BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31631_g1_i1 len=372 path=[1:0-371]

Length=372
                                                                      Score     E

gb|AFN85539.1|  proteinase inhibitor type-2                           74.3    1e-14   
ref|XP_009787056.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     66.2    1e-11   
emb|CDP20849.1|  unnamed protein product                              64.3    6e-11   
emb|CDP10656.1|  unnamed protein product                              62.8    2e-10   
ref|XP_009786451.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     61.6    9e-10   
ref|XP_009609049.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     61.6    9e-10   
emb|CDP10659.1|  unnamed protein product                              60.1    3e-09   
ref|XP_006361191.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  59.7    4e-09   
ref|XP_009768792.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     59.3    5e-09   
ref|XP_006361202.1|  PREDICTED: uncharacterized protein LOC102586215  60.5    6e-09   
ref|XP_004241960.1|  PREDICTED: proteinase inhibitor PSI-1.2          58.9    7e-09   
emb|CDP10662.1|  unnamed protein product                              57.8    2e-08   
ref|XP_006357816.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  57.0    8e-08   
gb|AAL36458.1|AF174381_1  proteinase inhibitor IIa                    57.0    9e-08   Solanum americanum
ref|XP_004299887.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  55.8    1e-07   
gb|ADP05506.1|  serine proteinase inhibitor 2c-R2                     56.2    1e-07   
ref|XP_009598289.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     55.1    2e-07   
ref|XP_006361318.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  55.1    2e-07   
ref|XP_006368155.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  55.5    2e-07   
gb|ADP05504.1|  serine proteinase inhibitor 2a                        55.5    3e-07   
emb|CDP10660.1|  unnamed protein product                              52.8    1e-06   
ref|XP_006351573.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  53.9    1e-06   
gb|AIT75805.1|  Pin-II type proteinase inhibitor 69                   53.1    2e-06   
ref|XP_010521150.1|  PREDICTED: proteinase inhibitor PSI-1.2 isof...  52.0    2e-06   
gb|AIT75816.1|  Pin-II type proteinase inhibitor 70                   53.1    2e-06   
gb|AIT75806.1|  Pin-II type proteinase inhibitor 79                   53.1    3e-06   
gb|AIT75808.1|  Pin-II type proteinase inhibitor 71                   52.8    3e-06   
dbj|BAA95792.1|  proteinase inhibitor II                              51.2    3e-06   Nicotiana tabacum [American tobacco]
ref|XP_004304861.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  51.6    3e-06   
gb|EPS62184.1|  hypothetical protein M569_12608                       50.8    6e-06   
ref|NP_001234246.1|  proteinase inhibitor type-2 CEVI57 precursor     52.0    7e-06   
gb|AAS82779.1|  proteinase inhibitor II                               50.1    8e-06   Solanum americanum
ref|XP_006368124.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  50.4    9e-06   
ref|XP_006362682.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  52.8    1e-05   
gb|ABA42891.1|  trypsin proteinase inhibitor precursor                50.8    1e-05   Nicotiana cavicola
ref|XP_010521149.1|  PREDICTED: proteinase inhibitor PSI-1.2 isof...  49.3    2e-05   
ref|XP_009600456.1|  PREDICTED: wound-induced proteinase inhibito...  51.6    2e-05   
ref|XP_004516042.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  48.5    3e-05   
gb|ABA42894.1|  trypsin proteinase inhibitor precursor                51.2    4e-05   Nicotiana megalosiphon
sp|P83241.1|IP23_CAPAN  RecName: Full=Proteinase inhibitor PSI-1.2    47.8    4e-05   Capsicum annuum
ref|XP_010317560.1|  PREDICTED: proteinase inhibitor type-2 P303....  50.1    4e-05   
sp|P01080.2|IP2K_SOLTU  RecName: Full=Proteinase inhibitor type-2...  49.3    4e-05   Solanum tuberosum [potatoes]
sp|Q00782.1|IP2X_SOLTU  RecName: Full=Proteinase inhibitor type-2...  49.3    4e-05   Solanum tuberosum [potatoes]
ref|XP_003566353.1|  PREDICTED: proteinase inhibitor PSI-1.2          47.4    8e-05   
ref|XP_002463922.1|  hypothetical protein SORBIDRAFT_01g008960        47.4    1e-04   Sorghum bicolor [broomcorn]
gb|AAW71990.1|  proteinase inhibitor IIb                              47.0    1e-04   Solanum americanum
gb|ABA42892.1|  trypsin proteinase inhibitor precursor                49.7    1e-04   Nicotiana benthamiana
ref|XP_004250426.1|  PREDICTED: wound-induced proteinase inhibito...  47.8    1e-04   
ref|XP_010521151.1|  PREDICTED: proteinase inhibitor PSI-1.2 isof...  47.0    1e-04   
sp|P05119.1|IP21_SOLLC  RecName: Full=Wound-induced proteinase in...  47.8    1e-04   Solanum lycopersicum
ref|XP_007227425.1|  hypothetical protein PRUPE_ppb022308mg           47.0    1e-04   
gb|AAL54921.2|AF209709_1  proteinase inhibitor IIb                    47.8    1e-04   Solanum americanum
ref|NP_001275441.1|  proteinase inhibitor II precursor                47.4    2e-04   
ref|XP_009787055.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     46.6    2e-04   
emb|CAC40750.1|  putative proteinase inhibitor II                     45.8    2e-04   Atropa belladonna [deadly nightshade]
ref|XP_009789362.1|  PREDICTED: proteinase inhibitor type-2           48.1    2e-04   
sp|Q40561.1|IP21_TOBAC  RecName: Full=Proteinase inhibitor type-2...  48.1    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_009615785.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     46.6    2e-04   
ref|XP_006350326.1|  PREDICTED: proteinase inhibitor type-2 TR8-like  47.0    2e-04   
gb|ABA42895.1|  trypsin proteinase inhibitor precursor                48.9    2e-04   Nicotiana simulans
gb|ABA42893.1|  trypsin proteinase inhibitor precursor                48.9    2e-04   Nicotiana occidentalis subsp. hesperis
ref|XP_004299886.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     45.8    3e-04   
gb|AFJ93093.1|  proteinase inhibitor II                               47.0    3e-04   
ref|XP_010315026.1|  PREDICTED: proteinase inhibitor type-2 P303....  46.6    3e-04   
sp|Q41435.1|IP2T_SOLTU  RecName: Full=Proteinase inhibitor type-2...  46.6    3e-04   Solanum tuberosum [potatoes]
ref|XP_010317559.1|  PREDICTED: proteinase inhibitor type-2 P303.51   47.0    3e-04   
sp|Q43652.1|IP27_SOLTU  RecName: Full=Proteinase inhibitor type-2...  46.6    3e-04   Solanum tuberosum [potatoes]
gb|AEH21811.1|  proteinase inhibitor II precursor type A-b            46.2    5e-04   
emb|CAA27409.1|  unnamed protein product                              45.4    6e-04   Solanum tuberosum [potatoes]
ref|XP_006351572.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  47.0    7e-04   



>gb|AFN85539.1| proteinase inhibitor type-2, partial [Olea europaea]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 7/78 (9%)
 Frame = -2

Query  254  ISKVWLLTLLL-CGIIVVGSMV-----EAKVCIQQCMEVAYTKCPPNF-KKIRPSCVNCC  96
            +SKV + TLLL CG+  +GS V     E K+C ++C+ V Y  CP +  +K+ PSC NCC
Sbjct  1    VSKVGIFTLLLICGLFFLGSNVNYAEAETKICTKECLNVGYMICPSSGPQKLHPSCTNCC  60

Query  95   TVKKGCKLYRASGSLICT  42
              +KGCKLYR+ G+LICT
Sbjct  61   RAQKGCKLYRSDGTLICT  78



>ref|XP_009787056.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris]
Length=90

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 4/84 (5%)
 Frame = -2

Query  278  YMLRIMGAISKVWLLTLLLCGIIVVGSMV---EAKVCIQQCM-EVAYTKCPPNFKKIRPS  111
            Y    M      +L  LLL G I++G+ V   + K C + C  +VAY  CP   +KI   
Sbjct  6    YQDNFMAIHRVAFLAILLLSGAILLGNKVKCADGKACTRNCDPDVAYMVCPSTRQKITKP  65

Query  110  CVNCCTVKKGCKLYRASGSLICTG  39
            CVNCC+ +KGCKL+R++GS+ CTG
Sbjct  66   CVNCCSARKGCKLFRSNGSVKCTG  89



>emb|CDP20849.1| unnamed protein product [Coffea canephora]
Length=79

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 6/78 (8%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIVVG---SMVEAKVCIQQCM-EVAYTKCPP-NFKKIRPSCVNCCT  93
            A +KV ++TLLLC  I++G       AKVC   C  EVAY  CPP  +KK+ P C NCC 
Sbjct  2    AGTKVGVITLLLCATILLGLKPEHASAKVCPFFCYAEVAYMTCPPAPYKKLGPVC-NCCL  60

Query  92   VKKGCKLYRASGSLICTG  39
             K GCKL+RA G++ICT 
Sbjct  61   AKPGCKLFRADGTVICTA  78



>emb|CDP10656.1| unnamed protein product [Coffea canephora]
Length=79

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 5/77 (6%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIVVG---SMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTV  90
            A +KV ++TLL C  I++G       AKVC   C + AY  CP P  KK+RP C NCC  
Sbjct  2    AGAKVGIITLLFCATILLGWKPEHASAKVCPLVCFKAAYMICPHPPHKKLRPVC-NCCLA  60

Query  89   KKGCKLYRASGSLICTG  39
            K  CKLYR  G++ICT 
Sbjct  61   KPHCKLYRHDGTVICTA  77



>ref|XP_009786451.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris]
 ref|XP_009800915.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris]
Length=84

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -2

Query  194  VEAKVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
            V AK C+Q C  EVAY  CP +  ++I P CVNCCT  +GCKL+R  GSLICTG
Sbjct  28   VNAKSCLQFCDNEVAYMTCPSSGDEQISPVCVNCCTADEGCKLFRTDGSLICTG  81



>ref|XP_009609049.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tomentosiformis]
 ref|XP_009609787.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tomentosiformis]
Length=96

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -2

Query  194  VEAKVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
            V AK C+Q C  EVAY  CP +  ++I P CVNCCT  +GCKL+R  GSLICTG
Sbjct  40   VNAKSCLQFCDNEVAYMTCPSSGDEQISPVCVNCCTADEGCKLFRTDGSLICTG  93



>emb|CDP10659.1| unnamed protein product [Coffea canephora]
Length=80

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 7/79 (9%)
 Frame = -2

Query  257  AISKVWLLTLLLCG-IIVVG---SMVEAKVCIQQCME-VAYTKCPP-NFKKIRPSCVNCC  96
            A +KV ++TLLLC   I++G    +  AKVC + C   VAY  CPP  +KK+ P C NCC
Sbjct  2    AGTKVGVITLLLCAATILLGLKPELASAKVCPRFCYAAVAYMTCPPAPYKKLGPVC-NCC  60

Query  95   TVKKGCKLYRASGSLICTG  39
              K GCKL+RA G++ICT 
Sbjct  61   MAKPGCKLFRADGTVICTA  79



>ref|XP_006361191.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=84

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = -2

Query  185  KVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
            K+C+Q C  EVAY  CP +  +KI   CVNCCT  +GCKLYRA GSLICTG
Sbjct  31   KMCLQVCDNEVAYMTCPSSGDEKITEVCVNCCTADEGCKLYRADGSLICTG  81



>ref|XP_009768792.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris]
Length=73

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 5/65 (8%)
 Frame = -2

Query  215  IIVVGSMVE---AKVCIQQCM-EVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSL  51
            +  +GS VE   AK C+Q+C  EV Y  CP +  +KI P+C NCC  + GCKL+RA GSL
Sbjct  1    MFFLGSKVENANAKACLQKCNNEVEYMTCPSSGDEKIMPTCTNCCLAEVGCKLFRADGSL  60

Query  50   ICTGK  36
            IC G 
Sbjct  61   ICVGN  65



>ref|XP_006361202.1| PREDICTED: uncharacterized protein LOC102586215 [Solanum tuberosum]
Length=195

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = -2

Query  185  KVCIQQCM-EVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
            K+C+Q C  EVAY  CP +  ++I P CVNCCT  +GCKL+RA GSLICTG
Sbjct  142  KMCLQVCDDEVAYMTCPSSGDEQISPVCVNCCTAGEGCKLFRADGSLICTG  192



>ref|XP_004241960.1| PREDICTED: proteinase inhibitor PSI-1.2 [Solanum lycopersicum]
Length=84

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = -2

Query  185  KVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
            K+C+Q C  EVAY  CP +  +KI   CVNCCT  +GCKLYRA GSLICTG
Sbjct  31   KMCLQVCDNEVAYMTCPSSGDEKISGVCVNCCTADEGCKLYRADGSLICTG  81



>emb|CDP10662.1| unnamed protein product [Coffea canephora]
Length=95

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 8/94 (9%)
 Frame = -2

Query  329  IKLFHFAHKHTL-RQAKPYMLRIMGAISKVWLLTLLLCGIIVVG-SMVEAKVCIQQCMEV  156
            I L  F  K    RQ    + R+ G      ++ +LLCG+I++G + VE + C Q C++V
Sbjct  3    ISLSSFKSKQGFGRQGIMAINRMNG------VMAILLCGMILLGGANVEVEACPQYCLDV  56

Query  155  AYTKCPPNFKKIRPSCVNCCTVKKGCKLYRASGS  54
             Y  C  +  K  PSC+NCC   KGC L+ A G+
Sbjct  57   EYMTCGNSGTKQYPSCINCCLAPKGCTLHLADGT  90



>ref|XP_006357816.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=145

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = -2

Query  263  MGAISKVWLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            M A    ++  LL+ G+ ++ + V+AKVC + C    Y  CP       +P C NCC+  
Sbjct  1    MAAHKVSFIACLLVLGMFLLVNTVDAKVCPRICGNFGYGLCPRSEGSPEKPICTNCCSGY  60

Query  86   KGCKLYRASGSLICTGK*EKRKKKN  12
            KGCK Y A+G L+C G+ + R   +
Sbjct  61   KGCKYYSANGDLVCEGESDPRNPND  85



>gb|AAL36458.1|AF174381_1 proteinase inhibitor IIa [Solanum americanum]
Length=148

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (53%), Gaps = 3/85 (4%)
 Frame = -2

Query  257  AISKVWLLT--LLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            A+ KV  L   L+L  + ++   V+AK C ++C   +Y  CP       +P C NCC+  
Sbjct  2    AVHKVSFLACLLVLGWMFLLAKHVDAKACTRECGHFSYGICPRSEGSPQKPICTNCCSGY  61

Query  86   KGCKLYRASGSLICTGK*EKRKKKN  12
            KGC  Y A G LIC G+ + R  K+
Sbjct  62   KGCNYYSAKGDLICEGESDPRNPKD  86



>ref|XP_004299887.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Fragaria 
vesca subsp. vesca]
Length=80

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -2

Query  239  LLTLLLCGIIVVG-SMVEAKVCIQQCMEVAYTKCPPN-FKKIRPSCVNCCTVKK-GCKLY  69
            ++ LL+CG I++G +  EAKVCIQ C E AY  CP +    + PSC NCC   + GC +Y
Sbjct  10   IVLLLVCGSILLGMNPTEAKVCIQVCYEAAYMTCPSSGSTHLSPSC-NCCLAPEVGCSIY  68

Query  68   RASGSLICTG  39
             + G+ ICTG
Sbjct  69   NSDGTKICTG  78



>gb|ADP05506.1| serine proteinase inhibitor 2c-R2 [Solanum nigrum]
Length=155

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIVVGSMVEAKVCIQQC-MEVAYTKCP-PNFKKIRPSCVNCCTVKK  84
            AI KV LL  LL G+IV+GS  + K C ++C   +AY  CP    K+I   C NCC  KK
Sbjct  2    AIYKVALL--LLFGMIVLGSNADGKPCTRECDTRIAYGICPLSETKRINQICTNCCAGKK  59

Query  83   GCKLYRASGSLICTGK*E  30
            GC  +   G+ IC G+ E
Sbjct  60   GCMYFSNDGTFICEGESE  77



>ref|XP_009598289.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tomentosiformis]
Length=80

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -2

Query  194  VEAKVCIQQCM-EVAYTKCPPNFKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
             + K C + C  +VAY  CP   ++I   CVNCC+ +KGCKL+R++GS+ CTG
Sbjct  27   ADGKACTRNCDPDVAYMVCPSTGQRITKPCVNCCSARKGCKLFRSNGSVKCTG  79



>ref|XP_006361318.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=84

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = -2

Query  185  KVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
            K+C+Q C  EVAY  CP +  +K+   CVNCCT  +GCKL+RA GSLICT
Sbjct  31   KMCLQVCDNEVAYMTCPSSGDEKMTEVCVNCCTADEGCKLFRADGSLICT  80



>ref|XP_006368155.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like, partial [Solanum 
tuberosum]
Length=122

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G  +E K C Q+C   VAY  CP +   K+   CVNCCT  +GCKLY   GSL+CT
Sbjct  55   FVCEGESIEPKGCTQECDPRVAYMTCPSSGLAKLNEVCVNCCTAGEGCKLYEHDGSLLCT  114

Query  41   GK  36
            G+
Sbjct  115  GE  116



>gb|ADP05504.1| serine proteinase inhibitor 2a [Solanum nigrum]
 gb|ADP05505.1| serine proteinase inhibitor 2a [Solanum nigrum]
Length=147

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (52%), Gaps = 3/85 (4%)
 Frame = -2

Query  257  AISKVWLLT--LLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            A+ KV  L   L+L  + ++   V+AK C ++C   +Y  CP       +P C NCC+  
Sbjct  1    AVHKVSFLACLLVLGWMFLLAKHVDAKACTRECGHFSYGICPRSEGSPEKPICTNCCSGY  60

Query  86   KGCKLYRASGSLICTGK*EKRKKKN  12
            KGC  Y A G LIC G+ + R   +
Sbjct  61   KGCNYYSAKGDLICEGESDPRNPND  85



>emb|CDP10660.1| unnamed protein product [Coffea canephora]
Length=77

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 5/72 (7%)
 Frame = -2

Query  257  AISKV-WLLTLLLCGIIVVGSMVEAKV---CIQQCMEVAYTKCPPNFKKIRPSCVNCCTV  90
            AIS++  ++ +LLCG+I++ S VE KV   C Q C++V Y  C  +  K+ P C NCC  
Sbjct  2    AISRINGVMAILLCGMILLSSNVEVKVVEACPQYCLDVEYMTCGNSETKLPPRC-NCCLA  60

Query  89   KKGCKLYRASGS  54
             KGC L+ A G+
Sbjct  61   PKGCTLHLADGT  72



>ref|XP_006351573.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=205

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G  +E K C  +C   VAY  CP +   KI   CVNCCT  +GCKLY   GSLICT
Sbjct  136  FVCEGESIEPKACTLECDSRVAYMTCPSSGLAKIYQVCVNCCTAGEGCKLYGHDGSLICT  195

Query  41   GK  36
            G+
Sbjct  196  GE  197


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (49%), Gaps = 1/78 (1%)
 Frame = -2

Query  245  VWLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLY  69
             +LL L +   +      +AK C ++C  + Y  CP        P C NCC   KGC  Y
Sbjct  11   AYLLVLGMLLFVSAMEHADAKACTKECGNLGYGICPRSEGSPENPICTNCCAGYKGCNYY  70

Query  68   RASGSLICTGK*EKRKKK  15
             A+G+ IC G+ + +K K
Sbjct  71   SANGTFICEGESDPKKPK  88



>gb|AIT75805.1| Pin-II type proteinase inhibitor 69 [Capsicum annuum]
Length=199

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPP-NFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VAY  CP     KI+  CVNCCT  +GCKLY  +GSL+CT
Sbjct  131  FLCEGESTEPKACTLECDPRVAYMTCPSTGLAKIKDVCVNCCTAGEGCKLYGHNGSLLCT  190

Query  41   GK  36
            G+
Sbjct  191  GE  192


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 40/78 (51%), Gaps = 3/78 (4%)
 Frame = -2

Query  242  WLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCPPNFKKIR-PSCVNCCTVKKGCKLYR  66
            +L  LL+ GI +    V+ K C ++C  + Y  CP +      P C NCC   KGCK Y 
Sbjct  9    FLGYLLVLGIFL--HHVDGKACTRECGNLGYGICPRSEGSAEEPICTNCCAGYKGCKYYS  66

Query  65   ASGSLICTGK*EKRKKKN  12
            A G+ IC G+ + +  K 
Sbjct  67   ADGTFICEGESDPKNPKG  84



>ref|XP_010521150.1| PREDICTED: proteinase inhibitor PSI-1.2 isoform X2 [Tarenaya 
hassleriana]
Length=77

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIV---VGSMVEAKVCIQQCMEVAYTKCPPNFKKIRPSCVNCCTVK  87
            A++   +++L + G+I+   +GS   A+ C Q C++V Y  CP +  +  PS  NCC   
Sbjct  2    ALATNQMMSLFVLGVILAVGLGSAASARACPQYCLDVDYVTCPFSGNEELPSRCNCCMAP  61

Query  86   KGCKLYRASGSLI  48
            KGC L+ + GS I
Sbjct  62   KGCTLHLSDGSSI  74



>gb|AIT75816.1| Pin-II type proteinase inhibitor 70 [Capsicum annuum]
Length=199

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPP-NFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VAY  CP     KI+  CVNCCT  +GCKLY  +GSL+CT
Sbjct  131  FLCEGESTEPKACTLECDPRVAYMTCPSTGLAKIKDVCVNCCTAGEGCKLYGHNGSLLCT  190

Query  41   GK  36
            G+
Sbjct  191  GE  192


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 39/78 (50%), Gaps = 3/78 (4%)
 Frame = -2

Query  242  WLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYR  66
            +L  LL+ GI +    V+ K C ++C  + Y  CP        P C NCC   KGCK Y 
Sbjct  9    FLGYLLVLGIFL--HHVDGKACTRECGNLGYGICPRSEGSAEEPICTNCCAGYKGCKYYS  66

Query  65   ASGSLICTGK*EKRKKKN  12
            A G+ IC G+ + +  K 
Sbjct  67   ADGTFICEGESDPKNPKG  84



>gb|AIT75806.1| Pin-II type proteinase inhibitor 79 [Capsicum annuum]
Length=199

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPP-NFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VAY  CP     KI+  CVNCCT  +GCKLY  +GSL+CT
Sbjct  131  FLCEGESTEPKACTLECDPRVAYMTCPSTGLAKIKDVCVNCCTAGEGCKLYGHNGSLLCT  190

Query  41   GK  36
            G+
Sbjct  191  GE  192


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 40/78 (51%), Gaps = 3/78 (4%)
 Frame = -2

Query  242  WLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCPPNFKKIR-PSCVNCCTVKKGCKLYR  66
            +L  LL+ GI +    V+ K C ++C  + Y  CP +      P C NCC   KGCK Y 
Sbjct  9    FLGYLLVLGIFL--HHVDGKACTRECGNLGYGICPRSEGSAEEPICTNCCAGYKGCKYYS  66

Query  65   ASGSLICTGK*EKRKKKN  12
            A G+ IC G+ + +  K 
Sbjct  67   ADGTFICEGESDPKNPKG  84



>gb|AIT75808.1| Pin-II type proteinase inhibitor 71, partial [Capsicum annuum]
Length=181

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPP-NFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VAY  CP     KI+  CVNCCT  +GCKLY  +GSL+CT
Sbjct  113  FLCEGESTEPKACTLECDPRVAYMTCPSTGLAKIKDVCVNCCTAGEGCKLYGHNGSLLCT  172

Query  41   GK  36
            G+
Sbjct  173  GE  174


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (2%)
 Frame = -2

Query  197  MVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICTGK*EKRK  21
             V+ K C ++C  + Y  CP        P C NCC   KGCK Y A G+ IC G+ + + 
Sbjct  4    HVDGKACTRECGNLGYGICPRSEGSAEEPICTNCCAGYKGCKYYSADGTFICEGESDPKN  63

Query  20   KK  15
             K
Sbjct  64   PK  65



>dbj|BAA95792.1| proteinase inhibitor II [Nicotiana tabacum]
Length=45

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  161  EVAYTKCPPNFKKIRPSCVNCCTVKKGCKLYRASGSLICTG  39
            +VAY  CP   +KI   CVNCC+ KKGCKL+R++GS+ CTG
Sbjct  4    DVAYMVCPSTRQKITKPCVNCCSPKKGCKLFRSNGSVKCTG  44



>ref|XP_004304861.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Fragaria 
vesca subsp. vesca]
Length=79

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 4/69 (6%)
 Frame = -2

Query  239  LLTLLLCGIIVVG-SMVEAKVCIQQCMEVAYTKCPPN-FKKIRPSCVNCCTVKK-GCKLY  69
            ++ LL+CG I++G +  EAKVC Q C E AY  CP +    + PSC NCC     GC +Y
Sbjct  10   IILLLVCGSILLGMNPTEAKVCPQVCYEAAYMTCPSSGLTHLSPSC-NCCFAPAVGCSIY  68

Query  68   RASGSLICT  42
             + G+ ICT
Sbjct  69   NSDGTKICT  77



>gb|EPS62184.1| hypothetical protein M569_12608 [Genlisea aurea]
Length=73

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCMEVAYTKCPP-NFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
            I+++ ++  +K C   C + AY  CP    +K+ P+C NCC    GCK+Y A GSLIC+
Sbjct  14   ILIIAAVEGSKACYLICFDAAYMTCPSTGLQKLAPAC-NCCLAGSGCKIYAADGSLICS  71



>ref|NP_001234246.1| proteinase inhibitor type-2 CEVI57 precursor [Solanum lycopersicum]
 sp|Q43502.1|IP23_SOLLC RecName: Full=Proteinase inhibitor type-2 CEVI57; AltName: Full=Proteinase 
inhibitor type II CEVI57; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA64416.1| proteinase inhibitor II [Solanum lycopersicum]
Length=201

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G  +E K C ++C   VAY  CP +   K+   CVNCC+  +GCKLY   GSL+CT
Sbjct  133  FVCEGESIEPKGCTKECDPRVAYMTCPSSGLAKLNQVCVNCCSAGEGCKLYDNDGSLLCT  192

Query  41   GK  36
            G+
Sbjct  193  GE  194


 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 3/84 (4%)
 Frame = -2

Query  257  AISKV-WLLTLLLCGIIVVGSMVE-AKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            A+ KV +L  LL+ G+ ++ S VE A  C ++C  + Y  CP        P C NCC+  
Sbjct  2    AVYKVSFLAHLLVLGMYLLVSTVEHANACTKECGNLGYGICPGSEGSPENPICTNCCSGY  61

Query  86   KGCKLYRASGSLICTGK*EKRKKK  15
            KGC  Y A+G+ IC G  + +   
Sbjct  62   KGCNYYYANGTFICEGTSDPKNPN  85



>gb|AAS82779.1| proteinase inhibitor II, partial [Solanum americanum]
Length=76

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 3/74 (4%)
 Frame = -2

Query  257  AISKVWLLT--LLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            A+ KV  L   L+L  + ++   V+AK C ++C   +Y  CP       +P C NCC+  
Sbjct  2    AVHKVSFLACLLVLGWMFLLAKHVDAKACTRECGHFSYGICPRSEGSPQKPICTNCCSGY  61

Query  86   KGCKLYRASGSLIC  45
            KGC  Y A G LIC
Sbjct  62   KGCNYYSAKGDLIC  75



>ref|XP_006368124.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like, partial [Solanum 
tuberosum]
Length=86

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = -2

Query  257  AISKV-WLLTLLLCGIIVVGSMVEA-KVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            A+ KV +L  LL  G+ ++ S VE    C ++C  + Y  CP        P C NCC+  
Sbjct  2    ALYKVSFLAHLLFLGMFILVSRVEHVNACTKECGNLGYGICPGSEGSPENPICTNCCSGY  61

Query  86   KGCKLYRASGSLICTGK*EKRKKK  15
            KGC  Y A+G+ IC G  + +   
Sbjct  62   KGCNYYNANGTFICEGTSDPKNPN  85



>ref|XP_006362682.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=386

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQC-MEVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G  +E K C  +C   VAY  CP +   K+   CVNCCT  +GCKLY   GSLICT
Sbjct  136  FVCEGESIEPKACTLECDSRVAYMTCPSSGLAKLNQVCVNCCTAGEGCKLYGYDGSLICT  195

Query  41   GK  36
            G+
Sbjct  196  GE  197


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = -2

Query  257  AISKV-WLLTLLLCGIIVVGSMVEA-KVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVK  87
            A+ KV +L  LL  G+ ++ S VE    C ++C  + Y  CP        P C NCC+  
Sbjct  210  ALYKVSFLAHLLFLGMFILVSRVEHVNACTKECGNLGYGICPGSEGSPENPICTNCCSGY  269

Query  86   KGCKLYRASGSLICTGK*EKRKKK  15
            KGC  Y A+G+ IC G  + +   
Sbjct  270  KGCNYYNANGTFICEGTSDPKNPN  293



>gb|ABA42891.1| trypsin proteinase inhibitor precursor [Nicotiana cavicola]
Length=163

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -2

Query  257  AISKVWLLTLLLC-GIIVVGSMVE-AKVCIQQC-MEVAYTKCPP-NFKKIRPSCVNCCTV  90
            A+ +V  L LLL  G+ ++ S VE AK C ++C   +AY  CP    KK    C NCC+ 
Sbjct  2    AVHRVSFLALLLSFGMSLLVSNVEHAKACTRECDTRIAYGVCPRLEEKKNNRLCTNCCSG  61

Query  89   KKGCKLYRASGSLICTGK*EKRKKK  15
             KGC  + A G+ +C G+ + R  K
Sbjct  62   TKGCNYFSADGTFVCEGESDPRNPK  86



>ref|XP_010521149.1| PREDICTED: proteinase inhibitor PSI-1.2 isoform X1 [Tarenaya 
hassleriana]
Length=79

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIV---VGSMVEAKVCIQQCMEVAYTKCPPNFKKIRPSCVNCCTVK  87
            A +++  L +L  G+I+   +GS   A+ C Q C++V Y  CP +  +  PS  NCC   
Sbjct  4    ATNQMMSLFVLAKGVILAVGLGSAASARACPQYCLDVDYVTCPFSGNEELPSRCNCCMAP  63

Query  86   KGCKLYRASGSLI  48
            KGC L+ + GS I
Sbjct  64   KGCTLHLSDGSSI  76



>ref|XP_009600456.1| PREDICTED: wound-induced proteinase inhibitor 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=331

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 5/86 (6%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIVVGSMVE---AKVCIQQCM-EVAYTKCP-PNFKKIRPSCVNCCT  93
            A+ +V  L LLL G+ ++ S VE   AK C + C   +AY  CP    KK    C NCC 
Sbjct  2    AVHRVSFLALLLFGMSLLVSNVEYADAKACPRNCDGRIAYGICPRSEEKKDNQICTNCCA  61

Query  92   VKKGCKLYRASGSLICTGK*EKRKKK  15
              KGC  + A G+ +C G+ + R  K
Sbjct  62   GTKGCNYFSADGTFVCEGESDPRNPK  87



>ref|XP_004516042.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Cicer arietinum]
Length=79

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = -2

Query  239  LLTLLLCGIIVVG---SMVEAKVCIQQCMEVA-YTKCPPN-FKKIRPSCVNCCTVKKGCK  75
            +L +L+ G I++G   + V+AKVC   C + A Y  CP +  + + P C NCC    GCK
Sbjct  8    ILLVLVFGAILLGGNLNFVDAKVCPLICYDSAGYMTCPSSGDQHLSPPC-NCCLASTGCK  66

Query  74   LYRASGSLICT  42
            +Y+A G+LICT
Sbjct  67   IYKADGTLICT  77



>gb|ABA42894.1| trypsin proteinase inhibitor precursor [Nicotiana megalosiphon]
Length=330

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -2

Query  257  AISKVWLLTLLLC-GIIVVGSMVE-AKVCIQQC-MEVAYTKCPPNFKKIRPS-CVNCCTV  90
            A+ +V  L LLL  G+ ++ S VE AK C ++C   +AY  CP   +K     C NCC  
Sbjct  2    AVHRVSFLALLLSFGMSLLVSNVEHAKACTRECDTRIAYGVCPRLEEKTNNRICTNCCAG  61

Query  89   KKGCKLYRASGSLICTGK*EKRKKK  15
            KKGCK + A G+ +C G+ + R  K
Sbjct  62   KKGCKYFSADGTFVCEGESDPRNPK  86



>sp|P83241.1|IP23_CAPAN RecName: Full=Proteinase inhibitor PSI-1.2 [Capsicum annuum]
Length=52

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -2

Query  185  KVCIQQC-MEVAYTKCPPNFKKI-RPSCVNCCTVKKGCKLYRASGSLICTG  39
            K C + C  ++AY  CP + ++I R  C NCC  +KGCKL+R++GS+ CTG
Sbjct  1    KACPRNCDTDIAYMVCPSSGERIIRKVCTNCCAAQKGCKLFRSNGSIKCTG  51



>ref|XP_010317560.1| PREDICTED: proteinase inhibitor type-2 P303.51-like [Solanum 
lycopersicum]
Length=206

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 34/62 (55%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPPN-FKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VAY  CP +   K+   CVNCCT   GCKLY   GSLICT
Sbjct  137  FVCEGESDEPKACTMECDPRVAYMICPSSGLAKLSQVCVNCCTAGDGCKLYGYDGSLICT  196

Query  41   GK  36
            G+
Sbjct  197  GE  198



>sp|P01080.2|IP2K_SOLTU RecName: Full=Proteinase inhibitor type-2 K; AltName: Full=Proteinase 
inhibitor type II K; Short=IIK; Contains: RecName: 
Full=Proteinase inhibitor PCI-1; AltName: Full=Proteinase inhibitor 
PCI-I; Flags: Precursor [Solanum tuberosum]
 gb|AAA33815.1| inhibitor II-chloramphenicol acetyltransferase [Solanum tuberosum]
 prf||1303362A inhibitor II
Length=153

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = -2

Query  194  VEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICTGK*EKRKK  18
            V+AK CI++C  + +  CP        P C NCC   KGC  Y A+G+ IC G+ + +K 
Sbjct  28   VDAKACIRECGNLGFGICPRSEGSPENPICTNCCAGYKGCNYYSANGAFICEGQSDPKKP  87

Query  17   K  15
            K
Sbjct  88   K  88



>sp|Q00782.1|IP2X_SOLTU RecName: Full=Proteinase inhibitor type-2; AltName: Full=Proteinase 
inhibitor type II; Flags: Precursor [Solanum tuberosum]
 emb|CAA78277.1| proteinase inhibitor II [Solanum tuberosum]
Length=158

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = -2

Query  245  VWLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLY  69
             +LL L +   +     V+AK C  +C  + Y  CP        P C NCC   KGC  Y
Sbjct  11   AYLLVLGMLLFVSAMEHVDAKACTLECGNLGYGICPRSEGSPENPICTNCCAGYKGCNYY  70

Query  68   RASGSLICTGK*EKRKKK  15
             A+G+ IC G+   +  K
Sbjct  71   SANGTFICEGQSHPKNPK  88



>ref|XP_003566353.1| PREDICTED: proteinase inhibitor PSI-1.2 [Brachypodium distachyon]
Length=79

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = -2

Query  230  LLLCGIIVVG----SMVEAKVCIQQCMEVAYTKCPPNFKKIRPSCVNCCTVKKGCKLYRA  63
            LLL G +++G    + +EA  C Q C+EV YT CP +  +  P+  NCC   KGC L+ +
Sbjct  12   LLLFGAVLLGQDGKAGMEAVACPQYCLEVEYTTCPSSGSEKLPARCNCCMAPKGCTLHLS  71

Query  62   SGS  54
             G+
Sbjct  72   DGT  74



>ref|XP_002463922.1| hypothetical protein SORBIDRAFT_01g008960 [Sorghum bicolor]
 gb|EER90920.1| hypothetical protein SORBIDRAFT_01g008960 [Sorghum bicolor]
Length=91

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 12/86 (14%)
 Frame = -2

Query  275  MLRIMGAISKVWLLTLLLCGIIVVGSMV-------EAKVCIQQCMEVAYTKCPPNFK-KI  120
            M  I    S++  + LLLCG+IV+GS+        + KVCI+ C E  Y  CP     K+
Sbjct  1    MATIKACSSRLVPVALLLCGLIVMGSISGLEAKDKDGKVCIETCQEAYYMTCPSTGNAKL  60

Query  119  RPSCVNCCTV---KKGCKLYRASGSL  51
             P+C NCC     + GC +Y   G++
Sbjct  61   NPAC-NCCLASLKEDGCTIYLKDGTV  85



>gb|AAW71990.1| proteinase inhibitor IIb [Solanum americanum]
Length=81

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -2

Query  257  AISKVWLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKG  81
            +++ + +L L+   +  V   V+AK C ++C  + Y  CP        P C NCC+  KG
Sbjct  9    SLAYLLVLGLMFLHVSAV-KHVDAKPCTRECGNLGYGICPRSEGSPENPICTNCCSGYKG  67

Query  80   CKLYRASGSLICTG  39
            C  Y A+G+ IC G
Sbjct  68   CNYYSANGTFICEG  81



>gb|ABA42892.1| trypsin proteinase inhibitor precursor [Nicotiana benthamiana]
Length=279

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -2

Query  257  AISKVWLLTLLLC-GIIVVGSMVE-AKVCIQQC-MEVAYTKCPPNFKKIRPS-CVNCCTV  90
            A+ +V  L LLL  G+ ++ S VE AK C ++C   +AY  CP   +K     C NCC  
Sbjct  2    AVHRVSFLALLLFFGMSLLVSNVEHAKACTRECDTRIAYGVCPRLEEKTNNRICTNCCAG  61

Query  89   KKGCKLYRASGSLICTGK*EKRKKK  15
            KKGCK +   G+ +C G+ + R  K
Sbjct  62   KKGCKYFSDDGTFVCEGESDPRNPK  86



>ref|XP_004250426.1| PREDICTED: wound-induced proteinase inhibitor 2-like [Solanum 
lycopersicum]
Length=146

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -2

Query  257  AISKVWLLTL--LLCGIIVVGSMVEA-KVCIQQCM-EVAYTKCP-PNFKKIRPSCVNCCT  93
            A +KV LL L  +  G +++ S V+A   C + C   + Y +CP    KK +  C NCC+
Sbjct  2    AFNKVALLILFAIFAGTVLLLSEVDAANACPRNCNPSIQYGRCPKSGNKKFKVGCTNCCS  61

Query  92   VKKGCKLYRASGSLICTGK  36
              +GC  Y A+G+ IC G+
Sbjct  62   GTEGCNYYSANGTFICEGQ  80



>ref|XP_010521151.1| PREDICTED: proteinase inhibitor PSI-1.2 isoform X3 [Tarenaya 
hassleriana]
Length=73

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = -2

Query  212  IVVGSMVEAKVCIQQCMEVAYTKCPPNFKKIRPSCVNCCTVKKGCKLYRASGSLI  48
            + +GS   A+ C Q C++V Y  CP +  +  PS  NCC   KGC L+ + GS I
Sbjct  16   VGLGSAASARACPQYCLDVDYVTCPFSGNEELPSRCNCCMAPKGCTLHLSDGSSI  70



>sp|P05119.1|IP21_SOLLC RecName: Full=Wound-induced proteinase inhibitor 2; AltName: 
Full=Wound-induced proteinase inhibitor II; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34201.1| wound-induced proteinase inhibitor II prepeptide [Solanum lycopersicum]
 gb|AAG12170.1| proteinase inhibitor II [Solanum lycopersicum]
 dbj|BAC76901.1| protease inhibitor II [Solanum lycopersicum]
 gb|AAN05016.1| proteinase inhibitor II [Solanum lycopersicum]
Length=148

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 6/86 (7%)
 Frame = -2

Query  263  MGAISKVWLLTLLLCGIIVVGSM--VEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCT  93
            M    +V  +  LL   IV+G    V+AK C ++C  + +  CP      + P C+NCC+
Sbjct  1    MAVHKEVNFVAYLL---IVLGMFLYVDAKACTRECGNLGFGICPRSEGSPLNPICINCCS  57

Query  92   VKKGCKLYRASGSLICTGK*EKRKKK  15
              KGC  Y + G  IC G+ + ++  
Sbjct  58   GYKGCNYYNSFGKFICEGESDPKRPN  83



>ref|XP_007227425.1| hypothetical protein PRUPE_ppb022308mg [Prunus persica]
 gb|EMJ28624.1| hypothetical protein PRUPE_ppb022308mg [Prunus persica]
Length=80

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = -2

Query  218  GIIVVG-SMVEAKVCIQQCMEVA-YTKCPPNFK-KIRPSCVNCCTVKKGCKLYRASGSLI  48
            G I++G +   AK+C Q C + A Y  CP +   ++ PSC NCC    GC LYRA G+ I
Sbjct  18   GSILLGINPSTAKICPQYCTDQAGYMTCPSSGNTQLSPSC-NCCLAPAGCTLYRADGTSI  76

Query  47   CTG  39
            CTG
Sbjct  77   CTG  79



>gb|AAL54921.2|AF209709_1 proteinase inhibitor IIb [Solanum americanum]
Length=152

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = -2

Query  269  RIMGAISKVWLLTLLLCGIIVVGSMVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCT  93
            + + +++ + +L L+   +  V   V+AK C ++C  + Y  CP        P C NCC+
Sbjct  5    KEVSSLAYLLVLGLMFLHVSAV-KHVDAKPCTRECGNLGYGICPRSEGSPENPICTNCCS  63

Query  92   VKKGCKLYRASGSLICTGK*EKRKKK  15
              KGC  Y A+G+ IC G  + +   
Sbjct  64   GYKGCNYYSANGTFICEGSSDPKNPN  89



>ref|NP_001275441.1| proteinase inhibitor II precursor [Solanum tuberosum]
 gb|AAZ94181.1| proteinase inhibitor II precursor [Solanum tuberosum]
Length=154

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 6/81 (7%)
 Frame = -2

Query  245  VWLLTLLLCGIIVVGSMVE---AKVCIQQCMEVAYTKCPP-NFKKIRPSCVNCCTVKKGC  78
             +LL +L  GI ++ S+VE   AK C  +C  + +  CP        P C+NCC+  KGC
Sbjct  11   AYLLIVL--GIFLLVSVVEHVDAKACTLECGNLGFGICPRLEGSPTNPICINCCSGYKGC  68

Query  77   KLYRASGSLICTGK*EKRKKK  15
              Y A G  IC G+ + +  K
Sbjct  69   NYYSAFGRFICEGESDPKNPK  89



>ref|XP_009787055.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris]
Length=87

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 10/83 (12%)
 Frame = -2

Query  257  AISKV-WLLTLLLCGIIVVGSMV-----EAKVCIQQCM-EVAYTKCPPNF---KKIRPSC  108
            AI KV +L  LLL G  V+GS +     E K C + C+ + AY  CP      K I   C
Sbjct  2    AIHKVGFLALLLLFGTHVLGSKMATAAEEEKSCPRDCISDAAYMVCPTRHGRHKLIESYC  61

Query  107  VNCCTVKKGCKLYRASGSLICTG  39
             NCCT+ + CKL++ +G LICTG
Sbjct  62   DNCCTLPENCKLFKENGDLICTG  84



>emb|CAC40750.1| putative proteinase inhibitor II [Atropa belladonna]
Length=46

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = -2

Query  161  EVAYTKCPPNFKKI-RPSCVNCCTVKKGCKLYRASGSLICTG  39
            EVAY  CP +  +I +P CVNCC+ +KGCKL+  +GS+ CTG
Sbjct  4    EVAYMVCPSSGHRIIKPVCVNCCSARKGCKLFCNNGSVKCTG  45



>ref|XP_009789362.1| PREDICTED: proteinase inhibitor type-2 [Nicotiana sylvestris]
Length=197

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 31/61 (51%), Gaps = 2/61 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VA   CP     KI   C+NCC   KGC+LY   GSLICT
Sbjct  130  FVCEGESDEPKSCTTECDPRVATISCPFSGLVKINQECINCCNADKGCELYDNDGSLICT  189

Query  41   G  39
            G
Sbjct  190  G  190



>sp|Q40561.1|IP21_TOBAC RecName: Full=Proteinase inhibitor type-2; AltName: Full=Proteinase 
inhibitor type II; Flags: Precursor [Nicotiana tabacum]
 emb|CAA82652.1| unnamed protein product [Nicotiana tabacum]
 gb|AIE54303.1| proteinase inhibitor II [Nicotiana tabacum]
Length=197

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 31/61 (51%), Gaps = 2/61 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C  +C   VA   CP     KI   C+NCC   KGC+LY   GSLICT
Sbjct  130  FVCEGESDEPKSCTTECDPRVATISCPFSGLVKINQECINCCNADKGCELYDNDGSLICT  189

Query  41   G  39
            G
Sbjct  190  G  190



>ref|XP_009615785.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana tomentosiformis]
Length=87

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = -2

Query  218  GIIVVGSMVEAKVCIQQCM-EVAYTKCPPNFKK---IRPSCVNCCTVKKGCKLYRASGSL  51
            G  +  +  E K C + C+ + AY  CP   ++   I   C NCCT+ + CKL++ +G L
Sbjct  21   GSKMATAAEEEKSCPRDCISDAAYMVCPTRHRQHKLIESYCDNCCTLPENCKLFKENGDL  80

Query  50   ICTG  39
            ICTG
Sbjct  81   ICTG  84



>ref|XP_006350326.1| PREDICTED: proteinase inhibitor type-2 TR8-like [Solanum tuberosum]
Length=146

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -2

Query  257  AISKVWLLTLL--LCGIIVVGSMVEAK-VCIQQCMEV-AYTKCP-PNFKKIRPSCVNCCT  93
            A +KV LL L     G I++ S V+A+  C + C  +  Y +CP    KK +  C NCC+
Sbjct  2    AFNKVALLILFAIFAGTILLLSQVDAEPACPRNCNPIIQYGRCPKSGNKKFKVGCTNCCS  61

Query  92   VKKGCKLYRASGSLICTGK  36
              +GC  + A+G+ IC G+
Sbjct  62   GTEGCNYFSANGTFICEGQ  80



>gb|ABA42895.1| trypsin proteinase inhibitor precursor [Nicotiana simulans]
Length=330

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -2

Query  257  AISKVWLLTLLLC-GIIVVGSMVE-AKVCIQQC-MEVAYTKCPPNFKKIRPS-CVNCCTV  90
            A+ +V  L LLL  G+ ++ S VE AK C ++C   +AY  CP   +K     C NCC  
Sbjct  2    AVHRVSFLALLLFFGMSLLVSNVEHAKACTRECDTRIAYGVCPRLEEKTNNRICTNCCAG  61

Query  89   KKGCKLYRASGSLICTGK*EKRKKK  15
            KKGCK +   G+ +C G+ + R  K
Sbjct  62   KKGCKYFSDDGTFVCEGESDPRNPK  86



>gb|ABA42893.1| trypsin proteinase inhibitor precursor [Nicotiana occidentalis 
subsp. hesperis]
Length=395

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -2

Query  257  AISKVWLLTLLLC-GIIVVGSMVE-AKVCIQQC-MEVAYTKCPPNFKKIRPS-CVNCCTV  90
            A+ +V  L LLL  G+ ++ S VE AK C ++C   +AY  CP   +K     C NCC  
Sbjct  2    AVHRVSFLALLLFFGMSLLVSNVEHAKACTRECDTRIAYGVCPRLEEKTNNRICTNCCAG  61

Query  89   KKGCKLYRASGSLICTGK*EKRKKK  15
            KKGCK +   G+ +C G+ + R  K
Sbjct  62   KKGCKYFSDDGTFVCEGESDPRNPK  86



>ref|XP_004299886.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Fragaria vesca 
subsp. vesca]
Length=80

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = -2

Query  251  SKVWLLTLLLCGIIVVGSM-VEAKVCIQQCMEVA-YTKCPPN-FKKIRPSCVNCCTVKKG  81
            S   +L LL+CG +++G +  EAKVC   C + A Y  CP +  +++ P C  C     G
Sbjct  6    SITAILLLLVCGSVILGVVPTEAKVCPFICYDAAAYMTCPSSGNEQLSPPCNCCLAPAPG  65

Query  80   CKLYRASGSLICT  42
            C LYRA G+ +CT
Sbjct  66   CALYRADGTRLCT  78



>gb|AFJ93093.1| proteinase inhibitor II [Solanum lycopersicum]
Length=148

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (49%), Gaps = 6/86 (7%)
 Frame = -2

Query  263  MGAISKVWLLTLLLCGIIVVGSM--VEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCT  93
            M    +V  +  LL   IV G    V+AK C ++C  + +  CP      + P C+NCC+
Sbjct  1    MAVQQEVNFVAYLL---IVHGMFLYVDAKACTRECGNLGFGICPRSEGSPLNPICINCCS  57

Query  92   VKKGCKLYRASGSLICTGK*EKRKKK  15
              KGC  Y + G  IC G+ + ++  
Sbjct  58   GYKGCNYYNSFGKFICEGESDPKRPN  83



>ref|XP_010315026.1| PREDICTED: proteinase inhibitor type-2 P303.51-like [Solanum 
lycopersicum]
Length=137

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (2%)
 Frame = -2

Query  197  MVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICTGK*EKRK  21
             V+A  C ++C  + +  CP        P C NCC   KGC  Y A G+ IC G+ + RK
Sbjct  28   HVDANSCTKECGHLGFGICPRSQGSPQNPICTNCCAGFKGCNYYSAHGTFICEGQSDPRK  87

Query  20   KK  15
             K
Sbjct  88   PK  89



>sp|Q41435.1|IP2T_SOLTU RecName: Full=Proteinase inhibitor type-2 T; AltName: Full=Proteinase 
inhibitor type II T; Flags: Precursor [Solanum tuberosum]
 gb|AAD09849.1| proteinase inhibitor II [Solanum tuberosum]
Length=147

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 42/86 (49%), Gaps = 6/86 (7%)
 Frame = -2

Query  263  MGAISKVWLLTLLLCGIIVVGSM--VEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCT  93
            M    +V  +  LL   IV+G    V+A  C ++C  + +  CP        P C+NCC+
Sbjct  1    MAVHKEVSFVAYLL---IVLGMFLYVDALGCTKECGNLGFGICPRSEGSPTNPICINCCS  57

Query  92   VKKGCKLYRASGSLICTGK*EKRKKK  15
              KGC  Y A G LIC G+ + +  K
Sbjct  58   GYKGCNYYSAFGDLICQGESDPKNPK  83



>ref|XP_010317559.1| PREDICTED: proteinase inhibitor type-2 P303.51 [Solanum lycopersicum]
Length=159

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (2%)
 Frame = -2

Query  197  MVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICTGK*EKRK  21
             V+AK C ++C  + +  CP        P C NCC   KGC  Y A G+ IC G+ + R 
Sbjct  28   HVDAKPCTKECGHLGFGICPRSQGSPQNPICTNCCAGFKGCNYYSAHGTFICEGQSDPRN  87

Query  20   KK  15
             K
Sbjct  88   PK  89



>sp|Q43652.1|IP27_SOLTU RecName: Full=Proteinase inhibitor type-2 CM7; AltName: Full=Proteinase 
inhibitor type II CM7; Flags: Precursor [Solanum 
tuberosum]
 emb|CAA55082.1| proteinase inhibitor II [Solanum tuberosum]
Length=154

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 6/81 (7%)
 Frame = -2

Query  245  VWLLTLLLCGIIVVGSMVE---AKVCIQQCMEVAYTKCPPNFKKIR-PSCVNCCTVKKGC  78
             +LL +L  GI ++ S+VE   AK+C ++C  + +  CP +    + P C+NCC+  KGC
Sbjct  11   AYLLIVL--GIFLLVSVVEHVDAKICTKECGNLGFGICPRSEGSPKNPICINCCSGYKGC  68

Query  77   KLYRASGSLICTGK*EKRKKK  15
              Y   G  IC G+ + +  K
Sbjct  69   NYYSVFGRFICEGESDLKNPK  89



>gb|AEH21811.1| proteinase inhibitor II precursor type A-b [Solanum tuberosum]
Length=154

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (52%), Gaps = 1/62 (2%)
 Frame = -2

Query  197  MVEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICTGK*EKRK  21
             V+AK C  +C  + +  CP        P C NCC   KGC  Y A+G+ IC G+ + +K
Sbjct  28   HVDAKACTLECGNLGFGICPRSEGSPENPICTNCCAGYKGCNYYSANGAFICEGQSDPKK  87

Query  20   KK  15
             K
Sbjct  88   PK  89



>emb|CAA27409.1| unnamed protein product [Solanum tuberosum]
Length=126

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 32/61 (52%), Gaps = 1/61 (2%)
 Frame = -2

Query  194  VEAKVCIQQCMEVAYTKCP-PNFKKIRPSCVNCCTVKKGCKLYRASGSLICTGK*EKRKK  18
            V+AK C  +C  + +  CP        P C NCC   KGC  Y A+G+ IC G+ + +K 
Sbjct  1    VDAKACTLECGNLGFGICPRSEGSPENPICTNCCAGYKGCNYYSANGAFICEGQSDPKKP  60

Query  17   K  15
            K
Sbjct  61   K  61



>ref|XP_006351572.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=225

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = -2

Query  215  IIVVGSMVEAKVCIQQCM-EVAYTKCPPNFKKIRPS-CVNCCTVKKGCKLYRASGSLICT  42
             +  G   E K C Q+C  +VAY  CP          CVNCCT K GC LY   GSLIC 
Sbjct  160  FVCEGKSDEPKGCSQECDPKVAYMTCPHTGSTYHTGVCVNCCTAKAGCNLYSRDGSLICI  219

Query  41   GK  36
            G 
Sbjct  220  GD  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510693543822