVVTDFGVGDRTDFIMSPRGYSKLGKNGDASAELFKYGVVDIEYKRIPCKYNG  149

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              +  K+H+ S+ PHYL+IL+   GG +D+ AV++++E+  +W  MRRAFG V+D  NPP
Sbjct  150  YNILFKVHERSKNPHYLAILILYVGGTNDVTAVQLWQEDCKEWRPMRRAFGTVFDAENPP  209

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             GE+++R  VS SA   WVES K +I ++W+AG   ++ I
Sbjct  210  RGEIKLRLQVSGSAGLYWVES-KNVISSDWEAGSVYDSQI  248



>emb|CDP08337.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 146/224 (65%), Gaps = 6/224 (3%)
 Frame = -1

Query  777  FSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSS  598
            +SSRA+YY T D +G P GACG+G+YGR  N G+V  VSS L++ G+ CGACYQVRC   
Sbjct  28   YSSRATYYGTPDCLGTPTGACGFGEYGRTVNDGQVSGVSS-LYRGGSGCGACYQVRCTIP  86

Query  597  GLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNS  418
              C++ G KV+ TDY EG +TDF+LS  A+  LA+ P MAE L   G VDVEF+R+ C  
Sbjct  87   EHCTEEGTKVVVTDYGEGDKTDFVLSTAAYGRLAR-PYMAEHLFAYGVVDVEFKRIPCKY  145

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
            +  L   +  +S+YP YL+++   Q GA DI A+E+++E+  QW  MRR  GAV+D+ +P
Sbjct  146  SYNLLFLVQAHSRYPGYLALVPLYQPGAYDITAIEVWQEDCKQWRPMRRPSGAVFDMTDP  205

Query  237  PSGELRVRF---LVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L +RF   +     +  WV+    +IP+EWKAG T +T I
Sbjct  206  PLGALTLRFQGTVYGYGDSNFWVQLTN-VIPSEWKAGYTYDTGI  248



>emb|CDP08339.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 144/225 (64%), Gaps = 5/225 (2%)
 Frame = -1

Query  783  QNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            Q   SRA+YYK++D  G P GACGYG+YG   N G V  VS +L++NGA CGACYQV+CK
Sbjct  26   QGIVSRATYYKSSDGFGTPTGACGYGEYGHKINGGRVTGVS-KLYRNGAGCGACYQVKCK  84

Query  603  SSGLCSDLGEKVMATDYVEGQE-TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
                CS+ G  V+ TD+ +G    DF+LS  AF  +A  P  A  L   G + VE+ R+ 
Sbjct  85   VPLYCSEDGTTVVVTDHGDGAHIADFVLSQNAFAEMA-LPDTASKLFSYGVIGVEYNRIP  143

Query  426  CNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
            C   A L +K+H+ S+YP YL++LL    GA DI A ++++EE+  W  M RA+GAV+D+
Sbjct  144  CLYDADLLLKVHETSKYPVYLAVLLLFLPGADDITAFQVWQEESNVWKPMHRAYGAVYDI  203

Query  246  ANPPSGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
             NPP G L +RFLV+ SA    WV+ +  ++P +W+AGLT  T I
Sbjct  204  TNPPLGALTLRFLVTVSADYNYWVQLDN-VLPTDWEAGLTYNTGI  247



>ref|XP_007155710.1| hypothetical protein PHAVU_003G224800g [Phaseolus vulgaris]
 gb|ESW27704.1| hypothetical protein PHAVU_003G224800g [Phaseolus vulgaris]
Length=251

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 150/226 (66%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q  F+ SRA+YY + D  GNP GACG+G+YGR  N G V  VS RL++NG+ CGACYQ R
Sbjct  25   QDTFTCSRATYYGSPDCYGNPKGACGFGEYGRTVNDGSVAGVS-RLWRNGSGCGACYQAR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S RAF+ L +    +  L + G VD+E+RRV
Sbjct  84   CKIPQYCDENGAFVVVTDYGEGDRTDFIMSPRAFSRLGRNADASAELFKYGVVDIEYRRV  143

Query  429  SCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C+ S   +  K+H++S+ P Y ++++   GG  D+ AVE++++E  +W ++RRA GA++
Sbjct  144  PCSYSGYNVVFKVHEHSRNPDYFAVVVLYVGGTYDVTAVELFQQECQEWKALRRASGAMF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D +NPPSG++ +RF VS SA   WV+S  A + ++W AG T +T +
Sbjct  204  DYSNPPSGKIYLRFQVSDSAGIYWVQSRNA-VSSDWTAGATYDTMV  248



>gb|EYU17878.1| hypothetical protein MIMGU_mgv1a026243mg, partial [Erythranthe 
guttata]
Length=236

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 144/224 (64%), Gaps = 12/224 (5%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D +GNP  +CGYG+YGR    GEV  VS RL+KNG+ CGACYQVRCK    
Sbjct  14   SRATYYGSPDCIGNP--SCGYGEYGRTVYNGEVSGVS-RLYKNGSGCGACYQVRCKIPTH  70

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS+ G K++ TDY EG ETDFILS RA++ LA  P +A  L   G +DVE++RV C  A+
Sbjct  71   CSEEGTKIVVTDYGEGHETDFILSARAYSNLA-LPNLAPQLLAYGVIDVEYKRVPCTYAS  129

Query  411  KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPS  232
             L +K+H +S +P Y +IL   Q G  DI  V+++ E   +W  MRR +G VWD+ NPP 
Sbjct  130  NLVIKVHHHSHFPTYFAILPIYQAGTYDITDVQLWLEYCKEWRGMRRVYGTVWDMENPPI  189

Query  231  G-ELRVRFLVSSSAAA------RWVESEKAIIPAEWKAGLTIET  121
            G  + +RF + S  AA      +W++    +IP +WKAG+  +T
Sbjct  190  GMPINMRFQLVSGGAANANAEVKWLQIAN-VIPTDWKAGVAYDT  232



>gb|KHN34892.1| Expansin-like B1 [Glycine soja]
Length=253

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 146/228 (64%), Gaps = 6/228 (3%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ--  616
            Q +F+ SRA+YY + D  GNP GACG+G+YG+  N G V  VS  L+KNG+ CGACYQ  
Sbjct  25   QDSFTCSRATYYGSTDCYGNPRGACGFGEYGKTVNDGSVAGVSW-LWKNGSGCGACYQAS  83

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRCK    C + G  V+ TDY EG  TDFI+S RA++ L      +  L + G VDVE+R
Sbjct  84   VRCKIPQFCDENGAYVVVTDYGEGDRTDFIMSPRAYSRLGSNADASAELFKYGVVDVEYR  143

Query  435  RVSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      L VK+H+ S+ PHYL+I++   GG  D+ AVE+++E+  +W  MRRAFG 
Sbjct  144  RVPCRYGGYNLLVKVHEQSRNPHYLAIVILYLGGTYDVTAVELWQEDCQEWRRMRRAFGT  203

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D  NPP G++++RF +   A   WV+S K +I   W+AG+  ++ I
Sbjct  204  VFDAENPPRGDIKLRFQLGGDAQQYWVQS-KNVISGNWEAGVVYDSEI  250



>ref|XP_006477089.1| PREDICTED: expansin-like B1-like [Citrus sinensis]
Length=247

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 143/228 (63%), Gaps = 5/228 (2%)
 Frame = -1

Query  792  YCQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q  F SSRAS+Y + D +G P GACG+G YG+  N   V  VS+ L+ NG ACG CYQ
Sbjct  20   YSQFTFTSSRASFYGSPDGLGTPAGACGFGAYGKTVNDANVAGVSN-LWNNGTACGTCYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY EG +TDF+LS RA+  +A   +  E  T  G VDVEF 
Sbjct  79   VRCNVPEVCTDYGVYVVVTDYGEGDDTDFVLSPRAYGRMALTDKSEELYT-FGVVDVEFL  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RV C      +  K+H+NS+YP YL++     GG +D+ AVE+++E+  +W+ M+RAFGA
Sbjct  138  RVPCRFRGYNVMFKVHENSKYPQYLAVATLYVGGQNDVLAVEMWQEDCKEWMPMKRAFGA  197

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D+  PP G + +RF VS SA   WV +  A IP  WK G+  E+ I
Sbjct  198  VFDIFYPPPGPMNLRFQVSGSAGLTWVVANNA-IPKVWKVGVAYESAI  244



>dbj|BAO45906.1| hypothetical protein [Acacia mangium]
Length=247

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 139/227 (61%), Gaps = 4/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA++Y   D  G P GACG+GDYG   N+G V  VS  L++ GA CGACYQV
Sbjct  21   CLSQFTDSRATFYTRPDGGGTPTGACGFGDYGGTENSGRVAGVSDALWRGGAGCGACYQV  80

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK + LCS  G  +  TD   G  TDF++S   F  L   P  +E LT+ G VD+++RR
Sbjct  81   RCKDTKLCSTDGVTIAVTDMGSGDRTDFVMSLNGFLRLGVNPSASEQLTKNGTVDIQYRR  140

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + +++KI++NS++P YL+I +    G++D+ +++I       W  +RRAFGAV
Sbjct  141  VPCVFDGSNVKIKINENSRFPDYLAIAVIYVPGSNDVVSIQISNNNGRDWRPLRRAFGAV  200

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +D++NPP G  +VR  V  S +  WVES   +IPA+W  G   ++ I
Sbjct  201  FDISNPPRGPFKVR--VQFSGSQTWVESPNNVIPADWNVGAIYDSGI  245



>gb|KEH31624.1| expansin-B1-like protein [Medicago truncatula]
Length=251

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 145/226 (64%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            Q +F+ SRA+YY + D  G P GACG+G+YGR  N G V  VS +L+KNG  CGACYQVR
Sbjct  25   QDSFTDSRATYYGSPDCYGTPRGACGFGEYGRTVNDGNVAGVS-KLWKNGTGCGACYQVR  83

Query  609  CKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRV  430
            CK    C + G  V+ TDY EG  TDFI+S R +  L +    +  L + G VD+E++RV
Sbjct  84   CKIPQYCDENGATVVVTDYGEGDRTDFIMSPRGYAKLGRNADASAELFKYGVVDIEYKRV  143

Query  429  SCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
             C  S   +  ++H+ S+ P Y ++++    G  D+ AVE+++E+  +W  MRRA+G V+
Sbjct  144  PCMYSGYNIVAQVHERSKNPDYFAVVVLYVDGMYDVNAVEMWQEDCQEWRPMRRAYGVVF  203

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D ANPPSGE+ +RF VS +    WV+S+ A IP++WKAG   +T +
Sbjct  204  DYANPPSGEINLRFQVSGNEGVYWVQSKNA-IPSDWKAGAAYDTMV  248



>gb|KHG10161.1| Expansin-like B1 [Gossypium arboreum]
Length=248

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 151/221 (68%), Gaps = 9/221 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG-  595
            SRA+YY ++D +G  +GACG+G+YGRN ++G V  V  RL+KNG  CGACYQVRC ++  
Sbjct  32   SRATYYGSSDGLGTTSGACGFGEYGRNISSGNVAGV-YRLYKNGVGCGACYQVRCTTNPQ  90

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
            +C+  G  V+ TDY +G  TDFILS+ A+  +A+ P  A+ L   G V VE++RV C   
Sbjct  91   ICTKKGVNVVVTDYGQGDNTDFILSHHAYEVMAR-PGTADRLFAYGVVGVEYQRVPCQYV  149

Query  414  A-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
              K++VK+H+ S+ P YL+I++  Q G SDI +V+I+++   +W+ MRR+FGAV+D+ NP
Sbjct  150  GHKIQVKVHEYSRNPDYLAIIMLYQAGKSDILSVDIWQQG--KWVEMRRSFGAVFDMPNP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G + +RF V  +A    ++  KA+IP  WKAG+  +T+I
Sbjct  208  PLGAISLRFKVQDNAG---IKLPKAVIPRYWKAGVAYDTDI  245



>ref|XP_006838532.1| hypothetical protein AMTR_s00002p00195390 [Amborella trichopoda]
 gb|ERN01101.1| hypothetical protein AMTR_s00002p00195390 [Amborella trichopoda]
Length=250

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 143/223 (64%), Gaps = 7/223 (3%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y + D +G P+GACG+G++GR  N G+V  V+ +L+KNG  CGACYQVRC    +
Sbjct  28   SRATFYGSPDCLGTPSGACGFGEFGRRINGGDVGGVA-KLYKNGTGCGACYQVRCTQPQV  86

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G  ++ TDY EG  TDFILS  A++ LA  P MA  L   G VD+E+RRVSC    
Sbjct  87   CNPYGLTIVVTDYGEGDHTDFILSTSAYSKLA-LPNMALELMAYGVVDIEYRRVSCQYPG  145

Query  411  -KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              +  K+H+NS+YP  L++++  Q G  DI AVE+++E+  +W  MRRA+GAVWD+ NPP
Sbjct  146  YNMMFKVHENSRYPDSLALVIWYQAGQYDITAVELWQEDCKEWRGMRRAYGAVWDMPNPP  205

Query  234  S--GELRVRFLVSSSA-AARWVESEKAIIPAEWKAGLTIETNI  115
            +    L +RF VS      +WV    A IP  WKAG   ++ I
Sbjct  206  NAGAGLNLRFRVSGGVEGEKWVVLPNA-IPTNWKAGAVYDSTI  247



>ref|XP_003549943.1| PREDICTED: expansin-like B1-like [Glycine max]
 ref|XP_003549944.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN03126.1| Expansin-like B1 [Glycine soja]
 gb|KHN33202.1| Expansin-like B1 [Glycine soja]
Length=250

 Score =   200 bits (509),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 142/226 (63%), Gaps = 7/226 (3%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C + F+ SRASYY T D +GNP GACG+ +YGR  N G V AVS  L++NGA CG CY V
Sbjct  24   CNEYFTNSRASYYNTPDGLGNPRGACGFEEYGRTINNGSVAAVSG-LWRNGAGCGTCYWV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK    C   G +V+ATD   G  TDFI+S R F+ LA+    ++ L ++G VD+ F R
Sbjct  83   RCKIPQYCGK-GVQVVATDSGAGDGTDFIMSKRGFSGLARNVAASKELFKRGVVDIAFTR  141

Query  432  VSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVW  253
            V CN  + +++++H +S+ P YL++LL N  G  DI AVE+++    +W  +RR +GAV+
Sbjct  142  VPCNYPSNIKLRVHKSSKNPGYLAVLLLNVNGVRDITAVEMWQRGQKRWEPLRRVYGAVF  201

Query  252  DLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            D ANPPSG + +RF V       W+ S    IPA WK G T +T +
Sbjct  202  DYANPPSGAILLRFQV---GYGYWLPSNNP-IPANWKPGATYDTKV  243



>ref|XP_003549945.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN01622.1| Expansin-like B1 [Glycine soja]
Length=248

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 141/228 (62%), Gaps = 9/228 (4%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNA--GEVCAVSSRLFKNGAACGACY  619
            CQ+ F+ SRA+YY T D  G P GACG+G++GR  +   G V  VS  L++NGA CG CY
Sbjct  24   CQEYFTKSRATYYGTPDGFGTPTGACGFGEFGRLMDGYGGRVAGVSG-LWRNGAGCGTCY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QV+C    LC   G  ++ATDY +G  TDFI+S  AF+ L      +E + +KG VD+EF
Sbjct  83   QVKCLMPKLCDVNGVTLVATDYGQGDRTDFIMSPSAFSRLGVNKIASEEIKKKGTVDIEF  142

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            +RV C     +   +   S  P YL++++ N  G  D+ AVE++++   +W+ +RR++GA
Sbjct  143  KRVPCKYTGNVLFHVQQTSSNPGYLAVVILNVNGKYDVTAVEMWQKSQQRWVPLRRSYGA  202

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D ANPPSGE+ +RF V S+    W +  K  IPA WK G T +T +
Sbjct  203  VFDFANPPSGEILLRFKVGSN----W-KLPKIPIPAYWKPGATYDTKV  245



>ref|XP_010533848.1| PREDICTED: expansin-like B1 [Tarenaya hassleriana]
Length=240

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 141/212 (67%), Gaps = 9/212 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY T D  G  +GACGYG++GRN N  +V AVS +L++NGA CGACYQV+C +   
Sbjct  29   SRAAYYGTPDGKGTTSGACGYGEFGRNMNGAKVAAVS-KLWRNGAGCGACYQVKCTNPWC  87

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+ +   V  +DY EG  TDFI++ +AF  LA  P   + +   G VD+ ++RV C    
Sbjct  88   CNSV--VVSVSDYGEGDRTDFIMNKQAFKKLA-CPGAEKEVISYGVVDIVYKRVPCQFPT  144

Query  411  KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPS  232
             + +K+H+NS++  YLS++L N GGA+DI A+EI +++  +WI MRRA+GAV+DL NPP 
Sbjct  145  NILLKVHENSRFHDYLSLVLLNVGGANDILALEI-KDDWGEWIEMRRAYGAVFDLPNPPK  203

Query  231  GELRVRFLVSSSAAARWVESEKAIIPAEWKAG  136
            G L VRFLV     A W E+   IIP +WK G
Sbjct  204  GALTVRFLVDK---AGWKEATD-IIPYKWKPG  231



>ref|XP_010677136.1| PREDICTED: expansin-like B1 [Beta vulgaris subsp. vulgaris]
Length=251

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 138/230 (60%), Gaps = 8/230 (3%)
 Frame = -1

Query  792  YCQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            Y Q    SRA+YY + D +GNP GACGYG+YGR  N G V  V  R ++NG  CG CYQV
Sbjct  24   YSQDYICSRATYYGSPDCLGNPTGACGYGEYGRTVNDGYVAGVH-RPYRNGTGCGGCYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
             C ++G C+  G  V+ATD+  G  TDF+   +A+T +A+ P    +L   G VD+++RR
Sbjct  83   WC-TTGECTKEGVIVVATDFGVGDWTDFLFPAKAYTKMAR-PGFEAYLLSYGVVDIQYRR  140

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C    + L   +H+ + YPHY ++ +    G  D+   +I++E+   W  MR+ +GAV
Sbjct  141  VPCTFRGSNLIFSVHERTNYPHYFALTIIYPPGVYDVVGAQIWQEDCKAWRGMRKPYGAV  200

Query  255  WDLANPPSGELRVRFLVSSSA---AARWVESEKAIIPAEWKAGLTIETNI  115
            WD+ NPP  +LRVRFL+S++     A WVES   +I A W +G T E  +
Sbjct  201  WDMENPPRADLRVRFLLSATGDVNDATWVES-PTMITAFWNSGTTYEVAV  249



>gb|ACU24607.1| unknown [Glycine max]
Length=248

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 140/228 (61%), Gaps = 9/228 (4%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNA--GEVCAVSSRLFKNGAACGACY  619
            CQ+ F+ SRA+YY T D  G P GACG+G++GR  +   G V  VS  L +NGA CG CY
Sbjct  24   CQEYFTKSRATYYGTPDGFGTPTGACGFGEFGRLMDGYGGRVAGVSG-LRRNGAGCGTCY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QV+C    LC   G  ++ATDY +G  TDFI+S  AF+ L      +E + +KG VD+EF
Sbjct  83   QVKCLMPKLCDVNGVTLVATDYGQGDRTDFIMSPSAFSRLGVNKIASEEIKKKGTVDIEF  142

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            +RV C     +   +   S  P YL++++ N  G  D+ AVE++++   +W+ +RR++GA
Sbjct  143  KRVPCKYTGNVLFHVQQTSSNPGYLAVVILNVNGKYDVTAVEMWQKSQQRWVPLRRSYGA  202

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D ANPPSGE+ +RF V S+    W +  K  IPA WK G T +T +
Sbjct  203  VFDFANPPSGEILLRFKVGSN----W-KLPKIPIPAYWKPGATYDTKV  245



>ref|XP_010677135.1| PREDICTED: expansin-like B1 [Beta vulgaris subsp. vulgaris]
Length=253

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 143/226 (63%), Gaps = 8/226 (4%)
 Frame = -1

Query  777  FSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAV-SSRLFKNGAACGACYQVRCKS  601
            F S+A+YY   D +G P G C YG+YGR  N G+V  V SS+L+K GA+CGACY+VRC  
Sbjct  28   FHSKATYYYAIDGLGTPKGGCAYGEYGRTINDGDVALVTSSKLYKGGASCGACYKVRCNE  87

Query  600  SGLCSDLGEKVMATDY-VEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
            +  C+  G  V+ TDY V   +TD ILS  AF  +A  P+  + L + G V +E++RV+C
Sbjct  88   AE-CAAEGVVVVVTDYGVSDGDTDLILSTHAFNKMA-MPKYEKELRDYGKVHIEYQRVAC  145

Query  423  NSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
                K L +K+ D+S +  YL++      G +DI AVE++EE+T +W   RRA+G VWD+
Sbjct  146  QYPGKTLTIKVLDHSHFHSYLALQFLYLAGNADITAVELFEEDTLEWKRCRRAYGTVWDI  205

Query  246  ANPPSGELRVRFLVSSS--AAARWVESEKAIIPAEWKAGLTIETNI  115
            ANPP G L VRF +  S    ARWV   K +IP  W+AG+T +T+I
Sbjct  206  ANPPKGPLTVRFFLDGSVNVRARWVLVPK-VIPIFWQAGVTYDTSI  250



>ref|XP_007211070.1| hypothetical protein PRUPE_ppa017982mg [Prunus persica]
 gb|EMJ12269.1| hypothetical protein PRUPE_ppa017982mg [Prunus persica]
Length=255

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 135/221 (61%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRASYY  ++  G   GACG+G +G   N G+V A +S L++NG  CGACYQVRC +S  
Sbjct  34   SRASYYPNSEAQGTDIGACGFGSFGATINGGDVSA-ASDLYRNGVGCGACYQVRCTNSLY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A+    A  L   G VD+E+RRVSC+   
Sbjct  93   CSDKGATVVITDQGSGHNTDFILSKRAFGRMAQTTDAAASLLSLGVVDIEYRRVSCSYPG  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YPHYL+ ++  Q G +DI AV++ E + +    + R++GAVW   +PP
Sbjct  153  KNITIKIDENSNYPHYLAFVIYYQQGKNDITAVQLCETQNFACKLLDRSYGAVWTTTSPP  212

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L++R L S       WV  E   IP +WK G T ++ +
Sbjct  213  SGPLQIRMLFSDEDGDENWVVPENN-IPQDWKVGQTYDSGV  252



>gb|EPS74160.1| hypothetical protein M569_00601, partial [Genlisea aurea]
Length=192

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 126/191 (66%), Gaps = 3/191 (2%)
 Frame = -1

Query  777  FSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSS  598
             SSRA+Y+K+   +GN  GACGYGD+GR    G V AVS +L+++G  CGACYQVRCK  
Sbjct  3    ISSRATYFKSPHGLGNARGACGYGDHGRTIYGGSVAAVS-KLYRDGIGCGACYQVRCKIP  61

Query  597  GLCSDLGEKVMATDYVEGQE--TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
            G+CS+ G+ V+A DY +G +  TDFILS RAF+ LA  P  A  L  +G VDVEFRRV C
Sbjct  62   GICSEDGDTVVAVDYGQGGDKGTDFILSERAFSRLAASPDDAHELFAQGVVDVEFRRVPC  121

Query  423  NSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLA  244
               + L + I + S+ P YL++L   Q    DI  ++ Y+++  +W  MR+ +GAVWD+ 
Sbjct  122  RYGSNLLLAIREQSRRPGYLALLPIYQPDNYDIVGIDYYQDKEEEWKHMRKPYGAVWDVE  181

Query  243  NPPSGELRVRF  211
            NPP G+L V+ 
Sbjct  182  NPPPGDLMVKI  192



>ref|XP_008229527.1| PREDICTED: expansin-like B1 isoform X1 [Prunus mume]
Length=255

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 135/221 (61%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRASYY  ++  G   GACG+G +G   N G+V A +S L++NG  CGACYQVRC +S  
Sbjct  34   SRASYYPNSEAQGTDIGACGFGSFGATINGGDVSA-ASDLYRNGVGCGACYQVRCTNSRY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF+ +A+    A  L   G VD+E+RRVSC+   
Sbjct  93   CSDKGATVVITDQGSGHNTDFILSKRAFSRMAQTTDAAASLLSLGVVDIEYRRVSCSYPG  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YPHYL+ ++  Q G +DI AV++ E + +    + R++GAVW   +PP
Sbjct  153  KNITIKIDENSNYPHYLAFVIYYQQGKNDITAVQLCETQNFACKLLDRSYGAVWTTTSPP  212

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L++R L S       WV  E   IP +W  G T ++ +
Sbjct  213  SGPLQIRMLFSDEDGDENWVVPENN-IPQDWTVGQTYDSGV  252



>pir||F71438 probable allergen - Arabidopsis thaliana
 emb|CAB10483.1| allergen like protein [Arabidopsis thaliana]
 emb|CAB80974.1| allergen like protein [Arabidopsis thaliana]
Length=260

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 134/231 (58%), Gaps = 30/231 (13%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            G CGYG++GR+ N GEV  VS RL+ NG  CGACYQVRCK    CS+ G  V+ATD  EG
Sbjct  29   GHCGYGEFGRDINNGEVSGVSWRLWNNGTGCGACYQVRCKIPPHCSEEGVYVVATDSGEG  88

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA-KLRVKIHDNSQYPHY  367
              TDFILS +A+  +A+ P     L   G V+VE++R+ C  A   L  KIH+ S  PHY
Sbjct  89   DGTDFILSPKAYGRMAR-PGTENQLYSFGVVNVEYQRIPCRYAGYNLVYKIHEKSYNPHY  147

Query  366  LSILLTNQGGASDIFAVEIYE---------------------------EETYQWISMRRA  268
            L+IL+   GG +DI AVE+++                           E+  +W  MRR 
Sbjct  148  LAILVLYVGGVNDILAVEVWQVNLIKDVEKLRYMFLRIKIYSLLLDDFEDCKEWRRMRRV  207

Query  267  FGAVWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            FGAV DL NPP G L +RFLV  SA   W++S  A IPA+W AG T ++NI
Sbjct  208  FGAVHDLQNPPRGTLTLRFLVYGSAGINWIQSPNA-IPADWTAGATYDSNI  257



>ref|NP_001242114.1| uncharacterized protein LOC100813628 precursor [Glycine max]
 gb|ACU24190.1| unknown [Glycine max]
Length=244

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 137/228 (60%), Gaps = 12/228 (5%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGR--NTNAGEVCAVSSRLFKNGAACGACY  619
            CQ+ F+ SRA+YY T D  G P GACGYG++GR  +   G V  VS  L++NGA CG CY
Sbjct  24   CQEYFTKSRATYYGTPDGYGTPTGACGYGEFGRLMDGYGGRVTGVSG-LWRNGAGCGTCY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRCK   LC   G  ++ TDY +G  TDFI+S RAF+ L      +E + +KG VD+EF
Sbjct  83   QVRCKIPKLCDVNGVTLVVTDYGQGDGTDFIMSPRAFSKLGVNKIASEEIKKKGTVDIEF  142

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            +RV C     +   + + S  P Y ++++    G  D+  VE++++   +W  +RR++GA
Sbjct  143  KRVPCKYTGNVLFHVQETSSNPGYFAVVILFVNGKYDLTDVEMWQKSQQRWEPLRRSYGA  202

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D ANPPSGE+ +RF   S   A+        IPA WK G+T +T +
Sbjct  203  VFDFANPPSGEILLRFKAGSWKLAK--------IPANWKPGVTYDTKV  242



>ref|XP_003524157.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN28472.1| Expansin-like B1 [Glycine soja]
Length=247

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 135/228 (59%), Gaps = 8/228 (4%)
 Frame = -1

Query  792  YCQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTN--AGEVCAVSSRLFKNGAACGACY  619
            YCQ+   SRA++Y T+D  G P GACG+G+YGR  N   G V  VS  L++NGA CG CY
Sbjct  23   YCQEYTKSRATFYSTSDGYGTPTGACGFGEYGRKMNWYGGRVAGVSG-LWRNGAGCGTCY  81

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRC    LC   G  ++ATD   G  TDF++S RAF  L +    +E L + G VD+E+
Sbjct  82   QVRCLVPELCDTNGAYLVATDQGYGDRTDFVMSPRAFLKLGRNEYSSEELKKYGTVDIEY  141

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            +RV C     +   I + S  P Y ++++ N  G  D+ AVE+Y+    QW S+ R  GA
Sbjct  142  KRVPCTYTGNVLFHIKETSTNPGYFALVILNVNGIHDVTAVELYQMG--QWKSLNRNSGA  199

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D  NPPSGE+R+RF V  S  + WV+    +IP+ W+ G T  T +
Sbjct  200  VFDFPNPPSGEIRLRFRV--SGMSDWVDP-MIVIPSNWQPGNTYATKV  244



>gb|KHN28471.1| Expansin-like B1 [Glycine soja]
Length=244

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 136/228 (60%), Gaps = 12/228 (5%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGR--NTNAGEVCAVSSRLFKNGAACGACY  619
            CQ+ F+ SRA+YY T D  G P GACGYG++GR  +   G V  VS  L++NGA CG CY
Sbjct  24   CQEYFTKSRATYYGTPDGYGTPTGACGYGEFGRLMDGYGGRVTGVSG-LWRNGAGCGTCY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRCK   LC   G  ++ TDY +G  TDFI+S RAF+ L      +E + +KG VD+EF
Sbjct  83   QVRCKIPKLCDVNGVTLVVTDYGQGDGTDFIMSPRAFSKLGVNKIASEEIKKKGTVDIEF  142

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            +RV C     +   + + S  P Y ++++    G  D+  VE++++   +W  +RR++GA
Sbjct  143  KRVPCKYTGNVLFHVQETSSNPGYFAVVILFVNGKYDLTDVEMWQKSQQRWEPLRRSYGA  202

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D ANPPSGE+ +RF   S   A+        IPA WK G T +T +
Sbjct  203  VFDFANPPSGEILLRFKAGSWKLAK--------IPANWKPGATYDTKV  242



>ref|XP_003549946.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN01623.1| Expansin-like B1 [Glycine soja]
Length=247

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 136/228 (60%), Gaps = 8/228 (4%)
 Frame = -1

Query  792  YCQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTN--AGEVCAVSSRLFKNGAACGACY  619
            +CQ+   SRA++Y T+D  G P GACG+G+YGR  N   G V  VS  L++NGA CG CY
Sbjct  23   FCQEYTKSRATFYGTSDGYGTPTGACGFGEYGRAMNWYDGRVAGVSD-LWRNGAGCGTCY  81

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRC    LC   G  ++ATD   G  TDF++S RAF  L +    +E L + G VD+E+
Sbjct  82   QVRCLVPELCDTNGAYLVATDQGYGDRTDFVMSPRAFLKLGRDEYSSEELKKYGTVDIEY  141

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            +RV C     +   I + S  P Y ++++ N  G  D+ AVE+Y+    QW S+ R +GA
Sbjct  142  KRVPCTYTGNVLFHIKETSTNPGYFALVILNVNGIHDVTAVELYQMG--QWKSLNRNYGA  199

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D  NPPSGE+R+RF V  S  + WV+    +IP+ W+ G T  T +
Sbjct  200  VFDFPNPPSGEIRLRFRV--SGMSDWVDP-MIVIPSNWQPGNTYATKV  244



>gb|KDP45947.1| hypothetical protein JCGZ_11850 [Jatropha curcas]
Length=255

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 135/221 (61%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  +DE G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC +S  
Sbjct  33   SRAAYYPNSDEQGTERGACGFGSFGATINGGDVSA-ASNLYRDGVGCGACYQVRCTNSNY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  ++ TD      TDFILS RAF+ +A+    A  L   G VD+E+RRVSC+   
Sbjct  92   CADKGVTIVITDQGSSDNTDFILSRRAFSRMAQTTDAAASLLSLGIVDIEYRRVSCSYPN  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YPHYL+ ++  Q G SDI AV++ E + +    + R++GAVW   +PP
Sbjct  152  KNITIKIDENSNYPHYLAFVIWYQQGKSDITAVQLCETQNFACKLLDRSYGAVWTTTSPP  211

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L SS      W+      IP +WKAG T +  +
Sbjct  212  SGPLSLRMLFSSEDGDEEWLVPVNN-IPQDWKAGETYDIGV  251



>ref|XP_010055416.1| PREDICTED: expansin-like B1 [Eucalyptus grandis]
 gb|KCW71893.1| hypothetical protein EUGRSUZ_E00358 [Eucalyptus grandis]
Length=246

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 134/221 (61%), Gaps = 9/221 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D  G P GACGYG+YGR    G V  VS RL++NG+ CGACYQVRC +   
Sbjct  30   SRATYYGSPDCYGTPTGACGYGEYGRTVYDGYVTGVS-RLYRNGSGCGACYQVRC-TKPQ  87

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAK-QPRMAEFLTEKGAVDVEFRRVSCNSA  415
            C+  G  V  TDY EG  TDFILS RA+  +AK      E L   G V+VEFRRV C   
Sbjct  88   CTGEGAYVAVTDYGEGDRTDFILSTRAYAKMAKPDDYQTEQLFAYGVVEVEFRRVPCRYP  147

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             + L V + ++S+ P YL+++L    G  D+ A E ++E+  +W  MRR +GAV+D   P
Sbjct  148  GQNLLVSVSEHSRNPSYLAVILLYVAGKDDVIAAEYWQEDCQEWKPMRRVYGAVFDTQTP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P GEL +RF V  S    WV  + A +PA+WKAG   ++ +
Sbjct  208  PIGELYLRFQVGGS----WVHPKYA-LPADWKAGAVYDSQV  243



>ref|XP_007039592.1| Expansin-like B1 [Theobroma cacao]
 gb|EOY24093.1| Expansin-like B1 [Theobroma cacao]
Length=272

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 135/227 (59%), Gaps = 3/227 (1%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA+YY  +DE G   GACG+G +G   N G+V + +S L++NG  CGACYQV
Sbjct  43   CSNYFTHSRAAYYPNSDEHGTDVGACGFGSFGATINGGDV-STASELYRNGVGCGACYQV  101

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC +S  CSD G  V+ TD   G  TDFILS RAF  +A+    A  L  +G VD+E+RR
Sbjct  102  RCTNSNYCSDDGVTVVITDQGSGPNTDFILSRRAFGRMAQTTDAAASLLAQGVVDIEYRR  161

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC+   K + +KI +NS YPHYL+ +L  Q G  DI AV++ E + +    + R++GAV
Sbjct  162  VSCSYPNKNITIKIDENSNYPHYLAFVLWYQQGDKDITAVQLCETKNFVCKLLDRSYGAV  221

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            W   +PP+G L +R L+S              IP  WK G T +T +
Sbjct  222  WTTTSPPTGPLSLRMLLSGEDGDESWFVPINNIPENWKGGETYDTGV  268



>emb|CDP08338.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 136/220 (62%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY   D +G P GACG+G+YGR  N G V AVS RL++ G+ CGACY+VRC     
Sbjct  27   SRATYYGRPDFLGTPTGACGFGEYGRFVNDGRVTAVS-RLYRGGSGCGACYRVRCTIPED  85

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS+ G +V+ TDY EG +TDFILS  AF +LA+ P  A+ L   G V VEF+RV C    
Sbjct  86   CSEEGTRVVVTDYGEGDKTDFILSQAAFESLAR-PYKAQHLFAYGVVGVEFKRVPCLYYR  144

Query  411  KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPS  232
            +    +   S+YP YL+I+   Q G  DI A+EI++ +  +W  MRRA+G V+D+ + P 
Sbjct  145  RFIFLVLPQSRYPAYLAIVPLYQPGTFDIIAIEIFQTDRGEWRPMRRAYGTVFDITDAPL  204

Query  231  GELRVRFL-VSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            G + +R+  V       WV+  + +IP++WKAG   E  I
Sbjct  205  GVITLRYKSVDYGDPESWVQLNE-VIPSDWKAGHAYEIEI  243



>ref|XP_010533847.1| PREDICTED: expansin-like B1 [Tarenaya hassleriana]
Length=243

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 138/213 (65%), Gaps = 8/213 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY T D  G  +GACGYG +GRN N  +V AVS +L++NG  CGACYQV C     
Sbjct  29   SRAAYYGTPDGKGTTSGACGYGKFGRNMNDAKVAAVS-KLWRNGTGCGACYQVICTIPQY  87

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G  +  +DY EG  TDFI++  AF  LA+ P   + +   G VD+ ++RV C    
Sbjct  88   CNTKGVIISVSDYGEGDRTDFIMNKLAFNKLAR-PGAEKKVISYGVVDIVYKRVPCQFPN  146

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            + + +K+H+NS++  YLS++L N GGA+DI A++I + +  +WI MRRA+GAV+DL NPP
Sbjct  147  SNILLKVHENSRFRDYLSLVLLNVGGANDILALQI-KNDWGEWIKMRRAYGAVFDLPNPP  205

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAG  136
             G L V+FLV     A W ++   IIP +WK+G
Sbjct  206  KGALTVKFLVDK---AGWKQATD-IIPYKWKSG  234



>ref|XP_008229528.1| PREDICTED: expansin-like B1 isoform X2 [Prunus mume]
Length=254

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 134/221 (61%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRASYY  N E    + ACG+G +G   N G+V A +S L++NG  CGACYQVRC +S  
Sbjct  34   SRASYYP-NSEAQGTDSACGFGSFGATINGGDVSA-ASDLYRNGVGCGACYQVRCTNSRY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF+ +A+    A  L   G VD+E+RRVSC+   
Sbjct  92   CSDKGATVVITDQGSGHNTDFILSKRAFSRMAQTTDAAASLLSLGVVDIEYRRVSCSYPG  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YPHYL+ ++  Q G +DI AV++ E + +    + R++GAVW   +PP
Sbjct  152  KNITIKIDENSNYPHYLAFVIYYQQGKNDITAVQLCETQNFACKLLDRSYGAVWTTTSPP  211

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L++R L S       WV  E   IP +W  G T ++ +
Sbjct  212  SGPLQIRMLFSDEDGDENWVVPENN-IPQDWTVGQTYDSGV  251



>ref|XP_010055418.1| PREDICTED: expansin-like B1 [Eucalyptus grandis]
 gb|KCW71895.1| hypothetical protein EUGRSUZ_E00360 [Eucalyptus grandis]
Length=246

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 134/221 (61%), Gaps = 9/221 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D  G P GACGYG+YGR    G V  VS RL++NG+ CGACYQVRC +   
Sbjct  30   SRATYYGSPDCYGTPTGACGYGEYGRTVYDGYVTGVS-RLYRNGSGCGACYQVRC-TKPQ  87

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAK-QPRMAEFLTEKGAVDVEFRRVSCNSA  415
            C+  G  V  TDY EG  TDFILS RA+  +AK      + L   G V+VEFRRV C   
Sbjct  88   CTGEGAYVAVTDYGEGDRTDFILSTRAYAKMAKPDDYQTKQLFAYGVVEVEFRRVPCRYP  147

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             + L V + ++S+ P YL+++L    G  D+ A E ++E+  +W  MRR +GAV+D   P
Sbjct  148  GQNLLVSVSEHSRNPSYLAVMLLYVAGKDDVIAAEYWQEDCQEWKPMRRVYGAVFDTQTP  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P GEL +RF V  S    WV  + A +PA+WKAG   ++ +
Sbjct  208  PIGELYLRFQVGGS----WVHPKYA-LPADWKAGAVYDSQV  243



>gb|KDP45948.1| hypothetical protein JCGZ_11851 [Jatropha curcas]
Length=257

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 133/222 (60%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  +DE G  +GACG+G +G   N G+V A +S L++ G  CGACYQVRC  S  
Sbjct  34   SRAAHYPNSDEQGTESGACGFGSFGATINGGDVSA-ASDLYRGGVGCGACYQVRCTDSNY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  V+ TD      TDFILS +AF  +A+    A FL   G V +E+RRVSC+   
Sbjct  93   CTDKGVNVVITDQGSSHNTDFILSRQAFGRMAQNVDAAAFLLSFGIVGIEYRRVSCSYPD  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YPHYL+ ++  Q G  DI AV++ E + +    + R++GAVW   +PP
Sbjct  153  KNITIKIDENSNYPHYLAFVIRFQQGKRDITAVQLCEAQNFVCKLLDRSYGAVWTTTSPP  212

Query  234  SGELRVRFLVSSSAA--ARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L SS       WV      IP +WKAG T +T +
Sbjct  213  SGPLSLRMLFSSEDGDDEEWVVPVNN-IPQDWKAGETYDTGV  253



>ref|XP_007155708.1| hypothetical protein PHAVU_003G224600g [Phaseolus vulgaris]
 gb|ESW27702.1| hypothetical protein PHAVU_003G224600g [Phaseolus vulgaris]
Length=248

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 138/228 (61%), Gaps = 9/228 (4%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTN--AGEVCAVSSRLFKNGAACGACY  619
            C + F+ SRA+YY T+D  G P GACG+G+YGR  N   G V  VS  L++NGA CG CY
Sbjct  24   CNEYFTNSRATYYGTSDGNGTPTGACGFGEYGRKMNWYDGRVAGVSG-LWRNGAGCGTCY  82

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QV+CK + LC   G  ++ATD   G  TDF++S  AF+ L      +  L + G VD+E+
Sbjct  83   QVKCKIAELCDVKGAYLVATDQGYGDRTDFVMSPNAFSRLGGNKNASAELKKYGTVDIEY  142

Query  438  RRVSCNSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGA  259
            RRV C     +   I ++S  P YL++++ N  G  D+ AVE++++   +W ++RR +GA
Sbjct  143  RRVPCTYIGNVLFHIKESSSNPGYLAVVILNVNGKYDVNAVEMWQKGKERWEALRRVYGA  202

Query  258  VWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            V+D ANPP GE+ +RF V      +W+    A IPA WK G T +T +
Sbjct  203  VFDFANPPRGEILLRFQV----GVKWMIPNIA-IPANWKPGATYDTKL  245



>ref|XP_010055415.1| PREDICTED: expansin-like B1 [Eucalyptus grandis]
 gb|KCW71892.1| hypothetical protein EUGRSUZ_E00357 [Eucalyptus grandis]
Length=245

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 143/229 (62%), Gaps = 11/229 (5%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            +CQ  F+ SRA+YY +    G P GACGYG+YGR  + G V  VS RL++NG+ CGACYQ
Sbjct  22   HCQDPFTPSRATYYGSPYCYGTPTGACGYGEYGRTID-GYVTGVS-RLYRNGSGCGACYQ  79

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAK-QPRMAEFLTEKGAVDVEF  439
            VRC     C+  G  V+ TDY EG  TDFILS R++  +AK      + L   G V+VEF
Sbjct  80   VRCTEP-QCTGEGAYVVVTDYGEGDRTDFILSTRSYAKMAKPDDYQTKQLFAYGVVEVEF  138

Query  438  RRVSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            RRV C    + L V ++++S+ P YL+I+L   GG +D+ A E ++++   W  MRR +G
Sbjct  139  RRVPCRYPGQNLLVSVNEHSRNPSYLAIILLYVGGTNDVTAAEYWQDDYQGWNRMRRVYG  198

Query  261  AVWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            AV+D   PP G+L +RF V  S    WV+ ++A +PA+WKAG   ++ +
Sbjct  199  AVFDTQTPPRGDLYLRFRVGGS----WVQPKRA-LPADWKAGAVYDSQV  242



>ref|XP_010531686.1| PREDICTED: LOW QUALITY PROTEIN: expansin-like B1 [Tarenaya hassleriana]
Length=245

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 133/227 (59%), Gaps = 18/227 (8%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACY-------QV  613
            SRA+YY + D  GNP GACGYGDYGR  N G+V AVS RL+ NG+ CG+ Y       +V
Sbjct  26   SRATYYGSPDCKGNPRGACGYGDYGREINDGQVSAVSWRLWNNGSMCGSFYIPNCXYNKV  85

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC     C + G  V+ATDY EG  TDFILS RA+  +A      E+L   G VDVE++R
Sbjct  86   RCTIPQHCKEEGTYVVATDYGEGDRTDFILSPRAYGRMASA-GAEEYLFSYGVVDVEYKR  144

Query  432  VSCNSAA-KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            + C      L  K+H+ S+ PHYL+IL    GG +DI AVE+       W SM      V
Sbjct  145  IPCRYGGYNLVYKVHERSRNPHYLAILFLYVGGLNDILAVEV-------WQSM-DCTSLV  196

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             DL  PP G + +RFLV  S    W++S  A IP++W AG T ++NI
Sbjct  197  HDLQTPPYGAITLRFLVYGSVGTTWLQSPNA-IPSDWNAGSTYDSNI  242



>ref|XP_009341228.1| PREDICTED: expansin-like B1 [Pyrus x bretschneideri]
Length=234

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 133/220 (60%), Gaps = 3/220 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++  G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC +S  
Sbjct  14   SRATYYPNSEAQGIDIGACGFGSFGAAINGGDVSA-ASDLYRSGLGCGACYQVRCTNSAY  72

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CSD G  V+ TD      TDFILS RAF  +A+    A  L   G VD+E+RRVSC+   
Sbjct  73   CSDKGVTVVLTDQGSSDHTDFILSKRAFGRMAQTIDAAASLLSLGIVDIEYRRVSCSYPN  132

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              + +KI +NS YPHYL+ ++  Q G  DI AV++ E + +    + R++GA+W   +PP
Sbjct  133  INITIKIDENSNYPHYLAFVIWYQQGKKDITAVQLCETKNFVCKVLDRSYGAIWTTTSPP  192

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L++R L+S      WV  +   IP +WK G T ++ +
Sbjct  193  SGALQIRMLLSDDDYETWVVPQNN-IPEDWKVGQTYDSGV  231



>ref|XP_010110506.1| Expansin-like protein [Morus notabilis]
 gb|EXC26724.1| Expansin-like protein [Morus notabilis]
Length=240

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 136/222 (61%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  +DE G  +G CGYG +G   N G+V A S  L+++G  CGACYQVRC +S  
Sbjct  17   SRAAYYPNSDEQGTDHGRCGYGSFGATINGGDVSAASD-LYRDGVGCGACYQVRCTNSAY  75

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  ++ TD+     TDFILS RAF  +A+    A  L   GAVD+E+RRVSC+  +
Sbjct  76   CSDKGATIVITDHGSSDRTDFILSRRAFGRMAQTSDAAASLFSLGAVDIEYRRVSCSYPS  135

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S +P+YL+ ++  Q G  D  AV++ E + +    + R++GAVW  ++PP
Sbjct  136  KNITIKIDESSSFPNYLAFVIWYQQGKRDNIAVQLCETQNFVCKLLDRSYGAVWTTSSPP  195

Query  234  SGELRVRFLVS--SSAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L++R L S        WV +    IP  WKAG T +T +
Sbjct  196  SGPLQIRMLFSDGDDGDESWV-APVNYIPQYWKAGDTYDTGL  236



>ref|XP_002528780.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
 gb|EEF33602.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
Length=256

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 137/228 (60%), Gaps = 5/228 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   FS SRA++Y  +D+ G  +GACG+G +G   N G+V A +S L+++G  CGACYQV
Sbjct  27   CSDCFSQSRAAHYPNSDDQGTVSGACGFGSFGATVNGGDVSA-ASNLYRDGVGCGACYQV  85

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC  S  C+D G  V+ TD     +TDFILS +AF  +A+    A  L   G +D+E+RR
Sbjct  86   RCTDSYYCTDKGVNVVITDSGSSHDTDFILSRQAFGRMAQTADAAASLLSLGVIDIEYRR  145

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            +SC+   K + VKI ++S YPHYL+ +L  Q G  DI AV++ E + +    + R++GAV
Sbjct  146  ISCSYPNKNVTVKIDESSNYPHYLAFVLWYQQGKRDITAVQLCETQNFVCKLLDRSYGAV  205

Query  255  WDLANPPSGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            W   +PPSG L +R L S       WV      IP +WKAG T +T +
Sbjct  206  WTTTSPPSGPLSLRMLFSGDDGEETWVVPVND-IPNDWKAGETYDTGV  252



>gb|EYU21911.1| hypothetical protein MIMGU_mgv1a019174mg [Erythranthe guttata]
Length=256

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 133/221 (60%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  +D  G   G+CGYG +G   N G+V A +S L+++G  CGACYQVRC ++  
Sbjct  34   SRAAHYPNSDVNGTETGSCGYGTFGATINGGDVSA-ASDLYRDGVGCGACYQVRCTNTNY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G   + TD+     TDFILS RAF  +A+    A  L   G VD+E+RRV C+  +
Sbjct  93   CSDKGVTTVITDHGSSGNTDFILSRRAFRRMAQNEDAAASLLAFGVVDIEYRRVPCSYPS  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YPHYL+ ++  Q G  DI AV++ E ++Y    M R++GAVW   +PP
Sbjct  153  KNITIKIDENSNYPHYLAFVIQYQQGTKDITAVQLCETQSYVCKLMDRSYGAVWTTTSPP  212

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S  +    WV      IP +WK G T ++ +
Sbjct  213  SGPLSLRMLFSDENGDETWVVPVND-IPEKWKPGETYDSGV  252



>emb|CAN79420.1| hypothetical protein VITISV_025068 [Vitis vinifera]
Length=259

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG        G + A    LFK+GA CGAC+Q+RCK++ LCS  G  V+ TD   
Sbjct  38   SGACGYGSLALGFYGGHLAAGVXSLFKDGAGCGACFQIRCKNTTLCSRAGTTVILTDLNR  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF+LS RAFTA+A +  M + + + G VDVE++RV CN +   L +++ + SQ PH
Sbjct  98   NNQTDFVLSSRAFTAMANKG-MGQQILKLGLVDVEYKRVLCNYNKQNLAIRVEEMSQKPH  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL+I +  QGG ++I  +++ + ++ +W  M R +GA+WD +N PSG L++RF+V+    
Sbjct  157  YLAIKVLYQGGQTEIVGMDVAQVDSSRWTYMTRNYGAIWDTSNVPSGPLQLRFVVTGGYD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +WV ++K ++PA+WK G T +  +
Sbjct  217  GKWVWAKK-VLPADWKVGETYDAGV  240



>ref|XP_002281851.1| PREDICTED: expansin-like A2 [Vitis vinifera]
 emb|CBI37780.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG        G + A    LFK+GA CGAC+Q+RCK++ LCS  G  V+ TD   
Sbjct  38   SGACGYGSLALGFYGGHLAAGVPSLFKDGAGCGACFQIRCKNTTLCSRAGTTVILTDLNR  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF+LS RAFTA+A +  M + + + G VDVE++RV CN +   L +++ + SQ PH
Sbjct  98   NNQTDFVLSSRAFTAMANKG-MGQQILKLGLVDVEYKRVLCNYNKQNLAIRVEEMSQKPH  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL+I +  QGG ++I  +++ + ++ +W  M R +GA+WD +N PSG L++RF+V+    
Sbjct  157  YLAIKVLYQGGQTEIVGMDVAQVDSSRWTYMTRNYGAIWDTSNVPSGPLQLRFVVTGGYD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +WV ++K ++PA+WK G T +  +
Sbjct  217  GKWVWAKK-VLPADWKVGETYDAGV  240



>ref|XP_004300282.1| PREDICTED: expansin-like B1-like [Fragaria vesca subsp. vesca]
Length=257

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 132/221 (60%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++  G   GACG+G +G   N G+V A +S LF+NG  CGACYQVRC + G 
Sbjct  35   SRAAYYPNSETQGTEIGACGFGTFGATINGGDVSA-ASDLFRNGVGCGACYQVRCTNGGY  93

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD      TDFILS RAF  +A+    A  L   G VD+E+RRVSC+   
Sbjct  94   CSDKGVTVVITDSGSSDRTDFILSQRAFARMAQTTDAAASLLSLGIVDIEYRRVSCSYPN  153

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YP+YL+ ++  Q G  DI AV++ E + +    + R++GAVW   +PP
Sbjct  154  KNITIKIDENSNYPYYLAFVIWYQQGKKDITAVQLCETQNFVCKLLDRSYGAVWTTTSPP  213

Query  234  SGELRVRFLVS-SSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L++R L S       WV      IP +W+ G T ++ +
Sbjct  214  TGPLQIRMLFSDDDGDENWVVPVNN-IPQDWEVGQTYDSGV  253



>ref|XP_002278917.1| PREDICTED: expansin-like B1 [Vitis vinifera]
Length=255

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 136/228 (60%), Gaps = 5/228 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA+YY  +DE+G   G CGYG +G   N G+V A +S L+++G  CGACYQV
Sbjct  27   CSDCFTHSRAAYYPNSDELGTETGQCGYGSFGATINDGDVSA-ASDLYRDGVGCGACYQV  85

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC +S  CSD G  V+ TD+  G  TDFI+S RAF  +A+    A  L   G VD+E+RR
Sbjct  86   RCTNSNYCSDKGVTVVITDHGSGDRTDFIMSKRAFGRMAQTTDAAASLLALGVVDIEYRR  145

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC+  +K + +KI +NS +P+Y++ ++  Q G  DI AV++ E + +    + R++G+V
Sbjct  146  VSCSYPSKNITIKIDENSNFPYYMAFVIWYQQGMKDITAVQLCETQNFVCKLLDRSYGSV  205

Query  255  WDLANPPSGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            W   +PPSG L +R L S       WV      IP  WKA    +T +
Sbjct  206  WTTNSPPSGTLSLRMLFSGDDGDETWVVPINN-IPENWKAADIYDTGV  252



>emb|CBI33924.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 136/228 (60%), Gaps = 5/228 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA+YY  +DE+G   G CGYG +G   N G+V A +S L+++G  CGACYQV
Sbjct  10   CSDCFTHSRAAYYPNSDELGTETGQCGYGSFGATINDGDVSA-ASDLYRDGVGCGACYQV  68

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC +S  CSD G  V+ TD+  G  TDFI+S RAF  +A+    A  L   G VD+E+RR
Sbjct  69   RCTNSNYCSDKGVTVVITDHGSGDRTDFIMSKRAFGRMAQTTDAAASLLALGVVDIEYRR  128

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC+  +K + +KI +NS +P+Y++ ++  Q G  DI AV++ E + +    + R++G+V
Sbjct  129  VSCSYPSKNITIKIDENSNFPYYMAFVIWYQQGMKDITAVQLCETQNFVCKLLDRSYGSV  188

Query  255  WDLANPPSGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            W   +PPSG L +R L S       WV      IP  WKA    +T +
Sbjct  189  WTTNSPPSGTLSLRMLFSGDDGDETWVVPINN-IPENWKAADIYDTGV  235



>ref|XP_011032021.1| PREDICTED: expansin-like B1 [Populus euphratica]
Length=290

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 133/221 (60%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  +DE G   G CGYG +G   N G+V A +S L+++G  CGACYQVRC +S  
Sbjct  68   SRAAYYPNSDENGTDTGRCGYGSFGATLNGGDV-AAASDLYRDGVGCGACYQVRCTNSYY  126

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  ++ TD      TDFILS RAF  +A+    A  L   G VD+E+RRVSC+ + 
Sbjct  127  CTDKGVTIVITDQGSSDNTDFILSRRAFGRMAQTTDAAASLLALGVVDIEYRRVSCSYSN  186

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YP+YL  ++  Q G SDI AV++ E + +    + R++GAVW   +PP
Sbjct  187  KNITIKIDENSNYPYYLGFVIWYQQGRSDITAVQLCETQNFVCKLLDRSYGAVWTTTSPP  246

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L +R L S  +    WV      IP +WKAG T +T +
Sbjct  247  RGPLSLRMLFSDENGDETWVVPVNN-IPNDWKAGETYDTGV  286



>ref|XP_010055378.1| PREDICTED: expansin-like B1 [Eucalyptus grandis]
 gb|KCW71836.1| hypothetical protein EUGRSUZ_E00317 [Eucalyptus grandis]
Length=255

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 131/221 (59%), Gaps = 2/221 (1%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            SSRASYY  + E G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC +S 
Sbjct  33   SSRASYYPNSTEQGTETGACGFGSFGAMINGGDVSA-ASNLYRSGVGCGACYQVRCTNSK  91

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
             CSD G  V+ TD   G  TDFILS RA+  +A+    A ++   G VD+E+RRVSC+  
Sbjct  92   YCSDKGVTVVVTDQGSGDNTDFILSQRAYGRMAQTSDAASYIYALGVVDIEYRRVSCSYP  151

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               + +KI ++S  P+YL  ++  Q G  DI AV++ E + Y    + R++GAVW   +P
Sbjct  152  NHNITIKIDESSNNPYYLGFVIWYQQGDKDITAVQLCETQNYVCKLLDRSYGAVWTTTSP  211

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            PSG L +R L+S              IP +WKAG T +T +
Sbjct  212  PSGPLALRMLLSGDDGDETWLVPVNNIPQDWKAGATYDTGV  252



>ref|XP_006385603.1| hypothetical protein POPTR_0003s08530g [Populus trichocarpa]
 gb|ERP63400.1| hypothetical protein POPTR_0003s08530g [Populus trichocarpa]
Length=256

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 133/221 (60%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  +DE G   G CGYG +G   N G+V A +S L+++G  CGACYQV+C +S  
Sbjct  34   SRAAYYPNSDENGTDTGRCGYGSFGATLNGGDV-AAASDLYRDGVGCGACYQVKCTNSYY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  ++ TD      TDFILS RAF  +A+    A  L   G VD+E+RRVSC+   
Sbjct  93   CTDNGVTIVITDQGSSDNTDFILSRRAFGRMAQTTDAAASLLALGVVDIEYRRVSCSYPY  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YP+YL  ++  Q G SDI AV++ E + +    + R++G+VW   +PP
Sbjct  153  KNITIKIDENSNYPYYLGFVIWYQQGRSDITAVQLCETQNFVCKLLDRSYGSVWTTTSPP  212

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S  +    WV      IP +WKAG T +T +
Sbjct  213  SGPLSLRMLFSDENGDETWVVPVNN-IPNDWKAGETYDTGV  252



>ref|XP_010269911.1| PREDICTED: expansin-like B1 [Nelumbo nucifera]
Length=256

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 138/229 (60%), Gaps = 6/229 (3%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA+YY  +DE G  +GACG+G +G   N G+V A +S L+++G  CGACYQV
Sbjct  27   CSDCFTQSRAAYYPNSDEKGTEDGACGFGSFGATINGGDVSA-ASDLYRDGVGCGACYQV  85

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC ++  CSD G  V+ TD+     TDFILS RAF+ +A+    A  L   G V +E+RR
Sbjct  86   RCTNAQFCSDNGVTVVITDHGSSDRTDFILSRRAFSKMAQTTDAAASLLSLGVVGIEYRR  145

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC+   K ++ KI ++S YP+YL+ +L  Q G  D+ AV++ E + +    + R+ GAV
Sbjct  146  VSCSYPNKNIQFKIDESSNYPNYLAFVLWFQQGKKDVTAVQLCETQNFVCKLLDRSHGAV  205

Query  255  WDLANPPSGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            WD   PPSG L +R L++ S      W+      IP +WKAG   ++ +
Sbjct  206  WDSVMPPSGPLSIRMLLTDSDTGDETWLVPTND-IPQDWKAGDVYDSGV  253



>ref|XP_009596665.1| PREDICTED: expansin-like B1 [Nicotiana tomentosiformis]
Length=255

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 132/221 (60%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  ++E G   G+CG+G +G   N G+V A +S LF+NG  CGACYQVRC +S  
Sbjct  33   SRAAHYPNSEEKGTETGSCGFGTFGATINGGDVSA-ASDLFRNGLGCGACYQVRCTNSNY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A+    A  L   G VD+E+RRVSC+   
Sbjct  92   CSDKGVTVVITDQGAGDRTDFILSKRAFARMAQTTDAAASLLSFGVVDIEYRRVSCSYPD  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ ++  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  152  KNITIKIEESSDNPHYLAFVIWYQQGKKDITAVQLCETQNFVCKLLDRTRGAVWTTTSPP  211

Query  234  SGELRVRFLVS-SSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R L+S       WV +    IP  WKAG T ++ I
Sbjct  212  RGPLQIRMLLSVDDGDETWVVAVNN-IPENWKAGDTYDSGI  251



>ref|XP_011081880.1| PREDICTED: expansin-like B1 [Sesamum indicum]
Length=257

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 135/228 (59%), Gaps = 5/228 (2%)
 Frame = -1

Query  789  CQQNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F  SRA++Y  +D+ G   G CGYG +G   NAG+V A +S L+++G  CGACYQV
Sbjct  28   CRDCFIHSRAAHYPNSDDNGTEIGRCGYGTFGATLNAGDVSA-ASDLYRDGVGCGACYQV  86

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC +S  CSD G   + TD+     TDFILS RAF  +A+    A  L   G VD+E+RR
Sbjct  87   RCTNSNYCSDKGVTAVITDHGSSDRTDFILSRRAFGRMAQNQDAAASLLALGIVDIEYRR  146

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V C+   K + +KI +NS YPHYL+ ++  Q G+ DI AV++ E + Y    + R++GAV
Sbjct  147  VPCSYPNKNITIKIDENSNYPHYLAFVIWYQEGSKDITAVQLCETKNYICKLLDRSYGAV  206

Query  255  WDLANPPSGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            W   +PP G L VR L S  +    WV   K  IP  WK G T ++ +
Sbjct  207  WTTTSPPIGPLSVRMLFSDENGEETWVVPVKD-IPDNWKPGETYDSGV  253



>ref|XP_010266113.1| PREDICTED: expansin-like A2 [Nelumbo nucifera]
Length=260

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 139/220 (63%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            ++A+Y+ ++  +   +GACGYG    + NAG + A  S L+++G  CGAC+Q+RCK+  L
Sbjct  26   TKAAYFSSSAPL--SSGACGYGSLALSFNAGYLAAGVSSLYRDGVGCGACFQIRCKNETL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G KV+ TD     +TD +LS RAF+A+A Q  MA  + + G +DVE++R+ C+   
Sbjct  84   CNGGGTKVILTDLNRNNQTDLVLSSRAFSAMAHQG-MARDILKLGILDVEYKRIPCDYKK  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
             KL V++ + SQ PHYL+I L  QGG +DI AV++ +  +  W  M R +G VWD +  P
Sbjct  143  QKLSVRVEETSQRPHYLAIKLLYQGGQTDIVAVDVAQVGSSNWRYMSRKYGTVWDTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V+     +WV + K ++PA+W+ G+T ++ I
Sbjct  203  MGALQFRLVVTGGFDGKWVWAPK-VLPADWRPGMTYDSGI  241



>ref|XP_010695687.1| PREDICTED: expansin-like B1 [Beta vulgaris subsp. vulgaris]
Length=256

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 131/222 (59%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRASYY  +DE G  +GACG+G +G   N G V + +S L+++G  CGACYQVRC +S  
Sbjct  34   SRASYYPNSDEYGTNHGACGFGAFGATVNDGHV-STASDLYRDGVGCGACYQVRCTNSNY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF+ +A+   +A  L   G V++E++RVSCN   
Sbjct  93   CSDNGVTVVVTDQGSGDNTDFILSERAFSKMAQTEDLAASLKSLGVVNIEYQRVSCNYPG  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K +  KI ++S YP YL+  +  Q G  DI AV++ E +++    ++R  GAVW    PP
Sbjct  153  KNITFKIDESSSYPSYLAFAIYYQQGQKDITAVQLCETQSFTCKLLQRDHGAVWTSTPPP  212

Query  234  SGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S    A   W+      IP +W  G T ++ +
Sbjct  213  SGPLAIRMLFSDGDEANDTWIVPVNN-IPQDWNPGATYDSGV  253



>ref|XP_008373753.1| PREDICTED: expansin-like B1 [Malus domestica]
 ref|XP_008364491.1| PREDICTED: expansin-like B1 [Malus domestica]
Length=255

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 128/220 (58%), Gaps = 3/220 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++E G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC  S  
Sbjct  35   SRATYYPNSEEQGTDVGACGFGSFGATLNGGDVSA-ASDLYRSGLGCGACYQVRCTDSAY  93

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G   + TD      TDFILS RAF  +A+    A  L   G +D+E+RRVSC+   
Sbjct  94   CSDKGVTAVITDQGSSDGTDFILSKRAFGRMAQTTEAAASLQSLGVIDIEYRRVSCSYPN  153

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  P+YL+ ++  Q G  DI AV++ E   +  I M R+FGAVW   + P
Sbjct  154  KNITIKIDEHSNNPYYLAFVIEYQQGKKDITAVQLCETTNFVCIVMDRSFGAVWTTTSAP  213

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R L S      WV      IP +WK G T +T +
Sbjct  214  IGPLQIRMLFSDDDDETWVVPLNT-IPQDWKVGQTYDTGV  252



>ref|XP_004245860.1| PREDICTED: expansin-like B1 [Solanum lycopersicum]
Length=255

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 130/221 (59%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  ++E G   G+CG+G +G   N G+V A +S L++NG  CGACYQVRC  S  
Sbjct  33   SRAAHYPNSEEKGTETGSCGFGTFGATINGGDVSA-ASELYRNGLGCGACYQVRCTDSNY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A+    A  +   G VD+E+RRVSC    
Sbjct  92   CSDKGVTVVVTDQGAGDRTDFILSQRAFARMAQTTDAAASILPLGVVDIEYRRVSCTYPD  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ ++  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  152  KNITIKIEESSDNPHYLAFVIWYQQGKKDITAVQLCETQNFVCKLLDRTRGAVWTTTSPP  211

Query  234  SGELRVRFLVS-SSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R L+S       WV+     IP  WKAG T ++ I
Sbjct  212  RGPLQIRMLLSVDDEDETWVDPVNN-IPENWKAGDTYDSGI  251



>ref|XP_009804317.1| PREDICTED: expansin-like B1 [Nicotiana sylvestris]
Length=255

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 131/221 (59%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  ++E G   G+CG+G +G   N G+V A +S LF+NG  CGACYQVRC +S  
Sbjct  33   SRAAHYPNSEEKGTETGSCGFGTFGATINGGDVSA-ASDLFRNGLGCGACYQVRCTNSNY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A+    A  L   G VD+E+RRVSC+   
Sbjct  92   CSDKGVTVVITDQGAGDRTDFILSQRAFARMAQTTDAAASLLSLGVVDIEYRRVSCSYPD  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ ++  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  152  KNITIKIEESSDNPHYLAFVIWYQQGKRDITAVQLCETQNFVCKLLDRTRGAVWTTTSPP  211

Query  234  SGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
             G L++R L+S       WV      IP  WK+G T ++ I
Sbjct  212  RGPLQIRMLLSDDDGDETWVIPVNN-IPENWKSGDTYDSGI  251



>gb|KDP40448.1| hypothetical protein JCGZ_03948 [Jatropha curcas]
Length=259

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+  +  +   +GACGYG      N G + A    L+K+GA CGAC+++RCK S L
Sbjct  25   SKAAYFSKSSAL--YSGACGYGSLAIGFNGGHLAAAVPTLYKDGAGCGACFKLRCKDSSL  82

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  VM TD  +   TDF+LS RAF A+A    M + L + G VD+E++RV C    
Sbjct  83   CSSKGTTVMVTDLNQNNNTDFVLSGRAFMAMANNG-MGKDLLKHGIVDIEYKRVPCEFKN  141

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L V++ ++SQYP+YL+I L  QGG +++ A+++ +  +  W  M R +GAVWD +  P
Sbjct  142  KNLAVRVEESSQYPNYLAIKLLYQGGQTEVVAIDVAKVGSSNWGYMSRNYGAVWDTSRVP  201

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    +W+ ++  ++PA+WK G   ++ +
Sbjct  202  AGALQFRFVVTAGYDGKWIWAQN-VLPADWKVGTVYDSGV  240



>ref|XP_006362493.1| PREDICTED: expansin-like B1-like [Solanum tuberosum]
Length=253

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 140/226 (62%), Gaps = 5/226 (2%)
 Frame = -1

Query  783  QNF-SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRC  607
            QNF  SRA+YY  ++E G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC
Sbjct  27   QNFIQSRAAYYPNSEEKGTETGACGFGTFGATINGGDVSA-ASDLYRDGLGCGACYQVRC  85

Query  606  KSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
             +S  CS+ G KV+ TD+     TDFILS RAF+ +A+    A  L   G V +E+RRVS
Sbjct  86   TNSNYCSENGVKVVITDHGASDSTDFILSQRAFSRMAQTKDAAASLLSLGNVGIEYRRVS  145

Query  426  CNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C+   K +  KI ++S  P+YL+ ++  Q G +DI AV++ E + +    + R  GAVW 
Sbjct  146  CSYPNKNITFKIDESSDNPYYLAFVIWYQQGKTDISAVQLCETQNFVCKLLDRTRGAVWT  205

Query  249  LANPPSGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
             ++PP G+L++R L+SS     +WV S    IP  WKAG T ++ I
Sbjct  206  SSSPPKGQLQIRMLLSSDDGDEKWVISLNN-IPENWKAGETYDSGI  250



>ref|XP_006436816.1| hypothetical protein CICLE_v10032508mg [Citrus clementina]
 ref|XP_006485370.1| PREDICTED: expansin-like B1-like [Citrus sinensis]
 gb|ESR50056.1| hypothetical protein CICLE_v10032508mg [Citrus clementina]
Length=257

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 130/222 (59%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  +DE G  +GACG+G +G   N G+V A S  L++NG  CGACYQVRC +S  
Sbjct  35   SRAAHYPNSDEQGTDSGACGFGSFGATINGGDVSAASG-LYRNGLGCGACYQVRCLNSYY  93

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A+    A  L   G VDVE+RRVSC+   
Sbjct  94   CSDRGATVVITDSGWGPNTDFILSRRAFGRMAQTTDAAAALLAHGVVDVEYRRVSCSYPY  153

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI + S YPHYL  ++  Q G  DI AV++ E + +    + R+ GAVW   +PP
Sbjct  154  KNITIKIDEKSDYPHYLGFVIWYQQGKKDITAVQLCETKNFACKLLDRSHGAVWTTTSPP  213

Query  234  SGELRVRFLVSSSAA--ARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R   S        WV      IP +WKAG T +T +
Sbjct  214  SGPLSLRMFFSDEDGDDESWVVPVNN-IPQDWKAGETYDTGV  254



>gb|KHN01661.1| Expansin-like B1 [Glycine soja]
Length=251

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 130/222 (59%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  + E G   GAC +G +G   N G+V A +S L++NG  CGACYQVRC +S L
Sbjct  28   SRAAFYPNSQENGTDVGACEFGSFGATVNGGDVSA-ASNLYRNGVGCGACYQVRCSNSAL  86

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A     A  L   G +D+++RRVSC+   
Sbjct  87   CSDNGVTVVITDSGSGHNTDFILSQRAFGRMALNTDAAASLLALGVLDIQYRRVSCSYPN  146

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + VKIH++S  PHYL+ ++  Q G+ DI AV++ E + +    + R+ GAVW    PP
Sbjct  147  KNITVKIHESSNNPHYLAFVIWFQQGSRDITAVQLCETQNFVCKLLDRSHGAVWTTTAPP  206

Query  234  SGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S        WV      IP +WKAG T +  +
Sbjct  207  SGPLTLRMLFSPEEEGEETWVVPVNN-IPQDWKAGQTYDLGV  247



>ref|XP_011018644.1| PREDICTED: expansin-like B1 [Populus euphratica]
Length=256

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 129/221 (58%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++E G   G CGYG +G   N G+V AVS  L+++G  CGACYQVRC  S  
Sbjct  34   SRAAYYPNSNENGTDTGRCGYGSFGATLNDGDVSAVSD-LYRDGVGCGACYQVRCTDSQY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  ++ TD+     TDFILS RAF+ +A+    A  L   G VDVE++RVSC+   
Sbjct  93   CTDKGVTIVVTDHGSSHNTDFILSRRAFSRMAQTTDAAASLLALGVVDVEYKRVSCSYPN  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS +P Y+  ++  Q G  DI AV + E + +    + R +GAVW   +PP
Sbjct  153  KNITIKIDENSNHPSYMGFVVWYQQGRRDITAVLLCETQNFACKVLDRTYGAVWTTTSPP  212

Query  234  SGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S       WV      IP +WKAG T +T +
Sbjct  213  SGPLSLRMLFSEEDGDETWVVPVNN-IPNDWKAGQTYDTGV  252



>ref|XP_002528779.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
 gb|EEF33601.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis]
Length=256

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 131/221 (59%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+YY  +DE G   GACG+G +G   N G+V A +S L+++G  CG+CYQVRC +S  
Sbjct  34   SQAAYYPNSDEQGTDRGACGFGSFGATINGGDVSA-ASNLYRDGVGCGSCYQVRCINSNY  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  +  TD       DFILS RAF  +A+    A  L   G VDVE+RRVSC+   
Sbjct  93   CTDKGVVITITDQGSSGNADFILSRRAFGRMAQTTDAAASLLSLGVVDVEYRRVSCSYPN  152

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS YP+YL+ ++  Q G  DI AV++ E + +    + R++GAVW   +PP
Sbjct  153  KNITIKIDENSNYPYYLAFVIWFQQGKQDITAVQLCETQNFVCKLLDRSYGAVWTTTSPP  212

Query  234  SGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S       WV      IP +WKAG T +T +
Sbjct  213  SGPLSLRMLFSGEDGDETWVVPVNN-IPQDWKAGETYDTGV  252



>ref|XP_006368460.1| hypothetical protein POPTR_0001s03010g [Populus trichocarpa]
 gb|ERP65029.1| hypothetical protein POPTR_0001s03010g [Populus trichocarpa]
Length=254

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 128/221 (58%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  + E G   G CGYG +G   N G+V AVS  L+++G  CGACYQVRC  S  
Sbjct  32   SRAAYYPNSYENGTDTGRCGYGSFGATLNGGDVSAVSD-LYRDGVGCGACYQVRCTDSHY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  ++ TD+     TDFILS RAF  +A+    A  L   G VDVE++RVSC+   
Sbjct  91   CTDKGVTIVVTDHGSSHNTDFILSRRAFGRMAQTTDAAASLIALGVVDVEYKRVSCSYPN  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI +NS +P Y+  ++  Q G  DI AV + E + +    + R++GAVW   +PP
Sbjct  151  KNITIKIDENSDHPSYMGFVVWYQQGRRDITAVHLCETQNFACKVLDRSYGAVWTTTSPP  210

Query  234  SGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S       WV      IP +WKAG T +T +
Sbjct  211  SGPLSLRMLFSEEDGDETWVVPVNN-IPNDWKAGQTYDTGV  250



>dbj|BAA05476.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=163

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 113/161 (70%), Gaps = 1/161 (1%)
 Frame = -1

Query  597  GLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNS  418
            GLC D+G KV  TD  EG  TDFIL+  AF  +AK P++A  L  KG VDV+++RVSC  
Sbjct  1    GLCCDVGVKVKVTDSGEGPGTDFILTSDAFAKMAKHPKLAHMLFPKGVVDVDYKRVSC-K  59

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L ++++++S Y  YL+ILL N GG +DI AV+I EE++++W++MRR++GAV+DL+NP
Sbjct  60   YGNLIIRVNEHSNYNGYLAILLLNNGGYADILAVQISEEKSHKWLAMRRSYGAVFDLSNP  119

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L+++  +      +WV+S+K +IP  WKAG   ET++
Sbjct  120  PKGNLKLKIQIKEDGKTKWVQSDKTVIPDHWKAGDAYETDV  160



>ref|XP_007155744.1| hypothetical protein PHAVU_003G228000g [Phaseolus vulgaris]
 gb|ESW27738.1| hypothetical protein PHAVU_003G228000g [Phaseolus vulgaris]
Length=250

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 129/222 (58%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++E G   GACG+G +G   N G+V A +S L++NG  CGACYQVRC +S  
Sbjct  27   SRAAYYPNSEENGTDVGACGFGSFGATVNGGDVSA-ASNLYRNGVGCGACYQVRCSNSVY  85

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  ++ TD      TDFILS RAF  +A     A  L   G VD+E+RRVSC+   
Sbjct  86   CSGNGVTIVITDQGSSANTDFILSQRAFGGMAINKDAAASLLALGIVDIEYRRVSCSYPN  145

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + VKIH++S  PHYL  +L  Q G+ DI AV++ E + +    + R+ GAVW    PP
Sbjct  146  KNITVKIHESSNNPHYLGFVLWFQQGSRDITAVQLCETQNFVCKLLDRSHGAVWTTTAPP  205

Query  234  SGELRVRFLVSSSAAA--RWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S+       WV      IP +WKAG T +  I
Sbjct  206  SGPLALRMLFSAEEEGDESWVVPVND-IPQDWKAGETYDLGI  246



>ref|XP_003524361.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN21039.1| Expansin-like B1 [Glycine soja]
Length=250

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 128/222 (58%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  + E G   GAC +G +G   N G+V A +S L++NG  CGACYQVRC +S L
Sbjct  27   SRAAFYPNSQENGTDVGACEFGSFGATVNGGDVSA-ASNLYRNGVGCGACYQVRCGNSAL  85

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V+ TD   G  TDFILS RAF  +A     A  L   G VD+++RRVSC+   
Sbjct  86   CSGNGVTVVITDQGSGHNTDFILSQRAFGRMALNTDAAASLLALGVVDIQYRRVSCSYPN  145

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + VKIH++S  PHYL+ ++  Q G  DI AV+I E + +    + R+ GAVW    PP
Sbjct  146  KNITVKIHESSNNPHYLAFVIWFQQGNRDITAVQICETQNFVCKLLDRSHGAVWTTTAPP  205

Query  234  SGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S        WV      IP +WKAG T +  +
Sbjct  206  SGPLSLRMLFSPEEEGEETWVVPVNK-IPQDWKAGQTYDLGV  246



>ref|XP_004508990.1| PREDICTED: expansin-like B1-like [Cicer arietinum]
Length=254

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 130/221 (59%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRASYY  +DE G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC +S  
Sbjct  32   SRASYYPNSDENGTDAGACGFGSFGATINGGDVSA-ASNLYRDGVGCGACYQVRCANSVY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  ++ TD   G  TDFILS RAF  +A+    A  L   G V++E+RRVSC+   
Sbjct  91   CSSNGVTIVLTDQGSGDNTDFILSQRAFGGMAQTKDAAASLLALGVVNIEYRRVSCSYPN  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ +L  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  151  KNITIKIDESSSNPHYLAFVLWYQQGKRDITAVQLCETQNFVCKLLDRDHGAVWTTTSPP  210

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S+      WV      IP +WKAG T +  +
Sbjct  211  SGPLSLRMLFSTEDGEDTWVVPVNN-IPEDWKAGDTYDAGV  250



>gb|KHG18742.1| Expansin-like A1 [Gossypium arboreum]
Length=260

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 6/220 (3%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+    +    +GACGYG      + G + A  S L+K GA CGAC+Q+RCK S L
Sbjct  28   SKASYFS---DAAASSGACGYGSLALTISGGHLAAGVSSLYKQGAGCGACFQIRCKDSKL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G KV  TD     +TDF+L+ RAF A+A + +  + L + G VDVE++R+ C    
Sbjct  85   CSSKGTKVTLTDLNHNNQTDFVLTSRAFMAMANKGKGQDVL-KLGIVDVEYKRIPCEYKN  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L +++ ++S  P+YL+I L  QGG ++I A+++ +  +  W  M R +GAVWD +  P
Sbjct  144  QNLAIRVEESSHKPYYLAIKLLYQGGQTEIVAIDVAQVGSSNWSFMTRNYGAVWDASRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V+S    +WV + K ++PA+WK G+T ++ +
Sbjct  204  NGALQFRFVVTSGYDGKWVWA-KNVLPADWKIGVTYDSGV  242



>ref|XP_010274616.1| PREDICTED: expansin-like B1 [Nelumbo nucifera]
Length=257

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 138/229 (60%), Gaps = 6/229 (3%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA+YY  + E G  +GACG+G +G   N G+V A +S L+++G  CGACYQV
Sbjct  28   CSDCFTQSRAAYYPNSHEKGTEDGACGFGSFGATINGGDVSA-ASDLYRDGVGCGACYQV  86

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC +S  CS+ G  V+ TD+     TDFILS RAF+ +A+    A  L   G VD+E+RR
Sbjct  87   RCTNSQYCSENGVTVVITDHGSSDRTDFILSKRAFSKMAQTTDAAASLLALGVVDIEYRR  146

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC+  +K ++ KI ++S YP+YL+ +L  Q G  D+ AV++ E + +    + R+ GAV
Sbjct  147  VSCSYPSKNIQFKIDESSNYPNYLAFVLWYQQGKKDVTAVQLCETKNFVCKLLDRSHGAV  206

Query  255  WDLANPPSGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            W    PPSG L +R L++ S      W+      IP +WKAG   ++ +
Sbjct  207  WGSVMPPSGPLSIRMLLTDSDTGDETWLVPTNN-IPQDWKAGEVYDSGV  254



>ref|XP_006358602.1| PREDICTED: expansin-like B1-like [Solanum tuberosum]
Length=255

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 128/221 (58%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  ++E G   G+CG+G +G   N G+V A +S L++NG  CGACYQVRC     
Sbjct  33   SRAAHYPNSEEKGTETGSCGFGTFGATINGGDVSA-ASELYRNGLGCGACYQVRCTDGNY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  ++ TD   G  TDFILS RAF  +A+    A  +   G VD+E+RRVSC    
Sbjct  92   CSDKGVTIVVTDQGAGDRTDFILSQRAFARMAQTTDAAASILPLGVVDIEYRRVSCTYPD  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ ++  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  152  KNITIKIEESSDNPHYLAFVIWYQQGKKDITAVQLCETQNFVCKLLDRTRGAVWTTTSPP  211

Query  234  SGELRVRFLVS-SSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R L+S       WV      IP  WKAG T ++ I
Sbjct  212  RGPLQIRMLLSVDDEDETWVVPVNN-IPENWKAGDTYDSGI  251



>ref|XP_004163761.1| PREDICTED: expansin-like B1-like [Cucumis sativus]
Length=255

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 136/227 (60%), Gaps = 4/227 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA++Y  ++E G  +GACGYG +G   N G+V A +S L++NG  CGACYQ+
Sbjct  28   CNDCFTRSRAAHYPNSEEQGTDHGACGYGTFGATINDGDV-ATASDLYRNGLGCGACYQI  86

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC  S LCS+ G  V+ TD   G   DFI+S RA+  LA+ P  A  L   G +D+E++R
Sbjct  87   RCIDSELCSEKGTMVVITDQGSG-PGDFIMSRRAYAGLAQTPYAAVSLMALGVIDIEYKR  145

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V+C+   K + +KI +NS  PHYL+ ++  Q G +DI AV++ E + +    + R++G V
Sbjct  146  VACSYPNKNITIKIDENSNAPHYLAFVIRFQQGKNDITAVQLCETKNFVCKLLDRSYGTV  205

Query  255  WDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            W  A+PP G L +R L+++             IP +WKAG   +T +
Sbjct  206  WTTASPPRGPLSLRMLLTNEEGDEQWTVPINDIPRDWKAGDIYDTGV  252



>emb|CAN66372.1| hypothetical protein VITISV_009464 [Vitis vinifera]
Length=205

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 120/167 (72%), Gaps = 4/167 (2%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C+  F+ SRA+YY ++D +G P GACG+G+YGRN N G V AVS RL+++G  CGACYQV
Sbjct  24   CEDTFTYSRATYYGSSDGLGTPTGACGFGEYGRNVNGGNVGAVS-RLYRDGTGCGACYQV  82

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RCK + LC+D G KV+ TD+  G +TDFILS R F+ LA+  + A+ L   GAV VE+RR
Sbjct  83   RCKMTNLCADDGTKVVVTDHGGGDDTDFILSQRGFSMLARPNKTAD-LFAYGAVGVEYRR  141

Query  432  VSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEET  295
            V C    + +  K+H+NS++P YLS+++  Q G SDI AV+I++E++
Sbjct  142  VPCQYPGSNIFFKVHENSRFPDYLSLVMLYQAGLSDITAVDIWQEDS  188



>ref|XP_011045305.1| PREDICTED: expansin-like A2 [Populus euphratica]
Length=274

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 138/220 (63%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+     +    GACGYG      N+G + A  S L+K+GA CGAC+Q+RCK++ L
Sbjct  40   SKVAYFSKASAL--STGACGYGSMAIGFNSGHLAAAVSSLYKDGAGCGACFQIRCKNTAL  97

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G +V+ TD     +TDF+LS RAF A+AK+  M + + + G +DVE++RV C    
Sbjct  98   CSSRGTRVIVTDLNNNNQTDFVLSSRAFMAMAKKG-MGQDILKHGILDVEYKRVPCEYKN  156

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P+YL+I L  QGG +++ A+++ +  +  W  M R  GAVWD    P
Sbjct  157  QNLAVRVEESSKKPNYLAIKLLYQGGQTEVVAMDVAKVGSSNWGFMSRNHGAVWDTDRVP  216

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    +W+ ++K ++P +WK G+T ++ +
Sbjct  217  AGALQFRFVVTAGYDGKWIWAQK-VLPEDWKPGMTYDSGV  255



>ref|XP_004148502.1| PREDICTED: expansin-like B1-like [Cucumis sativus]
 gb|KGN60430.1| Major pollen allergen Ory s 1 [Cucumis sativus]
Length=255

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 139/228 (61%), Gaps = 6/228 (3%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRA++Y  ++E G  +GACGYG +G   N G+V A +S L++NG  CGACYQ+
Sbjct  28   CNDCFTRSRAAHYPNSEEQGTDHGACGYGTFGATINDGDV-ATASDLYRNGLGCGACYQI  86

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC  S LCS+ G  V+ TD   G   DFI+S RA+  LA+ P  A  L   G +D+E++R
Sbjct  87   RCIDSELCSEKGTMVVITDQGSG-PGDFIMSRRAYAGLAQTPYAAVSLMALGVIDIEYKR  145

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V+C+   K + +KI +NS  PHYL+ ++  Q G +DI AV++ E + +    + R++G V
Sbjct  146  VACSYPNKNITIKIDENSNAPHYLAFVIRFQQGKNDITAVQLCETKNFVCKLLDRSYGTV  205

Query  255  WDLANPPSGELRVRFLVSSSAA-ARWVESEKAIIPAEWKAGLTIETNI  115
            W  A+PP G L +R L+++     +W+      IP +WKAG   +T +
Sbjct  206  WTTASPPRGPLSLRMLLTNEEGDEQWIVPIND-IPRDWKAGDIYDTGV  252



>ref|NP_001241909.1| uncharacterized protein LOC100791557 precursor [Glycine max]
 gb|ACU23980.1| unknown [Glycine max]
Length=251

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 129/222 (58%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA++Y  + E G   GAC +G +G   N G+V A +S L++NG  CGACYQVRC +S L
Sbjct  28   SRAAFYPNSQENGTDVGACEFGSFGATVNGGDVSA-ASNLYRNGVGCGACYQVRCSNSAL  86

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CSD G  V+ TD   G  TDFILS RAF  +A     A  L   G +D+++RRVSC+   
Sbjct  87   CSDNGVTVVITDSGSGHNTDFILSQRAFGRMALNTDAAAPLLALGVLDIQYRRVSCSYPN  146

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + VKIH++S  PHY + ++  Q G+ DI AV++ E + +    + R+ GAVW    PP
Sbjct  147  KNITVKIHESSNNPHYSAFVIWFQQGSRDITAVQLCETQNFVCKLLDRSHGAVWTTTAPP  206

Query  234  SGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S        WV      IP +WKAG T +  +
Sbjct  207  SGPLTLRMLFSPEEEGEETWVVPVNN-IPQDWKAGQTYDLGV  247



>ref|XP_007041678.1| Expansin-like protein isoform 1 [Theobroma cacao]
 gb|EOX97509.1| Expansin-like protein isoform 1 [Theobroma cacao]
Length=259

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     +   +GACGYG      + G + A  S L+K+GA CGAC+Q+RC +S L
Sbjct  25   SKAAYFSKASAL--SSGACGYGSLALGLSGGHLAAGVSSLYKDGAGCGACFQIRCINSTL  82

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G +V  TD     +TDF+LS RAF A+A Q  M + + + G VDVE++R+ C    
Sbjct  83   CSSKGTRVTLTDLNHNNQTDFVLSSRAFMAMANQG-MGQDILKLGIVDVEYKRIPCEYKN  141

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++SQ P+YL+I L  QGG ++I  +++ +  +  W  M R +GAVWD +  P
Sbjct  142  QNLAVRVEESSQKPNYLAIKLLFQGGQTEIVGMDVAQVGSSNWNFMSRNYGAVWDTSRVP  201

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V+S    +W+ + K+++PA+WK G+  ++ +
Sbjct  202  TGALQFRFVVTSGFDGKWIWA-KSVLPADWKTGVIYDSGV  240



>ref|XP_008465922.1| PREDICTED: expansin-like B1 [Cucumis melo]
Length=273

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 138/228 (61%), Gaps = 6/228 (3%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ SRAS+Y  ++E G  +GACGYG +G   N G+V A +S L++NG  CGACYQ+
Sbjct  46   CNDCFTRSRASHYPNSEEQGTDHGACGYGTFGATINDGDV-ATASDLYRNGLGCGACYQI  104

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC  S LCS+ G  V+ TD   G   DFI+S RA+  LA+ P  A  L   G +D+E++R
Sbjct  105  RCIDSELCSEKGTMVVITDQGSG-PGDFIMSRRAYAGLAQTPYAAVSLMALGVIDIEYKR  163

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            V+C+   K + +KI +NS  PHYL+ ++  Q G +DI AV++ E + +    + R++G V
Sbjct  164  VACSYPNKNITIKIDENSDAPHYLAFVIRFQQGKNDITAVQLCETKNFVCKLLDRSYGTV  223

Query  255  WDLANPPSGELRVRFLVSSSAA-ARWVESEKAIIPAEWKAGLTIETNI  115
            W   +PP G L +R L+++     +W+      IP +WKAG   +T +
Sbjct  224  WTTTSPPRGPLSLRMLLTNEEGDEQWIVPIND-IPRDWKAGDIYDTGV  270



>gb|KEH31567.1| expansin-B1-like protein [Medicago truncatula]
Length=254

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 130/221 (59%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S AS+Y  ++E G   GACG+G +G   N G+V A SS L+++G  CGACYQVRC +S  
Sbjct  32   SHASFYPNSEENGTDTGACGFGSFGATINGGDVSAASS-LYRDGVGCGACYQVRCTNSVY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V+ TD   G  TDFILS RAF+ +A+    A  L   G V++E+RRVSC+   
Sbjct  91   CSGNGVTVVLTDQGSGDNTDFILSQRAFSGMAQSKDAATSLLALGVVNIEYRRVSCSYPN  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ +L  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  151  KNITIKIDESSSNPHYLAFVLWFQQGKRDITAVQLCETQNFVCKLLDRDHGAVWTSTSPP  210

Query  234  SGELRVRFLVSS-SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S+      W+      IP  WKAG T ++ +
Sbjct  211  SGPLTLRMLFSTEDGEDTWIVPVNN-IPENWKAGDTYDSGV  250



>ref|XP_010943941.1| PREDICTED: expansin-like A2 [Elaeis guineensis]
Length=263

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 122/202 (60%), Gaps = 2/202 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG    + N G + A SS L++ G  CG C+Q+RCK+S +CS  G KVM TD      
Sbjct  44   CGYGPMALDFNGGYLAAASSALYRGGVGCGGCFQIRCKNSKVCSSRGVKVMVTDLNASNR  103

Query  537  TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLS  361
            TDF+LS  AF A+AK+  M + L + G  DVE++R+ C    K L +++ +NS+ P+YL+
Sbjct  104  TDFVLSTTAFMAMAKEG-MGQELKQLGIADVEYKRIPCEYKNKNLAIRVEENSRKPNYLA  162

Query  360  ILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARW  181
            I    QGG +DI AV++ +  +  W  M R +GAVW     P G L+ R +V+     +W
Sbjct  163  IKFLYQGGQTDIVAVDVAQVGSTNWRYMTRDYGAVWSTNRAPVGPLQFRMVVTGGYDGKW  222

Query  180  VESEKAIIPAEWKAGLTIETNI  115
            V ++KA++P EWK GL  ++ +
Sbjct  223  VWAQKAVLPVEWKTGLVYDSGV  244



>gb|AFK41420.1| unknown [Medicago truncatula]
Length=254

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 128/220 (58%), Gaps = 2/220 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S AS+Y  ++E G   GACG+G +G   N G+V A SS L+++G  CGACYQVRC +S  
Sbjct  32   SHASFYPNSEENGTDTGACGFGSFGATINGGDVSAASS-LYRDGVGCGACYQVRCTNSVY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V+ TD   G  TDFILS RAF+ +A+    A  L   G V++E+RRVSC+   
Sbjct  91   CSGNGVTVVLTDQGSGDNTDFILSQRAFSGMAQSKDAATSLLALGVVNIEYRRVSCSYPN  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHYL+ +L  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  151  KNITIKIDESSSNPHYLAFVLWFQQGKRDITAVQLCETQNFVCKLLDRDHGAVWTSTSPP  210

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S+             IP  WKAG T ++ +
Sbjct  211  SGPLTLRMLFSTEDGEDTRIVPVNNIPENWKAGDTYDSGV  250



>ref|XP_004144877.1| PREDICTED: expansin-like A3-like [Cucumis sativus]
 ref|XP_004153087.1| PREDICTED: expansin-like A3-like [Cucumis sativus]
Length=263

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 132/220 (60%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A++Y   D   +  GACGYGD       G   A    L+K GA CGAC+QVRCK   L
Sbjct  26   SKATHY-YGDSPTSYGGACGYGDMALEFTNGYFSAAVPSLYKQGAGCGACFQVRCKDKRL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G KV+ TD       DF+LS +AF+A+A + +  E L   G VDVE++R+ C    
Sbjct  85   CNTAGSKVVLTDQNYDSRADFVLSRKAFSAMALKGKGQELLNT-GIVDVEYKRIPCGYKN  143

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L V++ ++S  P+YL++ L  QGG ++I AVEI E  +Y+W+S+RR +GAVWD +  P
Sbjct  144  KNLAVRVEESSYNPNYLAVKLLYQGGQTEIVAVEIAEVGSYEWVSLRRNYGAVWDTSKVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R   +S    +WV +E  ++P +WK G   +T +
Sbjct  204  KGALQMRMAFTSGYDGKWVWAE-YVLPVDWKVGAIYDTGV  242



>ref|XP_009792536.1| PREDICTED: expansin-like B1 [Nicotiana sylvestris]
Length=251

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 136/226 (60%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRC  607
            Q    S+A+YY  ++E G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC
Sbjct  25   QTFIHSKAAYYPNSEEKGTETGACGFGTFGATINGGDVSA-ASDLYRDGLGCGACYQVRC  83

Query  606  KSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
             +S  CSD G  ++ TD+     TDFILS RAF  +A+    A  L   G VD+E+RRVS
Sbjct  84   TNSNYCSDNGVTIVITDHGASGGTDFILSQRAFGRMAQTKDAAASLLSLGNVDIEYRRVS  143

Query  426  CNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C+  +K + +KI ++S  P+YL+ ++  Q G +DI AV++ E + +    + R  GAVW 
Sbjct  144  CSYPSKNITIKIDESSDNPYYLAFVIWYQQGKTDITAVQLCETQNFVCKLLDRTRGAVWT  203

Query  249  LANPPSGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
             ++PP G L++R L+S+      W+      IP  WKAG T ++ I
Sbjct  204  SSSPPRGPLQIRMLLSTDDGDETWIVPVNN-IPENWKAGETYDSGI  248



>ref|XP_010028810.1| PREDICTED: expansin-like A2 [Eucalyptus grandis]
 gb|KCW55629.1| hypothetical protein EUGRSUZ_I01493 [Eucalyptus grandis]
Length=259

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 142/220 (65%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     +   +GACGYG      N+G + A    L+K+GA CGAC+Q+RCK++ L
Sbjct  26   SKAAYFSKASAL--SSGACGYGSLAVGFNSGFLAAAIPSLYKDGAGCGACFQIRCKNANL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G +V+ TD      TDF+LS RAF A+A+Q  M++ +  +G VDVE++RV C+   
Sbjct  84   CTKGGTRVIVTDLNRNNNTDFVLSSRAFAAMARQG-MSQDILRQGIVDVEYKRVPCDYKD  142

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            + L V++ ++S+ P+YL+I +  QGG ++I A+++ +  +  W  M R +GAVW+ +  P
Sbjct  143  RNLAVRVEESSRKPNYLAIKVLYQGGQTEIVAMDVAQVGSSYWTYMSRNYGAVWNTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ RF+V+S    +W+ + K+++PA+W+ G+  ++ I
Sbjct  203  DGALQFRFVVTSGYDGKWIWA-KSVLPADWQNGVVYDSGI  241



>ref|XP_010690269.1| PREDICTED: expansin-like A2 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+  +  + +  GACGYG    N + G + A  S L+KNGA CGAC+Q+RCK++G+
Sbjct  27   SKAAYFYNDSPLSS--GACGYGSLALNFSGGFIAAGVSSLYKNGAGCGACFQIRCKNNGV  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G KV+ TD     + DF+LS RAF A+AK  +  + L + G  DVE++R+ C+   
Sbjct  85   CSKSGTKVILTDLNTNNKNDFVLSNRAFKAMAKAGKDQDVL-KLGIADVEYKRIPCDFKG  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S  P YL+I +  QGG ++I A+++ +     W  M R +GAVWD +  P
Sbjct  144  QNLAVRVEESSNNPGYLAIKVLYQGGQTEIVAMDVAQVGAPNWNFMSRNYGAVWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L+ RF+V+S    +++ + K ++PA+WK G   +T +
Sbjct  204  SGPLQFRFVVTSGYDGKYIWA-KNVLPADWKPGFIYDTKV  242



>gb|AFK41484.1| unknown [Medicago truncatula]
 gb|KEH30618.1| expansin A1 [Medicago truncatula]
Length=260

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+     +   +GACGYG    + + G + A  S LF NGA CGAC+QVRCK+  +
Sbjct  26   SKASYFSKASAL--SSGACGYGSLALDFSGGHLAAGVSSLFYNGAGCGACFQVRCKNQAI  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G KV+ TD     +TDF+LS RAFTA+A Q  M++ + + G VD+E++RV C    
Sbjct  84   CTKEGTKVVLTDLNHNNQTDFVLSSRAFTAMA-QKGMSQQILKLGIVDIEYKRVPCEYKK  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P YL+I    QGG ++I  V++ +  +  W  + R  GAVWD +  P
Sbjct  143  QNLAVRVEESSKKPDYLAIKFLYQGGQTEIVGVDVAQVGSSNWSFLSRNHGAVWDTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V+S    +W+ ++K ++PA+WK G+  +++I
Sbjct  203  QGALQFRIVVTSGYDGKWLWAKK-VLPADWKNGVIYDSDI  241



>gb|KHG30719.1| Expansin-like A2 [Gossypium arboreum]
Length=259

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     +    GACGYG      + G + A  S L+K+GA CGAC+Q+RCK+S L
Sbjct  25   SKAAYFSKASAL--SAGACGYGSLALGLSGGHLAAGVSSLYKDGAGCGACFQIRCKNSTL  82

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G ++  TD     ETDF+LS RAF A+A +    + L + G VDVE++R+ C    
Sbjct  83   CSSEGTRITLTDLNHNNETDFVLSSRAFMAMANKGIGRDIL-KLGIVDVEYKRIPCEYKN  141

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++SQ P+YL+I L  QGG +++ A+++ +  +  W  M R  GAVWD +  P
Sbjct  142  QNLAVRVEESSQKPNYLAIKLMYQGGQTEVVAMDVAQVGSANWNFMSRNHGAVWDTSRVP  201

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V+S    +W+ + K+++PAEWK G+  ++ +
Sbjct  202  NGALQFRFVVTSGFDGKWIWA-KSVLPAEWKTGVIYDSGV  240



>ref|XP_009768114.1| PREDICTED: expansin-like A2 [Nicotiana sylvestris]
Length=263

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+ +   +   +GACGYGD     N G + A    L+K GA CGACYQ+RCK S L
Sbjct  27   SKVAYFASASAL--LSGACGYGDLAIGFNGGRLAAAIPSLYKEGAGCGACYQIRCKDSTL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V+ TD     +TDF++S RAF A+A + +  + L + G  +VE++RVSC+  +
Sbjct  85   CSKEGTTVIVTDLNTNNQTDFVISSRAFMAMANKGKAKDVL-KLGIAEVEYKRVSCDYKS  143

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L +++ ++SQ P+YL+I    QGG ++I AV++ +  +  W  M R  GA+WD +  P
Sbjct  144  KNLAIRVEESSQKPNYLAISFLYQGGQTEIVAVDVAQVGSSSWNFMSRNHGAIWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    +W    K+++PA+WK G+  +T +
Sbjct  204  TGALQFRFVVTAGYDGKW-NWAKSVLPADWKNGVIYDTGL  242



>gb|ACJ84296.1| unknown [Medicago truncatula]
Length=260

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+     +   +GACGYG    + + G + A  S LF NGA CGAC+QVRCK+  +
Sbjct  26   SKASYFSKASAL--SSGACGYGSLALDFSGGHLAAGVSSLFYNGAGCGACFQVRCKNQAI  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G KV+ TD     +TDF+LS RAFTA+A Q  M++ + + G VD+E++RV C    
Sbjct  84   CTKEGTKVVLTDLNHNNQTDFVLSSRAFTAMA-QKGMSQQILKLGIVDIEYKRVPCEYKK  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P YL+I    QGG ++I  V++ +  +  W  + R  GAVWD +  P
Sbjct  143  QNLAVRVEESSKKPDYLAIKFLYQGGQTEIVGVDVAQVGSSNWSFLSRNHGAVWDTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V+S    +W+ ++K ++PA+WK G+  +++I
Sbjct  203  QGALQFRIVVTSGYDGKWLWAKK-VLPADWKNGVIYDSDI  241



>ref|XP_009628233.1| PREDICTED: expansin-like B1 [Nicotiana tomentosiformis]
Length=271

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 136/226 (60%), Gaps = 4/226 (2%)
 Frame = -1

Query  786  QQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRC  607
            Q    S+A+YY  ++E G   GACG+G +G   N G+V A +S L+++G  CGACYQVRC
Sbjct  45   QTFIHSKAAYYPNSEEKGTDTGACGFGTFGATINGGDVSA-ASDLYRDGLGCGACYQVRC  103

Query  606  KSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVS  427
             +S  CSD G  ++ TD+     TDFILS RAF  +A+    A  L   G VD+E+RRVS
Sbjct  104  TNSNYCSDNGVTIVITDHGASGGTDFILSQRAFGRMAQTKDAAASLLSLGNVDIEYRRVS  163

Query  426  CNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWD  250
            C+  +K + +KI ++S  P+YL+ ++  Q G +DI AV++ E + +    + R  GAVW 
Sbjct  164  CSYPSKNITIKIDESSDNPYYLAFVIWYQQGKTDITAVQLCETQNFVCKLLDRTRGAVWT  223

Query  249  LANPPSGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
             ++PP G L++R L+S+      W+      IP  WKAG T ++ I
Sbjct  224  SSSPPRGPLQIRMLLSTDDGDETWIVPVNN-IPENWKAGETYDSGI  268



>ref|XP_010242840.1| PREDICTED: expansin-like A1 [Nelumbo nucifera]
Length=260

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 134/220 (61%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            ++A+Y+ ++  +   +GACGYG      N G + A  S L+++G  CGAC+Q+RCK+  L
Sbjct  26   TKAAYFSSSAPL--SSGACGYGSLALGFNGGYLAAGVSSLYRDGVGCGACFQIRCKNETL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G KV+  D     +TDF+LS RAF A+A +  MA  + + G VDVE++R+ CN  +
Sbjct  84   CSRAGTKVILADLNRNNQTDFVLSRRAFMAMANRG-MASNVLKLGVVDVEYKRIPCNYKS  142

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            + L V++ + SQ PHYL+I    QGG +DI AV++ +  +  W  M R +G VWD    P
Sbjct  143  RNLAVRVEETSQRPHYLAIKFLYQGGQTDIIAVDVAQVGSSNWHYMSRNYGTVWDTNRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V+     +W+ +   ++P++WKAG+  ++ +
Sbjct  203  MGPLQFRLVVTGGFDGKWIWAPN-VLPSDWKAGMIYDSGV  241



>ref|NP_001275349.1| expansin-like protein precursor [Solanum tuberosum]
 gb|ABC47126.1| expansin-like protein precursor [Solanum tuberosum]
Length=260

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG+     N G + A   +L+ NGA CGACYQ+RCK   +CS  G  VM TD   
Sbjct  38   SGACGYGNLAIGFNGGRLAAAVPKLYNNGAGCGACYQIRCKDPKICSKHGTTVMVTDLNT  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPH  370
              +TDF++S RAF A+A + +  + L + G  DVE++RV C+   K L V++ ++SQ P+
Sbjct  98   NNQTDFVISSRAFMAMAIEGKAKDVL-KLGIADVEYKRVPCDYKGKNLAVRVDESSQKPY  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL+I +  QGG ++I +V++ +  +  W  + R  GA+WD +  PSG L+ RF+V++   
Sbjct  157  YLAISIFYQGGQTEIVSVDVAQVGSSNWNFLTRNHGAIWDTSRVPSGALQFRFVVTAGYD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W+ + K+++P++WK G+  +T +
Sbjct  217  GKWIWA-KSVLPSDWKMGVIYDTGV  240



>gb|ABM69039.1| expansin-like protein [Cunninghamia lanceolata]
Length=272

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 126/220 (57%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ SY  ++  +    GACGY       N+G+V   S+++++ G  CG CYQ+RC    +
Sbjct  34   SKVSYTSSSQPVNA--GACGYESLAGTLNSGDVATASAKIYREGVGCGGCYQIRCTDPAI  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G KV+ +D  +  +TDF+LS R F+ +A QP  +  L + G VD E++R+ C    
Sbjct  92   CSKSGVKVVVSDLTQNNQTDFVLSTRTFSKMA-QPTKSSQLIKMGLVDTEYKRIPCEYPG  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + VKI   S YP++L++    QGG +DI  VE+ +  T  W  M R +GAVW +  PP
Sbjct  151  KNMTVKIDKMSNYPYFLAVQFLYQGGQTDITGVEVAQVGTSNWKFMTRNYGAVWSMQQPP  210

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G + +R LV+S     WV ++ A++P+ WK G   ++ +
Sbjct  211  EGPMSLRVLVTSGYDGFWVWAKTAVLPSNWKVGSVYDSGV  250



>ref|XP_004167721.1| PREDICTED: expansin-like A3-like [Cucumis sativus]
Length=263

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 131/220 (60%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A++Y   D   +  GACGYGD       G   A    L+K GA CGAC+QVRCK   L
Sbjct  26   SKATHY-YGDSPTSYGGACGYGDMALEFTNGYFSAAVPSLYKQGAGCGACFQVRCKDKRL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G KV+ TD       DF+LS +AF+A+A + +  E L   G VDVE++R+ C    
Sbjct  85   CNTAGSKVVLTDQNYDSRADFVLSRKAFSAMALKGKGQELLNT-GIVDVEYKRIPCGYKN  143

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L +++ ++S  P+YL++ L  QGG ++I AVEI E  +Y+W+S+RR +GAVWD    P
Sbjct  144  KNLAIRVEESSYNPNYLAVKLLYQGGQTEIVAVEIAEVGSYEWVSLRRNYGAVWDTNKVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R   +S    +WV +E  ++P +WK G   +T +
Sbjct  204  KGALQMRMAFTSGYDGKWVWAE-YVLPVDWKVGAIYDTGV  242



>ref|XP_002313682.2| expansin-like family protein [Populus trichocarpa]
 gb|EEE87637.2| expansin-like family protein [Populus trichocarpa]
Length=274

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+     +    GACGYG      N+G + A  S L+K+GA CGAC+Q+RCK++ L
Sbjct  40   SKVAYFSKASAL--STGACGYGSMAIGFNSGHLAAAVSSLYKDGAGCGACFQIRCKNTAL  97

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G  V+ TD     +TDF+LS RAF A+A +  M + + + G +DVE++RV C    
Sbjct  98   CSSRGTTVIVTDLNNNNQTDFVLSSRAFMAMANKG-MGQDVLKHGILDVEYKRVPCEYKN  156

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P+YL+I L  QGG +++ A+++ +  +  W  M R  GAVWD    P
Sbjct  157  QNLAVRVEESSKKPNYLAIKLLYQGGQTEVVAMDVAKVGSSNWGFMSRNHGAVWDTDRVP  216

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    +W+ ++K ++P +WK G+T ++ +
Sbjct  217  AGALQFRFVVTAGFDGKWIWAQK-VLPEDWKPGMTYDSGV  255



>gb|ABK21763.1| unknown [Picea sitchensis]
 gb|ABK23438.1| unknown [Picea sitchensis]
Length=274

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 127/215 (59%), Gaps = 5/215 (2%)
 Frame = -1

Query  747  NDEMGNPNGACGYGDYGRN--TNAGEVCA-VSSRLFKNGAACGACYQVRCKSSGLCSDLG  577
            +D   N NGACGYG    +  T  G V A  S+++++ G  CGACYQ+RC   G+CS  G
Sbjct  37   SDARANINGACGYGTSATSLTTRGGLVTASASAKIYREGVGCGACYQIRCTDPGVCSKSG  96

Query  576  EKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRV  400
             KV+ TD+ +  +TDF+LS R+F+ LA   + A+FL + G VDV+++R+ C    + + V
Sbjct  97   VKVLVTDFTKNTQTDFVLSARSFSRLAVPSKAAQFL-KMGTVDVDYKRIPCEYGGQNMTV  155

Query  399  KIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELR  220
            K+  +S+YP YL++    QGG +DI AVE+ +  +  W  M R  GA+W + NPP G L 
Sbjct  156  KVDKSSKYPDYLAVQFLYQGGQTDITAVEVDQVGSSGWQYMTRNQGAIWGMQNPPRGYLS  215

Query  219  VRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             R LV+      WV   + ++P+ W  G   E+ I
Sbjct  216  FRLLVTGGYDGSWVWPRRNLLPSIWTPGSVYESGI  250



>gb|KHG06156.1| Expansin-like A2 [Gossypium arboreum]
Length=259

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 136/222 (61%), Gaps = 5/222 (2%)
 Frame = -1

Query  777  FSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSS  598
            + S+A+Y+   + +   +GACGYG      + G + A    L+K+GA CGAC+Q+RC +S
Sbjct  24   YQSKAAYFSKANAL--SSGACGYGSLALGLSGGHLAAGVFSLYKDGAGCGACFQIRCNNS  81

Query  597  GLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-  421
             LCS  G  V  TD     +T F+LS RAF A+A    M + + + G V+VE++R+ C  
Sbjct  82   TLCSSKGTSVTITDINHNNQTGFVLSTRAFMAMANHG-MGQHILKLGTVEVEYKRIPCEY  140

Query  420  SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
                L V++ ++SQ P+YL+I L  QGG ++I A+++ +  +  W  M+R  GAVWD + 
Sbjct  141  KNQNLAVRVEESSQKPNYLAIKLLYQGGQTEIVAIDVAQVGSSNWNFMKRNHGAVWDTSR  200

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             P+G L+ RF+V+S    +W+ + K ++PA+WK+G+  ++ +
Sbjct  201  APNGALQFRFVVTSGYDGKWIWA-KTVLPADWKSGVVYDSGV  241



>ref|XP_010918218.1| PREDICTED: expansin-like A1 [Elaeis guineensis]
Length=264

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 126/202 (62%), Gaps = 2/202 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG    + N G + A SS L++ G  CG C+Q+RC+S+ +CS  G +VM TD+     
Sbjct  45   CGYGPMALDFNGGYLAAASSALYRGGIGCGGCFQIRCRSTKVCSSRGVEVMVTDFNRSNR  104

Query  537  TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLS  361
            TDF+LS  AF A+AK+  M + L + G VDVE++R+ C    K L +++ ++SQ+P++L+
Sbjct  105  TDFLLSTGAFMAMAKEG-MGQELKQLGMVDVEYKRIPCKHKNKNLAIRVEEHSQWPNHLA  163

Query  360  ILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARW  181
            I    QGG +DI AV++ +  +  W  M R +GAVW +   P+G L++R +V+     +W
Sbjct  164  IKFLFQGGQTDIVAVDVAQVGSSHWRYMSRDYGAVWSMNRVPTGPLQIRMVVTGGYDGKW  223

Query  180  VESEKAIIPAEWKAGLTIETNI  115
            V +++ ++P EWK G   ++ +
Sbjct  224  VWTQEEVLPVEWKTGSVYDSGV  245



>ref|XP_006590253.1| PREDICTED: uncharacterized protein LOC100305884 isoform X1 [Glycine 
max]
 gb|KHN09258.1| Expansin-like A1 [Glycine soja]
Length=259

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 134/222 (60%), Gaps = 5/222 (2%)
 Frame = -1

Query  777  FSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSS  598
            + S+ASY+     +   +GACGYG    + + G + A    LFKNGA CGAC+Q+RCK+ 
Sbjct  25   YQSKASYFSKASAL--SSGACGYGSLALDISGGHLAAGVDSLFKNGAGCGACFQIRCKNP  82

Query  597  GLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-  421
             LCS  G KV+ TD     +TDF+LS RAF  +A Q  M + + + G  ++E++RV C+ 
Sbjct  83   TLCSKEGTKVVLTDLNHNNQTDFVLSSRAFAGMA-QKGMGQQILKLGIAEIEYKRVPCDY  141

Query  420  SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
                L V++ ++S+ P YL+I    QGG ++I AV++ +  +  W  M R  GAVWD + 
Sbjct  142  KNQNLAVRVEESSKKPDYLAIKFLYQGGQTEIVAVDVAQVGSSNWSFMSRNHGAVWDTSR  201

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             P G L+ R +V++    +W+ ++K ++PA+WK GL  ++ +
Sbjct  202  VPQGALQFRLVVTAGYDGKWIWAKK-VLPADWKNGLIYDSGL  242



>ref|XP_004505673.1| PREDICTED: expansin-like A2-like [Cicer arietinum]
Length=260

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+     +   +GACGYG    + + G++ A  S LF +GAACGAC+QVRCK+ GL
Sbjct  26   SKASYFSKVSAL--SSGACGYGSLALDFSGGQLAAGVSSLFYDGAACGACFQVRCKNQGL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC-NSA  415
            C+  G +V+ TD     ETDF+LS RAF A+A Q  M++ + + G VD+E++RV C    
Sbjct  84   CTKEGTRVVLTDLNHNNETDFVLSSRAFKAMA-QKGMSQQILKLGIVDIEYKRVPCVYKN  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L  ++ ++S+ P+YL+I    QGG ++I  V++ +  +  W  M R  GAVWD +  P
Sbjct  143  QNLAFRVEESSKKPNYLAIKFLYQGGQTEIVGVDVAQVGSSNWSFMSRNHGAVWDTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +W+ ++K ++PA+WK G+   +++
Sbjct  203  EGALQFRLVVTAGYDGKWIWAQK-VLPADWKNGVIYNSDV  241



>ref|XP_006431473.1| hypothetical protein CICLE_v10002142mg [Citrus clementina]
 gb|ESR44713.1| hypothetical protein CICLE_v10002142mg [Citrus clementina]
Length=213

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 109/162 (67%), Gaps = 3/162 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY + D +G P GACG+G+YGR  N   V  VS RL+KNG  CGACYQVRCK   L
Sbjct  54   SRATYYGSPDSLGTPTGACGFGEYGRTVNDANVAGVS-RLWKNGTGCGACYQVRCKVPQL  112

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC-NSA  415
            C+D G  V+ TDY EG +TDFILS RA+  +A   + AE L   G V+VEFRRV C    
Sbjct  113  CTDYGVYVVVTDYGEGDKTDFILSPRAYGRMALPDKSAE-LYSYGVVNVEFRRVPCWYKG  171

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQ  289
              L+ K+H+NS+YPHYL+I +    G +D+ AVEI++  TY+
Sbjct  172  YNLQFKVHENSRYPHYLAIAILYVAGQNDVLAVEIWQVITYK  213



>ref|XP_002534094.1| Beta-expansin 1a precursor, putative [Ricinus communis]
 gb|EEF28288.1| Beta-expansin 1a precursor, putative [Ricinus communis]
Length=259

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+    ++   +GACGYG      N+G + A    LFK GA CGAC+Q+RC++  +
Sbjct  25   SKAAYFSKASQL--SSGACGYGSSAIGFNSGHLAAGVPTLFKGGAGCGACFQIRCRNKTM  82

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC-NSA  415
            CS  G  V+ TD     +TDF+LS RAF A+A +  M + +   G VD+E++RV C    
Sbjct  83   CSSKGTTVILTDLNHNNQTDFVLSSRAFMAMANKG-MGQDILRLGIVDIEYKRVPCVYKN  141

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++SQ P+YL+I +  QGG ++I A+++ +  +  W  M R +GAVWD +  P
Sbjct  142  QNLAVRVEESSQKPNYLAIKVLYQGGQTEIVAMDVAQVGSSNWSYMSRNYGAVWDTSRVP  201

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ RF+V++    +W+ + K+++PA+WK G+  ++ +
Sbjct  202  GGALQFRFVVTAGYDGKWIWA-KSVLPADWKPGVVYDSGV  240



>ref|XP_007156627.1| hypothetical protein PHAVU_002G004100g [Phaseolus vulgaris]
 gb|ESW28621.1| hypothetical protein PHAVU_002G004100g [Phaseolus vulgaris]
Length=255

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 130/222 (59%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++E G   GACG+G +G   N G+V A SS L+++G  CGACYQVRC +S  
Sbjct  32   SRAAYYPNSEEHGTDVGACGFGSFGATVNGGDVSAASS-LYRSGVGCGACYQVRCTNSVY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS+ G   + TD      TDFILS  AF+ +A+    A  L   G VD+E+RRVSC+   
Sbjct  91   CSNNGVTAVITDQGSSDNTDFILSKHAFSRMAQTTDAAASLLALGVVDIEYRRVSCSYPD  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  P+YL+ ++  Q G  DI AV++ E + +    + R+ GAVW   +PP
Sbjct  151  KNITIKIDESSNNPYYLAFVIWYQQGRRDITAVQLCETQNFVCKLLDRSHGAVWTATSPP  210

Query  234  SGELRVRFLVSS--SAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S        WV      IP +WKAG T ++ +
Sbjct  211  SGPLSLRMLFSDEEEEEETWVVPANN-IPGDWKAGETYDSGV  251



>ref|XP_003517382.1| PREDICTED: expansin-like B1-like [Glycine max]
Length=255

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 130/222 (59%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++E G   GACG+G +G   N G+V A SS L++NG  CGACYQVRC +S  
Sbjct  32   SRAAYYPNSEEHGTDIGACGFGSFGATVNGGDVSAASS-LYRNGVGCGACYQVRCTNSVY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS+ G   + TD      TDFILS  AF+ +A+    A  L   G VD+E+RRV+C+   
Sbjct  91   CSENGVTAVITDQGSSDNTDFILSKHAFSRMAQTTDAAASLLALGVVDIEYRRVACSYPD  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  P+YL+ ++  Q G  DI AV++ E + +    + R+ GAVW   +PP
Sbjct  151  KNITIKIDESSNNPYYLAFVIWYQQGRRDITAVQLCETQNFVCQLLDRSHGAVWTTTSPP  210

Query  234  SGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S        WV      IP +WKAG T ++ +
Sbjct  211  SGPLSLRMLFSDEEEGEETWVVPVNN-IPGDWKAGETYDSGV  251



>ref|XP_006422480.1| hypothetical protein CICLE_v10029088mg [Citrus clementina]
 gb|ESR35720.1| hypothetical protein CICLE_v10029088mg [Citrus clementina]
Length=261

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG    + N G + A    L+K+GA CGAC+Q+RCK+  LCS  G +V+ TD   
Sbjct  38   SGACGYGSLALSFNGGHLAAGVPSLYKDGAGCGACFQMRCKNPTLCSGKGTRVILTDLNH  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF++S RAF AL+ Q +  + L + G VDVE++RV C      L V++ ++SQ P+
Sbjct  98   SNQTDFVISSRAFMALSNQGKGQDIL-KLGVVDVEYKRVPCEYKNQNLAVRVEESSQKPN  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL++ +  QGG +++ A+++ +  +  W  M R +GAVWD +  P+G L+ RF+V+S   
Sbjct  157  YLAVKVLYQGGQTEMVAMDVAQVGSSNWGYMSRNYGAVWDTSRVPNGALQFRFVVTSGYD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W+ + K ++PA+WK G+   + +
Sbjct  217  GKWIWA-KNVLPADWKPGMIYNSGV  240



>ref|XP_006486648.1| PREDICTED: expansin-like A1-like [Citrus sinensis]
 gb|KDO68253.1| hypothetical protein CISIN_1g024895mg [Citrus sinensis]
Length=261

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG    + N G + A    L+K+GA CGAC+Q+RCK+  LCS  G +V+ TD   
Sbjct  38   SGACGYGSLALSFNGGHLAAGVPSLYKDGAGCGACFQMRCKNPTLCSGRGTRVILTDLNH  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF++S RAF AL+ Q +  + L + G VDVE++RV C      L V++ ++SQ P+
Sbjct  98   SNQTDFVISSRAFMALSNQGKGQDIL-KLGVVDVEYKRVPCEYKNQNLAVRVEESSQKPN  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL++ +  QGG +++ A+++ +  +  W  M R +GAVWD +  P+G L+ RF+V+S   
Sbjct  157  YLAVKVLYQGGQTEMVAMDVAQVGSSNWGYMSRNYGAVWDTSRVPNGALQFRFVVTSGYD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W+ + K ++PA+WK G+   + +
Sbjct  217  GKWIWA-KNVLPADWKPGMIYNSGV  240



>ref|XP_003538767.1| PREDICTED: expansin-like B1-like [Glycine max]
 gb|KHN34871.1| Expansin-like B1 [Glycine soja]
Length=255

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 129/222 (58%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++E G   GACG+G +G   N G+V A SS L++NG  CGACYQVRC +S  
Sbjct  32   SRAAYYPNSEEHGTDVGACGFGSFGATVNGGDVSAASS-LYRNGVGCGACYQVRCTNSAY  90

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS+ G   + TD      TDFILS  AF+ +A+    A  L   G VD+E+RRV+C+   
Sbjct  91   CSENGVNAVITDQGSSDNTDFILSKHAFSRMAQTTDAAASLLALGVVDIEYRRVACSFPD  150

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  P+YL+ ++  Q G  DI AV++ E + +    + R+ GAVW   +PP
Sbjct  151  KNITIKIDESSNNPYYLAFVIWYQQGRRDITAVQLCETQNFVCKLLDRSHGAVWTTTSPP  210

Query  234  SGELRVRFLVSS--SAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L +R L S        W+      IP +WKAG T ++ I
Sbjct  211  RGPLSLRMLFSDEEEEEETWLVPVNN-IPGDWKAGETYDSGI  251



>ref|XP_008447888.1| PREDICTED: expansin-like A3 isoform X3 [Cucumis melo]
Length=263

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 132/220 (60%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A++Y   D   +  GACGYGD       G   A    L+K GA CGAC+QVRCK   L
Sbjct  26   SKATHY-YGDSPTSYGGACGYGDLALEFTDGYFSAAVPSLYKQGAGCGACFQVRCKDKRL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G KV+ TD       DF+LS +AF+A+A + +  E L   G VDVE++R+ C    
Sbjct  85   CNTAGSKVVLTDQNYDSRVDFVLSRKAFSAMALKGKGQELLNT-GIVDVEYKRIPCGYKN  143

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L V++ ++S  P+YL++ L  QGG ++I AV+I E  +Y+W+S+RR +GAVWD    P
Sbjct  144  KNLAVRVEESSYNPNYLALKLLYQGGQTEIVAVDIAEVGSYEWVSLRRNYGAVWDTNKVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L++R   +S    +WV +E  ++P +W+ G   +T +
Sbjct  204  NGALQMRMAFTSGYDGKWVWAE-YVLPVDWEVGAIYDTGV  242



>ref|XP_003540432.1| PREDICTED: expansin-like A2-like [Glycine max]
Length=261

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 134/220 (61%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+     +   +GACGYG    + + G + A  + LFK+GA CGAC+Q+RCK+  L
Sbjct  27   SKASYFSKASAL--SSGACGYGSLALDISGGHLAAGVASLFKDGAVCGACFQIRCKNPTL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G +V+ TD     +TDF+LS RAF  +A Q  M + + + G  D+E++RV C    
Sbjct  85   CSKEGTRVVLTDLNHNNQTDFVLSSRAFAGMA-QKGMGKQILKLGIADIEYKRVPCEYKK  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P YL+I    QGG ++I AV++ +  +  W  M R+ GAVWD +  P
Sbjct  144  QNLAVRVEESSKKPEYLAIKFLYQGGQTEIVAVDVAQVGSSNWSFMSRSDGAVWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +W+ ++K ++PA+WK GL  ++ +
Sbjct  204  QGALQFRLVVTAGYDGKWIWAKK-VLPADWKNGLIYDSGL  242



>ref|XP_004153445.1| PREDICTED: expansin-like A1-like, partial [Cucumis sativus]
Length=224

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            GACGYG+     + G   A    L++ G  CGACYQVRCK+  LC+ +G KV+ TD    
Sbjct  2    GACGYGNVALQFSNGFFAAAVPSLYRQGVGCGACYQVRCKNRRLCNTIGTKVVLTDQNND  61

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHY  367
              TD +LS RAF  +A   + A+ L   G VDVE++RV+C    K L V++ ++S  P Y
Sbjct  62   NVTDLVLSKRAFFTMALNGKGADLLN-LGVVDVEYKRVACEYKHKNLLVQVEESSYNPFY  120

Query  366  LSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAA  187
            L+I    QGG +D+ AV+I +  T +W  M+R++GAVW++ N P G L++R +V+S    
Sbjct  121  LAIKFLYQGGQTDMVAVDIAQVGTSEWSHMKRSYGAVWEINNIPEGSLQLRMVVTSGYDG  180

Query  186  RWVESEKAIIPAEWKAGLTIETNI  115
            +WV + K+++PA+WK+G   +T +
Sbjct  181  KWVWA-KSVLPADWKSGAIYDTGV  203



>gb|AFK24456.1| expansin-like 1 [Ziziphus jujuba]
Length=259

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG      +   V A    LFK+GA CGAC+Q+RCK + LCS  G +V+ TD  +
Sbjct  38   SGACGYGSLALGFSGEHVAAGVPTLFKDGAGCGACFQIRCKDTALCSKEGTRVILTDLNQ  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPH  370
              +TDF+LS RAFTA+A Q  + + + ++G VDV  R    N+  K L V++ ++SQ P+
Sbjct  98   HNQTDFVLSSRAFTAMA-QKGLDQDILKRGIVDVNTRGFLVNTRKKNLSVRVEESSQKPN  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YLSI L  QGG +++  +++ E  +  W  M R  GAVWD +  P+G L+ RF+V+S   
Sbjct  157  YLSIKLLYQGGQTEVVGIDVAEVGSSNWSFMSRNHGAVWDTSRVPAGALQFRFIVTSGYD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W+ + K+++PA WK G+  ++ +
Sbjct  217  GKWIWA-KSVLPAGWKVGVIYDSGV  240



>gb|KHN05483.1| Expansin-like A1 [Glycine soja]
Length=261

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 134/220 (61%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+     +   +GACGYG    + + G + A  + LFK+GA CGAC+Q+RCK+  L
Sbjct  27   SKASYFSKAAAL--SSGACGYGSLALDISGGHLAAGVASLFKDGAVCGACFQIRCKNPTL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G +V+ TD     +TDF+LS RAF  +A Q  M + + + G  D+E++RV C    
Sbjct  85   CSKEGTRVVLTDLNHNNQTDFVLSSRAFAGMA-QKGMGKQILKLGIADIEYKRVPCEYKK  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P YL+I    QGG ++I AV++ +  +  W  M R+ GAVWD +  P
Sbjct  144  QNLAVRVEESSKKPEYLAIKFLYQGGQTEIVAVDVAQVGSSNWSFMSRSDGAVWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +W+ ++K ++PA+WK GL  ++ +
Sbjct  204  QGALQFRLVVTAGYDGKWIWAKK-VLPADWKNGLIYDSGL  242



>ref|XP_004144935.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
 ref|XP_004161039.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
Length=262

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            GACGYG+     + G   A    L++ G  CGACYQVRCK+  LC+ +G KV+ TD    
Sbjct  40   GACGYGNVALQFSNGFFAAAVPSLYRQGVGCGACYQVRCKNRRLCNTIGTKVVLTDQNND  99

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHY  367
              TD +LS RAF  +A   + A+ L   G VDVE++RV+C    K L V++ ++S  P Y
Sbjct  100  NVTDLVLSKRAFFTMALNGKGADLL-NLGVVDVEYKRVACEYKHKNLLVQVEESSYNPFY  158

Query  366  LSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAA  187
            L+I    QGG +D+ AV+I +  T +W  M+R++GAVW++ N P G L++R +V+S    
Sbjct  159  LAIKFLYQGGQTDMVAVDIAQVGTSEWSHMKRSYGAVWEINNIPEGSLQLRMVVTSGYDG  218

Query  186  RWVESEKAIIPAEWKAGLTIETNI  115
            +WV + K+++PA+WK+G   +T +
Sbjct  219  KWVWA-KSVLPADWKSGAIYDTGV  241



>ref|XP_008447892.1| PREDICTED: expansin-like A2 [Cucumis melo]
Length=262

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            GACGYG+     + G   A    L++ G  CGACYQVRCK+  LC+ +G KV+ TD    
Sbjct  40   GACGYGNVALQFSNGYFAAAVPSLYRQGVGCGACYQVRCKNRRLCNTIGTKVVLTDQNND  99

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHY  367
              TD +LS RAF  +A   + A+ L   G VDVE++RV+C    K L V++ + S  P Y
Sbjct  100  NATDLVLSKRAFFTMALNGKGADLL-NLGVVDVEYKRVACEYKHKNLLVQVEEFSYNPFY  158

Query  366  LSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAA  187
            L+I    QGG +D+ AV+I +  T +W  M+R++GAVW++ N P G L++R +V+S    
Sbjct  159  LAIKFLYQGGQTDMVAVDIAQVGTSEWSHMKRSYGAVWEINNIPEGSLQLRMVVTSGYDG  218

Query  186  RWVESEKAIIPAEWKAGLTIETNI  115
            +WV + K+++PA+WK+G   +T +
Sbjct  219  KWVWA-KSVLPADWKSGAIYDTGV  241



>ref|XP_004290040.1| PREDICTED: expansin-like A1-like [Fragaria vesca subsp. vesca]
Length=280

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            ++A+Y+     +   +GACGYG      + G + A    ++K+GA CG+C+Q+RCK++ L
Sbjct  46   TKAAYFSKAPAL--SSGACGYGSLALGLSGGHLAAAVPSIYKDGAGCGSCFQIRCKNATL  103

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G KV+ +D     +TDF+LS RAF A+A Q  + + + + G VDVE++RV C    
Sbjct  104  CTKQGTKVITSDLNHNNQTDFVLSSRAFMAMA-QKGLGQDILKHGIVDVEYKRVPCEYKN  162

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L +++ ++SQ PHYL++ +  QGG ++I A+++ +  +  W  + R +GAVWD +  P
Sbjct  163  QNLALRVEESSQKPHYLAVKVLYQGGQTEIVAIDVAQVGSSNWSFLTRNYGAVWDTSRVP  222

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V+     + V + K ++PA+WK G+  +T +
Sbjct  223  AGALQFRFVVTGGFDGKMVWA-KNVLPADWKPGMVYDTKV  261



>ref|NP_001234736.1| expansin-like protein precursor [Solanum lycopersicum]
 gb|ABA64550.1| expansin-like protein precursor [Solanum lycopersicum]
Length=261

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 127/202 (63%), Gaps = 3/202 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG+     N G + A   +L+ NGA CGACYQ+RC    +CS  G  VM TD     +
Sbjct  41   CGYGNLAIGFNGGRLAAAVPKLYDNGAGCGACYQIRCTDPKICSKHGTTVMVTDLNTNNQ  100

Query  537  TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLS  361
            TDF++S RAF A+A + + A+ + + G  DVE++RV C+   K L V++ ++SQ PHYL+
Sbjct  101  TDFVISSRAFMAMAIEGK-AQDVHKLGIADVEYKRVPCDYKGKNLAVRVDESSQKPHYLA  159

Query  360  ILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARW  181
            I +  QGG ++I +V++ +  +  W  + R  GA+WD +  PSG L+ RF+V++    +W
Sbjct  160  ISIFYQGGQTEIVSVDVAQVGSSNWNFLSRNHGAIWDTSRVPSGALQFRFVVTAGYDGKW  219

Query  180  VESEKAIIPAEWKAGLTIETNI  115
            + + K+++P++WK G+  +T +
Sbjct  220  IWA-KSVLPSDWKNGVVYDTGL  240



>gb|EYU38011.1| hypothetical protein MIMGU_mgv1a011722mg [Erythranthe guttata]
Length=272

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 135/207 (65%), Gaps = 4/207 (2%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +G+CGYG      N G + A S  ++K+GAACGAC+Q+RCK   +CS  G KV+ +D  +
Sbjct  45   SGSCGYGSLAIGFNEGRLAAASPSIYKDGAACGACFQIRCKDERICSKEGTKVLVSDRND  104

Query  546  -GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN--SAAKLRVKIHDNSQY  376
               +TDF++S RAFTA+AK+  MA+ + + G  DVE++RV+C+      L +++ ++SQ 
Sbjct  105  YDNKTDFVVSSRAFTAMAKKGIMAQQILKLGLADVEYKRVACDEYKNKNLGLRVEESSQK  164

Query  375  PHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSS  196
            P+YL++ L  QGG +++ A+++ +  +  W  M R +GAVWD +  P+G L+ RF+V++ 
Sbjct  165  PNYLAVKLLYQGGQTEVVAMDVAQVGSSNWNYMSRKYGAVWDTSRVPNGALQFRFVVTAG  224

Query  195  AAARWVESEKAIIPAEWKAGLTIETNI  115
               +W  + K+++P++WK G   ++ +
Sbjct  225  FDGKWYWA-KSVLPSDWKNGSIYDSGL  250



>ref|XP_008791985.1| PREDICTED: expansin-like A2 [Phoenix dactylifera]
Length=263

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 132/220 (60%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASY+ ++  +    GACGYG      N G + A SS L++ G  CG C+Q+RC+S+ +
Sbjct  28   SKASYFYSSSAL--SAGACGYGPMALGFNGGFLAAASSSLYRGGVGCGGCFQIRCRSAKV  85

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G +VM TD  +   +DF+LS  AF A+AK+  M + L + G VDVE++R+ C    
Sbjct  86   CSSGGVEVMVTDSSKSNRSDFVLSPSAFMAMAKEG-MGQELKQLGMVDVEYKRIPCKHGN  144

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            + L +++ ++S++P++L+I    QGG +DI AV++ +  +  W  M R +GAVW     P
Sbjct  145  QNLAIRVEEHSRWPNHLAIKFLYQGGQTDIVAVDVAQVGSSSWRYMSRDYGAVWSTNRAP  204

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ R +V+     +W  +++ ++P EWK G   +  +
Sbjct  205  AGPLQFRMVVTGGYDGKWAWAQEEVLPVEWKTGAVYDLGV  244



>ref|XP_009606813.1| PREDICTED: expansin-like A2 [Nicotiana tomentosiformis]
Length=266

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 134/220 (61%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+ +   +   +GACGYGD     N G + A     +K GA CGACYQ+RCK S L
Sbjct  30   SKVAYFSSASAL--QSGACGYGDLAIGFNGGRLAAAIPSFYKQGAGCGACYQIRCKDSTL  87

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V+ TD     +TDF++S RAF A+A + +  + L + G  +VE++RV C+  +
Sbjct  88   CSKEGTTVIVTDLNTNNQTDFVISSRAFMAMANKGKAKDVL-KLGIAEVEYKRVPCDYKS  146

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L +++ ++S+ P+YL+I    QGG ++I AV++ +  +  W  M +  GA+WD +  P
Sbjct  147  KNLAIRVEESSRKPNYLAISFLYQGGQTEIVAVDVAQVGSSSWNFMSQNHGAIWDTSRVP  206

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    +W    K+++PA+WK G+  +T +
Sbjct  207  TGALQFRFVVTAGYDGKW-NWAKSVLPADWKNGVIYDTGL  245



>emb|CDP21630.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 127/221 (57%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA YY  +D+ G  +G CG+G +G   N G+V A +S L++ G  CGACYQVRC  S  
Sbjct  33   SRAGYYPNSDQKGTEDGECGFGKFGATLNGGDVSA-ASELYRGGVGCGACYQVRCTYSYY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C D G  V+ TD+     TDFILS RAF+ +A+    A  L   G VD+E+RRVSC+   
Sbjct  92   CLDKGVTVVITDHGISDRTDFILSQRAFSQMAQSTDAAASLLALGIVDIEYRRVSCSYPN  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K +  KI ++S  P+YL+  +  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  152  KNITFKIDESSNNPYYLAFEILYQQGKMDITAVQLCETQNFVCKLLDRTHGAVWTTTSPP  211

Query  234  SGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S++   + WV      IP  WK G T ++ +
Sbjct  212  SGPLSIRMLFSANDEDQTWVVPVNN-IPGNWKPGDTYDSGV  251



>ref|XP_006284347.1| hypothetical protein CARUB_v10005519mg [Capsella rubella]
 gb|EOA17245.1| hypothetical protein CARUB_v10005519mg [Capsella rubella]
Length=263

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 135/221 (61%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+AS++ +   + +  GAC YG    +  AG + A    ++K+GA CGAC+QVRCK+  L
Sbjct  26   SKASFFSSAPALSS--GACAYGSLATSFFAGHIAAALPSIYKDGAGCGACFQVRCKNPAL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEF-LTEKGAVDVEFRRVSCN-S  418
            CS  G  V+ TD      TD +LS RAF A+AK    A+  L ++G VD+E++RV C+  
Sbjct  84   CSSKGTTVIVTDLSNTNRTDLVLSTRAFRAMAKPVLGADRDLLKQGIVDIEYQRVPCDYG  143

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
              K+ V++ ++S+ P+YL+I L  QGG +++ A++I +  +  W  M R+ GAVW  A  
Sbjct  144  NKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIDIAQVGSSHWSYMSRSHGAVWVAAKV  203

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P+G L+ +F+V++    + V S++ ++PA W AG T +  +
Sbjct  204  PAGALQFKFVVTAGYDGKMVWSQRVVLPASWVAGKTYDAGV  244



>ref|XP_010548815.1| PREDICTED: expansin-like B1 [Tarenaya hassleriana]
Length=255

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 129/221 (58%), Gaps = 8/221 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+Y   N      +GAC +G  G   + G++ AVS  L++NG  CGACYQVRC     
Sbjct  37   SRAAYSNAN----GTSGACSFGSLGEAISGGDISAVSD-LYRNGLGCGACYQVRCLDGYY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS+ G +V+ TD   G  TDFILS ++F  +A+ P +A  L   G VDVE+RRVSC    
Sbjct  92   CSEGGVRVVITDQGSGHNTDFILSRQSFGRMAQTPDLATSLFSLGVVDVEYRRVSCYYPG  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  PHY + ++  Q G +DI AV++ E    +   + R++GAVW    PP
Sbjct  152  KNIMIKIDESSSNPHYFAFVILFQQGKTDITAVQLCENANQRCKLLERSYGAVWAAEGPP  211

Query  234  SGELRVRFLVS-SSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +GEL VR L+S       WV    A IP++WK G+  +T +
Sbjct  212  AGELTVRMLLSRDDGDETWVVPLYA-IPSDWKPGMAYDTGV  251



>emb|CDP12935.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 127/221 (57%), Gaps = 4/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA YY  +D+ G   G CG+G +G   N G+V A +S L++ G  CGACYQVRC +S  
Sbjct  33   SRAGYYPNSDQKGTEVGECGFGKFGATLNGGDVSA-ASELYRGGVGCGACYQVRCTNSYY  91

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C D G  V+ TD+     TDFILS RAF+ +A+    A  L   G VD+E+RRVSC+   
Sbjct  92   CLDKGVTVVITDHGISDRTDFILSQRAFSQMAQSTDAAASLLALGIVDIEYRRVSCSYPN  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K +  KI ++S  P+YL+  +  Q G  DI AV++ E + +    + R  GAVW   +PP
Sbjct  152  KNITFKIDESSNNPYYLAFEILYQQGKMDITAVQLCETQNFVCKLLDRTHGAVWTTTSPP  211

Query  234  SGELRVRFLVSSSAAAR-WVESEKAIIPAEWKAGLTIETNI  115
            SG L +R L S++   + WV      IP  WK G T ++ +
Sbjct  212  SGPLSIRMLFSANDEDQTWVVPVNN-IPGNWKPGDTYDSGV  251



>ref|XP_009371879.1| PREDICTED: expansin-like B1 [Pyrus x bretschneideri]
 ref|XP_009339396.1| PREDICTED: expansin-like B1 [Pyrus x bretschneideri]
Length=255

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 130/221 (59%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA+YY  ++  G  +GACG+G +G   N G+V A +S L+++G  CGACYQVRC +S  
Sbjct  35   SRATYYPNSEAQGTDSGACGFGSFGATLNGGDVSA-ASDLYRSGLGCGACYQVRCTNSAY  93

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+D G  V+ TD      TDFI+S +AF  +A+    A  L   G +D+E+RRVSC+   
Sbjct  94   CTDKGVTVVITDQGSSDGTDFIMSKQAFGRMAQSTEAAASLLSLGVIDIEYRRVSCSYPN  153

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K + +KI ++S  P+YL+ ++  Q G  DI AV++ E   +  + + R+ GA+W   + P
Sbjct  154  KNITIKIDEHSNNPYYLAFVIWYQQGKKDITAVQLCETTNFVCVVLDRSIGAIWTTTSAP  213

Query  234  S-GELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            S G L++R L S      WV      IP +WK G T +T +
Sbjct  214  SGGPLQIRMLFSDDDET-WVVPPNT-IPQDWKVGQTYDTGV  252



>ref|XP_011088678.1| PREDICTED: expansin-like A2 [Sesamum indicum]
Length=267

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 127/205 (62%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG      N G + A +  ++K GA CGAC+Q+RCK+  +CS  G +++ +D  E
Sbjct  42   SGACGYGSLAIGFNGGRIAAAAPSIYKEGAGCGACFQMRCKNEDICSKEGTRIIVSDRNE  101

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPH  370
               TDF+LS R F  +AK+  M + + + G VDVE++R+ C+   K L + + ++S  P+
Sbjct  102  DNGTDFVLSSRGFMGMAKKG-MGQDILKLGVVDVEYKRIPCDYKDKNLALGVEESSHNPN  160

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL++    QGG ++I AV++ +  +  W  M R +GAVWD +  PSG L+ RF+V+S   
Sbjct  161  YLAVKFLYQGGQTEIVAVDVAQVGSSNWKMMSRKYGAVWDTSRVPSGGLQFRFVVTSGFD  220

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W  + K ++PA+WK G+  ++ +
Sbjct  221  GKWYWA-KNVLPADWKNGVIYDSGL  244



>gb|KEH31627.1| expansin-B1-like protein [Medicago truncatula]
Length=179

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 112/169 (66%), Gaps = 2/169 (1%)
 Frame = -1

Query  618  QVRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEF  439
            QVRCK    C D G  V+ TDY EG  TDFI+S RAF+ L +    +E L + G +DVE+
Sbjct  10   QVRCKIPQYCDDNGALVVVTDYGEGDRTDFIMSPRAFSGLGRNAAASEKLKKYGVLDVEY  69

Query  438  RRVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            +RVSC      +  +I+++SQ P Y++I++   GG  D+ AVE++++E ++W  MRR++G
Sbjct  70   KRVSCTFKGNNIVYQINEHSQNPGYIAIVILYVGGTYDVNAVEMWQKEQHKWEYMRRSYG  129

Query  261  AVWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            AV+D ANPP GE+R+RF VSS+    WVES  A IPA WKAG T  T I
Sbjct  130  AVFDYANPPKGEIRLRFQVSSNVGVNWVESRFA-IPAGWKAGATYSTKI  177



>ref|XP_009797268.1| PREDICTED: expansin-like A2 [Nicotiana sylvestris]
Length=264

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 131/220 (60%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+     +   +GACGYG      N G + A    L+K GA CGAC+Q+RCK+S L
Sbjct  28   SKVAYFSKASAL--QSGACGYGSSAVGFNGGRLAAAVPSLYKEGARCGACFQIRCKNSKL  85

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V  TD     +TDF++S RAF+A+A Q + A+ L + G VDVE++RV C+   
Sbjct  86   CSKEGTSVTVTDQNTNNQTDFVVSSRAFSAMANQGK-AQDLLKLGIVDVEYKRVPCDFKN  144

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L +++  +S+ P+YLSI    QGG ++I  +++ +  +  W  M R  GAVWD +  P
Sbjct  145  KNLAIRVEQSSKRPNYLSITFLYQGGQTEIVGIDVAQVGSSNWSFMSRNEGAVWDTSRVP  204

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +W  + KA++PA W+ G+  +T +
Sbjct  205  KGALQFRLVVTAGFDGKWYWA-KAVLPANWRNGVIYDTRL  243



>ref|XP_008811008.1| PREDICTED: expansin-like A1 [Phoenix dactylifera]
Length=263

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 121/202 (60%), Gaps = 2/202 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG    + N G + A SS L++ G  CG C+Q+RCK+S +C+  G KV+ TD  +   
Sbjct  44   CGYGAMALDFNGGYLAAASSALYRGGVGCGGCFQIRCKNSKVCTSGGVKVIVTDLNKSNR  103

Query  537  TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLS  361
            TDF+LS  AFTA+AK+  M   L   G VD+E++R+ C    K L +++ +NS+ P+YL+
Sbjct  104  TDFVLSTPAFTAMAKEG-MGLELKRLGIVDMEYKRIPCEYRNKNLAIRVEENSRRPNYLA  162

Query  360  ILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARW  181
            I    QGG +DI AV++ +  +  W  M R +GAVW     P G L+ R +V+     +W
Sbjct  163  IKFLYQGGQTDIVAVDVAQVGSSNWRYMTRDYGAVWSTNRAPVGPLQFRMVVTGGYDGKW  222

Query  180  VESEKAIIPAEWKAGLTIETNI  115
            V ++K ++P EWK G   ++ +
Sbjct  223  VWAQKEVLPVEWKTGSVYDSGV  244



>ref|XP_011046305.1| PREDICTED: expansin-like A2 [Populus euphratica]
Length=259

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG      N+G +    S L+K+G+ CGAC+Q+RCK + LCS  G +V+ TD   
Sbjct  38   SGACGYGSMATGFNSGHLAGAVSSLYKDGSGCGACFQIRCKDAALCSREGTRVIVTDLNR  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF+LS RAF A+A +  M   + ++G V+VE++RV C      L V++ ++S+ P+
Sbjct  98   NNQTDFVLSSRAFMAMANKD-MGRNILKQGIVEVEYKRVPCEYKNQNLAVRVEESSKNPN  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL+I L  QGG +++ A++  +  +  W  + R  GAVWD    PSG L+ RF++++   
Sbjct  157  YLAIKLLYQGGQTEVVAIDFAKVGSSNWGFLSRNHGAVWDSDRVPSGALQFRFVITAGFD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W+ + + ++P +WK G+T ++ +
Sbjct  217  GKWIWA-RNVLPEDWKPGMTYDSGV  240



>ref|XP_008382466.1| PREDICTED: expansin-like A1 [Malus domestica]
Length=260

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 131/220 (60%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+++  +  +   +GACGYG      + G + A    LFK GA CGAC+Q+RCK++ L
Sbjct  26   SKAAFFSKSSAL--SSGACGYGSLALGFSGGHLAAGVPSLFKGGAGCGACFQIRCKNTTL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G  V  TD  +G +TDF+LS RAF A+A Q  + + +  +G VDVE +RV C    
Sbjct  84   CTKQGTIVTLTDLNQGSQTDFVLSSRAFAAMA-QKGLGQDILRRGIVDVEXKRVPCEYKN  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L +++ ++SQ PHYL+I L  QGG ++I  +++ +  +  W  + R  GA+WD +  P
Sbjct  143  QNLSLRVEESSQKPHYLAIKLLYQGGQTEIVGIDVAQVGSSNWSFLSRNHGAIWDTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    + V +   ++P  WK G+  +T +
Sbjct  203  AGALQFRFVVTAGYDGKTVWAPN-VLPVNWKPGMIYDTKV  241



>gb|ABK93417.1| unknown [Populus trichocarpa]
Length=259

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 135/220 (61%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+  +  +   +GACGYG      N+G + A  S L+K+G+ CGAC+Q+RCK + L
Sbjct  25   SKVAYFSRDSAL--SSGACGYGSMATGFNSGHLAAAVSSLYKDGSGCGACFQIRCKDTTL  82

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G +V+ TD     +TDF+LS RAF A+A + +    L ++G V+VE++RV C    
Sbjct  83   CSREGTRVIVTDLNRNNQTDFVLSSRAFMAMANKDKGRNIL-KQGIVEVEYKRVPCEYKN  141

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+  +YL+I L  QGG +++ A++  +  +  W  M R  GAVWD    P
Sbjct  142  QNLAVRVEESSKNSNYLAIKLLYQGGQTEVVAIDFAKVGSSNWGFMSRNHGAVWDSDRVP  201

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            SG L+ RF++++    +W+ + + ++P +WK G+T ++ +
Sbjct  202  SGALQFRFVITAGFDGKWIWA-RNVLPEDWKPGMTYDSGV  240



>ref|XP_010103314.1| Expansin-like A1 [Morus notabilis]
 gb|EXB95381.1| Expansin-like A1 [Morus notabilis]
Length=261

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 138/220 (63%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     +   +GACGYG        G + A    ++K+GA CGAC+Q+RCK++ L
Sbjct  27   SKAAYFSKASAL--SSGACGYGSLAIGFGGGHLAAAVPSIYKDGAGCGACFQIRCKNANL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G +V+ TD      TDF+LS RAF A+A++    + L + G VDVE++RV C   +
Sbjct  85   CTKEGTRVIVTDLNPNNRTDFVLSSRAFRAMARKGADKDIL-KLGIVDVEYKRVPCEYKS  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++SQ  +YL+I +  QGG ++I A+++ +  +  W  + R +GAVW+ +  P
Sbjct  144  QNLAVRVEESSQKSNYLAIKILYQGGQTEIVAIDVAQVGSSNWGFLTRNYGAVWNTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V++    +W+ + K+++P++WK G+T ++ +
Sbjct  204  AGALQFRFVVTAGYDGKWIWA-KSVLPSDWKPGVTYDSGV  242



>ref|XP_009401889.1| PREDICTED: expansin-like A2 [Musa acuminata subsp. malaccensis]
Length=264

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 120/204 (59%), Gaps = 2/204 (1%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            GACGYG    + N G + A SS L + G  CGAC+QVRCK+  LCS  G +V+ TD  + 
Sbjct  43   GACGYGSMALSFNGGYIAAGSSALHREGFGCGACFQVRCKNRRLCSTGGVRVILTDLNKS  102

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPHY  367
              TD +LS RAFTA+A+    A+ L   G +DVE++R+ C      L +++ ++S+ P  
Sbjct  103  NTTDLVLSPRAFTAMARDG-TAQELKRLGILDVEYKRIPCEYKKQNLSIRVEESSRRPDR  161

Query  366  LSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAA  187
            L I    QGG +DI AV++ +  ++ W  M R +G VW     P+G L+ R +V+     
Sbjct  162  LVIKFLYQGGQTDIVAVDVAQVGSWNWRFMSREYGPVWSTRRAPAGALQFRMVVTGGYDG  221

Query  186  RWVESEKAIIPAEWKAGLTIETNI  115
            +WV +EKA++PAEWK G   E  +
Sbjct  222  KWVWAEKAVLPAEWKTGSIYELGV  245



>ref|XP_009388354.1| PREDICTED: expansin-like A2 [Musa acuminata subsp. malaccensis]
Length=259

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 121/210 (58%), Gaps = 3/210 (1%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A Y+ +   +    G CGYG      + G V A SS L + G ACGAC+QVRC+++ +
Sbjct  29   SKAGYFSSLSAL--SAGTCGYGSMTLGLSGGYVAAASSALLRGGVACGACFQVRCRNTRI  86

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C   G KV+ TD  E  +TD +LS  AF A+A+   + E L + G VDVE++R+ C    
Sbjct  87   CRGGGVKVILTDLNESNDTDLVLSRPAFVAMARHSAVGE-LEKLGTVDVEYKRIPCEHTK  145

Query  411  KLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPS  232
             L +K+ + S+ P+ L+I    QGG +DI AV++ +E +  W  M R FG VW  +  P 
Sbjct  146  NLSIKVEEKSRSPNVLAIKFLYQGGQTDIGAVDVAQEGSSDWRFMSRVFGPVWSTSRAPP  205

Query  231  GELRVRFLVSSSAAARWVESEKAIIPAEWK  142
            G L++R +V+     +WV ++   +P +W+
Sbjct  206  GPLQLRMVVTGGYGGKWVYAQSEALPVDWR  235



>ref|XP_004153444.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
Length=266

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 134/222 (60%), Gaps = 5/222 (2%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
             ++A++Y+ ++  G   GACGYGD     + G   A+   L+K GA CGAC+QVRCK+  
Sbjct  25   QAKAAFYQ-DEAAGLYRGACGYGDLTLQLSNGYFSAIMPPLYKYGAGCGACFQVRCKNEK  83

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
            +CS  G K++ TD  +   T  +LS +AF  +A   +    L   G VDVEF+R+ C   
Sbjct  84   ICSKEGTKIIVTDRNDNTYTGLVLSQKAFGEMAMSGKDG-LLLSYGVVDVEFKRIPCEYD  142

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             K L V++ + SQYP+YL+I L NQGG ++I A++I +     W  M R +GAVW+   P
Sbjct  143  NKNLMVRVEEWSQYPNYLAIKLLNQGGQTEIVAIDIAQVGYSNWDYMGRNYGAVWETKKP  202

Query  237  -PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             P G L++RF+V+S    +++ + K ++PA+W+ GL  +T +
Sbjct  203  APKGPLQLRFVVTSGYDGKYIWA-KYVLPADWRPGLVYDTGV  243



>ref|XP_004161038.1| PREDICTED: expansin-like A1-like, partial [Cucumis sativus]
Length=281

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 134/222 (60%), Gaps = 5/222 (2%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
             ++A++Y+ ++  G   GACGYGD     + G   A+   L+K GA CGAC+QVRCK+  
Sbjct  40   QAKAAFYQ-DEAAGLYRGACGYGDLTLQLSNGYFSAIMPPLYKYGAGCGACFQVRCKNEK  98

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
            +CS  G K++ TD  +   T  +LS +AF  +A   +    L   G VDVEF+R+ C   
Sbjct  99   ICSKEGTKIIVTDRNDNTYTGLVLSQKAFGEMAMSGKDG-LLLSYGVVDVEFKRIPCEYD  157

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             K L V++ + SQYP+YL+I L NQGG ++I A++I +     W  M R +GAVW+   P
Sbjct  158  NKNLMVRVEEWSQYPNYLAIKLLNQGGQTEIVAIDIAQVGYSNWDYMGRNYGAVWETKKP  217

Query  237  -PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             P G L++RF+V+S    +++ + K ++PA+W+ GL  +T +
Sbjct  218  APKGPLQLRFVVTSGYDGKYIWA-KYVLPADWRPGLVYDTGV  258



>ref|XP_009594036.1| PREDICTED: expansin-like A2 isoform X1 [Nicotiana tomentosiformis]
Length=263

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 130/220 (59%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +Y+     +   +GACGYG      N G + A    ++K GA CGACYQ+RCK+S L
Sbjct  27   SKVAYFSKASAL--QSGACGYGSSAIGFNGGRLAAAVPSIYKEGARCGACYQIRCKNSNL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  V  TD     +TDF++S R F+A+A Q + A+ L E G V VE++RV C+   
Sbjct  85   CSKEGTTVTVTDQNTNNQTDFVVSSRTFSAMANQGK-AQDLLELGIVHVEYKRVPCDFKN  143

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L +++  +S+ P+YL+I L  QGG ++I  V++ +  +  W  M R  GAVWD +  P
Sbjct  144  KNLAIRVEQSSKRPNYLAITLLYQGGQTEIVGVDVAQVGSSNWSFMSRNEGAVWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +W  + KA++PA W+ G+  +T +
Sbjct  204  KGALQFRLVVTAGFDGKWYWA-KAVLPANWRNGVIYDTRL  242



>ref|XP_009341550.1| PREDICTED: expansin-like A2 [Pyrus x bretschneideri]
Length=260

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 132/220 (60%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+AS++ T+  +   +GACGYG      + G + A    LFK GA CGAC+Q+RCK++ L
Sbjct  26   SKASFFSTSAAL--SSGACGYGSLAMGFSGGHLAAGVPSLFKGGAGCGACFQMRCKNTTL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G  V  TD  +   TDF+LS RAF A+A Q  + + +  +G +DVE++RV C    
Sbjct  84   CTKQGTIVTLTDLNQSNHTDFVLSSRAFAAMA-QKGLDQHILRRGILDVEYKRVPCEYKN  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L +++ ++SQ PHYL++ +  QGG ++I A+++ +  +  W  + R  GA+WD +  P
Sbjct  143  QNLSLRVEESSQKPHYLAVKILYQGGQTEIVAMDVAQVGSSNWSFLSRNNGAIWDTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V+S    + V +   ++P  WK G+  +T +
Sbjct  203  AGALQFRFVVTSGYDGKTVWAPN-VLPVNWKPGMIYDTKV  241



>gb|KDO57055.1| hypothetical protein CISIN_1g025837mg [Citrus sinensis]
Length=224

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 4/179 (2%)
 Frame = -1

Query  792  YCQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQ  616
            Y Q +F+ SRA+YY + D +G P GACG+G YGRN N   V  VS RL+ NGA CG CYQ
Sbjct  20   YSQYSFTNSRATYYGSPDGLGTPTGACGFGGYGRNVNDANVAGVS-RLWNNGAGCGTCYQ  78

Query  615  VRCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            VRC    +C+D G  V+ TDY EG +TDFILS RA+  +A   + +E L   G VDVEF 
Sbjct  79   VRCTVPEICTDEGVSVVVTDYGEGDDTDFILSPRAYGRMAVADK-SEELYSHGVVDVEFE  137

Query  435  RVSCN-SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFG  262
            RV C      +  K+H+NS+YP YL++ +    G +D+ AVEI++  TY+  S +  FG
Sbjct  138  RVPCRFRGYNVMFKVHENSRYPQYLAVSMLYVSGQNDVLAVEIWQVITYKLTSKQLIFG  196



>ref|XP_003562133.1| PREDICTED: expansin-like A1 [Brachypodium distachyon]
Length=269

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 126/221 (57%), Gaps = 4/221 (2%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            +SRA+YY ++  +    G+CGYG    + N G + A S  L+++G  CGAC+QVRCK   
Sbjct  33   TSRAAYYTSSLTLAA--GSCGYGTAAASFNGGLLAAASPALYRDGVGCGACFQVRCKDKK  90

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
            LC   G +V+ TD      TD +LS  AF A+A+ P MA  L + GAV VE++RV C   
Sbjct  91   LCGAAGARVVVTDRARTNRTDLVLSSPAFAAMAR-PGMAAQLAKFGAVKVEYKRVPCEYK  149

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             K L V++ + S+ P+ L+I    QGG +DI AV++ +  +  W  M R  G  W  +  
Sbjct  150  GKNLSVRVEERSRAPNELAIRFLFQGGQTDIVAVDVAQVGSSNWKFMARDSGPAWSTSQA  209

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L+ R +V+     +WV +EK ++P  W+AG   +T +
Sbjct  210  PPGPLQFRVVVTGGYDGKWVWAEKEVLPRRWRAGEVYDTGV  250



>ref|XP_002305545.2| expansin-like family protein [Populus trichocarpa]
 gb|EEE86056.2| expansin-like family protein [Populus trichocarpa]
Length=259

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG      N+G + A  S L+K+G+ CGAC+Q+RCK + LCS  G +V+ TD   
Sbjct  38   SGACGYGSMATGFNSGHLAAAVSSLYKDGSGCGACFQIRCKDTTLCSREGTRVIVTDLNR  97

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF+LS RAF A+A + +    L ++G V+VE++RV C      L V++ ++S+  +
Sbjct  98   NNQTDFVLSSRAFMAMANKDKGRNIL-KQGIVEVEYKRVPCEYKNQNLAVRVEESSKNSN  156

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL+I L  QGG +++ A++  +  +  W  M R  GAVWD    PSG L+ RF++++   
Sbjct  157  YLAIKLLYQGGQTEVVAIDFAKVGSSNWGFMSRNHGAVWDSDRVPSGALQFRFVITAGFD  216

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +W+ + + ++P +WK G+T ++ +
Sbjct  217  GKWIWA-RNVLPEDWKPGMTYDSGV  240



>ref|NP_001048868.1| Os03g0132200 [Oryza sativa Japonica Group]
 sp|Q10S70.1|EXLA1_ORYSJ RecName: Full=Expansin-like A1; AltName: Full=OsEXLA1; AltName: 
Full=OsEXPL1; AltName: Full=OsaEXPb2.1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAK84681.1| expansin-like protein A [Oryza sativa]
 gb|ABF93824.1| Rare lipoprotein A like double-psi beta-barrel containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF10782.1| Os03g0132200 [Oryza sativa Japonica Group]
 dbj|BAG87937.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94331.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74453.1| hypothetical protein OsI_09865 [Oryza sativa Indica Group]
 gb|EEE58281.1| hypothetical protein OsJ_09301 [Oryza sativa Japonica Group]
Length=279

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 127/221 (57%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGE-VCAVSSRLFKNGAACGACYQVRCKSSG  595
            SRA+YY ++  +    G+CGYG      N G  + A    L++ G  CGACYQVRCK   
Sbjct  43   SRAAYYTSSLTL--TAGSCGYGTAAATFNGGGFLAAAGPALYRGGVGCGACYQVRCKDKK  100

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
            LCS+ G +V+ TD      T  +LS  AF A+A+ P MA  LTE  AVDVE++RV C   
Sbjct  101  LCSNAGARVVVTDRARTNRTGLVLSSPAFAAMAR-PGMAASLTELAAVDVEYKRVPCEYR  159

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             + L V++ + S+ P+ L+I    QGG +DI AV++ +  +  W  M R  G  W +AN 
Sbjct  160  HRSLSVRVDERSRGPNELTISFLYQGGQTDIVAVDVAQVGSSSWKFMTREHGPSWSMANA  219

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L++R +V+     +WV +++ ++P  W+AG   +T +
Sbjct  220  PPGPLQMRLVVTGGYDGKWVWADREVLPRRWRAGEVYDTGV  260



>ref|XP_008447884.1| PREDICTED: expansin-like A2 [Cucumis melo]
Length=313

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 135/221 (61%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            ++A++Y+ ++  G   GACGYGD     + G   A+   L+K GA CGAC+QVRCK+  +
Sbjct  73   AKAAFYQ-DEAAGLYRGACGYGDLTLQLSNGYFSAIMPPLYKYGAGCGACFQVRCKNEKI  131

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            CS  G K++ TD  +   T  +LS +AF  +A   +    L+  G VDVEF+R+ C  + 
Sbjct  132  CSKEGTKIIVTDRNDNTYTGLVLSQKAFGEMAVSGKDGLLLSY-GVVDVEFKRIPCEYNN  190

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP-  238
              L V++ + SQYP+YL+I L NQGG ++I A++I +     W  M R +GAVW+   P 
Sbjct  191  LNLMVRVEEWSQYPNYLAIKLLNQGGQTEIVAIDIAQVGYSNWDYMGRNYGAVWETKKPA  250

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L++RF+V+S    +++ + K ++PA+W+ GL  +T +
Sbjct  251  PKGPLQLRFVVTSGYDGKYIWA-KHVLPADWRPGLVYDTGV  290



>emb|CDP14520.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 141/222 (64%), Gaps = 6/222 (3%)
 Frame = -1

Query  774  SSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSG  595
            S++A+++  N      +GACGYG    + NAG + A    ++K+GA CGAC+Q+RCK++ 
Sbjct  32   STKAAFF--NKASALQSGACGYGSMATSFNAGHLAAAVPAIYKDGAGCGACFQIRCKNTQ  89

Query  594  LCSDLGEKVMATDYVE-GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNS  418
            LC+  G KV+ TD  +   ETDF+LS RAF A+A Q +  + L + G +DVE++RV C+ 
Sbjct  90   LCTKQGAKVIVTDLNKNNNETDFVLSSRAFRAMAVQGKDQDIL-KLGILDVEYKRVPCDY  148

Query  417  AAKLRVKIHDNSQ-YPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLAN  241
               L +++ ++SQ   +YL+I    QGG ++I  V++ + ++  W  M R +GAVWD + 
Sbjct  149  RRNLGIRVEESSQKRSNYLAIKFLYQGGQTEIVGVDVAQVDSPNWTFMSRNYGAVWDSSR  208

Query  240  PPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             PSG L++R +V++    ++V ++ A +PA+WK G+  ++ +
Sbjct  209  VPSGALQLRVVVTAGYDGKFVWAKNA-LPADWKNGMVYDSGV  249



>ref|XP_008380966.1| PREDICTED: expansin-like A2 [Malus domestica]
Length=260

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 133/220 (60%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+AS++ T+  +   +GACGYG      + G + A    LFK GA CGAC+Q+RCK++ L
Sbjct  26   SKASFFSTSSAL--SSGACGYGSLASGFSGGHLAAGVPSLFKGGAGCGACFQMRCKNTTL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C+  G  V  TD  +  +TDF+LS RAF A+A Q  + + +  +G +DVE++RV C    
Sbjct  84   CTKQGTIVTLTDLNQSNQTDFVLSSRAFAAMA-QKGLDQHILRRGILDVEYKRVPCEYKN  142

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L +++ ++SQ PHYL++ +  QGG ++I A+++ +  +  W  + R  GA+W  +  P
Sbjct  143  QNLSLRVEESSQKPHYLAVKILYQGGQTEIVAMDVAQVGSSNWSFLSRNNGAIWXTSRVP  202

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L+ RF+V+S    + V +   ++P  WK+G+  +T +
Sbjct  203  AGALQFRFVVTSGYDGKTVWAPN-VLPVNWKSGMIYDTRV  241



>gb|ACC61048.1| expansin-like 1 protein [Ipomoea batatas]
Length=268

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 121/202 (60%), Gaps = 3/202 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG      N G + A    L+K+G  CGAC+Q+RCK   LC+  G  V+ TD   
Sbjct  46   SGACGYGSMAIAFNGGHLAAAVPTLYKDGDGCGACFQMRCKDPNLCTKQGTTVIVTDLNT  105

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPH  370
              +TDF++S RAF A+A Q +  + L + G  DV+++RV CN   K L V + + SQ P+
Sbjct  106  NNQTDFVISSRAFRAMATQGKDQDLL-KLGIADVDYKRVPCNYKTKNLAVFVEETSQKPN  164

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL+I    QGG ++I AV++ +  +  W  M R  GA+WD +  PSG L+ RF+V++   
Sbjct  165  YLAIKFLYQGGQTEIVAVDVAQVGSSNWNFMSRNHGAIWDTSRVPSGALQFRFVVTAGYD  224

Query  189  ARWVESEKAIIPAEWKAGLTIE  124
             +W  + K ++PA+WK G+  +
Sbjct  225  GKWYWA-KNVMPADWKNGVIYD  245



>ref|XP_003563074.1| PREDICTED: expansin-like B1 [Brachypodium distachyon]
Length=257

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 122/224 (54%), Gaps = 7/224 (3%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ASYY  +D  G  NGAC YG +G   N G+V A S+ L++NG  CGACYQVRC     
Sbjct  31   SKASYYPNSDTKGTENGACEYGTFGATLNNGDVSA-SASLYRNGVGCGACYQVRCTDPYY  89

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  ++ TD      TDFILS  AFT + +       L   G V +E+RRVSC+   
Sbjct  90   CSPEGVTIVITDSGSSDGTDFILSQHAFTGMGQSADAGAALLTLGYVGIEYRRVSCSYPN  149

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K +  KI ++S +P+Y+   +  Q G+ DI AV++ E  T +   + R  GAVW   +PP
Sbjct  150  KNIVFKITESSHFPYYIEFEIWYQQGSQDIIAVQLCETVTLKCQLLSRTHGAVWATVSPP  209

Query  234  SGELRVRFLVSSSAA----ARWVESEKAIIPAEWKAGLTIETNI  115
            +G L +R L SS A      +W+      IP  W AG   ++ +
Sbjct  210  TGPLYIRMLFSSGAPRVGDQKWLAPTNT-IPQNWTAGAIYDSGV  252



>ref|XP_010555195.1| PREDICTED: expansin-like A2 [Tarenaya hassleriana]
Length=262

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 121/202 (60%), Gaps = 3/202 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG        G + A    ++K+GA CGAC+Q+RCK + LC+  G  V+ TD  +  +
Sbjct  44   CGYGSMAMGFYGGHLAAAVPSIYKDGARCGACFQIRCKDTKLCNSKGTTVIVTDVNKSNQ  103

Query  537  TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLS  361
            TDF+LS RAF A+A      + L  +G +DVE++RV C    K L V++ ++SQ PHYL+
Sbjct  104  TDFVLSSRAFRAMANHGFDRDLL-RQGLLDVEYKRVPCVYKDKNLAVRVEESSQKPHYLA  162

Query  360  ILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARW  181
            I L  QGG +++ A++I    +  W  M R  GAVWD    PSG L+ RF+V+S    +W
Sbjct  163  IKLLYQGGQTEVVAMDIATVGSSNWGFMSRNHGAVWDTDRVPSGALQFRFVVTSGYDGKW  222

Query  180  VESEKAIIPAEWKAGLTIETNI  115
            V S++ ++PAEW+ G   +  +
Sbjct  223  VWSQR-VLPAEWENGKVYDAGV  243



>ref|XP_009382059.1| PREDICTED: expansin-like A2 [Musa acuminata subsp. malaccensis]
Length=266

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 120/202 (59%), Gaps = 2/202 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG      + G V A SS + + G  CGAC+Q+RCK++ LCS  G KV+ TD  +   
Sbjct  47   CGYGSMALGFDGGYVAAGSSAIHRGGVGCGACFQIRCKNTSLCSTGGVKVILTDLNKSNT  106

Query  537  TDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPHYLS  361
            TDF+LS  AF A+A+  +  E L + G +DVE++R+ C      L +++ +NS+ P+YL+
Sbjct  107  TDFVLSGPAFAAMARNGKAQE-LKKLGILDVEYKRIPCEYKNHNLSIRVEENSKSPNYLA  165

Query  360  ILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARW  181
            I    QGG +DI AV++ +  +  W  M R +G VW  +  P+G L++R +V+     +W
Sbjct  166  IKFMYQGGQTDIVAVDVAQVGSTNWRFMSRDYGPVWSTSRAPAGPLQLRVVVTGGYDGKW  225

Query  180  VESEKAIIPAEWKAGLTIETNI  115
            V + K ++PAEW+ G   +  +
Sbjct  226  VWAPKPVLPAEWRTGSIYDMGV  247



>ref|XP_009384618.1| PREDICTED: expansin-like A3 [Musa acuminata subsp. malaccensis]
Length=265

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 128/220 (58%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y  ++   G   GACGYG      N G   A SS L + G  CGAC+Q+RCK++ +
Sbjct  36   SKAAYSSSS---GLSVGACGYGSMALGFNGGYTAAGSSTLHRGGVGCGACFQIRCKNTSV  92

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C   G  V+ TD  +   TDF+L   AF A+A+  +  E L + G +DVE++R+ C    
Sbjct  93   CGTEGVSVILTDLNKSNHTDFVLGDPAFMAMARNGKEQE-LKKLGILDVEYKRIPCEYKN  151

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            + L V++ ++S+ P +L+I    QGG +D+ AV++ +  +  W  MRR +G VW ++  P
Sbjct  152  RNLSVRVEESSRSPSHLAIKFLYQGGQTDMVAVDVAQVGSPNWRFMRRDYGPVWSISRAP  211

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R +V+     RWV ++KA++PAEW  G   +  +
Sbjct  212  VGPLQLRMVVTGGYGGRWVWAQKAVLPAEWTTGSVYDLGV  251



>ref|XP_009411148.1| PREDICTED: expansin-like A2 [Musa acuminata subsp. malaccensis]
Length=307

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 123/204 (60%), Gaps = 2/204 (1%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            GACGYG      + G V A SS L++ G  CGAC+QVRCK++ +CS  G +V+ TD  + 
Sbjct  86   GACGYGSMALGFSGGYVAAASSALYRGGVGCGACFQVRCKNTKICSSRGVEVIITDLNKS  145

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHY  367
             +TD +LS  A+ A+A++  MA+ L + G VDVE++R+ C  + K L +++ + S+ P+ 
Sbjct  146  NDTDLVLSRPAYVAMARR-GMAKSLKKLGIVDVEYKRIPCEYSNKNLSIRVEEKSKRPNS  204

Query  366  LSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAA  187
            L+I   +QGG +DI AV++ +  +  W  M R +G VW     P G L++R +V+     
Sbjct  205  LTIKFLHQGGQTDIVAVDVAQVGSSNWQFMSREYGPVWSTDRAPVGPLQLRMVVTGGYDG  264

Query  186  RWVESEKAIIPAEWKAGLTIETNI  115
            +WV ++K ++P  WK G   +  +
Sbjct  265  KWVWAQKEVLPVHWKIGSVYDLGV  288



>ref|XP_008448110.1| PREDICTED: expansin-like A1 [Cucumis melo]
Length=325

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 132/221 (60%), Gaps = 6/221 (3%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+YY ++D +    GACGYG     +  G +      L+K GA CG C+QVRCK+  L
Sbjct  88   SKAAYYYSDDPI--QYGACGYGSLANESFHGYIAGAVPLLYKQGAGCGVCFQVRCKNKKL  145

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS +G K++ TD      TDF+LS +AF+ +A+   MA+ L + G VD+E++RV C    
Sbjct  146  CSPIGAKIVLTDQNYDNRTDFVLSRKAFSGMARWG-MAQQLLQLGMVDIEYKRVPCGYKN  204

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L V+I + S  P+YL++    QGG ++I +V+I +     W  ++R +GA+WD +  P
Sbjct  205  KNLLVRIEEWSNKPYYLAMKFLYQGGQTEIKSVDIAQVGRSDWEGLKRNYGAIWDTSKVP  264

Query  234  SGELRVRFLVSSS-AAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R +V+S      W+ +    IPA+WK+G T +T I
Sbjct  265  EGALQLRLVVTSGYDNENWIWTNYE-IPADWKSGETYDTGI  304



>ref|XP_009400330.1| PREDICTED: expansin-like A1 [Musa acuminata subsp. malaccensis]
Length=261

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 119/203 (59%), Gaps = 1/203 (0%)
 Frame = -1

Query  723  GACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEG  544
            GACGYG      + G V A  S L + G  CGAC+QVRCK++ +CS  G KV+ TD  + 
Sbjct  42   GACGYGSLALGFSGGYVAAAGSSLHRGGIGCGACFQVRCKNTKICSSGGVKVILTDLNKI  101

Query  543  QETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAKLRVKIHDNSQYPHYL  364
             +TD  L+  A+ A+A+   MA+ L + G VDVE++R+ C     L +++ + SQ P+YL
Sbjct  102  SDTDLALNRPAYAAMARYG-MAKELKKLGIVDVEYKRIPCEHNKNLSIRVEEKSQSPNYL  160

Query  363  SILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAAR  184
            +I +  QGG +DI AV++ +  +  W  M R +G VW     P G L++R +V+     +
Sbjct  161  AIKVLYQGGQTDIVAVDVAQVGSSDWQFMSREYGPVWSTNRAPPGPLQLRMVVTGGYDGK  220

Query  183  WVESEKAIIPAEWKAGLTIETNI  115
            WV S++ ++P +WK G   +  +
Sbjct  221  WVWSQEEVLPVDWKTGSVYDLRV  243



>ref|XP_008447887.1| PREDICTED: expansin-like A2 isoform X2 [Cucumis melo]
Length=263

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 133/224 (59%), Gaps = 8/224 (4%)
 Frame = -1

Query  777  FSSRASY-YKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKS  601
            F S+AS+ Y++    G   GACGYG+     + G   A    L+K GA CGACYQVRCK+
Sbjct  24   FQSKASHLYESPTTYG---GACGYGNLALQFSNGFFAAAVPSLYKQGAGCGACYQVRCKN  80

Query  600  SGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN  421
              LC+ +G KV+ TD      TD +LS +AF  +A   + ++ L   G VDVE++RV C 
Sbjct  81   RRLCNTVGTKVVLTDQNNDNVTDLVLSQKAFFTMALSGKGSDLLN-LGVVDVEYKRVPCE  139

Query  420  --SAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
              +   L V++ ++S  P  L+I    QGG +++ AV+I +  T  W  M+R++GAVW+ 
Sbjct  140  YPNYRNLLVRVEESSYNPFKLAIKFLYQGGQTEMVAVDIAQVGTSDWSHMKRSYGAVWET  199

Query  246  ANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             N P G L++R +V+S    +WV + K+++PA W+AG   +T +
Sbjct  200  DNVPEGALQLRMVVTSGYDGKWVWA-KSVLPANWRAGAIYDTGV  242



>gb|AFK46747.1| unknown [Lotus japonicus]
Length=260

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 130/220 (59%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     +   +GACGY       + G + A    LFK+GA CGACYQ+RCK+  L
Sbjct  27   SKAAYFSKASAL--SSGACGYDSLALGLSGGHLAAGVPSLFKSGAGCGACYQLRCKNPAL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C   G +V+ TD     +T+F+LS RAF A+A+  +  + L + G VD+E++RV+C    
Sbjct  85   CKKEGARVVLTDLNPNNQTEFVLSSRAFVAMAQDGKGQQIL-KLGIVDIEYKRVACEFKN  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P YL+I    QGG ++I  V++ +  +  W  M R  GAVWD +  P
Sbjct  144  QNLAVRVEESSKKPDYLAIKFLYQGGQTEIVGVDVAQVGSSNWRFMSRNHGAVWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +WV ++K ++P +WK G+  ++ +
Sbjct  204  QGPLQFRLVVTAGYDGKWVWAQK-VLPLDWKNGVIYDSGV  242



>sp|Q850K7.2|EXLB1_ORYSJ RecName: Full=Expansin-like B1; AltName: Full=Expansin-related 
1; AltName: Full=OsEXLB1; AltName: Full=OsEXPR1; AltName: 
Full=OsaEXPb3.1; Flags: Precursor [Oryza sativa Japonica Group]
 gb|EAZ03949.1| hypothetical protein OsI_26085 [Oryza sativa Indica Group]
 gb|EAZ39893.1| hypothetical protein OsJ_24331 [Oryza sativa Japonica Group]
 dbj|BAH00899.1| unnamed protein product [Oryza sativa Japonica Group]
Length=256

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 124/227 (55%), Gaps = 7/227 (3%)
 Frame = -1

Query  780  NFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            NF+ SRA+YY  +D  G  NGAC YG +G   N G+V A S+ L+++G  CGACYQVRC 
Sbjct  27   NFTVSRAAYYPNSDIKGTENGACEYGAFGATLNNGDVSA-SASLYRDGVGCGACYQVRCT  85

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
            +   CS  G  ++ TD      TDFILS  AFT +A+       L   G V +E+RRVSC
Sbjct  86   NPYYCSPNGVTIVITDSGASDGTDFILSQHAFTRMAQSTDAGTALLTLGVVGIEYRRVSC  145

Query  423  NSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
                K +  KI ++S +P+YL   +  Q G  DI AV++ E        + R  GAVW  
Sbjct  146  TYPNKNIVFKITESSNFPNYLEFEIWYQQGNQDIIAVQLCETVNLTCQLLSRTHGAVWAA  205

Query  246  ANPPSGELRVRFLVSSSA---AARWVESEKAIIPAEWKAGLTIETNI  115
             +PPSG L +R L SS A      W+     I+P  W AG T ++ +
Sbjct  206  VSPPSGPLSIRMLFSSGAPRGGDTWLVPTN-IVPQNWTAGATYDSGV  251



>gb|AFK37951.1| unknown [Lotus japonicus]
 gb|AFK41070.1| unknown [Lotus japonicus]
Length=260

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 130/220 (59%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     +   +GACGY       + G + A    LFK+GA CGACYQ+RCK+  L
Sbjct  27   SKAAYFSKASAL--SSGACGYDSLALGLSGGHLAAGVPSLFKSGAGCGACYQLRCKNPTL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SA  415
            C   G +V+ TD     +T+F+LS RAF A+A+  +  + L + G VD+E++RV+C    
Sbjct  85   CKKEGARVVLTDLNPNNQTEFVLSSRAFVAMAQDGKGQQIL-KLGIVDIEYKRVACEFKN  143

Query  414  AKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
              L V++ ++S+ P YL+I    QGG ++I  V++ +  +  W  M R  GAVWD +  P
Sbjct  144  QNLAVRVEESSKKPDYLAIKFLYQGGQTEIVGVDVAQVGSSNWRFMSRNHGAVWDTSRVP  203

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V++    +WV ++K ++P +WK G+  ++ +
Sbjct  204  QGPLQFRLVVTAGYDGKWVWAQK-VLPLDWKNGVIYDSGV  242



>ref|XP_008784689.1| PREDICTED: expansin-like B1 [Phoenix dactylifera]
Length=258

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 121/222 (55%), Gaps = 5/222 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRA YY  +D+ G  NGACGYG +G   N G+V A +S L++NG  CGACYQVRC +S  
Sbjct  36   SRAVYYPNSDKEGTENGACGYGSFGATLNGGDVSA-ASNLYRNGVGCGACYQVRCTNSNY  94

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G  ++ TD       DFILS  AF  + +       L   G V +E+RRVSC+   
Sbjct  95   CSTDGVTIVITDSGASDGADFILSQHAFAKMGQTADAGASLLALGVVGIEYRRVSCSYPN  154

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K +  KI  +S +P+YL+  +  Q G  DI AV++ E        + R+ GAVW + +PP
Sbjct  155  KNITFKIDGSSNFPYYLAFEIWYQQGNQDITAVQLCETVNLTCKLLERSHGAVWAVVSPP  214

Query  234  SGELRVRFLVSSS--AAARWVESEKAIIPAEWKAGLTIETNI  115
            +G L +R L+S    A   W+      IP  W AG   ++ +
Sbjct  215  TGPLSIRMLLSGGDDADETWMVPTNN-IPQNWTAGAIYDSGV  255



>ref|XP_006651010.1| PREDICTED: expansin-like A1-like [Oryza brachyantha]
Length=270

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 123/221 (56%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGE-VCAVSSRLFKNGAACGACYQVRCKSSG  595
            SRA+Y   +  +    G+CGYG      N G  + A    L++ G  CGACYQVRCK   
Sbjct  34   SRAAYSTASLTL--TAGSCGYGTAAARLNGGGFLAAAGPALYRGGVGCGACYQVRCKDKK  91

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSA  415
            LCS  G +V+ TD      T  +LS  AF A+A  P MA  LT+  AVDVE++RV C   
Sbjct  92   LCSAAGARVVVTDRARTNRTGLVLSSPAFAAMA-HPGMAASLTKLAAVDVEYKRVPCEYR  150

Query  414  AK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
             K L V++ + S+ P+ LSI    QGG +DI AV++ +  +  W  M R  G  W +AN 
Sbjct  151  HKNLSVRVDERSRGPNELSISFLYQGGQTDIVAVDVAQVGSSSWKFMTREHGPSWSMANA  210

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L++R +V+     +WV +++ ++P  W+AG   +T +
Sbjct  211  PPGPLQLRLVVTGGYDGKWVWADREVLPRRWRAGEVYDTGV  251



>ref|XP_006292201.1| hypothetical protein CARUB_v10018414mg [Capsella rubella]
 gb|EOA25099.1| hypothetical protein CARUB_v10018414mg [Capsella rubella]
Length=263

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 123/203 (61%), Gaps = 3/203 (1%)
 Frame = -1

Query  717  CGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQE  538
            CGYG       AG + A +  ++KNGA CGAC+QVRCK+  LC+  G  VM TD      
Sbjct  44   CGYGSMATRFVAGHIAAATPSIYKNGAGCGACFQVRCKNPKLCTSKGTIVMVTDLNTNSH  103

Query  537  TDFILSYRAFTALAKQPRMAE-FLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYL  364
            TD +LS RAF A+AK    A+ +L ++G VD+E++RV CN   + L+V++ + S+ P+YL
Sbjct  104  TDLVLSNRAFRAMAKPVGSADKYLLKQGIVDIEYQRVPCNYGKRNLQVRVEEASKKPYYL  163

Query  363  SILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAAR  184
            +I L  QGG +++  ++I +  + QW  M R++G VW     P+G L+ R  V+     +
Sbjct  164  AIKLLYQGGQTEVVGIDIAQVGSSQWSYMTRSYGGVWATDKVPTGALQFRVTVTGGYDGK  223

Query  183  WVESEKAIIPAEWKAGLTIETNI  115
             V +++ ++PA W+AG   ++ +
Sbjct  224  TVWAKR-VLPANWEAGRIYDSGV  245



>ref|XP_008447886.1| PREDICTED: expansin-like A1 isoform X1 [Cucumis melo]
Length=264

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 131/221 (59%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A++Y   D   +  GACGYG+     + G   A    L+K GA CGACYQVRCK+  L
Sbjct  26   SKATHY-YGDSPTSYGGACGYGNLALQFSNGFFAAAVPSLYKQGAGCGACYQVRCKNRRL  84

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN--S  418
            C+ +G KV+ TD      TD +LS +AF  +A   + ++ L   G VDVE++RV C   +
Sbjct  85   CNTVGTKVVLTDQNNDNVTDLVLSQKAFFTMALSGKGSDLL-NLGVVDVEYKRVPCEYPN  143

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L V++ ++S  P  L+I    QGG +++ AV+I +  T  W  M+R++GAVW+  N 
Sbjct  144  YRNLLVRVEESSYNPFKLAIKFLYQGGQTEMVAVDIAQVGTSDWSHMKRSYGAVWETDNV  203

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L++R +V+S    +WV + K+++PA W+AG   +T +
Sbjct  204  PEGALQLRMVVTSGYDGKWVWA-KSVLPANWRAGAIYDTGV  243



>ref|XP_004144934.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
 ref|XP_004153090.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
 ref|XP_004167724.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
Length=264

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 133/223 (60%), Gaps = 7/223 (3%)
 Frame = -1

Query  777  FSSRASY-YKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKS  601
            F S+AS+ Y++    G   GACGYG+     + G   A    L+K GA CGACYQVRCK+
Sbjct  26   FQSKASHLYESPTTYG---GACGYGNLALQFSNGFFAAAVPSLYKQGAGCGACYQVRCKN  82

Query  600  SGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN  421
              LC+ +G KV+ TD      TD +LS +AF  +A   + ++ L   G VDVE++RV C 
Sbjct  83   RRLCNTVGTKVVLTDQNNDNVTDLVLSPKAFFTMALNGKGSDLL-NLGVVDVEYKRVPCE  141

Query  420  SAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLA  244
               + L V++ ++S  P  L+I    QGG +++ AV+I +  T  W  M+R++GAVW+  
Sbjct  142  YPNRNLLVRVEESSYNPFKLAIKYLYQGGQTEMVAVDIAQVGTSDWSHMKRSYGAVWETD  201

Query  243  NPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            N P G L++R +V+S    +WV + K+++PA W+AG   +T +
Sbjct  202  NVPEGALQLRMVVTSGYDGKWVWA-KSVLPATWRAGGIYDTGV  243



>ref|XP_006828980.1| hypothetical protein AMTR_s00001p00240270 [Amborella trichopoda]
 gb|ERM96396.1| hypothetical protein AMTR_s00001p00240270 [Amborella trichopoda]
Length=260

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 126/220 (57%), Gaps = 5/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+ +YY +   +  P GACGYG      N G V A SS L++ G  CGAC+Q+RC    +
Sbjct  25   SKVAYYSSPSAI--PAGACGYGSMALAFNGGYVAATSSALYREGIGCGACFQIRCTDWTV  82

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            CS  G +++ TD      T+F+LS  AF  +A++  M + L + G   VE++RV C+   
Sbjct  83   CSKGGSQIIVTDLNYDNHTEFVLSGAAFFGMARKG-MKQQLKKIGVAVVEYKRVPCDYKN  141

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L V + ++SQYP+YL++    QGG +DI AV++ +  +  W  M R  GA+WD    P
Sbjct  142  KNLSVMVEESSQYPYYLAVKFVYQGGQTDIVAVDVAQVGSSNWRYMTRNHGAIWDTNRVP  201

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L+ R +V+     +W+ ++ +++PA+W  G   ++ +
Sbjct  202  QGALQFRLVVTGGYDGKWIWAQ-SVLPADWTKGAVYDSGV  240



>ref|XP_004985830.1| PREDICTED: expansin-like A1-like isoform X2 [Setaria italica]
Length=274

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 125/220 (57%), Gaps = 4/220 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+YY ++  +    G+CGYG    +   G + A S  L++ G  CGAC+QVRCK   L
Sbjct  39   SKAAYYASSLTLAG--GSCGYGAEAASMGGGFLAAASPALYRAGVGCGACFQVRCKDRKL  96

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G +V+ TD      TD +LS  AF A+A+ P MA  L ++  VDVE++RV C    
Sbjct  97   CAAAGARVVVTDRARTNRTDLVLSSPAFAAMAR-PGMAARLAKRRTVDVEYKRVPCEYKH  155

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            + L V++ + S+ P  L+I    QGG +DI AV++ +  +  W  M R +G  W  +  P
Sbjct  156  RNLSVRVEEKSRAPSELTIRFLYQGGQTDIVAVDVAQVGSSNWKFMTRDYGPAWSTSQAP  215

Query  234  SGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R +V+     +WV +++ ++P  W+AG   +T +
Sbjct  216  PGPLQLRVVVTGGYDGKWVWADREVLPRRWRAGEVYDTGV  255



>ref|XP_003562134.2| PREDICTED: expansin-like A1 [Brachypodium distachyon]
Length=267

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 127/221 (57%), Gaps = 8/221 (4%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            SRAS+Y ++  +    G+CGYG+   + N G + A    L++ G  CGAC+QVRCK   L
Sbjct  34   SRASFYTSSLTLSA--GSCGYGN---SFNGGMLAAAGPALYRGGVGCGACFQVRCKDKEL  88

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC--NS  418
            CS  G  V+ TD  +   T+ +LS  AF A+A+ P MA+ L + G VDVE +RV C  N+
Sbjct  89   CSTSGAGVIVTDSAKTNRTELVLSSPAFNAMAR-PGMADRLAKLGEVDVECKRVPCEYNN  147

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L V++ + S  P +L+I    QGG +DI AV+I +  +  W  M R  G  W  +  
Sbjct  148  HKNLSVRVEEKSHAPSHLAIRFFYQGGQTDIVAVDIAQVGSSNWKFMAREHGPAWSTSQA  207

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P+G L++R +V++    +W+  EK ++P+ W+AG    T +
Sbjct  208  PAGPLQLRVVVTAGYDGKWLWVEKEVLPSAWRAGEMYGTGL  248



>ref|XP_004957766.1| PREDICTED: expansin-like B1-like [Setaria italica]
Length=281

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/280 (36%), Positives = 141/280 (50%), Gaps = 11/280 (4%)
 Frame = -1

Query  936  SSSLIIYTLNTHCFSCSQMEIFSLSKMTVFPIYFFTSlclilllpplCYCQQNFS-SRAS  760
            + SLI+Y       S       S+ +M  FP++  ++L  +  L        NF+ S+A 
Sbjct  2    TPSLILYICTIQ--SSKPCSFVSVPQMD-FPMHCLSALLYLFALISKATADANFTVSKAV  58

Query  759  YYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDL  580
            YY  +D  G   GAC YG +G   N G+V A S+ L++NG  CGACYQVRC +   CS  
Sbjct  59   YYPNSDTRGTETGACEYGAFGATLNNGDVSA-SASLYRNGVGCGACYQVRCTNPHYCSPS  117

Query  579  GEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAK-LR  403
            G  ++ TD      TDFILS  AF  + +       L   G V +E+RRV C    K + 
Sbjct  118  GVTIVITDSGASNGTDFILSQHAFAGMGQNKDAGATLLNLGYVGIEYRRVPCIYPGKNII  177

Query  402  VKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGEL  223
             KI ++S +P+YL   +  Q G  DI AV++ E        + R  GAVW   +PP+G L
Sbjct  178  FKITESSHFPYYLEFEIWYQQGNQDIIAVQLCETVNLTCQLLGRTHGAVWAAISPPNGPL  237

Query  222  RVRFLVSSSAAAR----WVESEKAIIPAEWKAGLTIETNI  115
             +R L SS A  R    W+ S  + IP  W AG T ++ +
Sbjct  238  NIRMLFSSGAPHRGDQKWLVS-TSTIPQNWTAGATYDSGV  276



>gb|KCW55628.1| hypothetical protein EUGRSUZ_I01493 [Eucalyptus grandis]
Length=294

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/255 (33%), Positives = 142/255 (56%), Gaps = 40/255 (16%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+Y+     + +  GACGYG      N+G + A    L+K+GA CGAC+Q+RCK++ L
Sbjct  26   SKAAYFSKASALSS--GACGYGSLAVGFNSGFLAAAIPSLYKDGAGCGACFQIRCKNANL  83

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G +V+ TD      TDF+LS RAF A+A+Q  M++ +  +G VDVE++RV C+   
Sbjct  84   CTKGGTRVIVTDLNRNNNTDFVLSSRAFAAMARQG-MSQDILRQGIVDVEYKRVPCDYKD  142

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQ------------------  289
            + L V++ ++S+ P+YL+I +  QGG ++I A+++ +   +                   
Sbjct  143  RNLAVRVEESSRKPNYLAIKVLYQGGQTEIVAMDVAQVSLHPLYHQIHFPFKSIRHFLGP  202

Query  288  -----------------WISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARWVESEKAI  160
                             W  M R +GAVW+ +  P G L+ RF+V+S    +W+ + K++
Sbjct  203  SCQITSRFPYSQVGSSYWTYMSRNYGAVWNTSRVPDGALQFRFVVTSGYDGKWIWA-KSV  261

Query  159  IPAEWKAGLTIETNI  115
            +PA+W+ G+  ++ I
Sbjct  262  LPADWQNGVVYDSGI  276



>ref|XP_006422510.1| hypothetical protein CICLE_v10029905mg [Citrus clementina]
 ref|XP_006486850.1| PREDICTED: expansin-like A2-like [Citrus sinensis]
 gb|ESR35750.1| hypothetical protein CICLE_v10029905mg [Citrus clementina]
 gb|KDO68214.1| hypothetical protein CISIN_1g025007mg [Citrus sinensis]
Length=259

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 125/221 (57%), Gaps = 6/221 (3%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGA-CYQVRCKSSG  595
            S+ SY+     +    GACGYG       +G + A    ++KNGAACG  C+QVRCK+  
Sbjct  25   SKVSYFSKTSALSK--GACGYGSLALGLGSGHIAAAVPSIYKNGAACGGTCFQVRCKNRA  82

Query  594  LCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-S  418
            LCS  G +V+ TD     +TD +LS RAF ALA +    E L ++ AVDVE+ RV C   
Sbjct  83   LCSRKGTRVIVTDLNHNNKTDMVLSRRAFRALANKGMDNEILKQR-AVDVEYIRVPCEYK  141

Query  417  AAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANP  238
               L V++ ++S+ P+YL+I +  QGG ++I  V + E  +   I MRR FGAVW+    
Sbjct  142  HHNLAVRVEESSKNPNYLAIKVLYQGGKTEILGVVLSEYGSPVRIDMRRKFGAVWETDRA  201

Query  237  PSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
            P G L+  F +      +W+ + K  +PA+WK G+T +  +
Sbjct  202  PKGPLQFGFPIVQGFDVKWIWA-KNPVPADWKIGVTYDAGV  241



>ref|XP_010426024.1| PREDICTED: expansin-like A3 [Camelina sativa]
Length=263

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = -1

Query  711  YGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQETD  532
            YG    +  AG +      ++K+GA CGAC+QVRCK+  LC+  G  VM TD   G +TD
Sbjct  46   YGSMATSFFAGHIAGAIPSIYKDGAGCGACFQVRCKNPKLCTSKGTIVMVTDLNTGSQTD  105

Query  531  FILSYRAFTALAKQPRMAE-FLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLSI  358
             +LS RAF A+AK    A+ +L ++G VDVE++RV CN   + L V++ + S+ P+YL+I
Sbjct  106  LVLSSRAFRAMAKPSAGADKYLLKQGIVDVEYQRVPCNYGKRNLHVRVEEPSKKPNYLAI  165

Query  357  LLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARWV  178
             L  QGG +++  ++I +  + +W  M R+ GAVW     P+G L+ RF V+     + V
Sbjct  166  KLLYQGGQTEVVGIDIAQVGSSEWSYMTRSHGAVWATDKVPTGALQFRFTVTGGYDGKTV  225

Query  177  ESEKAIIPAEWKAGLTIETNI  115
             +++ ++PA WKAG+  +  +
Sbjct  226  WAKR-VLPASWKAGMIYDAGV  245



>ref|XP_004144933.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
 ref|XP_004153089.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
 ref|XP_004167723.1| PREDICTED: expansin-like A1-like [Cucumis sativus]
Length=268

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 130/221 (59%), Gaps = 5/221 (2%)
 Frame = -1

Query  771  SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGL  592
            S+A+YY   D   +  GACGYG+     + G   A    L+K GA CGACYQVRCK + L
Sbjct  29   SKAAYY-YEDSPTSYGGACGYGNLALEISQGYFAAAVPSLYKGGAGCGACYQVRCKDTYL  87

Query  591  CSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAA  412
            C+  G K++ TD      TD +LS +AF+A+A + + A+ L   G VD+E++R+ C    
Sbjct  88   CNTAGTKIVLTDQNNDNRTDIVLSKKAFSAMALKGK-AQQLLNTGLVDIEYKRIPCEYKN  146

Query  411  K-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPP  235
            K L V++ + S  P+YL+I    QGG +DI AV I +    +W  M+R +G +WD+   P
Sbjct  147  KNLLVQVVEWSHKPYYLAIKFLYQGGQTDIQAVNIAQVGLPKWRPMKRNYGGIWDINGVP  206

Query  234  SGELRVRFLVSSS-AAARWVESEKAIIPAEWKAGLTIETNI  115
             G L++R +V+S     +W+ +  +++P++WK G   +T +
Sbjct  207  KGGLQLRMVVTSRYDNGKWIWA-GSVLPSDWKNGEIYDTGV  246



>ref|XP_010690271.1| PREDICTED: expansin-like A1 [Beta vulgaris subsp. vulgaris]
Length=260

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 131/229 (57%), Gaps = 8/229 (3%)
 Frame = -1

Query  789  CQQNFSSRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVR  610
            C Q   ++A+++ ++   G  +GACGYG    N   G V A    L+K G  CGACYQ+R
Sbjct  19   CNQCVLAKAAFFASSK--GLSSGACGYGPLALNLYGGHVAAALPPLYKKGEGCGACYQIR  76

Query  609  CKSSGLCSDLGEKVMATDYV--EGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFR  436
            CK  G+C+  G  ++ TD    +   TDF+LS RAF A+A  P   + L + G  DVE++
Sbjct  77   CKKIGVCNTKGTTIVVTDIHTDKSNTTDFVLSSRAFRAMA-LPAKDKQLLQIGIADVEYK  135

Query  435  RVSC-NSAAKLRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYE-EETYQWISMRRAFG  262
            RV C      L +++ + S+  +YL+I +  QGG ++I   E+    +   WISM R +G
Sbjct  136  RVPCVYKGQNLAIRVEEFSKPSNYLAIKVLYQGGQTNILGAEVASVNQPSNWISMSRNYG  195

Query  261  AVWDLANPPSGELRVRFLVSSSAAARWVESEKAIIPAEWKAGLTIETNI  115
             VWD +  P+G+L  RF+++S   A++  +++ I+P  WK G+T  T +
Sbjct  196  VVWDTSKAPTGKLMFRFIINSGFDAQYFYTQE-ILPVNWKPGVTYTTKV  243



>ref|XP_006657721.1| PREDICTED: expansin-like B1-like [Oryza brachyantha]
Length=255

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 125/227 (55%), Gaps = 7/227 (3%)
 Frame = -1

Query  780  NFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCK  604
            NF+ SRA+YY  +D  G  NGA  YG +G   N G+V + S+ L+++G  CGACYQVRC 
Sbjct  27   NFTVSRAAYYPNSDTKGTENGASEYGVFGATLNNGDV-STSASLYRDGVGCGACYQVRCT  85

Query  603  SSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSC  424
            +   CS  G +++ TD      TDFILS  AF  + +       L   G V +E+RRVSC
Sbjct  86   NPYYCSPDGVRIVITDSGASDGTDFILSQHAFARMGQNTDSGAALLTLGVVGIEYRRVSC  145

Query  423  NSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDL  247
            +   + +  KI ++S +PHYL   +  Q G  DI AV++ E        + R  GAVW  
Sbjct  146  SYPNQNIIFKITESSNFPHYLEFEIWYQQGNQDIIAVQLCETLNLTCQLLSRTHGAVWAA  205

Query  246  ANPPSGELRVRFLVSSSA---AARWVESEKAIIPAEWKAGLTIETNI  115
             +PPSG L +R L+SS A     +W+     I+P  W AG T ++ +
Sbjct  206  VSPPSGPLSIRMLLSSGAPRGGDKWLVPTN-IVPQNWTAGATYDSGV  251



>emb|CAE12163.1| expansin-like protein [Quercus robur]
Length=265

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 125/205 (61%), Gaps = 3/205 (1%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +GACGYG      N+G + A  + L+K+GA CGAC+QVRCK++  C+  G  V  TD   
Sbjct  44   SGACGYGSLALGFNSGHLAAGVASLYKDGAGCGACFQVRCKNTSHCTKEGTIVTVTDLNR  103

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCN-SAAKLRVKIHDNSQYPH  370
              +TDF++S RAF A+A Q  M + + + G VDVE++RV C      L V++ + SQ P+
Sbjct  104  NNQTDFVVSSRAFMAMA-QKGMGQDILKLGIVDVEYKRVPCQYKNQNLAVRVEEPSQKPN  162

Query  369  YLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAA  190
            YL++    QG  ++I  V++ +  +  W  M   +GAVWD +  PSG L+ R ++++   
Sbjct  163  YLAVKFLYQGSQTEIVGVDVAQVGSSNWGFMSHNYGAVWDTSRVPSGALQFRIVITAGYD  222

Query  189  ARWVESEKAIIPAEWKAGLTIETNI  115
             +++ ++  ++PA+WK+G+  ++ +
Sbjct  223  GKYIWAQH-VLPADWKSGVIYDSGV  246



>ref|XP_010919842.1| PREDICTED: expansin-like B1 [Elaeis guineensis]
Length=257

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 125/229 (55%), Gaps = 6/229 (3%)
 Frame = -1

Query  789  CQQNFS-SRASYYKTNDEMGNPNGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQV  613
            C   F+ S+A+YY  +D+ G  NGACGYG +G   N G+V A +S L++NG  CGACYQV
Sbjct  28   CSNCFTQSKAAYYPNSDKEGTENGACGYGSFGATLNGGDVSA-ASNLYRNGVGCGACYQV  86

Query  612  RCKSSGLCSDLGEKVMATDYVEGQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRR  433
            RC +S  CS  G  ++ TD      TDFILS  AF  + +       L   G V +E+RR
Sbjct  87   RCTNSNYCSTNGVTIVITDSGASDNTDFILSQHAFAEMGQTADAGASLLALGWVGIEYRR  146

Query  432  VSCNSAAK-LRVKIHDNSQYPHYLSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAV  256
            VSC+   K +  KI ++S +P+YL+  +    G  DI AV++ E   +    + R+ GAV
Sbjct  147  VSCSYPNKNITFKIDESSNFPYYLAFEIWYLQGNQDITAVQLCETVNFTCKLLERSHGAV  206

Query  255  WDLANPPSGELRVRFLVSSSAAAR--WVESEKAIIPAEWKAGLTIETNI  115
            W + +PPSG L VR L+S        W+      I   W AG   ++ +
Sbjct  207  WAVVSPPSGPLSVRMLLSGGDDGDDAWLVPTNN-ISQNWTAGAIYDSGV  254



>ref|XP_010514920.1| PREDICTED: expansin-like A3 [Camelina sativa]
Length=263

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 121/201 (60%), Gaps = 3/201 (1%)
 Frame = -1

Query  711  YGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVEGQETD  532
            YG    +  AG +      ++K+GA CGAC+QVRCK+  LC+  G  VM TD   G +TD
Sbjct  46   YGSMATSFFAGHIAGAIPSIYKDGAGCGACFQVRCKNPKLCTSKGTIVMVTDLNTGSQTD  105

Query  531  FILSYRAFTALAKQPRMAE-FLTEKGAVDVEFRRVSCNSAAK-LRVKIHDNSQYPHYLSI  358
             +LS RAF A+AK    A+ +L ++G VDVE++RV CN   + L V++ + S+ P+YL+I
Sbjct  106  LVLSSRAFRAMAKPGSGADKYLLKQGIVDVEYQRVPCNYGKRNLHVRVEEASKKPNYLAI  165

Query  357  LLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAARWV  178
             L  QGG +++  ++I +  + QW  M R+ GAVW     P+G L+ RF V+     + V
Sbjct  166  KLLYQGGQTEVVGIDIAQVGSSQWSYMTRSHGAVWATDKVPTGALQFRFTVTGGYDGKTV  225

Query  177  ESEKAIIPAEWKAGLTIETNI  115
             +++ ++PA WKAG   +  +
Sbjct  226  WAKR-VLPASWKAGRIYDAGV  245



>ref|XP_010690676.1| PREDICTED: expansin-like A3 [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 1/204 (0%)
 Frame = -1

Query  726  NGACGYGDYGRNTNAGEVCAVSSRLFKNGAACGACYQVRCKSSGLCSDLGEKVMATDYVE  547
            +G+CGYG    N N G + A    L+K GA CGAC++VRCK  GLC   G  VM  D   
Sbjct  37   SGSCGYGPLALNFNGGLLAAGQPSLYKEGAGCGACFKVRCKHPGLCRSQGTTVMLADSHG  96

Query  546  GQETDFILSYRAFTALAKQPRMAEFLTEKGAVDVEFRRVSCNSAAKLRVKIHDNSQYPHY  367
                DF+L+ +A   +A +   +E L + G VD+E++RV C     L +++ + S  P+Y
Sbjct  97   DSSRDFVLNKKAMITMANKGH-SENLLKLGVVDIEYKRVPCYYRGNLALRVEEASNKPYY  155

Query  366  LSILLTNQGGASDIFAVEIYEEETYQWISMRRAFGAVWDLANPPSGELRVRFLVSSSAAA  187
            L+I +  QGG ++I AV++    +  W  MRR  GAVWD     SG L+ RFLV+S    
Sbjct  156  LAIKILYQGGQTEITAVDVAMVGSRNWNPMRRTHGAVWDAQKMLSGPLKFRFLVNSGFYY  215

Query  186  RWVESEKAIIPAEWKAGLTIETNI  115
            R     + ++P+ W++G+T +  I
Sbjct  216  RKYYETRYVLPSNWRSGVTYDAGI  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2009378593860