BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31596_g1_i1 len=736 path=[1:0-735]

Length=736
                                                                      Score     E

emb|CDP07485.1|  unnamed protein product                                272   5e-85   
ref|XP_009792964.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    270   2e-84   
ref|XP_011083655.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    269   2e-83   
ref|XP_011083654.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    268   8e-83   
gb|EPS63025.1|  hypothetical protein M569_11760                         263   2e-81   
ref|XP_009621350.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    262   3e-81   
ref|XP_006341966.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    259   2e-80   
ref|XP_004238270.2|  PREDICTED: inositol-pentakisphosphate 2-kinase     258   1e-79   
gb|EYU45129.1|  hypothetical protein MIMGU_mgv1a006036mg                253   1e-77   
gb|EYU32907.1|  hypothetical protein MIMGU_mgv1a006028mg                246   4e-75   
ref|XP_010539889.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    242   7e-74   
ref|XP_010539886.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    242   3e-73   
ref|XP_009365515.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    237   1e-71   
ref|XP_009365516.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    237   2e-71   
ref|XP_008377206.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    236   2e-71   
ref|XP_008347365.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    235   2e-71   
ref|XP_008347364.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    235   3e-71   
gb|KDP38543.1|  hypothetical protein JCGZ_04468                         235   8e-71   
ref|XP_007223293.1|  hypothetical protein PRUPE_ppa005582mg             234   2e-70   
ref|XP_008220840.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    234   3e-70   
ref|XP_009365518.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    236   4e-70   
ref|XP_008377208.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    235   6e-70   
ref|XP_010254762.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    233   6e-70   
ref|XP_007227480.1|  hypothetical protein PRUPE_ppa006527mg             231   8e-70   
ref|XP_008219053.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    231   3e-69   
ref|XP_008220842.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    232   1e-68   
ref|XP_010061286.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    229   2e-68   
ref|XP_010110041.1|  Inositol-pentakisphosphate 2-kinase                231   1e-67   
ref|XP_010673136.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    226   3e-67   
ref|XP_007017602.1|  Inositol-pentakisphosphate 2-kinase 1, putat...    224   3e-67   
ref|XP_010664715.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    225   5e-67   
ref|XP_007017601.1|  Inositol-pentakisphosphate 2-kinase family p...    223   9e-66   
ref|XP_008359763.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    224   9e-66   
ref|XP_002306883.1|  hypothetical protein POPTR_0005s25180g             221   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004291851.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    221   2e-65   
ref|XP_004152686.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    221   2e-65   
gb|KHN45871.1|  Inositol-pentakisphosphate 2-kinase                     221   3e-65   
emb|CAM33431.1|  Ins5P-2kinase                                          217   5e-65   Phaseolus vulgaris [French bean]
ref|XP_003523790.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    220   7e-65   
ref|XP_002302020.2|  hypothetical protein POPTR_0002s03430g             219   8e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002893210.1|  hypothetical protein ARALYDRAFT_313098             219   1e-64   
ref|XP_007160728.1|  hypothetical protein PHAVU_001G012200g             219   2e-64   
ref|XP_011048791.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    218   2e-64   
ref|NP_001237433.1|  inositol pentakisphosphate 2-kinase                219   2e-64   
ref|XP_007160729.1|  hypothetical protein PHAVU_001G012200g             219   4e-64   
ref|XP_006416232.1|  hypothetical protein EUTSA_v10007647mg             218   4e-64   
gb|ABK28408.1|  unknown                                                 217   7e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173629.2|  Inositol-pentakisphosphate 2-kinase family protein    216   8e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136627.1|  hypothetical protein PHAVU_009G060100g             217   9e-64   
ref|XP_011029078.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    219   1e-63   
ref|XP_008466533.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    216   1e-63   
ref|XP_008444741.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    216   1e-63   
gb|AGZ03654.1|  inositol pentakisphosphate 2-kinase                     215   5e-63   
ref|XP_003528009.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    214   7e-63   
ref|XP_010477465.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     214   1e-62   
gb|KHN22235.1|  Inositol-pentakisphosphate 2-kinase                     214   1e-62   
emb|CBI19737.3|  unnamed protein product                                214   1e-62   
ref|XP_006435038.1|  hypothetical protein CICLE_v10001170mg             213   1e-62   
ref|XP_004154853.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    213   2e-62   
ref|XP_010254756.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    214   2e-62   
ref|XP_004147852.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    212   5e-62   
ref|XP_006473539.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    211   7e-62   
ref|XP_010459951.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    211   1e-61   
emb|CDY41494.1|  BnaA08g20960D                                          211   2e-61   
ref|XP_009110150.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     211   2e-61   
gb|KHG30015.1|  Inositol-pentakisphosphate 2-kinase -like protein       211   2e-61   
ref|XP_010940107.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    209   4e-61   
ref|XP_010940105.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    210   5e-61   
ref|XP_006306470.1|  hypothetical protein CARUB_v10012434mg             209   5e-61   
ref|XP_010498671.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    208   2e-60   
ref|XP_008795957.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    206   3e-60   
ref|XP_008795956.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    207   3e-60   
tpg|DAA64565.1|  TPA: non-functional inositol-pentakisphosphate 2...    201   3e-60   
tpg|DAA64564.1|  TPA: non-functional inositol-pentakisphosphate 2...    200   4e-60   
ref|XP_008795949.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    207   4e-60   
ref|XP_004500990.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    207   6e-60   
tpg|DAA64566.1|  TPA: non-functional inositol-pentakisphosphate 2...    201   8e-60   
ref|XP_010540330.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    206   1e-59   
gb|AAF86558.1|AC069252_17  F2E2.17                                      206   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KHG28547.1|  Inositol-pentakisphosphate 2-kinase -like protein       206   5e-59   
tpg|DAA64567.1|  TPA: inositol-pentakisphosphate 2-kinase 450           202   3e-58   
ref|XP_006302305.1|  hypothetical protein CARUB_v10020353mg             201   3e-58   
gb|KEH36181.1|  inositol-pentakisphosphate 2-kinase-like protein        202   3e-58   
tpg|DAA64568.1|  TPA: inositol-pentakisphosphate 2-kinase 452           202   4e-58   
gb|KEH36180.1|  inositol-pentakisphosphate 2-kinase-like protein        201   5e-58   
emb|CAN76214.1|  hypothetical protein VITISV_009512                     204   3e-57   Vitis vinifera
tpg|DAA64569.1|  TPA: inositol-pentakisphosphate 2-kinase 555           202   4e-57   
ref|XP_004499187.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    198   1e-56   
ref|XP_009389920.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    197   2e-56   
ref|XP_002510425.1|  Inositol-pentakisphosphate 2-kinase, putative      202   2e-56   Ricinus communis
pdb|2XAL|A  Chain A, Lead Derivative Of Inositol 1,3,4,5,6-Pentak...    197   4e-56   
pdb|4AXE|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    197   4e-56   
pdb|4AQK|A  Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinas...    197   4e-56   
ref|XP_004499186.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    197   5e-56   
pdb|3UDS|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    197   7e-56   
ref|NP_568613.1|  inositol-pentakisphosphate 2-kinase 1                 196   9e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40178.1|  inositol-pentakisphosphate 2-kinase-like protein        195   2e-55   
gb|KEH40179.1|  inositol-pentakisphosphate 2-kinase-like protein        195   2e-55   
emb|CDY52373.1|  BnaA09g15720D                                          194   6e-55   
pdb|3UDZ|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    194   7e-55   
ref|XP_004499185.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    194   8e-55   
ref|XP_006403344.1|  hypothetical protein EUTSA_v10003206mg             192   2e-54   
pdb|4AXD|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    192   3e-54   
pdb|4AXC|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    192   3e-54   
ref|XP_009390180.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    192   3e-54   
ref|XP_009390179.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    191   4e-54   
ref|XP_009114034.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     191   6e-54   
ref|XP_010494238.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     191   7e-54   
pdb|4LV7|A  Chain A, Crystal Structure Of Inositol 1,3,4,5,6-pent...    191   1e-53   
ref|XP_002865479.1|  inositol-pentakisphosphate 2-kinase 1              189   3e-53   
emb|CDX95152.1|  BnaC09g17180D                                          189   4e-53   
ref|XP_010539888.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    187   7e-53   
ref|XP_006280454.1|  hypothetical protein CARUB_v10026386mg             188   9e-53   
ref|XP_010481940.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    187   2e-52   
gb|AHZ62755.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase           185   1e-51   
ref|XP_004168683.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    176   2e-51   
ref|XP_002888206.1|  hypothetical protein ARALYDRAFT_475379             182   2e-50   
gb|KFK31811.1|  hypothetical protein AALP_AA6G161800                    180   9e-50   
ref|XP_008795955.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    178   4e-49   
gb|ACF78888.1|  unknown                                                 170   2e-48   Zea mays [maize]
gb|ABK24850.1|  unknown                                                 177   3e-48   Picea sitchensis
tpg|DAA35552.1|  TPA: hypothetical protein ZEAMMB73_927289              175   2e-47   
ref|XP_010511060.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    172   6e-47   
ref|NP_001106063.1|  LOC100126363                                       171   2e-46   Zea mays [maize]
ref|NP_001183320.1|  uncharacterized protein LOC100501721               172   3e-46   
ref|XP_004960165.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    171   3e-46   
gb|AFW59740.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase iso...    170   3e-46   
ref|XP_010414720.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    169   7e-46   
dbj|BAJ91392.1|  predicted protein                                      169   8e-46   
ref|NP_001106053.1|  inositol polyphosphate 2-kinase                    169   1e-45   Zea mays [maize]
ref|XP_010414722.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    168   2e-45   
gb|EMT22168.1|  Inositol-pentakisphosphate 2-kinase                     169   3e-45   
emb|CDY00419.1|  BnaC07g14070D                                          163   3e-45   
dbj|BAG68917.1|  hypothetical protein                                   168   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500991.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    167   5e-45   
ref|NP_564736.1|  Inositol-pentakisphosphate 2-kinase-like protein      167   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827390.1|  hypothetical protein AMTR_s00011p00177280          166   1e-44   
ref|XP_010474037.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    166   1e-44   
ref|XP_002862989.1|  predicted protein                                  158   3e-44   
ref|XP_010240557.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     165   3e-44   
gb|AEM36353.1|  At1g59312                                               166   4e-44   
ref|NP_001054147.1|  Os04g0661200                                       164   9e-44   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67064.1|  H0112G12.9                                             164   1e-43   Oryza sativa [red rice]
ref|XP_006652958.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    163   2e-43   
ref|XP_010540332.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    159   3e-42   
ref|XP_010254763.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    155   2e-40   
ref|XP_001757602.1|  predicted protein                                  146   2e-37   
gb|AGW50727.1|  inositol pentakisphosphate 2-kinase                     138   3e-37   
ref|XP_010445901.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    146   3e-37   
gb|AGW50729.1|  inositol pentakisphosphate 2-kinase                     138   3e-37   
gb|AGW50722.1|  inositol pentakisphosphate 2-kinase                     137   9e-37   
ref|XP_001761338.1|  predicted protein                                  143   5e-36   
gb|AGW50731.1|  inositol pentakisphosphate 2-kinase                     132   4e-35   
ref|XP_002980010.1|  hypothetical protein SELMODRAFT_111972             136   2e-33   
ref|XP_002992945.1|  hypothetical protein SELMODRAFT_136205             135   2e-33   
ref|XP_008795958.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    126   2e-30   
ref|XP_006341967.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    120   5e-28   
gb|KDO84622.1|  hypothetical protein CISIN_1g0134841mg                  114   4e-26   
gb|KDO84619.1|  hypothetical protein CISIN_1g0134842mg                  103   3e-24   
dbj|BAB10637.1|  unnamed protein product                                108   4e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38844.1|  BnaC08g20180D                                          102   9e-22   
ref|XP_004353085.1|  inositol 1,3,4,5,6pentakisphosphate 2-kinase       100   8e-21   
gb|AFW59738.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase         97.1    4e-20   
ref|XP_004349251.1|  hypothetical protein CAOG_02501                  89.7    4e-17   
gb|AFW59739.1|  hypothetical protein ZEAMMB73_223578                  77.8    1e-14   
ref|XP_002507536.1|  inositol-pentakisphosphate 2-kinase              82.4    2e-14   Micromonas commoda
ref|XP_005832271.1|  hypothetical protein GUITHDRAFT_108933           81.6    2e-14   
ref|XP_003294485.1|  hypothetical protein DICPUDRAFT_43505            79.7    1e-13   
ref|XP_010765158.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   78.2    4e-13   
ref|XP_010743867.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  75.9    2e-12   
ref|XP_004351454.1|  hypothetical protein DFA_10812                   74.7    3e-12   
gb|KFH73726.1|  hypothetical protein MVEG_00940                       74.7    4e-12   
ref|XP_008318919.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   74.7    5e-12   
ref|XP_008289491.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   73.9    8e-12   
ref|XP_005469745.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  73.6    1e-11   
ref|XP_005469746.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  73.6    1e-11   
ref|XP_006783025.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  73.6    1e-11   
ref|XP_005917853.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  73.6    1e-11   
ref|XP_005749523.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  73.6    1e-11   
ref|XP_004547453.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  73.2    1e-11   
ref|XP_008406493.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   72.8    2e-11   
ref|XP_007575013.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   72.8    2e-11   
ref|XP_002671419.1|  predicted protein                                72.0    4e-11   Naegleria gruberi strain NEG-M
ref|XP_006631161.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  71.2    7e-11   
ref|XP_005813640.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  70.9    1e-10   
ref|XP_003973068.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  70.1    2e-10   
emb|CDQ90148.1|  unnamed protein product                              65.9    7e-10   
gb|ESA22216.1|  hypothetical protein GLOINDRAFT_91521                 68.2    7e-10   
gb|EXX69950.1|  hypothetical protein RirG_091860                      68.2    7e-10   
emb|CAF89733.1|  unnamed protein product                              66.2    3e-09   Tetraodon nigroviridis
gb|AAY79345.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase         65.1    8e-09   Danio rerio [leopard danio]
sp|Q4JL91.3|IPPK_DANRE  RecName: Full=Inositol-pentakisphosphate ...  64.7    9e-09   Danio rerio [leopard danio]
ref|NP_001014346.1|  inositol-pentakisphosphate 2-kinase              64.3    1e-08   Danio rerio [leopard danio]
ref|XP_636779.1|  hypothetical protein DDB_G0288351                   63.2    3e-08   Dictyostelium discoideum AX4
ref|XP_010873338.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  63.2    4e-08   
emb|CDP17915.1|  unnamed protein product                              61.6    4e-08   
ref|XP_010873347.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  63.2    4e-08   
ref|XP_004086208.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  62.4    6e-08   
emb|CBN74385.1|  conserved unknown protein                            60.5    3e-07   
ref|XP_003055988.1|  predicted protein                                60.1    4e-07   
ref|XP_007428725.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   58.9    9e-07   
ref|XP_009089470.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   58.9    1e-06   
ref|XP_003468284.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   58.2    1e-06   
ref|XP_003795089.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   58.5    1e-06   
ref|XP_005856254.1|  inositol-pentakisphosphate 2-kinase-like pro...  56.6    2e-06   
ref|XP_002193083.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   57.0    4e-06   Taeniopygia guttata
ref|XP_005320928.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   56.2    7e-06   
ref|XP_002927737.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  55.8    9e-06   
gb|EWM22690.1|  inositol-pentakisphosphate 2-kinase-like protein      55.8    9e-06   
gb|EFA81684.1|  hypothetical protein PPL_05678                        55.5    1e-05   Polysphondylium pallidum PN500
ref|XP_005408970.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  55.5    1e-05   
ref|XP_004647610.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   55.5    1e-05   
ref|XP_009492418.1|  hypothetical protein H696_00295                  55.5    1e-05   
ref|XP_005408971.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  55.5    1e-05   
ref|NP_001280251.1|  inositol-pentakisphosphate 2-kinase              55.5    1e-05   
ref|XP_002820003.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   55.5    1e-05   
ref|XP_004652359.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   55.1    2e-05   
gb|EDL98114.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase         55.1    2e-05   
gb|ELR51986.1|  Inositol-pentakisphosphate 2-kinase                   55.1    2e-05   
ref|XP_004898275.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   55.1    2e-05   
ref|XP_005901898.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   55.1    2e-05   
ref|NP_001008556.1|  inositol-pentakisphosphate 2-kinase              55.1    2e-05   Rattus norvegicus [brown rat]
ref|XP_002951880.1|  hypothetical protein VOLCADRAFT_105293           55.1    2e-05   
gb|ELV14098.1|  Inositol-pentakisphosphate 2-kinase                   54.7    2e-05   
ref|XP_005987157.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.7    2e-05   
ref|XP_005851212.1|  hypothetical protein CHLNCDRAFT_137903           55.1    2e-05   
ref|XP_010834294.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  54.7    2e-05   
ref|XP_007967932.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.7    2e-05   
ref|XP_003217705.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.7    2e-05   
ref|XP_001103030.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.7    2e-05   Macaca mulatta [rhesus macaque]
ref|XP_001623620.1|  predicted protein                                54.7    2e-05   Nematostella vectensis
ref|XP_005971608.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.7    3e-05   
ref|XP_010834292.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  54.3    3e-05   
ref|XP_009187460.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  54.3    3e-05   
ref|XP_004393629.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.3    3e-05   
ref|XP_006161538.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.3    3e-05   
ref|XP_010608886.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  54.3    3e-05   
ref|XP_003260534.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.3    3e-05   
ref|XP_541331.3|  PREDICTED: inositol-pentakisphosphate 2-kinase      54.3    3e-05   Canis lupus familiaris [dogs]
ref|XP_003912033.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  54.3    4e-05   
ref|XP_001146962.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.3    4e-05   Pan troglodytes
ref|XP_005582306.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.9    4e-05   
ref|XP_003807884.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.9    4e-05   
gb|EFA10622.1|  hypothetical protein TcasGA2_TC016259                 52.4    4e-05   
ref|XP_005066372.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.9    4e-05   
ref|XP_010373400.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.9    4e-05   
ref|XP_006717298.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.5    5e-05   
ref|XP_003938248.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.5    5e-05   
ref|XP_005522267.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.5    5e-05   
ref|NP_073592.1|  inositol-pentakisphosphate 2-kinase                 53.5    6e-05   Homo sapiens [man]
ref|XP_005052966.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.5    6e-05   
gb|ELK03394.1|  Inositol-pentakisphosphate 2-kinase                   53.5    6e-05   
ref|XP_010373399.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.5    6e-05   
ref|XP_006025938.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.5    6e-05   
ref|XP_004004122.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    7e-05   
ref|XP_008155090.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    7e-05   
ref|XP_006102265.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    7e-05   
ref|XP_006922874.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    8e-05   
ref|XP_005684285.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    8e-05   
ref|XP_005881722.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    8e-05   
ref|XP_004684558.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    8e-05   
ref|XP_010973179.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    9e-05   
ref|XP_006992344.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    9e-05   
ref|XP_007182449.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.8    9e-05   
ref|XP_007267638.1|  hypothetical protein FOMMEDRAFT_88227            52.8    9e-05   
ref|XP_008255083.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.8    9e-05   
ref|XP_003505388.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.1    9e-05   
ref|XP_008851096.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    1e-04   
ref|XP_006876833.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    1e-04   
ref|XP_003995355.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    1e-04   
ref|XP_002708272.2|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.8    1e-04   Oryctolagus cuniculus [domestic rabbit]
dbj|GAM24665.1|  hypothetical protein SAMD00019534_078400             52.4    1e-04   
ref|XP_007907076.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.4    1e-04   
ref|XP_008577572.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.4    1e-04   
ref|XP_007468229.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.4    1e-04   
ref|XP_006127629.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.4    1e-04   
ref|XP_004160062.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    1e-04   
ref|XP_007182450.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.4    1e-04   
ref|NP_951011.1|  inositol-pentakisphosphate 2-kinase isoform a       52.4    1e-04   Mus musculus [mouse]
ref|XP_006517044.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    2e-04   
ref|NP_176152.1|  Inositol-pentakisphosphate 2-kinase-like protein    48.9    2e-04   
ref|XP_007111364.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.4    2e-04   
ref|XP_006063158.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    2e-04   
ref|XP_004322141.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    2e-04   
ref|XP_006900784.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    2e-04   
ref|XP_004598876.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    2e-04   
ref|XP_004284162.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    2e-04   
ref|XP_006063159.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    2e-04   
ref|XP_004442787.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.6    2e-04   
ref|XP_003421137.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.6    2e-04   
ref|XP_008199701.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.6    2e-04   
ref|XP_008199703.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.6    2e-04   
ref|XP_003124839.3|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    3e-04   
ref|XP_002689884.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  51.2    3e-04   
dbj|BAE20447.1|  unnamed protein product                              51.2    4e-04   
ref|XP_004384280.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.4    6e-04   
ref|XP_004803040.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.1    7e-04   
ref|XP_004766197.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    8e-04   
ref|XP_004766196.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    8e-04   
ref|XP_004766195.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    8e-04   
ref|XP_008865587.1|  hypothetical protein H310_03491                  50.1    0.001   
ref|XP_005355230.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  50.1    0.001   



>emb|CDP07485.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MAV L AKDA +W+YRGEGA+NLVL+Y G +  F GK+LRI KV TNG   ENGH  LT 
Sbjct  1    MAVALTAKDADDWTYRGEGAVNLVLAYAGNSAEFVGKVLRIPKVSTNGSHLENGHSALTP  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD  DL SAPTREIAE  +VQ VMCP LG EHVDAG+ ILVS+EFL A+EK VL
Sbjct  61   HECLLWKDTADLTSAPTREIAEQLYVQHVMCPLLGSEHVDAGMRILVSKEFLVAIEKKVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP+WRV AAK+N L DS+LL+SDHS+FPH T K E  +CVEIKPKCGFLP SKFI E 
Sbjct  121  SQRPSWRVKAAKVNPLCDSVLLISDHSVFPHGTLKGEFSLCVEIKPKCGFLPTSKFIAEG  180

Query  29   NAVKRRITR  3
            NA+KR +TR
Sbjct  181  NAIKRSVTR  189



>ref|XP_009792964.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792965.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792966.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792967.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792968.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792969.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792970.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
Length=449

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MAVVL+AKDA EW+YRGEGA+NLVL+Y G    F GK+LRIQKVP NG E  NG+ GLT 
Sbjct  1    MAVVLEAKDAGEWTYRGEGAVNLVLAYNGTRSDFVGKVLRIQKVPRNGSENGNGYLGLTN  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  LWK+V ++VSAPTREIA+H+FVQ VMCP LGP HVDAGI I V++EFLE VE NVL
Sbjct  61   QECILWKEVNEIVSAPTREIAQHYFVQHVMCPLLGPGHVDAGISIQVTQEFLETVESNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WRVDAAK+N L DS++LMSDHS+FP    KE   I VEIKPKCGFLP S+FI E 
Sbjct  121  SQRPAWRVDAAKVNPLCDSVMLMSDHSMFPLGMCKEACSISVEIKPKCGFLPHSEFITED  180

Query  29   NAVKRRITR  3
            NAVK+ +TR
Sbjct  181  NAVKKSVTR  189



>ref|XP_011083655.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Sesamum indicum]
Length=476

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA VL AKDA+EW YRGEGA NLVL+Y G AP+F GK+LRIQKVP NG E ENGH  LT 
Sbjct  1    MAAVLGAKDAVEWIYRGEGAANLVLAYCGSAPKFVGKVLRIQKVPNNGSECENGHSALTK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  LW   + +VSAPTRE AE  +VQ+VMCP LG EHVDAGIH+LVSREFLEAVEK VL
Sbjct  61   LECVLWGKFEGIVSAPTRETAEQLYVQKVMCPLLGSEHVDAGIHVLVSREFLEAVEKKVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTP--KEELCICVEIKPKCGFLPASKFII  36
             +RP+WRVDAAK+N L DS+LL++DHS FPHV+   KE+ C+ VEIKPK GFLP S+FI 
Sbjct  121  GQRPSWRVDAAKVNPLCDSVLLIADHSKFPHVSGIFKEDFCVSVEIKPKGGFLPVSEFIA  180

Query  35   ESNAVKRRITR  3
            E NAVK++I R
Sbjct  181  EENAVKKKIIR  191



>ref|XP_011083654.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Sesamum indicum]
Length=508

 Score =   268 bits (684),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 160/214 (75%), Gaps = 4/214 (2%)
 Frame = -3

Query  632  LGFSPYRFLSLQSTFPILIPR--MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGK  459
            + ++P   + +     IL+    MA VL AKDA+EW YRGEGA NLVL+Y G AP+F GK
Sbjct  10   INYNPVHGICIHVVKSILLAYKWMAAVLGAKDAVEWIYRGEGAANLVLAYCGSAPKFVGK  69

Query  458  ILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPE  279
            +LRIQKVP NG E ENGH  LT  E  LW   + +VSAPTRE AE  +VQ+VMCP LG E
Sbjct  70   VLRIQKVPNNGSECENGHSALTKLECVLWGKFEGIVSAPTRETAEQLYVQKVMCPLLGSE  129

Query  278  HVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTP--K  105
            HVDAGIH+LVSREFLEAVEK VL +RP+WRVDAAK+N L DS+LL++DHS FPHV+   K
Sbjct  130  HVDAGIHVLVSREFLEAVEKKVLGQRPSWRVDAAKVNPLCDSVLLIADHSKFPHVSGIFK  189

Query  104  EELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            E+ C+ VEIKPK GFLP S+FI E NAVK++I R
Sbjct  190  EDFCVSVEIKPKGGFLPVSEFIAEENAVKKKIIR  223



>gb|EPS63025.1| hypothetical protein M569_11760, partial [Genlisea aurea]
Length=439

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 153/192 (80%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENG-HPGLT  393
            MAVVL AKDA+EW+YRGEGA+NLVL+Y G +P F GK+LRIQK+ TNG EYENG H  LT
Sbjct  3    MAVVLTAKDAVEWAYRGEGAVNLVLAYCGNSPNFVGKVLRIQKIATNGSEYENGQHSSLT  62

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  +W D++ +VSAPT E AE  +VQ+V+CP LG EHVDAGI +LVS+EFLEAVE  V
Sbjct  63   THECLMWGDLEGIVSAPTMEEAEQMYVQEVLCPLLGAEHVDAGIRVLVSKEFLEAVECQV  122

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTP--KEELCICVEIKPKCGFLPASKFI  39
            L +RP+WRVDAAK+N + DS LL++DHSIFPHV+    E+ C+ +EIKPK G LP S++I
Sbjct  123  LRQRPSWRVDAAKVNPMCDSGLLIADHSIFPHVSGIFSEDFCVSIEIKPKAGILPDSEYI  182

Query  38   IESNAVKRRITR  3
             E NAVKRRITR
Sbjct  183  DEENAVKRRITR  194



>ref|XP_009621350.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621351.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621352.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621353.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621354.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621356.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
Length=449

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MAVVL+AKDA EW+YRGEGA+NLVL+Y G    F GK+LRIQKVP NG E  NG+ GLT 
Sbjct  1    MAVVLEAKDAGEWTYRGEGAVNLVLAYNGTRSDFVGKVLRIQKVPRNGSENGNGYLGLTN  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  LWK+V ++VSAPTREIA+H+FVQ VMCP LG  HVDAGI I V++EFLE VE NVL
Sbjct  61   QECVLWKEVNEIVSAPTREIAQHYFVQHVMCPLLGSGHVDAGISIQVTQEFLETVESNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WRVDAAK+N L  S++LMSDHS+FP    KE   I VEIKPKCGFLP S+FI E 
Sbjct  121  SQRPAWRVDAAKVNPLCVSVMLMSDHSMFPLGMCKEACSISVEIKPKCGFLPHSEFIAED  180

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  181  NAIKKSVTR  189



>ref|XP_006341966.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Solanum tuberosum]
Length=440

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA+VL A DA EW YRGEGA+NLVL+Y G  P F GK+LR+QK+P NG + ENGHPGLT 
Sbjct  1    MAMVLQANDAREWCYRGEGAVNLVLAYSGEHPDFVGKVLRVQKIPRNGSQRENGHPGLTE  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  +WK+ K+LVSAPT+E+AE+ FVQ VMC  LG ++VDAGIHI V+REFLE V+ NVL
Sbjct  61   LECLMWKEFKELVSAPTKEMAEYNFVQHVMCSLLGSKNVDAGIHIPVTREFLETVDNNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP+WRVDAA +N L DS+LL+SDHS+FP    K++ CI VEIKPKCGFLP S+FI   
Sbjct  121  CQRPSWRVDAAMVNPLCDSVLLISDHSLFPRGALKKDFCISVEIKPKCGFLPLSEFIASE  180

Query  29   NAVKRRITR  3
            N++KR +TR
Sbjct  181  NSIKRSVTR  189



>ref|XP_004238270.2| PREDICTED: inositol-pentakisphosphate 2-kinase [Solanum lycopersicum]
Length=445

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA+VL A DA EW YRGEGA+NLVL+Y G  P F GK+LR+QKVP NG + ENGHPGLT 
Sbjct  1    MAMVLQANDAREWCYRGEGAVNLVLAYSGEHPDFVGKVLRVQKVPKNGSQRENGHPGLTE  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  +WK+ ++LVSAPT+E+AE+ FVQ VMC  LG ++VDAGI+I V+REFLE V+ NVL
Sbjct  61   LERLMWKEFEELVSAPTKEMAEYCFVQHVMCSLLGSKNVDAGIYIPVTREFLETVDNNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP+WRVDAA +N L DS+LL+SDHS+FP    KE+ CI VEIKPKCGFLP S+FI   
Sbjct  121  CQRPSWRVDAAMVNPLCDSVLLISDHSLFPRGALKEDFCISVEIKPKCGFLPLSEFIASE  180

Query  29   NAVKRRITR  3
            N++KR +TR
Sbjct  181  NSIKRTVTR  189



>gb|EYU45129.1| hypothetical protein MIMGU_mgv1a006036mg [Erythranthe guttata]
Length=460

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA VL AKDA EW+YRGEGA+NLVLSY G +P+F GK+LRIQKV     +YENGH  LT 
Sbjct  1    MAEVLQAKDADEWAYRGEGAVNLVLSYCGTSPKFVGKVLRIQKVSNKVSKYENGHSALTK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  LW   + +V+A TREIAE  +VQ+VMCP LG EHVDAGI ILVSREFL+AVE  VL
Sbjct  61   DERVLWGQFEGIVAARTREIAEQLYVQKVMCPLLGSEHVDAGIRILVSREFLKAVENKVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RPT RVDAAK+N L DS+L+++DHSIFP    KE+ C+ VEIKPK GFLP S FI E 
Sbjct  121  LQRPTLRVDAAKVNPLCDSVLVIADHSIFPSGILKEDFCLSVEIKPKGGFLPTSDFIDEE  180

Query  29   NAVKRRITR  3
            NAVK+RITR
Sbjct  181  NAVKKRITR  189



>gb|EYU32907.1| hypothetical protein MIMGU_mgv1a006028mg [Erythranthe guttata]
Length=460

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA VL  KDA EW+YRGEGA+NLVL+Y G +PRF GK+LRIQKV     +YEN H  LT 
Sbjct  1    MAEVLQEKDADEWAYRGEGAVNLVLAYCGSSPRFVGKVLRIQKVSNKVSKYENHHSALTK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  LW   + +V+A TREIAE  +VQ+VMCP LG EHVDAGI ILVSREFL+AVE  VL
Sbjct  61   DERLLWGKFEGIVAARTREIAEQMYVQKVMCPLLGSEHVDAGIRILVSREFLKAVEHKVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTP--KEELCICVEIKPKCGFLPASKFII  36
             +RP WRVDAAK+N L DS+L+++DHSIFP V    KE+ C+ VEIKPK GFLP S FI 
Sbjct  121  LQRPAWRVDAAKVNPLCDSVLVIADHSIFPSVRGILKEDFCLSVEIKPKGGFLPTSDFIA  180

Query  35   ESNAVKRRITR  3
            E NAVK+RITR
Sbjct  181  EENAVKKRITR  191



>ref|XP_010539889.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X3 [Tarenaya 
hassleriana]
Length=408

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY--ENGHPGL  396
            M +VL+ KDA++WSY+GEGA+NLVL+Y G +P F GK++RIQK+P +G E   +N   GL
Sbjct  1    MEIVLEQKDAVDWSYKGEGAVNLVLAYTGSSPAFLGKVMRIQKMPKDGNENSNDNNDTGL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  +W++V++LVS   +E+AEH +V+ VM P LGP+HVDAG  +LV+REFLE+VE+N
Sbjct  61   TSHEKLVWREVEELVSCQDKEVAEHMYVKLVMSPLLGPKHVDAGTRLLVAREFLESVEEN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP+WRVDAAK++ LR S+LLM DH++F   + K+E CI VEIKPKCGFLP S +I 
Sbjct  121  VVSQRPSWRVDAAKVDTLRSSVLLMDDHTLFTCGSIKDETCISVEIKPKCGFLPDSSYIT  180

Query  35   ESNAVKRRITR  3
            E NA+K+  TR
Sbjct  181  EENAIKKTRTR  191



>ref|XP_010539886.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539887.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
Length=455

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY--ENGHPGL  396
            M +VL+ KDA++WSY+GEGA+NLVL+Y G +P F GK++RIQK+P +G E   +N   GL
Sbjct  1    MEIVLEQKDAVDWSYKGEGAVNLVLAYTGSSPAFLGKVMRIQKMPKDGNENSNDNNDTGL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  +W++V++LVS   +E+AEH +V+ VM P LGP+HVDAG  +LV+REFLE+VE+N
Sbjct  61   TSHEKLVWREVEELVSCQDKEVAEHMYVKLVMSPLLGPKHVDAGTRLLVAREFLESVEEN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP+WRVDAAK++ LR S+LLM DH++F   + K+E CI VEIKPKCGFLP S +I 
Sbjct  121  VVSQRPSWRVDAAKVDTLRSSVLLMDDHTLFTCGSIKDETCISVEIKPKCGFLPDSSYIT  180

Query  35   ESNAVKRRITR  3
            E NA+K+  TR
Sbjct  181  EENAIKKTRTR  191



>ref|XP_009365515.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Pyrus x bretschneideri]
Length=453

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK  TNG +  N    LT 
Sbjct  1    MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARTNGSKASNSPTALTA  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  61   HELLLWKDVDDIVATSNKELACQLYVKNVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SK I E 
Sbjct  121  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKLIDEG  180

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  181  NSIKRSITR  189



>ref|XP_009365516.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Pyrus x bretschneideri]
Length=468

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK  TNG +  N    LT 
Sbjct  16   MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARTNGSKASNSPTALTA  75

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  76   HELLLWKDVDDIVATSNKELACQLYVKNVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  135

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SK I E 
Sbjct  136  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKLIDEG  195

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  196  NSIKRSITR  204



>ref|XP_008377206.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Malus domestica]
Length=453

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK   NG +  N    LT 
Sbjct  1    MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARINGSKASNSPTALTA  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  61   HELLLWKDVDDIVATSNKELACQLYVKHVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  181  NSIKRSITR  189



>ref|XP_008347365.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Malus domestica]
Length=415

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK   NG +  N    LT 
Sbjct  1    MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARINGSKASNSPTALTA  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  61   HELLLWKDVDDIVATSNKELACQLYVKHVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  181  NSIKRSITR  189



>ref|XP_008347364.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Malus domestica]
Length=430

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK   NG +  N    LT 
Sbjct  16   MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARINGSKASNSPTALTA  75

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  76   HELLLWKDVDDIVATSNKELACQLYVKHVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  135

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SKFI E 
Sbjct  136  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKFIDEG  195

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  196  NSIKRSITR  204



>gb|KDP38543.1| hypothetical protein JCGZ_04468 [Jatropha curcas]
Length=454

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENG-HPGLT  393
            M   L+ KDA EW YRGEGA NLVL+Y G +P F GK++RIQK+  NG     G H  LT
Sbjct  1    METKLEQKDAGEWVYRGEGAANLVLAYTGSSPLFVGKVMRIQKIARNGSSRRLGEHTVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ K+LVSAPT+E+AE F+V+ VM P LGP+HVDAG+H+ VSR+FLE++EK V
Sbjct  61   EQERLLWRESKELVSAPTKELAEWFYVKHVMSPLLGPKHVDAGMHVSVSRDFLESIEKKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  RD +L+M+DHS+FPH + K   CI VEIKPKCGFLP+S+FI E
Sbjct  121  ISQRPAWRVDAAKIDTDRDFVLIMTDHSLFPHGSLKVGPCISVEIKPKCGFLPSSRFIAE  180

Query  32   SNAVKRRITR  3
             N++KR   R
Sbjct  181  RNSIKRSTAR  190



>ref|XP_007223293.1| hypothetical protein PRUPE_ppa005582mg [Prunus persica]
 gb|EMJ24492.1| hypothetical protein PRUPE_ppa005582mg [Prunus persica]
Length=453

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M V+LD KDA +W YRGEGA NLVL Y G  P F GK++R+QK P NG +  N    LTV
Sbjct  1    MEVILDKKDAGDWIYRGEGAANLVLGYSGSTPSFTGKVMRLQKAPVNGSKSMNSPTALTV  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD +D+V+   +E+A   FV+ +M P LG  +VD+G+ +  S+EFLE+VEKN++
Sbjct  61   HERLLWKDTEDIVATSNKELACQLFVKHIMSPLLGSTYVDSGMRVSASKEFLESVEKNII  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDAAK++   DS+LLMSDHS+FP  T + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  SQRPASRVDAAKVDTECDSVLLMSDHSLFPRGTHEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            NA+KR ITR
Sbjct  181  NAIKRSITR  189



>ref|XP_008220840.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Prunus 
mume]
 ref|XP_008220841.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Prunus 
mume]
Length=453

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M V+L+ KDA +W YRGEGA NLVL Y G  P F GK++R+QK P NG +  N    LTV
Sbjct  1    MEVILEKKDAGDWIYRGEGAANLVLGYNGSTPAFIGKVMRLQKAPVNGSKSMNSPTALTV  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD +D+V+   +E+A   FV+ +M P LG  +VD+G+ +L S+EFLE+VEKN++
Sbjct  61   HERLLWKDTEDIVATSNKELACQLFVKHIMSPLLGSTYVDSGMRVLASKEFLESVEKNII  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDAAK++   DS+LLMSDHS+FP  T + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  SQRPASRVDAAKVDTQCDSVLLMSDHSLFPRGTHEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            NA+KR ITR
Sbjct  181  NAIKRSITR  189



>ref|XP_009365518.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Pyrus x bretschneideri]
Length=559

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK  TNG +  N    LT 
Sbjct  16   MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARTNGSKASNSPTALTA  75

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  76   HELLLWKDVDDIVATSNKELACQLYVKNVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  135

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SK I E 
Sbjct  136  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKLIDEG  195

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  196  NSIKRSITR  204



>ref|XP_008377208.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Malus domestica]
Length=555

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK   NG +  N    LT 
Sbjct  16   MEVVLEKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVMRLQKARINGSKASNSPTALTA  75

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKDV D+V+   +E+A   +V+ VM P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  76   HELLLWKDVDDIVATSNKELACQLYVKHVMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  135

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K++   D++LLMSDHS+FP VT + E CI VEIKPKCGFLP+SKFI E 
Sbjct  136  SQRPASRVDATKVDTQSDTVLLMSDHSLFPRVTQEVEPCISVEIKPKCGFLPSSKFIDEG  195

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  196  NSIKRSITR  204



>ref|XP_010254762.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Nelumbo nucifera]
Length=461

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            +VL+ KDA +W YRGEGA NLVL+Y+G +P F GK++R+QK P N  +  NG    +V E
Sbjct  14   LVLEEKDAADWIYRGEGAANLVLAYKGSSPSFVGKVIRLQKAPKNISQSMNGTSVFSVQE  73

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              LWKD  DL+S+ ++E     +   +M P LG EHVD G+ ILVS+EFLE+VEKNVL +
Sbjct  74   CLLWKDTNDLLSSTSKENVGQLYSLHIMSPLLGSEHVDPGMRILVSKEFLESVEKNVLCQ  133

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
            RP WRVDAA +N+L DS LL+SDHS+FPH   KEE CI VEIKPKCGFLP+S+FI E N 
Sbjct  134  RPAWRVDAANINILCDSALLVSDHSVFPHGILKEEPCISVEIKPKCGFLPSSRFIAEGNF  193

Query  23   VKRRITR  3
            +KR ITR
Sbjct  194  IKRSITR  200



>ref|XP_007227480.1| hypothetical protein PRUPE_ppa006527mg [Prunus persica]
 gb|EMJ28679.1| hypothetical protein PRUPE_ppa006527mg [Prunus persica]
Length=407

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W YRGEGA NLV+ Y G AP F GK++R+QK P NG +  N    LT+
Sbjct  1    MEVVLEKKDAADWVYRGEGAANLVIGYSGSAPAFIGKVMRLQKAPINGSKSMNSPTALTM  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD +D+V+   +E+A   FV+ +M P LG  HVD+G+ +  S+EFLE+VEKN++
Sbjct  61   HERLLWKDTEDIVATSNKELACQLFVKHIMSPLLGSTHVDSGMRVPASKEFLESVEKNII  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDAAK++   DS+LLMSDHSIFP  T + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  CQRPASRVDAAKVDTQCDSVLLMSDHSIFPRGTQEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            +A+KR ITR
Sbjct  181  SAIKRSITR  189



>ref|XP_008219053.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Prunus mume]
 ref|XP_008219054.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Prunus mume]
Length=453

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W YRGEGA NLVL Y G AP F GK++R+QK P NG +  N    LT+
Sbjct  1    MEVVLEKKDAADWVYRGEGAANLVLGYSGSAPAFIGKVMRLQKAPINGSKSMNSPTALTM  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD +D+V+   +E+A   FV+ +M P LG  HVD+GI +  S+EFLE+V KN++
Sbjct  61   HERLLWKDTEDIVATSNKELACQLFVKHIMSPLLGSTHVDSGIRVPASKEFLESVVKNII  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDAAK++   DS+LLMSDHS+FP  T + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  CQRPASRVDAAKVDTQCDSVLLMSDHSLFPRGTQEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            NA+KR ITR
Sbjct  181  NAIKRSITR  189



>ref|XP_008220842.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Prunus 
mume]
Length=548

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M V+L+ KDA +W YRGEGA NLVL Y G  P F GK++R+QK P NG +  N    LTV
Sbjct  1    MEVILEKKDAGDWIYRGEGAANLVLGYNGSTPAFIGKVMRLQKAPVNGSKSMNSPTALTV  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD +D+V+   +E+A   FV+ +M P LG  +VD+G+ +L S+EFLE+VEKN++
Sbjct  61   HERLLWKDTEDIVATSNKELACQLFVKHIMSPLLGSTYVDSGMRVLASKEFLESVEKNII  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDAAK++   DS+LLMSDHS+FP  T + E CI VEIKPKCGFLP+SKFI E 
Sbjct  121  SQRPASRVDAAKVDTQCDSVLLMSDHSLFPRGTHEVEPCISVEIKPKCGFLPSSKFIDEG  180

Query  29   NAVKRRITR  3
            NA+KR ITR
Sbjct  181  NAIKRSITR  189



>ref|XP_010061286.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 ref|XP_010061287.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 ref|XP_010061288.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 ref|XP_010061289.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 gb|KCW68220.1| hypothetical protein EUGRSUZ_F01873 [Eucalyptus grandis]
Length=448

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M ++L+ KDA +W YRGEGA N+VL+Y G AP F GK+LRI+K P NG +  NG    + 
Sbjct  1    MDLILEEKDAADWVYRGEGAANIVLTYTGSAPTFVGKVLRIRKAPENGTQSSNGILSFSN  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LWKD ++LV +PT+EIA   +VQ V+ P LG +HVDAGI +LVS+EFLE +E N+ 
Sbjct  61   HERLLWKDFEELVQSPTKEIAAQKYVQHVITPLLGSKHVDAGIRVLVSKEFLEEIEINIK  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
              RP WR+DAAK++ L    LL+SDHS+FPH   K   CI VEIKPKCGFLP SK+I   
Sbjct  121  SHRPDWRIDAAKVDTLNKYALLISDHSLFPHGILKGNACISVEIKPKCGFLPFSKYIARQ  180

Query  29   NAVKRRITR  3
            NA+KR  TR
Sbjct  181  NAIKRSTTR  189



>ref|XP_010110041.1| Inositol-pentakisphosphate 2-kinase [Morus notabilis]
 gb|EXC25059.1| Inositol-pentakisphosphate 2-kinase [Morus notabilis]
Length=618

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = -3

Query  617  YRFLSLQSTFPILIPRMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKV  438
            +R L  +S     I RM V+LD KDA +W+YRGEGA NLVL+Y G +P F GK+LRIQK 
Sbjct  2    WRKLRSESESRKKIGRMEVILDKKDAADWAYRGEGAANLVLAYTGSSPAFIGKVLRIQKA  61

Query  437  PTNGCEYENGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIH  258
                 E       LT+HE  +WKD +DLVS+  +E+A   FVQ V+ P LG ++VDAG+ 
Sbjct  62   DRKELESTKSRTALTLHERLVWKDTEDLVSSTNKEVACQLFVQHVISPLLGSKYVDAGVR  121

Query  257  ILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEI  78
            I  SREFLE +E NV+ +RP  RVDAAK++   DS+LL+SDHS+FP  TP+ E CICVEI
Sbjct  122  IPASREFLETIETNVICQRPALRVDAAKVDTHWDSVLLLSDHSLFPSGTPEGEPCICVEI  181

Query  77   KPKCGFLPASKFIIESNAVKRRITR  3
            KPKCGFLP S+FI E NA+KR + R
Sbjct  182  KPKCGFLPISEFIGEGNAIKRSVPR  206



>ref|XP_010673136.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M ++L+ KDA +W YRGEGA+NLVL+Y G +P F+GKI+R+QK   NG  Y+ G   ++ 
Sbjct  1    MELMLEEKDASDWIYRGEGAVNLVLAYSGSSPAFSGKIIRVQKALRNGSNYDTGSSVVSK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  +WKD   +V++P REIAE  +V+ VM P LG E VD G+ ILVSREFLE+VE+NVL
Sbjct  61   HECIVWKDDGAIVTSPNREIAEQLYVKCVMIPLLGSEFVDPGVRILVSREFLESVERNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WRV AA+++   DS+LLMSDHS++P  T K   CI VEIKPKCGFLP+S FI + 
Sbjct  121  SQRPGWRVKAARVDSCADSVLLMSDHSVYPDSTFKGVPCISVEIKPKCGFLPSSSFIADE  180

Query  29   NAVKRRITR  3
             ++K+ +TR
Sbjct  181  TSIKKDVTR  189



>ref|XP_007017602.1| Inositol-pentakisphosphate 2-kinase 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY14827.1| Inositol-pentakisphosphate 2-kinase 1, putative isoform 2 [Theobroma 
cacao]
Length=390

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            VVL+ KDA++W YRGEGA NLVL+Y G +P F GK++RIQK P N     NG+  LT  E
Sbjct  4    VVLEQKDAVDWVYRGEGAANLVLAYTGSSPAFIGKVMRIQKSPRNDKNGVNGNGSLTTQE  63

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              LW++  +L ++P REI E  +V+  M P LGP+HVDAGI + V++EFLE+V+ NV+ +
Sbjct  64   QLLWREDMELTASPNREIVEQLYVKHAMSPLLGPKHVDAGIRVRVTKEFLESVDNNVICQ  123

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
            RP WRVD+++++  RD+ L++SDHS+FP+ T K   C+ VEIKPKCGFLP S+FI E NA
Sbjct  124  RPAWRVDSSQVDANRDTALIISDHSVFPNGTLKGGPCVTVEIKPKCGFLPISRFIAEENA  183

Query  23   VKRRITR  3
            +KR ITR
Sbjct  184  LKRIITR  190



>ref|XP_010664715.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Vitis vinifera]
Length=453

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 138/194 (71%), Gaps = 10/194 (5%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQK----VPTNGCEYENGH  405
             M V L   DA  W YRGEGA+NLVL+Y G +P F GK+LRIQK    V     ++ NGH
Sbjct  2    EMEVALHKNDAPHWVYRGEGAVNLVLAYNGSSPLFVGKVLRIQKASRKVAPGSEQWLNGH  61

Query  404  PGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
              L      +WKD  D++S+P++EIA+  FVQ VM P LG +H+DAGI +LVSREFLE+V
Sbjct  62   ERL------IWKDNPDILSSPSKEIAQQMFVQNVMAPRLGSQHIDAGIRVLVSREFLESV  115

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASK  45
            EKNVL +RP WR++AAK+N   D  LL+SDHS+FPH   K E CI VEIKPKCGFLP S+
Sbjct  116  EKNVLCQRPAWRIEAAKVNTNCDYALLLSDHSVFPHSFVKGEPCISVEIKPKCGFLPFSR  175

Query  44   FIIESNAVKRRITR  3
            FI E NA+K+R+TR
Sbjct  176  FIAEGNAIKKRVTR  189



>ref|XP_007017601.1| Inositol-pentakisphosphate 2-kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY14826.1| Inositol-pentakisphosphate 2-kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=492

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            VVL+ KDA++W YRGEGA NLVL+Y G +P F GK++RIQK P N     NG+  LT  E
Sbjct  4    VVLEQKDAVDWVYRGEGAANLVLAYTGSSPAFIGKVMRIQKSPRNDKNGVNGNGSLTTQE  63

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              LW++  +L ++P REI E  +V+  M P LGP+HVDAGI + V++EFLE+V+ NV+ +
Sbjct  64   QLLWREDMELTASPNREIVEQLYVKHAMSPLLGPKHVDAGIRVRVTKEFLESVDNNVICQ  123

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
            RP WRVD+++++  RD+ L++SDHS+FP+ T K   C+ VEIKPKCGFLP S+FI E NA
Sbjct  124  RPAWRVDSSQVDANRDTALIISDHSVFPNGTLKGGPCVTVEIKPKCGFLPISRFIAEENA  183

Query  23   VKRRITR  3
            +KR ITR
Sbjct  184  LKRIITR  190



>ref|XP_008359763.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Malus domestica]
Length=552

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M VVL+ KDA +W+YRGEGA NLVL+Y G +P F GK++R+QK   NG +  N    LT 
Sbjct  1    MEVVLEKKDAGDWAYRGEGAANLVLAYTGSSPTFIGKVMRLQKARINGSKASNSPTALTA  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE+ LWKD+ D+V+   +E+A   +V+ +M P LG  +VDAG+ + VSREFLE+VEKNV+
Sbjct  61   HELLLWKDMDDIVATSNKELASQLYVKHIMSPLLGSAYVDAGMRVPVSREFLESVEKNVI  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP  RVDA K+    D++LLMSDHS F  VT + E  I VEIKPKCGFLP+S+FI E 
Sbjct  121  SQRPASRVDATKVGTQSDTVLLMSDHSXFSRVTQEVEPSISVEIKPKCGFLPSSRFIDEG  180

Query  29   NAVKRRITR  3
            N++KR ITR
Sbjct  181  NSIKRSITR  189



>ref|XP_002306883.1| hypothetical protein POPTR_0005s25180g [Populus trichocarpa]
 gb|EEE93879.1| hypothetical protein POPTR_0005s25180g [Populus trichocarpa]
Length=435

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 137/190 (72%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KDA +WSYRGEGA N+VL+Y G +P F GK+ RI K   NG  + ++    LT
Sbjct  1    MEVKLERKDAADWSYRGEGAANIVLAYTGSSPAFIGKVTRIAKKERNGSPKCDSNQSVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW+DV++LV++PT+EIAE  + Q VM P LGP+HVDAG+ + V+REFLE VEKNV
Sbjct  61   EEERLLWRDVQELVASPTKEIAEQIYTQLVMSPLLGPKHVDAGMRVPVAREFLECVEKNV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVD +  ++ RDS+++MSDHS+FP     +  CI VEIKPKCGFLP SKF+ E
Sbjct  121  IKQRPPWRVDVSTFDMERDSVIIMSDHSLFPGGVLGDGSCISVEIKPKCGFLPLSKFMAE  180

Query  32   SNAVKRRITR  3
             N+VKR  TR
Sbjct  181  GNSVKRSTTR  190



>ref|XP_004291851.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQK-VPTNGCEYENGHPGLT  393
            M VVL+ KDA EW YRGEGA NLV++Y G +P F GK++RIQK    NG E     P LT
Sbjct  1    MEVVLEEKDAAEWVYRGEGAANLVMAYSGSSPDFIGKVMRIQKKAKRNGLERPGSPPALT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
            +HE  LWKD++D+V+   +E+A   +V+ VM P LG   VDAG+ +  SR+FLE VEKNV
Sbjct  61   MHERLLWKDLEDMVTCSNKELASQLYVKHVMSPLLGSHFVDAGMRVQASRDFLETVEKNV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
              +RP  RVDAAK++   D +L+MSDHS+FP    + E CI VEIKPKCGFLP+S++I E
Sbjct  121  NCQRPASRVDAAKVDTECDYVLVMSDHSLFPDGVQEGETCISVEIKPKCGFLPSSEYIDE  180

Query  32   SNAVKRRITR  3
             NA+KRRITR
Sbjct  181  GNAIKRRITR  190



>ref|XP_004152686.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
 gb|KGN62621.1| hypothetical protein Csa_2G361850 [Cucumis sativus]
Length=453

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M  VL  KDA +W YRGEGA NLVL+Y G +  F GK++RIQK P NG +        + 
Sbjct  1    METVLKEKDAADWVYRGEGAANLVLAYTGSSQTFIGKVMRIQKAPINGSQRARSPTAFSK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            +E  LW D+ +LVS+  R+ A   FVQ+VM P LG +HVDAG  ILVSREFLE VEKNV 
Sbjct  61   YEYLLWGDIGNLVSSSDRDAAAQTFVQRVMSPLLGSKHVDAGKLILVSREFLELVEKNVS  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP+WRV+A K++  RD +L++SDHSIFP+ + ++E CI +EIKPKCGFLP S+FI   
Sbjct  121  SQRPSWRVNAGKIDTQRDYVLILSDHSIFPNGSLEDEPCISIEIKPKCGFLPFSRFITHC  180

Query  29   NAVKRRITR  3
            NAVKR +TR
Sbjct  181  NAVKRCMTR  189



>gb|KHN45871.1| Inositol-pentakisphosphate 2-kinase [Glycine soja]
Length=457

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCE--YENGHPGL  396
            M V+L  KDA EW YRGEGA NLVL+Y G +P F GK++RI+K P NG E         L
Sbjct  1    MEVILREKDAGEWVYRGEGAANLVLAYTGSSPTFIGKVMRIRKCPRNGAEGMCMRSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV +L+S+   EIA   F   VM P LGP+++DAG+ + VSREFLE VEKN
Sbjct  61   TAHERLLWKDVDELISSSDNEIACQLFSHHVMKPLLGPKYIDAGMLVGVSREFLELVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WRVD A++++ RDS+LLMSDHS+F H       CI VEIKPKCGF+P S+FI 
Sbjct  121  VIRQRPAWRVDNAQVDMHRDSVLLMSDHSLFTHGNLVSIPCISVEIKPKCGFIPLSRFIS  180

Query  35   ESNAVKRRITR  3
            E  A+KRRITR
Sbjct  181  EGTAIKRRITR  191



>emb|CAM33431.1| Ins5P-2kinase [Phaseolus vulgaris]
 emb|CAX94845.1| inositol 1,3,4,5,6 pentakisphosphate 2-kinase [Phaseolus vulgaris]
 emb|CAX94846.1| inositol 1,3,4,5,6 pentakisphosphate 2-kinase [Phaseolus vulgaris]
Length=352

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP--GL  396
            M V+L  KDA +W YRGEGA NLVL+Y G  P F GK++RI+K   +G           L
Sbjct  1    MEVILQEKDAGKWVYRGEGAANLVLAYSGSFPTFIGKVMRIRKASRSGANAMTMRSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV + +S+P  EIA   FVQ VM P LG ++VDAG+ + V+REFLE+VEKN
Sbjct  61   TAHECLLWKDVHEFISSPDSEIASQIFVQHVMKPLLGSKYVDAGMLVGVTREFLESVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+++RP WRVD A++++ RDS+LL+SDHS+F H       CI VEIKPKCGFLP S +I 
Sbjct  121  VIYQRPAWRVDNARVDMHRDSVLLLSDHSLFTHGNLGSSPCISVEIKPKCGFLPLSSYIS  180

Query  35   ESNAVKRRITR  3
            E  AVKR ITR
Sbjct  181  EETAVKRTITR  191



>ref|XP_003523790.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Glycine 
max]
Length=457

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCE--YENGHPGL  396
            M V+L  KDA EW YRGEGA NLVL+Y G +P F GK++RI+K P NG E         L
Sbjct  1    MEVILREKDAGEWVYRGEGAANLVLAYTGSSPTFIGKVMRIRKCPRNGAEGMCMRSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV +L+S+   EIA   F   VM P LGP+++DAG+ + VSREFLE VEKN
Sbjct  61   TAHERLLWKDVDELISSLDNEIACQLFSHHVMKPLLGPKYIDAGMLVGVSREFLELVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WRVD A++++ RDS+LLMSDHS+F H       CI VEIKPKCGF+P S+FI 
Sbjct  121  VIRQRPAWRVDNAQVDMHRDSVLLMSDHSLFTHGNLVSIPCISVEIKPKCGFIPLSRFIS  180

Query  35   ESNAVKRRITR  3
            E  A+KRRITR
Sbjct  181  EGTAIKRRITR  191



>ref|XP_002302020.2| hypothetical protein POPTR_0002s03430g [Populus trichocarpa]
 gb|EEE81293.2| hypothetical protein POPTR_0002s03430g [Populus trichocarpa]
Length=453

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC--EYENGHPGL  396
            M V ++ KDA +WSYRGEGA N+VL+Y G +P F GK++RI K   NG   + ++    L
Sbjct  1    MEVKIEQKDASDWSYRGEGAANIVLAYTGSSPSFIGKVMRITKKARNGSSPKCDSNQSVL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  E  LW+DV++LV++PT+EIAE  + Q VM P LG +HVDAG+ + V+R+FLE VEKN
Sbjct  61   TEEERLLWRDVEELVTSPTKEIAEQIYTQLVMSPLLGSKHVDAGMRVPVTRDFLECVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WR+D + ++L RD +++MSDHS+FP    K+E CI VEIKPKCGF+P+S+FI 
Sbjct  121  VIKQRPAWRIDVSVVDLERDFVIIMSDHSLFPGGVLKDEPCISVEIKPKCGFIPSSEFIA  180

Query  35   ESNAVKRRITR  3
            E N+VKR  TR
Sbjct  181  ERNSVKRSATR  191



>ref|XP_002893210.1| hypothetical protein ARALYDRAFT_313098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69469.1| hypothetical protein ARALYDRAFT_313098 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E  +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYTGSSPTFLGKMMRIQKMPKDGNENGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W D+KDLVS   +EI E+ FV+ VM P LG +HV+ GI +LV++EFLE+VEK +  
Sbjct  64   EKLIWADIKDLVSCKNKEIEEYLFVKHVMRPLLGRKHVNPGIRLLVAKEFLESVEKIITS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR DAA ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI E N
Sbjct  124  QRPSWRADAASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSSFIAEEN  183

Query  26   AVKRRITR  3
             +K+ ITR
Sbjct  184  VIKKSITR  191



>ref|XP_007160728.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
 gb|ESW32722.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
Length=466

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHP  402
            MA+ L  +DA  W YRGEGA+NLVL+Y G +P F GK++R++K P NG E +        
Sbjct  1    MALTLKEEDAAHWVYRGEGAVNLVLAYAGSSPSFIGKVIRLRKAPKNGLESKGVSVRNSM  60

Query  401  GLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVE  222
             LT  E  LWKDV  L+S+  +EI    +V+ VM P LG  +VDAG+HILV+REFLE VE
Sbjct  61   ALTPLERVLWKDVDQLISSSDKEIVGQVYVEHVMKPLLGSNYVDAGMHILVTREFLELVE  120

Query  221  KNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKF  42
            KN+  +RP WRVDAA+++   D  LLMSDHS+F H +P+   C+ VEIKPKCGFLP SKF
Sbjct  121  KNITGQRPVWRVDAARVDTHCDFGLLMSDHSLFAHGSPRPSPCLSVEIKPKCGFLPLSKF  180

Query  41   IIESNAVKRRITR  3
            I E NA+KRRITR
Sbjct  181  ISEGNAIKRRITR  193



>ref|XP_011048791.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
 ref|XP_011048792.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
 ref|XP_011048793.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
Length=435

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 135/190 (71%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KDA  WSYRGEGA N+VL+Y G +P F GK++RI K   NG    ++    LT
Sbjct  1    MEVKLERKDAANWSYRGEGAANIVLAYTGSSPAFTGKVMRIAKKERNGSPNCDSKQSVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW+DV++LV++ T+EIAE  + Q VM P LGP+HVDAG+ + V+REFLE VEKNV
Sbjct  61   EEERLLWRDVQELVASTTKEIAEQIYTQLVMSPLLGPKHVDAGMRVPVTREFLECVEKNV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVD +  ++ RDS+++MSDHS+FP     +  CI VEIKPKCGFLP SKF+ E
Sbjct  121  IKQRPPWRVDVSTFDMERDSVIIMSDHSLFPGGVLGDGPCISVEIKPKCGFLPLSKFMAE  180

Query  32   SNAVKRRITR  3
             N+VKR  TR
Sbjct  181  GNSVKRSTTR  190



>ref|NP_001237433.1| inositol pentakisphosphate 2-kinase [Glycine max]
 ref|XP_006595481.1| PREDICTED: inositol pentakisphosphate 2-kinase isoform X1 [Glycine 
max]
 ref|XP_006595482.1| PREDICTED: inositol pentakisphosphate 2-kinase isoform X2 [Glycine 
max]
 gb|ABU93829.1| inositol pentakisphosphate 2-kinase [Glycine max]
 gb|KHN20959.1| Inositol-pentakisphosphate 2-kinase [Glycine soja]
Length=456

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 136/193 (70%), Gaps = 4/193 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHP  402
            MA+ L  +DA +W YRGEGA+NLVL+Y G +P F GK++RI+K P NG + ++       
Sbjct  1    MALTLKEEDAADWVYRGEGAVNLVLAYAGSSPSFIGKVVRIRKAPRNGSQSKSVSVRNSI  60

Query  401  GLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVE  222
             LT HE  LWKDV  L+S+  +EI    +VQ VM P LG   VDAG+H+LV+REFLE VE
Sbjct  61   ALTPHERVLWKDVHQLISSSDKEIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLELVE  120

Query  221  KNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKF  42
            KNV  +RP WRV+AA+++   D  LLMSDHS+F + +    LC+ VEIKPKCGFLP S+F
Sbjct  121  KNVSGQRPAWRVEAARVDAHCDFGLLMSDHSLFAYGSQGSSLCLSVEIKPKCGFLPLSRF  180

Query  41   IIESNAVKRRITR  3
            I E NA+KRRITR
Sbjct  181  ISEVNAIKRRITR  193



>ref|XP_007160729.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
 gb|ESW32723.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
Length=489

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHP  402
            MA+ L  +DA  W YRGEGA+NLVL+Y G +P F GK++R++K P NG E +        
Sbjct  1    MALTLKEEDAAHWVYRGEGAVNLVLAYAGSSPSFIGKVIRLRKAPKNGLESKGVSVRNSM  60

Query  401  GLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVE  222
             LT  E  LWKDV  L+S+  +EI    +V+ VM P LG  +VDAG+HILV+REFLE VE
Sbjct  61   ALTPLERVLWKDVDQLISSSDKEIVGQVYVEHVMKPLLGSNYVDAGMHILVTREFLELVE  120

Query  221  KNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKF  42
            KN+  +RP WRVDAA+++   D  LLMSDHS+F H +P+   C+ VEIKPKCGFLP SKF
Sbjct  121  KNITGQRPVWRVDAARVDTHCDFGLLMSDHSLFAHGSPRPSPCLSVEIKPKCGFLPLSKF  180

Query  41   IIESNAVKRRITR  3
            I E NA+KRRITR
Sbjct  181  ISEGNAIKRRITR  193



>ref|XP_006416232.1| hypothetical protein EUTSA_v10007647mg [Eutrema salsugineum]
 gb|ESQ34585.1| hypothetical protein EUTSA_v10007647mg [Eutrema salsugineum]
Length=442

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 141/193 (73%), Gaps = 5/193 (3%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP----  402
            M   L+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E ENG      
Sbjct  1    MENFLEPKDAVDWSYRGEGAVNLVLAYTGSSPTFLGKMMRIQKIPNDGKE-ENGDTSSGN  59

Query  401  GLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVE  222
            GLT HE  +W +VKDLVS   +EI ++ FV+ VM P LG +HV+ G+ +LV++EFLE+VE
Sbjct  60   GLTTHEKLIWGEVKDLVSCQNKEIVDYLFVKHVMRPLLGHKHVNPGMRLLVAKEFLESVE  119

Query  221  KNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKF  42
            K V  +RP+WR DAA ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S F
Sbjct  120  KIVTSQRPSWRADAASVDTNRSSVLLMDDLTLFAHGRVEDKPCLSVEIKPKCGFLPSSSF  179

Query  41   IIESNAVKRRITR  3
            I E NA+K+ +TR
Sbjct  180  IAEENAIKKSVTR  192



>gb|ABK28408.1| unknown [Arabidopsis thaliana]
Length=442

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E  +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYTGSSPSFLGKMMRIQKMPKDGNENGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W DVKDLVS   +EI E+ FV+ VM P LG +HV+ GI +LV++EFLE+VEK +  
Sbjct  64   EKLIWGDVKDLVSCKNKEIEEYLFVKHVMRPLLGRKHVNPGILLLVAKEFLESVEKIITS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR D A ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI E N
Sbjct  124  QRPSWRADVASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSSFIAEEN  183

Query  26   AVKRRITR  3
             +K+ ITR
Sbjct  184  VIKKSITR  191



>ref|NP_173629.2| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
 gb|ABE65642.1| hypothetical protein At1g22100 [Arabidopsis thaliana]
 gb|AEE30197.1| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
Length=441

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E  +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYTGSSPSFLGKMMRIQKMPKDGNENGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W DVKDLVS   +EI E+ FV+ VM P LG +HV+ GI +LV++EFLE+VEK +  
Sbjct  64   EKLIWGDVKDLVSCKNKEIEEYLFVKHVMRPLLGRKHVNPGILLLVAKEFLESVEKIITS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR D A ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI E N
Sbjct  124  QRPSWRADVASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSSFIAEEN  183

Query  26   AVKRRITR  3
             +K+ ITR
Sbjct  184  VIKKSITR  191



>ref|XP_007136627.1| hypothetical protein PHAVU_009G060100g [Phaseolus vulgaris]
 gb|ESW08621.1| hypothetical protein PHAVU_009G060100g [Phaseolus vulgaris]
Length=453

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP--GL  396
            M V+L  KDA +W YRGEGA NLVL+Y G  P F GK++RI+K   +G           L
Sbjct  1    MEVILQEKDAGKWVYRGEGAANLVLAYSGSFPTFIGKVMRIRKASRSGANAMTMRSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV + +S+P  EIA   FVQ VM P LG ++VDAG+ + V+REFLE+VEKN
Sbjct  61   TAHECLLWKDVHEFISSPDSEIASQIFVQHVMKPLLGSKYVDAGMLVGVTREFLESVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+++RP WRVD A++++ RDS+LL+SDHS+F H       CI VEIKPKCGFLP S +I 
Sbjct  121  VIYQRPAWRVDNARVDMHRDSVLLLSDHSLFTHGNLGSSPCISVEIKPKCGFLPLSSYIS  180

Query  35   ESNAVKRRITR  3
            E  AVKR ITR
Sbjct  181  EETAVKRTITR  191



>ref|XP_011029078.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
Length=570

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC--EYENGHPGL  396
            M + L+ KDA +WSYRGEGA N+VL+Y G +P F GK++RI K   N    + ++  P L
Sbjct  1    MEIKLEQKDAADWSYRGEGAANIVLAYTGSSPSFIGKVMRITKKARNESSPKCDSNQPVL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  E  LW+DV++LV++PT+EIAE  + Q VM P LG +HVDAG+ + V+R+FLE VEKN
Sbjct  61   TEEERLLWRDVEELVTSPTKEIAEQIYTQLVMSPLLGSKHVDAGMRMPVTRDFLECVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WR+D + ++L RD +++MSDHS+FP    K+E CI VEIKPKCGF+P+S+FI 
Sbjct  121  VIKQRPAWRIDVSVVDLERDFVIIMSDHSLFPGGVLKDEPCISVEIKPKCGFIPSSEFIA  180

Query  35   ESNAVKRRITR  3
            E N+VKR  TR
Sbjct  181  ERNSVKRSATR  191



>ref|XP_008466533.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
melo]
Length=444

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 134/191 (70%), Gaps = 3/191 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNG--CEYENGHPGL  396
            M +VLD KD+ +W+YRGEGA+NLVL+Y G +P F GK++RIQK   NG  C        L
Sbjct  1    MEIVLDQKDSADWTYRGEGAVNLVLAYTGSSPLFFGKVIRIQKAARNGSHCTSVRSVVAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            + HE  LW+D+ DLVS   R++    +VQ VM P L  +HVDAG+HILV+REFLE +EKN
Sbjct  61   SAHERLLWRDLGDLVSCTDRDVVCQMYVQHVMIPLLDSKHVDAGVHILVTREFLETIEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            +L +RP WRV A ++N+  DS+LL SDHSIFP    + E CI VEIKPK G LP S+FI 
Sbjct  121  ILSQRPAWRVSAGRVNIHCDSVLLQSDHSIFPQ-GGEGEFCISVEIKPKWGCLPTSRFIS  179

Query  35   ESNAVKRRITR  3
            + NA+K+ +TR
Sbjct  180  KRNAIKKSVTR  190



>ref|XP_008444741.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
melo]
Length=453

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 132/189 (70%), Gaps = 0/189 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M  VL  KDA +W YRGEGA NLVL+Y G +  F GK++RIQK P NG +        + 
Sbjct  1    METVLKEKDAADWVYRGEGAANLVLAYTGSSQPFIGKVMRIQKAPINGSQRARSPTAFSK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            +E  LW D+ +LVS+  R+ A   FVQ+VM P LG +HVDAG  ILVS+EFLE  EKNV 
Sbjct  61   YEYLLWGDIGNLVSSSDRDTAAQTFVQRVMSPLLGSKHVDAGKLILVSKEFLELAEKNVS  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP+WRV+A K++  RD +L++SDHSIFP+ + + E CI VEIKPKCGFLP S+FI   
Sbjct  121  SQRPSWRVNAGKIDTQRDYVLILSDHSIFPNGSLEGEPCISVEIKPKCGFLPFSRFITHC  180

Query  29   NAVKRRITR  3
            NAVKR +TR
Sbjct  181  NAVKRCMTR  189



>gb|AGZ03654.1| inositol pentakisphosphate 2-kinase [Glycine max]
Length=456

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHP  402
            MA+ L  +DA +W YRGEGA+NLVL+Y G +  F GK++RI+K P NG + ++       
Sbjct  1    MALTLKEEDAADWVYRGEGAVNLVLAYAGSSLSFIGKVVRIRKAPRNGSQSKSVSVRNSI  60

Query  401  GLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVE  222
             LT HE  LWKDV  L+S+  +EI    +VQ VM P LG   VDAG+H+LV+REFLE VE
Sbjct  61   ALTPHERVLWKDVHQLISSSDKEIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLELVE  120

Query  221  KNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKF  42
            KNV  +RP WRV+AA+++   D  LLMSDHS+F + +    LC+ VEIKPKCGFLP S+F
Sbjct  121  KNVSGQRPAWRVEAARVDAHCDFGLLMSDHSLFAYGSQGSSLCLTVEIKPKCGFLPLSRF  180

Query  41   IIESNAVKRRITR  3
            I E NA+KRRITR
Sbjct  181  ISEVNAIKRRITR  193



>ref|XP_003528009.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Glycine max]
 ref|XP_006581199.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Glycine max]
 ref|XP_006581200.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Glycine max]
Length=457

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCE--YENGHPGL  396
            M ++L  KDA EW YRGEGA NLVL+Y G +P F GK++RI+K P NG E         L
Sbjct  1    MEMILREKDANEWVYRGEGAANLVLAYTGSSPTFIGKVMRIRKCPRNGAEGMCMRSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  E  LWKDV +L+S+   EIA   F   VM P LGP++VDAG+ + V REFLE VEKN
Sbjct  61   TALERLLWKDVDELISSSDNEIACQLFAHHVMKPLLGPKYVDAGMLVEVPREFLELVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WRVD A++++ R S+LLMSDHS+F H       CI VEIKPKCGF+P S+FI 
Sbjct  121  VIRQRPAWRVDNARVDMHRGSVLLMSDHSVFTHGNLGSSPCISVEIKPKCGFIPLSRFIS  180

Query  35   ESNAVKRRITR  3
            E  A+KRRITR
Sbjct  181  EGTAIKRRITR  191



>ref|XP_010477465.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Camelina sativa]
Length=445

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RI K+P +G E  +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYIGSSPTFLGKMMRIHKMPKDGNENGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W+DVK+LVS   +EI E+ FV+ VM P LG +HV+ GI +LV++EFLE+VE  +  
Sbjct  64   EKLIWRDVKELVSCQNKEIKEYLFVKHVMRPLLGRKHVNPGIRLLVAKEFLESVENIITS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR DAA ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI E N
Sbjct  124  QRPSWRADAASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSSFIAEEN  183

Query  26   AVKRRITR  3
             +K+ ITR
Sbjct  184  VIKKSITR  191



>gb|KHN22235.1| Inositol-pentakisphosphate 2-kinase [Glycine soja]
Length=457

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCE--YENGHPGL  396
            M ++L  KDA EW YRGEGA NLVL+Y G +P F GK++RI+K P NG E         L
Sbjct  1    MEMILREKDANEWVYRGEGAANLVLAYTGSSPTFIGKVMRIRKCPRNGAEGMCMRSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  E  LWKDV +L+S+   EIA   F   VM P LGP++VDAG+ + V REFLE VEKN
Sbjct  61   TALERLLWKDVDELISSSDNEIACQLFAHHVMKPLLGPKYVDAGMLVEVPREFLELVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WRVD A++++ R S+LLMSDHS+F H       CI VEIKPKCGF+P S+FI 
Sbjct  121  VIRQRPAWRVDNARVDMHRGSVLLMSDHSLFTHGNLGSSPCISVEIKPKCGFIPLSRFIS  180

Query  35   ESNAVKRRITR  3
            E  A+KRRITR
Sbjct  181  EGTAIKRRITR  191



>emb|CBI19737.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 138/210 (66%), Gaps = 26/210 (12%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQK----VPTNGCEYENGH  405
             M V L   DA  W YRGEGA+NLVL+Y G +P F GK+LRIQK    V     ++ NGH
Sbjct  2    EMEVALHKNDAPHWVYRGEGAVNLVLAYNGSSPLFVGKVLRIQKASRKVAPGSEQWLNGH  61

Query  404  PGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGI------------  261
              L      +WKD  D++S+P++EIA+  FVQ VM P LG +H+DAGI            
Sbjct  62   ERL------IWKDNPDILSSPSKEIAQQMFVQNVMAPRLGSQHIDAGIVSQVAPIHLWCH  115

Query  260  ----HILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC  93
                 +LVSREFLE+VEKNVL +RP WR++AAK+N   D  LL+SDHS+FPH   K E C
Sbjct  116  LLDIRVLVSREFLESVEKNVLCQRPAWRIEAAKVNTNCDYALLLSDHSVFPHSFVKGEPC  175

Query  92   ICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            I VEIKPKCGFLP S+FI E NA+K+R+TR
Sbjct  176  ISVEIKPKCGFLPFSRFIAEGNAIKKRVTR  205



>ref|XP_006435038.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
 ref|XP_006435039.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
 gb|ESR48278.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
 gb|ESR48279.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
Length=442

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 135/195 (69%), Gaps = 6/195 (3%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYE------NG  408
            M VVLD  DA +W YRGEGA NLVL+Y G +P F GK+LRI K   NG   E      NG
Sbjct  1    MDVVLDQNDAADWIYRGEGAANLVLAYAGSSPAFVGKVLRIPKAWRNGKPEESLAQCVNG  60

Query  407  HPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEA  228
                  HE  LW D ++L+S+ ++E  E  +V+++M P LGP+++DAG+ + V+REFLE+
Sbjct  61   GSVFGKHEQLLWGDNQELLSSSSKETMEQMYVEKIMSPLLGPKYIDAGMCVRVTREFLES  120

Query  227  VEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPAS  48
            V+KNV  +RP WRVDAA + +  DS+LLMSDH++FP     EE C+ VEIKPKCGFLP S
Sbjct  121  VQKNVTGQRPAWRVDAADIKIPCDSVLLMSDHTLFPQGILGEEPCLAVEIKPKCGFLPIS  180

Query  47   KFIIESNAVKRRITR  3
            +FI E NA+KR +TR
Sbjct  181  RFIAEENAIKRSVTR  195



>ref|XP_004154853.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
Length=444

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 132/191 (69%), Gaps = 3/191 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNG--CEYENGHPGL  396
            M +VLD  DA +W+YRGEGA+NLVL+Y G +P F GK++RIQK   NG  C        L
Sbjct  1    MEIVLDHNDAADWTYRGEGAVNLVLAYTGSSPLFFGKVVRIQKTARNGLHCTSVRNVVAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            + HE  LW+DV DL S   R++    +VQ VM P L  +HVDAG+HILV+REFLE +EKN
Sbjct  61   SAHERLLWRDVGDLDSCTDRDVVCQMYVQHVMIPLLDSKHVDAGVHILVTREFLETIEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            +L +RP WRV A ++N+  DS+LL SDHSIFP    + E CI VEIKPK G LP S+FI 
Sbjct  121  ILSQRPAWRVSAGRVNIHCDSVLLQSDHSIFPQ-GGEGEFCISVEIKPKWGCLPTSRFIS  179

Query  35   ESNAVKRRITR  3
            + NA+K+ +TR
Sbjct  180  KRNAIKKSVTR  190



>ref|XP_010254756.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010254757.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010254760.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010254761.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
Length=500

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 137/226 (61%), Gaps = 39/226 (17%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            +VL+ KDA +W YRGEGA NLVL+Y+G +P F GK++R+QK P N  +  NG    +V E
Sbjct  14   LVLEEKDAADWIYRGEGAANLVLAYKGSSPSFVGKVIRLQKAPKNISQSMNGTSVFSVQE  73

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAG--------------------  264
              LWKD  DL+S+ ++E     +   +M P LG EHVD G                    
Sbjct  74   CLLWKDTNDLLSSTSKENVGQLYSLHIMSPLLGSEHVDPGDLDLRKMVGRSRMVDGLYML  133

Query  263  -------------------IHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLM  141
                               + ILVS+EFLE+VEKNVL +RP WRVDAA +N+L DS LL+
Sbjct  134  ENKASLAVIESTSQSSEIQMRILVSKEFLESVEKNVLCQRPAWRVDAANINILCDSALLV  193

Query  140  SDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            SDHS+FPH   KEE CI VEIKPKCGFLP+S+FI E N +KR ITR
Sbjct  194  SDHSVFPHGILKEEPCISVEIKPKCGFLPSSRFIAEGNFIKRSITR  239



>ref|XP_004147852.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
 gb|KGN59987.1| hypothetical protein Csa_3G860230 [Cucumis sativus]
Length=444

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 132/191 (69%), Gaps = 3/191 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNG--CEYENGHPGL  396
            M +VLD  DA +W+YRGEGA+NLVL+Y G +P F GK++RIQK   NG  C        L
Sbjct  1    MEIVLDHNDAADWTYRGEGAVNLVLAYTGSSPLFFGKVVRIQKTARNGLHCTSVRHVVAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            + HE  LW+DV DL S   R++    +VQ VM P L  +HVDAG+HILV+REFLE +EKN
Sbjct  61   SAHERLLWRDVGDLDSCTDRDVVCQMYVQHVMIPLLDSKHVDAGVHILVTREFLETIEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            +L +RP WRV A ++N+  DS+LL SDHSIFP    + E CI VEIKPK G LP S+FI 
Sbjct  121  ILSQRPAWRVSAGRVNIHCDSVLLQSDHSIFPQ-GGEGEFCISVEIKPKWGCLPTSRFIS  179

Query  35   ESNAVKRRITR  3
            + NA+K+ +TR
Sbjct  180  KRNAIKKSVTR  190



>ref|XP_006473539.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Citrus sinensis]
Length=442

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 134/195 (69%), Gaps = 6/195 (3%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYE------NG  408
            M  VLD  DA +W YRGEGA NLVL+Y G +P F GK+LRI K   NG   E      NG
Sbjct  1    MDFVLDQNDAADWIYRGEGAANLVLAYAGSSPAFVGKVLRIPKAWRNGKPEESLAQCVNG  60

Query  407  HPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEA  228
                  HE  LW D ++L+S   +EI E  +V+++M P LGP+++DAG+ + V+REFLE+
Sbjct  61   GSVFGKHEQLLWGDNQELLSCSGKEIMEQMYVEKIMSPLLGPKYIDAGMCVRVTREFLES  120

Query  227  VEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPAS  48
            V+KNV  +RP WRVDAA + +  DS+LLMSDH++FP    ++E C+ VEIKPKCGFLP S
Sbjct  121  VQKNVTGQRPAWRVDAADIKIPCDSVLLMSDHTLFPQGVLEDEPCLAVEIKPKCGFLPIS  180

Query  47   KFIIESNAVKRRITR  3
            +FI E NA+KR +TR
Sbjct  181  RFIAEENAIKRSVTR  195



>ref|XP_010459951.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=444

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL  KDA++WSYRGEGA+NLVL+Y G +P F GK++RI K+P +G E  +    GLT H
Sbjct  4    IVLKPKDAVDWSYRGEGAVNLVLAYIGSSPTFLGKMMRIHKMPKDGNENGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W DVK+LVS   +EI E+ FV+ VM P LG +HV+ G  +LV++EFLE+VEK +  
Sbjct  64   EKLIWGDVKELVSCQNKEIKEYLFVKHVMRPLLGHKHVNPGTRLLVAKEFLESVEKIITS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR DAA ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S F+ E N
Sbjct  124  QRPSWRADAASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSSFVAEEN  183

Query  26   AVKRRITR  3
             +K+ ITR
Sbjct  184  VIKKSITR  191



>emb|CDY41494.1| BnaA08g20960D [Brassica napus]
Length=455

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 140/192 (73%), Gaps = 4/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP---G  399
            M + L+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E +NG+    G
Sbjct  1    MEIGLEPKDAVDWSYRGEGAVNLVLAYTGSSPSFLGKMMRIQKMPNDGKE-DNGNTSGNG  59

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT HE  +W + K+LVS   +EI E  FV+ VM P LG +HV+ G+ +LV++EFLE+VE 
Sbjct  60   LTSHEKVIWGECKELVSCQNKEIVEFLFVKHVMRPLLGHKHVNPGMRLLVAKEFLESVEN  119

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP+WR DAA ++  R+S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI
Sbjct  120  IVTSQRPSWRADAASVDTHRNSVLLMDDLTLFAHGRVEDKPCLSVEIKPKCGFLPSSSFI  179

Query  38   IESNAVKRRITR  3
             E N +K+ ITR
Sbjct  180  AEENVIKKSITR  191



>ref|XP_009110150.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Brassica rapa]
Length=455

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 140/192 (73%), Gaps = 4/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP---G  399
            M + L+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E +NG+    G
Sbjct  1    MEIGLEPKDAVDWSYRGEGAVNLVLAYTGSSPSFLGKMMRIQKMPNDGKE-DNGNTSGNG  59

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT HE  +W + K+LVS   +EI E  FV+ VM P LG +HV+ G+ +LV++EFLE+VE 
Sbjct  60   LTSHEKVIWGECKELVSCQNKEIVEFLFVKHVMRPLLGHKHVNPGMRLLVAKEFLESVEN  119

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP+WR DAA ++  R+S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI
Sbjct  120  IVTSQRPSWRADAASVDTHRNSVLLMDDLTLFAHGRVEDKPCLSVEIKPKCGFLPSSSFI  179

Query  38   IESNAVKRRITR  3
             E N +K+ ITR
Sbjct  180  AEENVIKKSITR  191



>gb|KHG30015.1| Inositol-pentakisphosphate 2-kinase -like protein [Gossypium 
arboreum]
Length=486

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            V+LD +DA++W YRGEGA NLVL+Y G +P F GK++RIQK    G    N +  LT HE
Sbjct  4    VILDKEDAVDWVYRGEGAANLVLAYTGSSPSFIGKVMRIQKSQRKGKSRVNENEVLTAHE  63

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              LW++ K+L+  P REI +  +V+ VM P LGP+HVDAG+ + V++EFL +VEKNV  +
Sbjct  64   RLLWREYKELMVWPNREIVQQLYVKHVMSPLLGPQHVDAGMRVRVTKEFLLSVEKNVTCR  123

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
            RP  R+D++++++ RDS+L++SDHS+F + + K   CI VEIKPKCGFLP S+FI E NA
Sbjct  124  RPACRIDSSQVDVNRDSVLIISDHSVFMNGSVKGGPCITVEIKPKCGFLPISRFIAEENA  183

Query  23   VKRRITR  3
            VKR ++R
Sbjct  184  VKRTLSR  190



>ref|XP_010940107.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Elaeis guineensis]
Length=445

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA++L A+DA +W Y+GEGA N+VLSYRG +    GK+LRIQKVP    +  NG   L+ 
Sbjct  1    MAMLLRAEDAKDWIYKGEGAANIVLSYRGSSLFLLGKVLRIQKVPKGSTKSVNGCAVLSR  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LW DV++LV + +++IA+  +++ VM   LGP+++D G ++ VSREFLE+VEKNV 
Sbjct  61   HEKLLWGDVEELVESKSKDIAQQNYIKHVMSHMLGPKYIDEGTYVTVSREFLESVEKNVH  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WR++AA+++   DS  L+SDHS+F   TP+ + C+ VEIKPKCGFLP+S+FI ++
Sbjct  121  DQRPAWRINAAEVDTSCDSAFLISDHSVFTG-TPRGDFCVAVEIKPKCGFLPSSEFITKA  179

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  180  NAIKKSVTR  188



>ref|XP_010940105.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Elaeis guineensis]
Length=465

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA++L A+DA +W Y+GEGA N+VLSYRG +    GK+LRIQKVP    +  NG   L+ 
Sbjct  1    MAMLLRAEDAKDWIYKGEGAANIVLSYRGSSLFLLGKVLRIQKVPKGSTKSVNGCAVLSR  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LW DV++LV + +++IA+  +++ VM   LGP+++D G ++ VSREFLE+VEKNV 
Sbjct  61   HEKLLWGDVEELVESKSKDIAQQNYIKHVMSHMLGPKYIDEGTYVTVSREFLESVEKNVH  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WR++AA+++   DS  L+SDHS+F   TP+ + C+ VEIKPKCGFLP+S+FI ++
Sbjct  121  DQRPAWRINAAEVDTSCDSAFLISDHSVFTG-TPRGDFCVAVEIKPKCGFLPSSEFITKA  179

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  180  NAIKKSVTR  188



>ref|XP_006306470.1| hypothetical protein CARUB_v10012434mg [Capsella rubella]
 gb|EOA39368.1| hypothetical protein CARUB_v10012434mg [Capsella rubella]
Length=446

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 135/188 (72%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNG-CEYENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GKILRIQK+P +G    +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYTGSSPTFLGKILRIQKMPKDGNINGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W D+KDLVS   +EI E+ FV+ VM P  G +HV+ GI +LV++EFLE V+  +  
Sbjct  64   EKLIWGDIKDLVSCQNKEIEEYLFVKHVMRPLFGHKHVNPGIRLLVAKEFLEYVDSIISS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR +AA ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI E N
Sbjct  124  QRPSWRANAASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSSFIAEEN  183

Query  26   AVKRRITR  3
             +K+ +TR
Sbjct  184  VIKKSVTR  191



>ref|XP_010498671.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=444

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RI K+P +G E  +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYTGSSPTFLGKMMRIHKMPKDGNEMGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W DVK+LVS   +EI E+ FV+ VM P LG +HV+ G  + V++EFLE+VEK +  
Sbjct  64   EKLIWGDVKELVSCQNKEIKEYLFVKHVMRPLLGRKHVNPGRRLPVAKEFLESVEKIITS  123

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            +RP+WR DAA ++  R S+LLM D ++F H   +++ C+ VEIKPKCGFLP+S FI E N
Sbjct  124  QRPSWRADAASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIKPKCGFLPSSCFIAEEN  183

Query  26   AVKRRITR  3
             +K+ ITR
Sbjct  184  VIKKSITR  191



>ref|XP_008795957.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X4 [Phoenix 
dactylifera]
Length=404

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA+VL A+DA +W Y+GEGA N+VLSYRG +    GK+LRIQKVP       NG   L+ 
Sbjct  1    MAMVLGAEDAKDWIYKGEGAANVVLSYRGSSLFLLGKVLRIQKVPKGSTHSVNGCAVLSG  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LW DV++LV + +R+IA   +++ VM   LGP+++D  I + V REFLE+++KNV 
Sbjct  61   HEKLLWGDVEELVESKSRDIAMQNYIKYVMSHMLGPKYIDDMIRVTVCREFLESIKKNVH  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WR+DAA+++ L DS  L+SDHS+F   TP+ +LC+ VEIKPKCGFLP+S+FI ++
Sbjct  121  DQRPAWRIDAAEVDALCDSAFLISDHSLFTG-TPRVDLCVAVEIKPKCGFLPSSEFITKA  179

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  180  NAIKKSVTR  188



>ref|XP_008795956.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X3 [Phoenix 
dactylifera]
Length=425

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA+VL A+DA +W Y+GEGA N+VLSYRG +    GK+LRIQKVP       NG   L+ 
Sbjct  1    MAMVLGAEDAKDWIYKGEGAANVVLSYRGSSLFLLGKVLRIQKVPKGSTHSVNGCAVLSG  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LW DV++LV + +R+IA   +++ VM   LGP+++D  I + V REFLE+++KNV 
Sbjct  61   HEKLLWGDVEELVESKSRDIAMQNYIKYVMSHMLGPKYIDDMIRVTVCREFLESIKKNVH  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WR+DAA+++ L DS  L+SDHS+F   TP+ +LC+ VEIKPKCGFLP+S+FI ++
Sbjct  121  DQRPAWRIDAAEVDALCDSAFLISDHSLFTG-TPRVDLCVAVEIKPKCGFLPSSEFITKA  179

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  180  NAIKKSVTR  188



>tpg|DAA64565.1| TPA_exp: non-functional inositol-pentakisphosphate 2-kinase 224 
[Ricinus communis]
Length=224

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>tpg|DAA64564.1| TPA_exp: non-functional inositol-pentakisphosphate 2-kinase 215 
[Ricinus communis]
Length=215

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>ref|XP_008795949.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795950.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795951.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795953.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795954.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795960.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
Length=454

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA+VL A+DA +W Y+GEGA N+VLSYRG +    GK+LRIQKVP       NG   L+ 
Sbjct  1    MAMVLGAEDAKDWIYKGEGAANVVLSYRGSSLFLLGKVLRIQKVPKGSTHSVNGCAVLSG  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LW DV++LV + +R+IA   +++ VM   LGP+++D  I + V REFLE+++KNV 
Sbjct  61   HEKLLWGDVEELVESKSRDIAMQNYIKYVMSHMLGPKYIDDMIRVTVCREFLESIKKNVH  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WR+DAA+++ L DS  L+SDHS+F   TP+ +LC+ VEIKPKCGFLP+S+FI ++
Sbjct  121  DQRPAWRIDAAEVDALCDSAFLISDHSLFTG-TPRVDLCVAVEIKPKCGFLPSSEFITKA  179

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  180  NAIKKSVTR  188



>ref|XP_004500990.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Cicer arietinum]
Length=450

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY--ENGHPGL  396
            M V+L  K+A +W YRGEGA NLVL+Y G +  F GK++RI+K P N       +    L
Sbjct  1    MEVILREKEADDWIYRGEGAANLVLAYNGSSSSFIGKVMRIRKAPRNDTPTVIASSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV +L+S+   EIA   FV  VM P LG E+VDAG+H+ VS  FLE VEKN
Sbjct  61   TAHERLLWKDVDELISSSDHEIASQLFVLHVMKPLLGSEYVDAGMHVQVSTGFLELVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WRVD A++++  D +LLMSDHS+F H      LCI VEIKPKCGFLP S FI 
Sbjct  121  VICQRPAWRVDTAQVDMHCDYVLLMSDHSLFAHGNLGSSLCISVEIKPKCGFLPVSNFIS  180

Query  35   ESNAVKRRITR  3
            E  ++K+ +TR
Sbjct  181  EETSIKKSVTR  191



>tpg|DAA64566.1| TPA_exp: non-functional inositol-pentakisphosphate 2-kinase 277 
[Ricinus communis]
Length=277

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>ref|XP_010540330.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540331.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
Length=439

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYE--NGHPGL  396
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +  N    L
Sbjct  1    MEMILEEKDASDWIYRGEGNANLVLAYAGSSPLFVGKVMRIQKARKNDKTNKSWNDTAVL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  E  LW++ K+L+S+P++E+ E  FV+ VM P LGP+HVDAG+ + VS+EFLE+V+K 
Sbjct  61   TSDEQFLWRENKELISSPSKEVLEQRFVKNVMSPLLGPKHVDAGMRVSVSKEFLESVDKK  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V  +RP WRV+AA ++   DS++LM+DHS+F         CI VEIKPKCGFLP S+FI 
Sbjct  121  VTKQRPLWRVNAANVDTSHDSVILMNDHSLFSRGISSCVDCISVEIKPKCGFLPTSRFIR  180

Query  35   ESNAVKRRITR  3
            E N VKR +TR
Sbjct  181  EGNTVKRSVTR  191



>gb|AAF86558.1|AC069252_17 F2E2.17 [Arabidopsis thaliana]
Length=457

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 138/204 (68%), Gaps = 17/204 (8%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY-ENGHPGLTVH  387
            +VL+ KDA++WSYRGEGA+NLVL+Y G +P F GK++RIQK+P +G E  +    GLT H
Sbjct  4    IVLEPKDAVDWSYRGEGAVNLVLAYTGSSPSFLGKMMRIQKMPKDGNENGDKSENGLTTH  63

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAG----------------IHI  255
            E  +W DVKDLVS   +EI E+ FV+ VM P LG +HV+ G                I +
Sbjct  64   EKLIWGDVKDLVSCKNKEIEEYLFVKHVMRPLLGRKHVNPGVCFLFISFSCHDSNAMILL  123

Query  254  LVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIK  75
            LV++EFLE+VEK +  +RP+WR D A ++  R S+LLM D ++F H   +++ C+ VEIK
Sbjct  124  LVAKEFLESVEKIITSQRPSWRADVASVDTNRSSVLLMDDLTLFAHGHVEDKPCLSVEIK  183

Query  74   PKCGFLPASKFIIESNAVKRRITR  3
            PKCGFLP+S FI E N +K+ ITR
Sbjct  184  PKCGFLPSSSFIAEENVIKKSITR  207



>gb|KHG28547.1| Inositol-pentakisphosphate 2-kinase -like protein [Gossypium 
arboreum]
Length=505

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 138/219 (63%), Gaps = 32/219 (15%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            V+L+ KDA++W YRGEGA NL+L+Y G +P F GK+LRIQK   NG         LT HE
Sbjct  4    VILEEKDAVDWIYRGEGAANLILAYTGSSPAFIGKVLRIQKSQRNGKSGVKEGRALTTHE  63

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              LW++ K+L ++  REI E  +V+ VM P LGP+HVD GI +LV++EFL++VEKNV   
Sbjct  64   RLLWRENKELTASSNREILEQLYVKHVMSPLLGPKHVDVGIRVLVTKEFLKSVEKNVTCH  123

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFP------------------------HVT-----  111
            RP WRV ++++++ RDS+L++SDHSIFP                        +VT     
Sbjct  124  RPAWRVHSSQVDVNRDSVLILSDHSIFPDGLEVREGLGSGSQCVICLEIYRSYVTLCRLE  183

Query  110  ---PKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
                K E CI VEIKPKCGFLP S+FI E NAVKR + R
Sbjct  184  VGNLKREPCITVEIKPKCGFLPISRFITEENAVKRNVVR  222



>tpg|DAA64567.1| TPA_exp: inositol-pentakisphosphate 2-kinase 450 [Ricinus communis]
Length=450

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>ref|XP_006302305.1| hypothetical protein CARUB_v10020353mg [Capsella rubella]
 gb|EOA35203.1| hypothetical protein CARUB_v10020353mg [Capsella rubella]
Length=422

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 131/190 (69%), Gaps = 4/190 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY--ENGHPGLTV  390
            +VL+AKDA++WSYRGEGA NLVLSY G +P F GK++RI K P NG E    NG+ GLT 
Sbjct  4    IVLEAKDAVDWSYRGEGAANLVLSYTGSSPTFLGKVMRIMKWPKNGNENGDTNGN-GLTT  62

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  +W + KDLVS   +EI E+ +V+ VM P LG +HV+AGI +LVS+EFLE+  K V 
Sbjct  63   HEKLIWGENKDLVSCQNKEIVEYLYVKHVMRPLLGHKHVNAGIRLLVSKEFLESATKIVS  122

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHV-TPKEELCICVEIKPKCGFLPASKFIIE  33
             +R  WR +AA  +  R S+LLM D ++F H        C+ VEIKPKCGFLP+S FI E
Sbjct  123  SQRFPWRANAANADTNRSSVLLMDDMTLFDHGHVDDHNPCLTVEIKPKCGFLPSSSFIAE  182

Query  32   SNAVKRRITR  3
             N +K+ ITR
Sbjct  183  ENVIKKSITR  192



>gb|KEH36181.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=447

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNG--CEYENGHPGL  396
            M V L  K+A +W YRGEGA NLVL+Y G  P F  K++RI+K P N    E       L
Sbjct  1    MEVTLREKEADDWVYRGEGAANLVLAYIGSCPAFFRKVMRIRKAPRNDSVTEIRTSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV +L+++   E++   FV  VM P LG ++VDAG+H+ VSR FLE++EKN
Sbjct  61   TAHERLLWKDVDELIASSDHEVSSQLFVLHVMKPLLGSKYVDAGMHVKVSRGFLESIEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP  RVD A+L++  D +LLMSDHSIF H   +   CI VEIKPKCGFLP S+F+ 
Sbjct  121  VICQRPAGRVDTAQLDMHCDYVLLMSDHSIFTHGNLESSPCISVEIKPKCGFLPVSRFVS  180

Query  35   ESNAVKRRITR  3
            E  A+K+R+TR
Sbjct  181  EETAIKKRVTR  191



>tpg|DAA64568.1| TPA_exp: inositol-pentakisphosphate 2-kinase 452 [Ricinus communis]
Length=452

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>gb|KEH36180.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=440

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNG--CEYENGHPGL  396
            M V L  K+A +W YRGEGA NLVL+Y G  P F  K++RI+K P N    E       L
Sbjct  1    MEVTLREKEADDWVYRGEGAANLVLAYIGSCPAFFRKVMRIRKAPRNDSVTEIRTSPSAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  LWKDV +L+++   E++   FV  VM P LG ++VDAG+H+ VSR FLE++EKN
Sbjct  61   TAHERLLWKDVDELIASSDHEVSSQLFVLHVMKPLLGSKYVDAGMHVKVSRGFLESIEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP  RVD A+L++  D +LLMSDHSIF H   +   CI VEIKPKCGFLP S+F+ 
Sbjct  121  VICQRPAGRVDTAQLDMHCDYVLLMSDHSIFTHGNLESSPCISVEIKPKCGFLPVSRFVS  180

Query  35   ESNAVKRRITR  3
            E  A+K+R+TR
Sbjct  181  EETAIKKRVTR  191



>emb|CAN76214.1| hypothetical protein VITISV_009512 [Vitis vinifera]
Length=696

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 138/238 (58%), Gaps = 54/238 (23%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQK----VPTNGCEYENGH  405
             M V L   DA  W YRGEGA+NLVL+Y G +P F GK+LRIQK    V     ++ NGH
Sbjct  2    EMEVALHKNDAPHWVYRGEGAVNLVLAYNGSSPLFVGKVLRIQKASRKVAPGSEQWLNGH  61

Query  404  PGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
              L      +WKD  D++S+P++EIA+  FVQ VM P LG +H+DAGI +LVSREFLE+V
Sbjct  62   ERL------IWKDNPDILSSPSKEIAQQMFVQNVMXPRLGSQHIDAGIRVLVSREFLESV  115

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIK----------  75
            EKNVL +RP WR++AAK+N   D  LL+SDHS+FPH   K E CI VEIK          
Sbjct  116  EKNVLCQRPAWRIEAAKVNTNCDYALLLSDHSVFPHSFVKGEPCISVEIKVFPSLLISSF  175

Query  74   ----------------------------------PKCGFLPASKFIIESNAVKRRITR  3
                                              PKCGFLP S+FI E NA+K+R+TR
Sbjct  176  HFISSLQSINLFSSLQTSYFTPLPIDFTFFSGKQPKCGFLPFSRFIAEGNAIKKRVTR  233



>tpg|DAA64569.1| TPA_exp: inositol-pentakisphosphate 2-kinase 555 [Ricinus communis]
Length=555

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>ref|XP_004499187.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Cicer arietinum]
Length=454

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 128/191 (67%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN--GHPGL  396
            M + L  +DA  W YRGEGA NLVLSY G +  + GK++RI+K P      +       L
Sbjct  1    MELTLTEQDADNWVYRGEGAANLVLSYNGSSFSYIGKVMRIRKSPRKESLLKGVRNSIAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  +WKDV +L+S+  +EIA   +VQ VM P LG ++VDAG HILV++EFLE+VEKN
Sbjct  61   TPHERLIWKDVHELISSSDKEIAGQLYVQHVMKPLLGSKYVDAGNHILVTKEFLESVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V+ +RP WRVD ++++   D  LLMSDHS+FP         I VEIKPKCGFLP S+FI 
Sbjct  121  VVSQRPAWRVDVSRVDTQCDFGLLMSDHSLFPDGCQGSSPSISVEIKPKCGFLPQSEFIS  180

Query  35   ESNAVKRRITR  3
            E  A+KRR+TR
Sbjct  181  EGTAIKRRVTR  191



>ref|XP_009389920.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            ++L  +DA +W Y+GEGA N+VL Y G +    GK+LRIQKV        NG   L+ HE
Sbjct  1    MLLRPEDAKDWFYKGEGAANIVLGYCGSSLSLVGKVLRIQKVAKGRSRSPNGCLVLSNHE  60

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              +W+D+ +LV   ++++A   F+Q VM   L  +HVDAGI + VS+EFLEAVE N+  +
Sbjct  61   RLVWRDIGELVECTSKDVAARAFIQHVMSNLLDSKHVDAGILVHVSKEFLEAVEGNIKSQ  120

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
            RP WRVDA+K+++L +S LL+SDHSI    TPK +LCI VEIKPKCGFLP+S++I+E+NA
Sbjct  121  RPPWRVDASKIDVLHESALLISDHSIISG-TPKHDLCIAVEIKPKCGFLPSSEYIVEANA  179

Query  23   VKRRITR  3
            VK+ +TR
Sbjct  180  VKKHVTR  186



>ref|XP_002510425.1| Inositol-pentakisphosphate 2-kinase, putative [Ricinus communis]
 gb|EEF52612.1| Inositol-pentakisphosphate 2-kinase, putative [Ricinus communis]
Length=695

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGC-EYENGHPGLT  393
            M V L+ KD  +W YRGEGA NLVL+Y G +P F GK++R+ K+  NG   +      LT
Sbjct  1    MEVKLEKKDVADWVYRGEGAANLVLAYTGSSPLFIGKVMRVPKIERNGTLHFVEDRAVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ ++L+S+ T+E+    +V+ VMCP LG +HVD G+H+ VSREFLE +E+ V
Sbjct  61   EKERLLWREFEELISSSTKEVTGLLYVKHVMCPLLGADHVDPGMHVEVSREFLERIEQKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            + +RP WRVDAAK++  R S+LLMSDHS+F     K   C+ VEIKPKCGF+P S+ I E
Sbjct  121  ISQRPAWRVDAAKIDTDRHSVLLMSDHSVFSRGALKVGSCLSVEIKPKCGFIPLSRLIAE  180

Query  32   SNAVKRRITR  3
             NA+K+  TR
Sbjct  181  RNALKKSTTR  190



>pdb|2XAL|A Chain A, Lead Derivative Of Inositol 1,3,4,5,6-Pentakisphosphate 
2- Kinase From A. Thaliana In Complex With Adp And Ip6.
 pdb|2XAL|B Chain B, Lead Derivative Of Inositol 1,3,4,5,6-Pentakisphosphate 
2- Kinase From A. Thaliana In Complex With Adp And Ip6.
 pdb|2XAM|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
 pdb|2XAM|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
 pdb|2XAN|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Amp Pnp And Ip5
 pdb|2XAN|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Amp Pnp And Ip5
 pdb|2XAO|A Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase From A. 
Thaliana In Complex With Ip5
 pdb|2XAO|B Chain B, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase From A. 
Thaliana In Complex With Ip5
 pdb|2XAR|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Ip6.
 pdb|2XAR|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Ip6.
Length=451

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  1    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  61   LTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  120

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  121  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  180

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  181  GKENMLKTSVSR  192



>pdb|4AXE|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase In Complex 
With Adp
Length=456

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  6    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  65

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  66   LTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  125

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  126  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  185

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  186  GKENMLKTSVSR  197



>pdb|4AQK|A Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase In Complex 
With Adp And Ip6
 pdb|4AXF|A Chain A, Insp5 2-k In Complex With Ins(3,4,5,6)p4 Plus Amppnp
Length=456

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  6    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  65

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  66   LTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  125

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  126  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  185

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  186  GKENMLKTSVSR  197



>ref|XP_004499186.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Cicer arietinum]
Length=458

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 131/197 (66%), Gaps = 10/197 (5%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN--GHPGL  396
            M + L  +DA  W YRGEGA NLVLSY G +  + GK++RI+K P      +       L
Sbjct  1    MELTLTEQDADNWVYRGEGAANLVLSYNGSSFSYIGKVMRIRKSPRKESLLKGVRNSIAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  +WKDV +L+S+  +EIA   +VQ VM P LG ++VDAG HILV++EFLE+VEKN
Sbjct  61   TPHERLIWKDVHELISSSDKEIAGQLYVQHVMKPLLGSKYVDAGNHILVTKEFLESVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC------ICVEIKPKCGFLP  54
            V+ +RP WRVD ++++   D  LLMSDHS+FP  T  E  C      I VEIKPKCGFLP
Sbjct  121  VVSQRPAWRVDVSRVDTQCDFGLLMSDHSLFPDGT--ETCCQGSSPSISVEIKPKCGFLP  178

Query  53   ASKFIIESNAVKRRITR  3
             S+FI E  A+KRR+TR
Sbjct  179  QSEFISEGTAIKRRVTR  195



>pdb|3UDS|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp.
 pdb|3UDS|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp.
 pdb|3UDT|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip5.
 pdb|3UDT|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip5.
Length=493

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  35   MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  94

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  95   LTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  154

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  155  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  214

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  215  GKENILKTSVSR  226



>ref|NP_568613.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis thaliana]
 sp|Q93YN9.1|IPPK_ARATH RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=AtIPK1; Short=InsP5 2-kinase 
[Arabidopsis thaliana]
 gb|AAL24380.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13361.1| unknown protein [Arabidopsis thaliana]
 gb|AAZ99216.1| inositol polyphosphate IP4/IP5 2-kinase [Arabidopsis thaliana]
 gb|AED94867.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis thaliana]
Length=451

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  1    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNANGVVSV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +V+ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  61   LTSDEQHLWRENNELISSPNKEVLEQRYVKNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  120

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  121  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISSGGDCISVEIKPKCGFLPTSRFI  180

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  181  GKENMLKTSVSR  192



>gb|KEH40178.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=447

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 126/191 (66%), Gaps = 2/191 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN--GHPGL  396
            M + L  +DA  W YRGEGA NLVLSY G +P + GK++RI+K P      +       L
Sbjct  1    MELTLTEEDAAHWVYRGEGAANLVLSYTGSSPSYIGKVMRIRKSPRKESALQGVRNTIAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  +WKDV +L+S+  +EIA   +V+ VM P LG ++VDAG HILV++EFLE VE+N
Sbjct  61   TPHERLIWKDVPELISSSDKEIAGQLYVEHVMKPLLGSKYVDAGTHILVTKEFLETVERN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
            V  +RP  RVD ++++   D  LLMSDHSIFP  +      + VEIKPKCGFLP S+FI 
Sbjct  121  VASQRPAGRVDVSRVDTQCDFGLLMSDHSIFPQGSQGSIPSLSVEIKPKCGFLPTSRFIS  180

Query  35   ESNAVKRRITR  3
            E  A+KRR TR
Sbjct  181  EETAIKRRKTR  191



>gb|KEH40179.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=478

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 2/192 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN--GHPG  399
            +M + L  +DA  W YRGEGA NLVLSY G +P + GK++RI+K P      +       
Sbjct  31   KMELTLTEEDAAHWVYRGEGAANLVLSYTGSSPSYIGKVMRIRKSPRKESALQGVRNTIA  90

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT HE  +WKDV +L+S+  +EIA   +V+ VM P LG ++VDAG HILV++EFLE VE+
Sbjct  91   LTPHERLIWKDVPELISSSDKEIAGQLYVEHVMKPLLGSKYVDAGTHILVTKEFLETVER  150

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
            NV  +RP  RVD ++++   D  LLMSDHSIFP  +      + VEIKPKCGFLP S+FI
Sbjct  151  NVASQRPAGRVDVSRVDTQCDFGLLMSDHSIFPQGSQGSIPSLSVEIKPKCGFLPTSRFI  210

Query  38   IESNAVKRRITR  3
             E  A+KRR TR
Sbjct  211  SEETAIKRRKTR  222



>emb|CDY52373.1| BnaA09g15720D [Brassica napus]
Length=450

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 130/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYE--NGHPG-LT  393
            ++L+ KDA +W YRGEG  NLVL+Y   +P F GK++RIQK P      +  NG    LT
Sbjct  1    MILEEKDASDWIYRGEGGANLVLAYAASSPLFVGKVIRIQKAPKTDKANKAVNGAASVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ K+LVS+P +E+ E  +V+ V+ P LGP+H+D G+ + VS+EFLE+V+K V
Sbjct  61   TDEQLLWRENKELVSSPNKEVVEQIYVKDVIIPLLGPKHIDPGVRVSVSKEFLESVDKKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
              +RP WRV+AA ++   DS L+++DHS+F       + C+ VEIKPKCGFLP S+FI E
Sbjct  121  TKQRPPWRVNAANVDTSHDSALILNDHSLFSQGISSGD-CLSVEIKPKCGFLPTSRFISE  179

Query  32   SNAVKRRITR  3
             N +KRR++R
Sbjct  180  ENKLKRRVSR  189



>pdb|3UDZ|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
 pdb|3UDZ|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
Length=493

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 127/189 (67%), Gaps = 3/189 (2%)
 Frame = -3

Query  560  VLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PGLTV  390
            +L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     LT 
Sbjct  38   ILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSVLTS  97

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K V 
Sbjct  98   DEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVT  157

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI + 
Sbjct  158  KQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFIGKE  217

Query  29   NAVKRRITR  3
            N +K  ++R
Sbjct  218  NILKTSVSR  226



>ref|XP_004499185.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Cicer arietinum]
Length=466

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 131/206 (64%), Gaps = 20/206 (10%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN--GHPGL  396
            M + L  +DA  W YRGEGA NLVLSY G +  + GK++RI+K P      +       L
Sbjct  1    MELTLTEQDADNWVYRGEGAANLVLSYNGSSFSYIGKVMRIRKSPRKESLLKGVRNSIAL  60

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T HE  +WKDV +L+S+  +EIA   +VQ VM P LG ++VDAG HILV++EFLE+VEKN
Sbjct  61   TPHERLIWKDVHELISSSDKEIAGQLYVQHVMKPLLGSKYVDAGNHILVTKEFLESVEKN  120

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCIC---------------VE  81
            V+ +RP WRVD ++++   D  LLMSDHS+FP  T   E CI                VE
Sbjct  121  VVSQRPAWRVDVSRVDTQCDFGLLMSDHSLFPDGT---ETCITALDSTGCQGSSPSISVE  177

Query  80   IKPKCGFLPASKFIIESNAVKRRITR  3
            IKPKCGFLP S+FI E  A+KRR+TR
Sbjct  178  IKPKCGFLPQSEFISEGTAIKRRVTR  203



>ref|XP_006403344.1| hypothetical protein EUTSA_v10003206mg [Eutrema salsugineum]
 gb|ESQ44797.1| hypothetical protein EUTSA_v10003206mg [Eutrema salsugineum]
Length=453

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 129/194 (66%), Gaps = 7/194 (4%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYE------NGHP  402
            ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK P N    +      NG  
Sbjct  1    MILEEKDASDWIYRGEGGANLVLAYTGSSPLFVGKVIRIQKAPKNDKANKSVIVSANGVV  60

Query  401  G-LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
              LT  E  LW+D K+L+S+  +E+ E  +V+ V+ P +GP+HVDAG+ + VS+EFL+AV
Sbjct  61   SVLTSDEQLLWRDNKELISSTNKEVLEQRYVKHVIIPLMGPKHVDAGVRVSVSKEFLQAV  120

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASK  45
            +K V  +RP WRV+AA ++   DS L+++DHS+FP        C  VEIKPKCGFLP S+
Sbjct  121  DKKVTKQRPPWRVNAANVDTSHDSALILNDHSLFPQGISSGGDCFSVEIKPKCGFLPTSR  180

Query  44   FIIESNAVKRRITR  3
            F+ E N +K  ++R
Sbjct  181  FLSEENMLKTSVSR  194



>pdb|4AXD|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase In Complex 
With Amppnp
Length=456

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 128/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  6    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  65

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  66   LTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  125

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP  RV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  126  KVTKQRPLARVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  185

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  186  GKENMLKTSVSR  197



>pdb|4AXC|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Apo Form
Length=456

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 128/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  6    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  65

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P +E+ E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  66   LTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  125

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP  RV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  126  KVTKQRPLARVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  185

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  186  GKENMLKTSVSR  197



>ref|XP_009390180.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 126/183 (69%), Gaps = 1/183 (1%)
 Frame = -3

Query  551  AKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLW  372
            A DA +W Y+GEGA N+VL Y G +    GK+LRIQKV   G    NG   L+ HE  +W
Sbjct  5    ADDAKDWFYKGEGAANIVLGYCGSSLFLVGKVLRIQKVAKGGSPSPNGCLVLSDHERLMW  64

Query  371  KDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTW  192
            KD+ +L  + ++++A   F+  VM   L  +H+DAGI + VS+EFLEAVE N+  +RP W
Sbjct  65   KDIGELAESTSKDVAATAFIDHVMRNLLDSKHIDAGILVHVSKEFLEAVEGNIKSQRPPW  124

Query  191  RVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRR  12
            R+DA+K+++L +S  L+SDHSI    TPK + CI VEIKPKCGFLP+S++I E NAVKR 
Sbjct  125  RIDASKIDVLCESAFLISDHSIIIG-TPKHDFCIAVEIKPKCGFLPSSEYIAEKNAVKRH  183

Query  11   ITR  3
            +TR
Sbjct  184  VTR  186



>ref|XP_009390179.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 126/183 (69%), Gaps = 1/183 (1%)
 Frame = -3

Query  551  AKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLW  372
            A DA +W Y+GEGA N+VL Y G +    GK+LRIQKV   G    NG   L+ HE  +W
Sbjct  14   ADDAKDWFYKGEGAANIVLGYCGSSLFLVGKVLRIQKVAKGGSPSPNGCLVLSDHERLMW  73

Query  371  KDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTW  192
            KD+ +L  + ++++A   F+  VM   L  +H+DAGI + VS+EFLEAVE N+  +RP W
Sbjct  74   KDIGELAESTSKDVAATAFIDHVMRNLLDSKHIDAGILVHVSKEFLEAVEGNIKSQRPPW  133

Query  191  RVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRR  12
            R+DA+K+++L +S  L+SDHSI    TPK + CI VEIKPKCGFLP+S++I E NAVKR 
Sbjct  134  RIDASKIDVLCESAFLISDHSIIIG-TPKHDFCIAVEIKPKCGFLPSSEYIAEKNAVKRH  192

Query  11   ITR  3
            +TR
Sbjct  193  VTR  195



>ref|XP_009114034.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Brassica rapa]
Length=443

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHE  384
            ++L+ KDA +W YRGEG  NLVL+Y   +P F GK++RIQK P    +       LT  E
Sbjct  1    MILEEKDASDWIYRGEGGANLVLAYAASSPLFVGKVIRIQKAP-KADKANKAASVLTTDE  59

Query  383  IHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHK  204
              LW++ K+LVS+P +E+ E  +V+ V+ P LGP+++D G+ + VS+EFLE+V+K V  +
Sbjct  60   QLLWRENKELVSSPNKEVVEQRYVKDVIIPLLGPKYIDPGVRVSVSKEFLESVDKKVTKQ  119

Query  203  RPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
            RP WRV+AA ++   DS L+++DHS+F   T   + C+ VEIKPKCGFLP S+FI E N 
Sbjct  120  RPPWRVNAANVDTSHDSALILNDHSLFSQGTSSGD-CLSVEIKPKCGFLPTSRFISEENK  178

Query  23   VKRRITR  3
            +KR I+R
Sbjct  179  LKRSISR  185



>ref|XP_010494238.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Camelina sativa]
Length=451

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTN--GCEYENGHPG-  399
            M +VL+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +  NG    
Sbjct  1    MEMVLEEKDACDWIYRGEGGANLVLAYAGSSPTFVGKVIRIQKARRNDKATKSANGVVSV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E  LW++ ++++S+P +E+ E  +V+ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  61   LTSDEQLLWREHQEIISSPNKEVLEQRYVKHVIIPLLGPKHVDAGVRVSVSKEFLECVDK  120

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  121  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISNSGDCISVEIKPKCGFLPTSRFI  180

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  181  GKENMLKTSVSR  192



>pdb|4LV7|A Chain A, Crystal Structure Of Inositol 1,3,4,5,6-pentakisphosphate 
2-kinase E82c/s142c
 pdb|4LV7|B Chain B, Crystal Structure Of Inositol 1,3,4,5,6-pentakisphosphate 
2-kinase E82c/s142c
Length=493

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  35   MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNSNGVVSV  94

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E HLW++  +L+S+P + + E  +VQ V+ P LGP+HVDAG+ + VS+EFLE V+K
Sbjct  95   LTSDEQHLWRENNELISSPNKCVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDK  154

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   D  L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  155  KVTKQRPLWRVNAANVDTSHDCALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFI  214

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  215  GKENILKTSVSR  226



>ref|XP_002865479.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41738.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 128/190 (67%), Gaps = 3/190 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PGLT  393
            +VL+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N   +   +     LT
Sbjct  1    MVLEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAHMTANGVVSVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ K+L+S+P +E+ E  +V+ V+ P LGP+HVDAG+ + VS+EFLE V+K V
Sbjct  61   SDEQLLWRENKELISSPNKEVLEQRYVKHVIIPLLGPKHVDAGVRVSVSKEFLECVDKKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
              +RP WRV+AA ++   DS L+++DHS+F H       CI VEIKPKCGFLP S+FI +
Sbjct  121  TKQRPLWRVNAAHVDTSHDSALILNDHSLFSHGIFSIGDCISVEIKPKCGFLPTSRFIGK  180

Query  32   SNAVKRRITR  3
             N +K  ++R
Sbjct  181  ENMLKTSVSR  190



>emb|CDX95152.1| BnaC09g17180D [Brassica napus]
Length=447

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 129/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVP--TNGCEYENGHPG-LT  393
            ++L+ KDA +W YRGEG  NLVL+Y   +P F GK++RIQK P      +  NG    LT
Sbjct  1    MILEEKDASDWIYRGEGGANLVLAYAASSPLFVGKVIRIQKAPKADKANKAVNGAASVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ K+LVS+P +E+ E  +V+ V+ P LGP+H+D G+ + VS+EFLE+V+K V
Sbjct  61   SDEKLLWRENKELVSSPNKEVVEQRYVKDVIIPLLGPKHIDPGVRVSVSKEFLESVDKKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPK-EELCICVEIKPKCGFLPASKFII  36
              +RP WRV+AA ++   DS L+++DHS+F   T      C+ VEIKPKCGFLP S+FI 
Sbjct  121  TKQRPPWRVNAANVDTSHDSALILNDHSLFSQGTSSGGGDCLSVEIKPKCGFLPTSRFIS  180

Query  35   ESNAVKRRITR  3
            E N +KR ++R
Sbjct  181  EENKLKRSVSR  191



>ref|XP_010539888.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Tarenaya 
hassleriana]
Length=417

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  LRIQKVPTNGCEY--ENGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGP  282
            +RIQK+P +G E   +N   GLT HE  +W++V++LVS   +E+AEH +V+ VM P LGP
Sbjct  1    MRIQKMPKDGNENSNDNNDTGLTSHEKLVWREVEELVSCQDKEVAEHMYVKLVMSPLLGP  60

Query  281  EHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKE  102
            +HVDAG  +LV+REFLE+VE+NV+ +RP+WRVDAAK++ LR S+LLM DH++F   + K+
Sbjct  61   KHVDAGTRLLVAREFLESVEENVVSQRPSWRVDAAKVDTLRSSVLLMDDHTLFTCGSIKD  120

Query  101  ELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            E CI VEIKPKCGFLP S +I E NA+K+  TR
Sbjct  121  ETCISVEIKPKCGFLPDSSYITEENAIKKTRTR  153



>ref|XP_006280454.1| hypothetical protein CARUB_v10026386mg [Capsella rubella]
 gb|EOA13352.1| hypothetical protein CARUB_v10026386mg [Capsella rubella]
Length=451

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M +VL+ KD  +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  1    MEMVLEEKDGSDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKANKNVNGVVSV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E  LW++ K+L+S+P +E+ E  +V+ V+ P LG +HVDAG+ + VS++FLE V+K
Sbjct  61   LTSDEQLLWRENKELISSPNKEVLEQRYVKHVIIPLLGSKHVDAGVRVSVSKKFLECVDK  120

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  121  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISSSGDCISVEIKPKCGFLPTSRFI  180

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  181  CKENMLKTSVSR  192



>ref|XP_010481940.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=453

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 128/192 (67%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTN--GCEYENGHPG-  399
            M +VL+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +  NG    
Sbjct  1    MEMVLEEKDACDWIYRGEGGANLVLAYAGSSPPFVGKVIRIQKARRNDKATKSANGVVSV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E  LW++ K+++S+P +E+ E  +V+ V+ P LG +HVDAG+ + VS+EFLE V+K
Sbjct  61   LTSDEQLLWREHKEIISSPNKEVLEQRYVKHVIIPLLGTKHVDAGVRVSVSKEFLECVDK  120

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  121  KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISSSGDCISVEIKPKCGFLPTSRFI  180

Query  38   IESNAVKRRITR  3
             + N +K  ++R
Sbjct  181  GKENMLKTSVSR  192



>gb|AHZ62755.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Brassica napus]
Length=447

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVP--TNGCEYENGHPGL-T  393
            ++L+ KDA +W Y GEG  NLVL+Y   +P F GK++RIQK P      +  NG   + T
Sbjct  1    MILEEKDASDWIYXGEGGANLVLAYAASSPLFVGKVIRIQKAPKADKANKAVNGAASVVT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ K+LVS+P +E+ E  +V+ V+ P LGP+H+D G+ + VS+EFLE+V+K V
Sbjct  61   SDEKLLWRENKELVSSPNKEVVEQRYVKDVIIPLLGPKHIDPGVRVSVSKEFLESVDKKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPK-EELCICVEIKPKCGFLPASKFII  36
              +RP WRV+AA ++   DS L+++DHS+F   T      C+ VEIKPKCGFLP S+FI 
Sbjct  121  TKQRPPWRVNAANVDTSHDSALILNDHSLFSQGTSSGGGDCLSVEIKPKCGFLPTSRFIS  180

Query  35   ESNAVKRRITR  3
            E N +KR ++R
Sbjct  181  EENKLKRSVSR  191



>ref|XP_004168683.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
Length=172

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M  VL  KDA +W YRGEGA NLVL+Y G +  F GK++RIQK P NG +        + 
Sbjct  1    METVLKEKDAADWVYRGEGAANLVLAYTGSSQTFIGKVMRIQKAPINGSQRARSPTAFSK  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            +E  LW D+ +LVS+  R+ A   FVQ+VM P LG +HVDAG  ILVSREFLE VEKNV 
Sbjct  61   YEYLLWGDIGNLVSSSDRDAAAQTFVQRVMSPLLGSKHVDAGKLILVSREFLELVEKNVS  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICV  84
             +RP+WRV+A K++  RD +L++SDHSIFP+   K    +C+
Sbjct  121  SQRPSWRVNAGKIDTQRDYVLILSDHSIFPN--GKSACVVCL  160



>ref|XP_002888206.1| hypothetical protein ARALYDRAFT_475379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64465.1| hypothetical protein ARALYDRAFT_475379 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 137/228 (60%), Gaps = 6/228 (3%)
 Frame = -3

Query  674  GVLFRLSDLRLGEYLGFSPYRFLSLQSTFPILIPRMAVVLDAKDAMEWSYRGEGAINLVL  495
            G LF +  L     L     RF        + +    +VL+ KDA++WSYR EG +NLVL
Sbjct  2    GTLFTIWSLLKSYVLMLWTIRFCQYYVLLGVWVQMEEIVLETKDAVDWSYRSEGVVNLVL  61

Query  494  SYRGIAPRFAGKILRIQKVPTNGCEYENGH---PGLTVHEIHLWKDVKDLVSAPTREIAE  324
            +Y G +P F GK++R +K+   G E  NG     GLT  E  +W D+KDLVS   +EIAE
Sbjct  62   AYTGSSPTFLGKVMRTKKMRNTGNE--NGDRSGNGLTTQEKLIWGDIKDLVSCQNKEIAE  119

Query  323  HFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILL  144
            + FV+ VM P LG ++V+AGI + V +EFLE+V+  V  +R +WR +AA ++  R   LL
Sbjct  120  YLFVKHVMKPLLGHKYVNAGIPLPVEKEFLESVKTIVTSQRHSWRANAASVDTNRSFALL  179

Query  143  MSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            + D +IF H   ++   C+ VEIKPKCGFL +S FI   N +K+ I+R
Sbjct  180  LDDLTIFSHGQIEDHKPCLTVEIKPKCGFLSSSSFIAGENVIKKSISR  227



>gb|KFK31811.1| hypothetical protein AALP_AA6G161800 [Arabis alpina]
Length=470

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 127/192 (66%), Gaps = 7/192 (4%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPR----FAGKILRIQKVPTNGCEYENG-HPG  399
            V+L+ KDA +W YRGEG  NLVL+Y G +      F GK++RIQK   N  +  NG    
Sbjct  4    VILEGKDACDWVYRGEGGANLVLAYSGSSSSPSSLFVGKVIRIQKARKN--DKANGVFSV  61

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT  E  LW++ K+L+S+  +E+ E  +V+ V+ P LG +HVDAG+ I VS+EFLE+V+K
Sbjct  62   LTCDEQLLWRENKELISSQNKEVLEQRYVKHVIIPLLGSKHVDAGVRISVSKEFLESVDK  121

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             V  +RP WRV+AA ++   DS L+++DHS+F         CI VEIKPKCGFLP S+FI
Sbjct  122  KVTKQRPPWRVNAANVDTSHDSALILNDHSLFSQGISSGGDCISVEIKPKCGFLPTSRFI  181

Query  38   IESNAVKRRITR  3
             E N +KR ++R
Sbjct  182  SEENMLKRSVSR  193



>ref|XP_008795955.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Phoenix 
dactylifera]
Length=432

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 125/189 (66%), Gaps = 23/189 (12%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            MA+VL A+DA +W Y+GEGA N+VLSYRG +    GK+LRIQKVP       NG   L+ 
Sbjct  1    MAMVLGAEDAKDWIYKGEGAANVVLSYRGSSLFLLGKVLRIQKVPKGSTHSVNGCAVLSG  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            HE  LW DV++LV + +R+IA   ++                      +EFLE+++KNV 
Sbjct  61   HEKLLWGDVEELVESKSRDIAMQNYI----------------------KEFLESIKKNVH  98

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             +RP WR+DAA+++ L DS  L+SDHS+F   TP+ +LC+ VEIKPKCGFLP+S+FI ++
Sbjct  99   DQRPAWRIDAAEVDALCDSAFLISDHSLFTG-TPRVDLCVAVEIKPKCGFLPSSEFITKA  157

Query  29   NAVKRRITR  3
            NA+K+ +TR
Sbjct  158  NAIKKSVTR  166



>gb|ACF78888.1| unknown [Zea mays]
 gb|ACF86397.1| unknown [Zea mays]
 gb|AFW59742.1| hypothetical protein ZEAMMB73_223578 [Zea mays]
 gb|AFW59743.1| hypothetical protein ZEAMMB73_223578 [Zea mays]
Length=218

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 118/190 (62%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR++K+  N  +        +
Sbjct  2    EMDGVLQAADAKDWVYKGEGAANLILSYTGSSPSMLGKVLRLKKILKNKSQRAPSCIVFS  61

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  LW  + +LV +  ++     +   VM   LG  HVD G+ + VSR+FLE VEKNV
Sbjct  62   SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGVRVRVSRDFLELVEKNV  121

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L  RP  RV+A+ ++   D+ LL++DHS+F    PK   CI VEIK KCGFLP+S++I E
Sbjct  122  LSSRPAGRVNASSIDNTADAALLIADHSLFSG-NPKGSSCIAVEIKAKCGFLPSSEYISE  180

Query  32   SNAVKRRITR  3
             N +K+++TR
Sbjct  181  DNTIKKQVTR  190



>gb|ABK24850.1| unknown [Picea sitchensis]
Length=508

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 123/192 (64%), Gaps = 3/192 (2%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTN---GCEYENGHPG  399
            M  + +A +A EW Y+GEGA N+++ Y G  P F GK+LR++K P          N  P 
Sbjct  1    MLSLFEANNAEEWDYKGEGAANVIVLYCGTLPNFVGKVLRVKKAPQKFLKDNHLRNKAPV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            L+V E  +W D +++V+A ++EI    +VQ  + P LG E+VD GI I VS  FLEA+E+
Sbjct  61   LSVEEQSIWSDWQEVVAANSKEILAQAYVQHAIGPLLGSEYVDPGILIRVSEGFLEALEQ  120

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFI  39
             + +KRP WR++AAK++L  D  L+MSDHS+F         CI +EIKPKCGFLP+S+FI
Sbjct  121  KISNKRPAWRIEAAKIDLQSDFALIMSDHSLFLRGPNDTAPCISIEIKPKCGFLPSSRFI  180

Query  38   IESNAVKRRITR  3
               N +KR ++R
Sbjct  181  SAENHIKRLVSR  192



>tpg|DAA35552.1| TPA: hypothetical protein ZEAMMB73_927289 [Zea mays]
Length=526

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 122/190 (64%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA  W Y+GEGA NL+LSY G +P   GK+LR++K+  +  +        +
Sbjct  88   EMNGVLQAADAKYWVYKGEGAANLILSYTGSSPTMLGKVLRVKKLLNDKSQLPPSCMVFS  147

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  LW  + +LV +  ++     +   VM   LG  HVD G+H+ VSR+FLE VEKNV
Sbjct  148  SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGVHVRVSRDFLELVEKNV  207

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L  RP WRV+A+ +++  D+ LL++DHS+F   TPK   CI VEIK KCGF+P+S++I +
Sbjct  208  LSSRPPWRVNASSIDITADAALLIADHSLFSG-TPKGSSCIAVEIKAKCGFVPSSEYISK  266

Query  32   SNAVKRRITR  3
             N++K+++TR
Sbjct  267  DNSIKKQVTR  276



>ref|XP_010511060.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010511061.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010511062.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010511063.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=444

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 127/190 (67%), Gaps = 7/190 (4%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP----GL  396
            +VL+ KDA++WSYRGEGAINLVL+Y G +P F GK++RI+K    G  YENG      GL
Sbjct  4    IVLEPKDAVDWSYRGEGAINLVLAYTGSSPTFLGKVMRIKKKLKKG--YENGGDTSGNGL  61

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  E  +W  +KDLVS   +E+ ++ FV+ VM P LG +HV+AGI  LV+ EFLE++EK 
Sbjct  62   TSLENIIWGGIKDLVSCQNKEMVDYLFVKHVMRPLLGHKHVNAGIRRLVATEFLESIEKM  121

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFI  39
            V  +  + R +A+ ++    S+LLM D + F     ++ + C+ VEIKPKCGFLP+S FI
Sbjct  122  VRSQHISRRDNASSVDTNLTSVLLMDDLTSFAQGHVEDHVPCLTVEIKPKCGFLPSSSFI  181

Query  38   IESNAVKRRI  9
             E N +K+ I
Sbjct  182  SEENLIKKTI  191



>ref|NP_001106063.1| LOC100126363 [Zea mays]
 gb|ABR92616.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Zea mays]
Length=440

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 118/190 (62%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR++K+  N  +        +
Sbjct  2    EMDGVLQAADAKDWVYKGEGAANLILSYTGTSPSMLGKVLRLKKILKNKSQRAPSCIVFS  61

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  LW  + +LV +  ++     +   VM   LG  HVD G+ + VSR+FLE VEKNV
Sbjct  62   SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGVRVRVSRDFLELVEKNV  121

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L  RP  RV+A+ ++   D+ LL++DHS+F    PK   CI VEIK KCGFLP+S++I E
Sbjct  122  LSSRPAGRVNASSIDNTADAALLIADHSLFSG-NPKGSSCIAVEIKAKCGFLPSSEYISE  180

Query  32   SNAVKRRITR  3
             N +K+++TR
Sbjct  181  DNTIKKQVTR  190



>ref|NP_001183320.1| uncharacterized protein LOC100501721 [Zea mays]
 gb|ACR36415.1| unknown [Zea mays]
Length=526

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 121/190 (64%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA  W Y+GEGA NL+LSY G +P   GK+LR++K+  +  +        +
Sbjct  88   EMNGVLQAADAKYWVYKGEGAANLILSYTGSSPTMLGKVLRVKKLLNDKSQLPPSCMVFS  147

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  LW  + +LV +  ++     +   VM   LG  HV  G+H+ VSR+FLE VEKNV
Sbjct  148  SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVGGGVHVRVSRDFLELVEKNV  207

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L  RP WRV+A+ +++  D+ LL++DHS+F   TPK   CI VEIK KCGF+P+S++I +
Sbjct  208  LSSRPPWRVNASSIDITADAALLIADHSLFSG-TPKGSSCIAVEIKAKCGFVPSSEYISK  266

Query  32   SNAVKRRITR  3
             N++K+++TR
Sbjct  267  DNSIKKQVTR  276



>ref|XP_004960165.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Setaria italica]
 ref|XP_004960166.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Setaria italica]
Length=452

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 121/190 (64%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR++K+  +  +        +
Sbjct  2    EMEGVLQAGDAKDWVYKGEGAANLILSYTGTSPAMLGKVLRVKKILKDKSQPAPSCMVFS  61

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             +E  LW  + +LV +  ++     +V  VM   LG  HVD G+ + VSR+FLE VEKNV
Sbjct  62   SYEQLLWGHIPELVDSVKQDSLAQAYVMHVMSKHLGANHVDGGVRVCVSRDFLELVEKNV  121

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L+ RP WRV+A+ ++   D+ LL+ DHS+F    P+   CI VEIK KCGFLP+S++I +
Sbjct  122  LNSRPAWRVNASSIDNTADAALLIPDHSLFSG-NPRGNSCIAVEIKAKCGFLPSSEYISK  180

Query  32   SNAVKRRITR  3
             N++K+++TR
Sbjct  181  ENSIKKQVTR  190



>gb|AFW59740.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase isoform 1 [Zea 
mays]
 gb|AFW59741.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase isoform 2 [Zea 
mays]
Length=440

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 118/190 (62%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR++K+  N  +        +
Sbjct  2    EMDGVLQAADAKDWVYKGEGAANLILSYTGSSPSMLGKVLRLKKILKNKSQRAPSCIVFS  61

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  LW  + +LV +  ++     +   VM   LG  HVD G+ + VSR+FLE VEKNV
Sbjct  62   SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGVRVRVSRDFLELVEKNV  121

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L  RP  RV+A+ ++   D+ LL++DHS+F    PK   CI VEIK KCGFLP+S++I E
Sbjct  122  LSSRPAGRVNASSIDNTADAALLIADHSLFSG-NPKGSSCIAVEIKAKCGFLPSSEYISE  180

Query  32   SNAVKRRITR  3
             N +K+++TR
Sbjct  181  DNTIKKQVTR  190



>ref|XP_010414720.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010414721.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=448

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 127/191 (66%), Gaps = 8/191 (4%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHP----GL  396
            +VL+ KDA+ WSYRGEGAINLVLSY G +P F GK++RI+K      E ENG      GL
Sbjct  4    IVLEPKDAVNWSYRGEGAINLVLSYTGSSPTFLGKVMRIKKELKK--ENENGGDTSGNGL  61

Query  395  TVHEIHLWKDV-KDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            T  E  +W  + KDLVS   +++ ++ FV+ VM P LG +HV+AGI  LV+ EFLE++EK
Sbjct  62   TSLENIIWGGIIKDLVSCENKDMVDYLFVKHVMRPLLGHKHVNAGIRRLVATEFLESIEK  121

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKF  42
             V  +  + R +A+ ++  R S+LLM D + F H   ++ + CI VEIKPKCGFLP+S F
Sbjct  122  MVRSQHISRRDNASSVDTNRTSVLLMDDLTRFSHGHVEDHVPCITVEIKPKCGFLPSSSF  181

Query  41   IIESNAVKRRI  9
            I E N +K+ I
Sbjct  182  ISEENLIKKSI  192



>dbj|BAJ91392.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 118/189 (62%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M  VL A DA  W Y+GEGA NL+LSY G +P   GK+LR +KV  +  +        + 
Sbjct  1    MEAVLQAGDAANWVYKGEGAANLILSYTGSSPSMLGKVLRAKKVLNDKAQPAPNCVNFST  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            +E  +W  + +LV +  +      +   VM P LG +HVD G+ + VS++FLE V KNVL
Sbjct  61   YEQLVWGQIPELVESVKQGSVAQAYAVHVMSPHLGHDHVDGGVRVPVSKDFLEIVGKNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
              RP+WRV+A+ ++   DS LL+SDHS+F    P+   CI VEIK KCGFLP+S++I   
Sbjct  121  SARPSWRVNASAIDTSADSALLISDHSLFSG-KPRGSSCIAVEIKAKCGFLPSSEYISRE  179

Query  29   NAVKRRITR  3
            NA+K+++TR
Sbjct  180  NAIKKQVTR  188



>ref|NP_001106053.1| inositol polyphosphate 2-kinase [Zea mays]
 gb|ABE03696.1| inositol polyphosphate 2-kinase [Zea mays]
 gb|ABO33318.1| inositol phosphate kinase 1A [Zea mays]
Length=440

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 117/190 (62%), Gaps = 1/190 (1%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR++K+  N  +        +
Sbjct  2    EMDGVLQAADAKDWVYKGEGAANLILSYTGSSPSMLGKVLRLKKILKNKSQRAPSCIVFS  61

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             HE  LW  + +LV +  ++     +   VM   LG  HVD G+ + VSR+FLE VEKNV
Sbjct  62   SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGVRVRVSRDFLELVEKNV  121

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
            L  RP  RV+A+ ++   D+ LL++DHS+F    PK   CI VEIK KCGFLP+S++I E
Sbjct  122  LSSRPAGRVNASSIDNTADAALLIADHSLFSG-NPKGSSCIAVEIKAKCGFLPSSEYISE  180

Query  32   SNAVKRRITR  3
             N +K+ +TR
Sbjct  181  DNTIKKLVTR  190



>ref|XP_010414722.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=442

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 125/190 (66%), Gaps = 3/190 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY--ENGHPGLTV  390
            +VL+AKDA++WSYRGEGA+NLVL+Y G +P   GK++RI+K    G E   +    GLT 
Sbjct  4    IVLEAKDAVDWSYRGEGAVNLVLAYTGSSPTCLGKVMRIKKKLKKGNENGGDTSGNGLTS  63

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  +W D+KDL S   +E+ ++ F + VM PFLG ++V+ GI  LV+ EFLE+VEK   
Sbjct  64   LENLIWGDIKDLASCQNKEMVDYLFAEHVMRPFLGHKYVNVGIRRLVATEFLESVEKMAT  123

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFIIE  33
             +  + R + + ++  R S+LLM D + F H   +++  C+ VEIKPK GFLP+S FI E
Sbjct  124  SQPLSRRANPSSVDTNRTSVLLMDDLTRFAHGHVEDDKPCLTVEIKPKYGFLPSSSFIAE  183

Query  32   SNAVKRRITR  3
             N +K+ +TR
Sbjct  184  ENLIKKSVTR  193



>gb|EMT22168.1| Inositol-pentakisphosphate 2-kinase [Aegilops tauschii]
Length=493

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 119/189 (63%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M V L A DA +W Y+GEGA NL+LSY G +P   GK+LR +KV  +  +        + 
Sbjct  1    MEVALQAGDAADWVYKGEGAANLILSYTGNSPSMFGKVLRAKKVLNDKAQPAPNCVNFSS  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
            +E  +W D+ +L+ +  +      +   VM   LG +HVD G+ + VS++FLE V KNVL
Sbjct  61   YEQLVWGDIPELIESVKQGSVAQAYAVHVMSQHLGHDHVDGGVRVSVSKDFLEIVGKNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
              RP WRV+A+ ++   DS LL+SDHS+F    P+   CI VEIK KCGFLP+S++I + 
Sbjct  121  SSRPAWRVNASAIDTNADSALLISDHSLFSG-KPRGSSCIAVEIKAKCGFLPSSEYISKE  179

Query  29   NAVKRRITR  3
            NA+K+++TR
Sbjct  180  NAIKKQVTR  188



>emb|CDY00419.1| BnaC07g14070D [Brassica napus]
Length=258

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 24/191 (13%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M +VL  KDA+ WSYRGEGA+NLVL+Y G +P F GK++RIQK+P N  + +    GLT 
Sbjct  1    MEIVLKPKDAVNWSYRGEGAVNLVLAYTGTSPTFLGKMMRIQKMP-NDVKRDTSENGLTS  59

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGI--HILVSREFLEAVEKN  216
            HE  +W ++K+LV                      PE    G+   +LV++EFLE+VE  
Sbjct  60   HEKLIWGEIKELVL---------------------PEQGGFGVFMRLLVAKEFLESVENI  98

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
               +RP+WR D A  +  R  +LLM D ++F H   +++ C+ VEIKPKCGF+P+S FI 
Sbjct  99   GTSQRPSWRADVASADTNRSFVLLMDDLTLFAHGRVEDKPCLSVEIKPKCGFIPSSSFIA  158

Query  35   ESNAVKRRITR  3
            E NA+K+ ITR
Sbjct  159  EENAIKKSITR  169



>dbj|BAG68917.1| hypothetical protein [Arabidopsis thaliana]
Length=475

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 121/191 (63%), Gaps = 6/191 (3%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG---LT  393
            +V + KDA++WSYR EG +NLVL+Y G +P F GK++RI+K+       ENG      LT
Sbjct  28   IVFETKDALDWSYRSEGVVNLVLAYSGSSPTFLGKVMRIKKI--RNTRNENGDRSGSCLT  85

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  +W ++KDL S   +EI ++ FV+ VM P LG ++V  GI + V +EFLE+V+K V
Sbjct  86   TQEKLIWGEIKDLASCQNKEIVDYLFVKHVMKPLLGHKYVTPGICLPVEKEFLESVKKIV  145

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFII  36
              +R +WR +   ++  R   LLM D +IF H   ++   C+ VEIKPKCGFL +S FI 
Sbjct  146  TSQRHSWRANTLSVDTNRSFALLMDDLTIFSHGQVEDHKPCLTVEIKPKCGFLSSSSFIA  205

Query  35   ESNAVKRRITR  3
            E N +K+ I+R
Sbjct  206  EENVIKKSISR  216



>ref|XP_004500991.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 104/156 (67%), Gaps = 2/156 (1%)
 Frame = -3

Query  464  GKILRIQKVPTNGCE--YENGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPF  291
            GK++RI+K P N       +    LT HE  LWKDV +L+S+   EIA   FV  VM P 
Sbjct  27   GKVMRIRKAPRNDTPTVIASSPSALTAHERLLWKDVDELISSSDHEIASQLFVLHVMKPL  86

Query  290  LGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVT  111
            LG E+VDAG+H+ VS  FLE VEKNV+ +RP WRVD A++++  D +LLMSDHS+F H  
Sbjct  87   LGSEYVDAGMHVQVSTGFLELVEKNVICQRPAWRVDTAQVDMHCDYVLLMSDHSLFAHGN  146

Query  110  PKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
                LCI VEIKPKCGFLP S FI E  ++K+ +TR
Sbjct  147  LGSSLCISVEIKPKCGFLPVSNFISEETSIKKSVTR  182



>ref|NP_564736.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
 ref|NP_564739.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
 ref|NP_683442.1| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
 gb|AAK62785.1|AC027036_6 hypothetical protein [Arabidopsis thaliana]
 gb|AAK62795.1|AC027036_16 hypothetical protein [Arabidopsis thaliana]
 gb|AEE33558.1| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
 gb|AEE33566.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
 gb|AEE33575.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
Length=486

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 121/189 (64%), Gaps = 2/189 (1%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKV-PTNGCEYENGHPGLTVH  387
            +V + KDA++WSYR EG +NLVL+Y G +P F GK++RI+K+  T     +     LT  
Sbjct  39   IVFETKDAVDWSYRSEGVVNLVLAYSGSSPTFLGKVMRIKKLRNTRNENRDRSGSCLTTQ  98

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLH  207
            E  +W ++KDLVS   +EI ++ FV+ VM P LG ++V  GI + V +EFLE+V+K V  
Sbjct  99   EKLIWGEIKDLVSCQNKEIVDYLFVKHVMKPLLGHKYVTPGICLPVEKEFLESVKKIVTS  158

Query  206  KRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFIIES  30
            +R +WR +   ++  R   LLM D +IF H   ++   C+ VEIKPKCGFL +S FI E 
Sbjct  159  QRHSWRANTLSVDTNRSFALLMDDLTIFSHGQVEDHKPCLTVEIKPKCGFLSSSSFIAEE  218

Query  29   NAVKRRITR  3
            N +K+ I+R
Sbjct  219  NVIKKSISR  227



>ref|XP_006827390.1| hypothetical protein AMTR_s00011p00177280 [Amborella trichopoda]
 gb|ERM94627.1| hypothetical protein AMTR_s00011p00177280 [Amborella trichopoda]
Length=411

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = -3

Query  470  FAGKILRIQKVPTNGCEYEN-GHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCP  294
              GK+LR+QK      + ++   P L+ H+  LW D+++LV+A ++EI  H +VQ VM P
Sbjct  1    MVGKVLRVQKTSKGDAQSKSINDPILSTHDRLLWGDIEELVTATSKEILAHSYVQHVMRP  60

Query  293  FLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHV  114
             L  EHVDAG  +LVSREFLE V    L +RP WRVDAAK++ L DS LL+SDHS+F H 
Sbjct  61   LLASEHVDAGKRVLVSREFLEGVATQTLSQRPAWRVDAAKVDTLSDSALLISDHSLFQHG  120

Query  113  TPKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
              K+  CI VEIKPKCGFLP S+FI + N +K   TR
Sbjct  121  DIKQAPCIAVEIKPKCGFLPCSRFIGKENFMKNNTTR  157



>ref|XP_010474037.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=452

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 126/191 (66%), Gaps = 4/191 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEY--ENGHPGLTV  390
            +VL+AKDA++WSYRGEGA+NLVL+Y G +P + GK++RI+K    G E   +    GLT 
Sbjct  13   IVLEAKDAVDWSYRGEGAVNLVLAYTGSSPTYLGKVMRIKKTLKKGNENGGDTSGNGLTS  72

Query  389  HEIHLWKDV-KDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
             E  +W  + KDL S   +E+ ++ F + VM PFLG ++V+ GI  LV+ EFLE+VEK V
Sbjct  73   LENIIWGGIIKDLASCQNKEMVDYLFAEHVMRPFLGHKYVNVGIRRLVAMEFLESVEKMV  132

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFII  36
              +  + R + + ++  R S+LLM D + F H   +++  C+ VEIKPK GFLP+S FI 
Sbjct  133  TSQPLSRRANPSSVDTNRTSVLLMDDLTRFTHGHVEDDTPCLTVEIKPKYGFLPSSSFIA  192

Query  35   ESNAVKRRITR  3
            E N +K+ +TR
Sbjct  193  EENLIKKSVTR  203



>ref|XP_002862989.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39248.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 110/166 (66%), Gaps = 3/166 (2%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PGLT  393
            +VL+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N   +   +     LT
Sbjct  1    MVLEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAHMTANGVVSVLT  60

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++ K+L+S+P +E+ E  +V+ V+ P LGP+HVDAG+ + VS+EFLE V+K V
Sbjct  61   SDEQLLWRENKELISSPNKEVLEQRYVKHVIIPLLGPKHVDAGVRVSVSKEFLECVDKKV  120

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIK  75
              +RP WRV+AA ++   DS L+++DHS+F H       CI VEIK
Sbjct  121  TKQRPLWRVNAAHVDTSHDSALILNDHSLFSHGIFSIGDCISVEIK  166



>ref|XP_010240557.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Brachypodium 
distachyon]
Length=454

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 120/189 (63%), Gaps = 1/189 (1%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTV  390
            M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR +K+  +  +        + 
Sbjct  1    MEAVLQAGDAEDWVYKGEGAANLILSYTGSSPSMLGKVLRAKKILNDKAQPAPNCVVFSS  60

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
             E  LW ++ +LV +  +++    +   VM   LG  HVD G+ + VS++FLE V KNVL
Sbjct  61   FEQLLWGEIPELVESVKQDLLPQAYAVHVMSQHLGANHVDGGVRVRVSKDFLEIVGKNVL  120

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
              RPTWRV+A+ ++   DS LL+SDHS+F   + +   CI VEIK KCGFLP+S++I + 
Sbjct  121  SARPTWRVNASAIDTSADSALLISDHSLFSGKS-RGSSCIAVEIKAKCGFLPSSEYISKE  179

Query  29   NAVKRRITR  3
            N++K+++TR
Sbjct  180  NSIKKQVTR  188



>gb|AEM36353.1| At1g59312 [Arabidopsis thaliana]
Length=486

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 6/191 (3%)
 Frame = -3

Query  563  VVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG---LT  393
            +V + KDA++WSYR EG +NLVL+Y G +P F GK++RI+K+       ENG      LT
Sbjct  39   IVFETKDAVDWSYRSEGVVNLVLAYSGSSPTFLGKVMRIKKIRNT--RNENGDRSGSCLT  96

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  +W ++KDLV    +E+ ++ FV+ VM P LG ++V  GI + V +EFLE+V+K V
Sbjct  97   TQEKLIWGEIKDLVFCQNKELVDYLFVKHVMKPLLGHKYVTPGICLPVEKEFLESVKKIV  156

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFII  36
              +R +WR +   ++  R   LLM D +IF H   ++   C+ VEIKPKCGFL +S FI 
Sbjct  157  TSQRHSWRANTLSVDTNRSFALLMDDLTIFSHGQVEDHKPCLTVEIKPKCGFLSSSSFIA  216

Query  35   ESNAVKRRITR  3
            E N +K+ I+R
Sbjct  217  EENVIKKSISR  227



>ref|NP_001054147.1| Os04g0661200 [Oryza sativa Japonica Group]
 emb|CAE02901.1| OSJNBa0015K02.18 [Oryza sativa Japonica Group]
 dbj|BAF16061.1| Os04g0661200 [Oryza sativa Japonica Group]
 dbj|BAG95743.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78180.1| hypothetical protein OsI_17777 [Oryza sativa Indica Group]
 gb|EEE61843.1| hypothetical protein OsJ_16498 [Oryza sativa Japonica Group]
Length=445

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 116/194 (60%), Gaps = 11/194 (6%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG---  399
            M VVL   DA +W Y+GEGA NL+LSY G +P   GK+LR++K+       + G P    
Sbjct  1    MEVVLHEGDAKDWVYKGEGAANLILSYTGSSPSMLGKVLRVKKILK-----DKGQPAPNC  55

Query  398  --LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
               + HE HLW  +  L+ +   +     +   VM   LG  HVD G+ + VS+ F E  
Sbjct  56   IVFSSHEEHLWGKIPGLLESVKNDCLPQAYATIVMSQHLGANHVDGGVRVRVSKNFFELA  115

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASK  45
             KNVL  RP WRV+A+ ++   DS LL+SDH++F    P+   CI VEIK KCGFLP+S+
Sbjct  116  GKNVLDNRPAWRVNASAIDAGADSALLISDHTLFSG-NPRGSSCIAVEIKAKCGFLPSSE  174

Query  44   FIIESNAVKRRITR  3
            +I + N++K+++TR
Sbjct  175  YISKENSIKKQVTR  188



>emb|CAH67064.1| H0112G12.9 [Oryza sativa Indica Group]
Length=445

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 116/194 (60%), Gaps = 11/194 (6%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG---  399
            M VVL   DA +W Y+GEGA NL+LSY G +P   GK+LR++K+       + G P    
Sbjct  1    MEVVLHEGDAKDWVYKGEGAANLILSYTGSSPSMLGKVLRVKKILK-----DKGQPAPNC  55

Query  398  --LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
               + HE HLW  +  L+ +   +     +   VM   LG  HVD G+ + VS+ F E  
Sbjct  56   IVFSSHEEHLWGKIPGLLESVKNDCLPQAYATIVMSQHLGANHVDGGVRVRVSKNFFELA  115

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASK  45
             KNVL  RP WRV+A+ ++   DS LL+SDH++F    P+   CI VEIK KCGFLP+S+
Sbjct  116  GKNVLDNRPAWRVNASAIDAGADSALLISDHTLFSG-NPRGSSCIAVEIKAKCGFLPSSE  174

Query  44   FIIESNAVKRRITR  3
            +I + N++K+++TR
Sbjct  175  YISKENSIKKQVTR  188



>ref|XP_006652958.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006652959.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Oryza brachyantha]
Length=451

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 117/194 (60%), Gaps = 11/194 (6%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG---  399
            M VVL  +DA +W Y+GEGA NL+LSY G +P   GK+LRI K+       + G P    
Sbjct  1    MEVVLHEEDAKDWVYKGEGAANLILSYTGSSPSMLGKVLRINKILR-----DKGQPAPNC  55

Query  398  --LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
               + +E  LW  +  L+ +   +     +   VM   LG  HVD G+ + VS+ FLE V
Sbjct  56   MVFSSYEELLWGKIPGLLESVKNDCLPQAYATNVMSQHLGANHVDGGVRVRVSKNFLELV  115

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASK  45
             KNVL  RP WRV+A+ ++   DS LL+SDH++F    PK   CI VEIK KCGFLP+S+
Sbjct  116  GKNVLDSRPAWRVNASAIDTGADSALLISDHTLFSG-NPKGSSCIAVEIKAKCGFLPSSE  174

Query  44   FIIESNAVKRRITR  3
            +I + N++K+++TR
Sbjct  175  YISKENSIKKQVTR  188



>ref|XP_010540332.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Tarenaya 
hassleriana]
Length=401

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 2/153 (1%)
 Frame = -3

Query  455  LRIQKVPTNGCEYE--NGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGP  282
            +RIQK   N    +  N    LT  E  LW++ K+L+S+P++E+ E  FV+ VM P LGP
Sbjct  1    MRIQKARKNDKTNKSWNDTAVLTSDEQFLWRENKELISSPSKEVLEQRFVKNVMSPLLGP  60

Query  281  EHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKE  102
            +HVDAG+ + VS+EFLE+V+K V  +RP WRV+AA ++   DS++LM+DHS+F       
Sbjct  61   KHVDAGMRVSVSKEFLESVDKKVTKQRPLWRVNAANVDTSHDSVILMNDHSLFSRGISSC  120

Query  101  ELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
              CI VEIKPKCGFLP S+FI E N VKR +TR
Sbjct  121  VDCISVEIKPKCGFLPTSRFIREGNTVKRSVTR  153



>ref|XP_010254763.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010254764.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010254765.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Nelumbo nucifera]
Length=438

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 100/176 (57%), Gaps = 39/176 (22%)
 Frame = -3

Query  413  NGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAG----------  264
            NG    +V E  LWKD  DL+S+ ++E     +   +M P LG EHVD G          
Sbjct  2    NGTSVFSVQECLLWKDTNDLLSSTSKENVGQLYSLHIMSPLLGSEHVDPGDLDLRKMVGR  61

Query  263  -----------------------------IHILVSREFLEAVEKNVLHKRPTWRVDAAKL  171
                                         + ILVS+EFLE+VEKNVL +RP WRVDAA +
Sbjct  62   SRMVDGLYMLENKASLAVIESTSQSSEIQMRILVSKEFLESVEKNVLCQRPAWRVDAANI  121

Query  170  NLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            N+L DS LL+SDHS+FPH   KEE CI VEIKPKCGFLP+S+FI E N +KR ITR
Sbjct  122  NILCDSALLVSDHSVFPHGILKEEPCISVEIKPKCGFLPSSRFIAEGNFIKRSITR  177



>ref|XP_001757602.1| predicted protein [Physcomitrella patens]
 gb|EDQ77659.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 112/193 (58%), Gaps = 11/193 (6%)
 Frame = -3

Query  548  KDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVP-------TNGCEYE---NGHPG  399
            +DA +WSYRGEGA N+VL+Y G  P F G++LRI+K          NG + +   +  P 
Sbjct  6    EDAEDWSYRGEGAANIVLAYDGEKPSFVGRVLRIRKASRNPSGLIDNGTQNQVKKDAKPV  65

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
            LT HEI LW++   +  A T     H +  ++M P LG +H+DAG+ + ++  FLEAV K
Sbjct  66   LTEHEIKLWREWPSMCEATTSAALAHAYACEIMQPLLGKDHIDAGMLVFLTTGFLEAVSK  125

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKE-ELCICVEIKPKCGFLPASKF  42
             V   +P WR   A++++     L+++DHS FP +   +    I VE+KPK GFLP +  
Sbjct  126  EVNANQPEWRRKDAQMDMTGGLALMIADHSSFPALRSTDLPQTITVELKPKWGFLPTAAT  185

Query  41   IIESNAVKRRITR  3
            I + N VKR + R
Sbjct  186  ISDKNNVKRHVPR  198



>gb|AGW50727.1| inositol pentakisphosphate 2-kinase, partial [Glycine gracilis]
Length=123

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 85/122 (70%), Gaps = 4/122 (3%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHPGLTVHEIHLWK  369
            +W YRGEGA+NLVL+Y G +P F GK++RI+K P NG + ++        LT HE  LWK
Sbjct  2    DWVYRGEGAVNLVLAYAGSSPSFIGKVVRIRKAPRNGSQSKSVSVRNSIALTPHERVLWK  61

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            DV  L+S+  +EI    +VQ VM P LG   VDAG+H+LV+REFLE+VEKNV  +RP WR
Sbjct  62   DVHQLISSSDKEIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLESVEKNVSGQRPAWR  121

Query  188  VD  183
            V+
Sbjct  122  VE  123



>ref|XP_010445901.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=423

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -3

Query  470  FAGKILRIQKVPTN--GCEYENGHPG-LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVM  300
              GK++RIQK   N    +  NG    LT  E  LW++ K+++S+P +E+ E  +V+ V+
Sbjct  6    LVGKVIRIQKARRNDKAAKSANGVVSVLTSDEQLLWREHKEIISSPNKEVLEQRYVKNVI  65

Query  299  CPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFP  120
             P LG +HVDAG+ + VS+EFLE V+K V  +RP WRV+AA ++   DS L+++DHS+F 
Sbjct  66   IPLLGTKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFS  125

Query  119  HVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
                    CI VEIKPKCGFLP S+FI + N +K  ++R
Sbjct  126  QGISTSGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSR  164



>gb|AGW50729.1| inositol pentakisphosphate 2-kinase, partial [Glycine soja]
Length=123

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 84/122 (69%), Gaps = 4/122 (3%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHPGLTVHEIHLWK  369
            +W YRGEGA+NLVL+Y G +P F GK++RI+K P NG + ++        LT HE  LWK
Sbjct  2    DWVYRGEGAVNLVLAYAGSSPSFIGKVVRIRKAPRNGSQSKSVSVRNSIALTPHERVLWK  61

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            DV  L+S+  REI    +VQ VM P LG   VDAG+H+LV+REFLE VEKNV  +RP WR
Sbjct  62   DVHQLISSSDREIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLELVEKNVSGQRPAWR  121

Query  188  VD  183
            V+
Sbjct  122  VE  123



>gb|AGW50722.1| inositol pentakisphosphate 2-kinase, partial [Glycine max]
 gb|AGW50723.1| inositol pentakisphosphate 2-kinase, partial [Glycine gracilis]
 gb|AGW50724.1| inositol pentakisphosphate 2-kinase, partial [Glycine soja]
 gb|AGW50725.1| inositol pentakisphosphate 2-kinase, partial [Glycine soja]
 gb|AGW50726.1| inositol pentakisphosphate 2-kinase, partial [Glycine max]
 gb|AGW50728.1| inositol pentakisphosphate 2-kinase, partial [Glycine soja]
 gb|AGW50730.1| inositol pentakisphosphate 2-kinase, partial [Glycine max]
Length=123

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 84/122 (69%), Gaps = 4/122 (3%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHPGLTVHEIHLWK  369
            +W YRGEGA+NLVL+Y G +P F GK++RI+K P NG + ++        LT HE  LWK
Sbjct  2    DWVYRGEGAVNLVLAYAGSSPSFIGKVVRIRKAPRNGSQSKSVSVRNSIALTPHERVLWK  61

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            DV  L+S+  +EI    +VQ VM P LG   VDAG+H+LV+REFLE VEKNV  +RP WR
Sbjct  62   DVHQLISSSDKEIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLELVEKNVSGQRPAWR  121

Query  188  VD  183
            V+
Sbjct  122  VE  123



>ref|XP_001761338.1| predicted protein [Physcomitrella patens]
 gb|EDQ73727.1| predicted protein [Physcomitrella patens]
Length=483

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 114/194 (59%), Gaps = 10/194 (5%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENG-----HPGLT  393
            L  +DA  W YRGEG+ N+VL+Y G  P F G++LR++K        +N       P L+
Sbjct  31   LHEEDAEGWLYRGEGSANIVLAYHGRRPSFIGRVLRLRKASKKDDGTQNQVKKEPKPVLS  90

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              E  LW++  ++  A T     H F  +VM P LG +HVDAG+ + ++  FLEAV ++V
Sbjct  91   EEEAKLWREWPNMSKATTSAALAHVFACEVMQPLLGEDHVDAGLLVFLTTGFLEAVSRDV  150

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKE----ELCICVEIKPKCGFLPASK  45
            L K+  WR + +K+++     LL++DHS+FP + P E       I +EIKPK G+LP + 
Sbjct  151  LAKQREWRRNDSKMDMTAGVALLITDHSLFP-IVPGEVKDLPQTITIEIKPKWGYLPDAA  209

Query  44   FIIESNAVKRRITR  3
             I E N+VKR +TR
Sbjct  210  TISEENSVKRHVTR  223



>gb|AGW50731.1| inositol pentakisphosphate 2-kinase, partial [Glycine max]
Length=123

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 82/122 (67%), Gaps = 4/122 (3%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYEN----GHPGLTVHEIHLWK  369
            +W YRGEGA+NLV +Y G +P F GK++RI+K P NG + ++        LT HE  LWK
Sbjct  2    DWVYRGEGAVNLVFAYAGSSPSFIGKVVRIRKAPRNGSQSKSVSVRNSIALTPHERVLWK  61

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            DV  L+S+  +EI    +VQ VM P LG   VDAG+H+LV+REFLE V KNV  +RP WR
Sbjct  62   DVHQLISSSDKEIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLELVGKNVSGQRPAWR  121

Query  188  VD  183
            V+
Sbjct  122  VE  123



>ref|XP_002980010.1| hypothetical protein SELMODRAFT_111972 [Selaginella moellendorffii]
 gb|EFJ18880.1| hypothetical protein SELMODRAFT_111972 [Selaginella moellendorffii]
Length=451

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 111/186 (60%), Gaps = 10/186 (5%)
 Frame = -3

Query  542  AMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENG---HPGLTVHEIHLW  372
            A +W Y+GEGA N+VL YRG   +  G +LRI+K P      ENG    P L+  E +LW
Sbjct  12   AGDWRYKGEGASNVVLDYRGSDSQLLGTVLRIRKAPLR----ENGGGCAPVLSDLERNLW  67

Query  371  KDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHIL--VSREFLEAVEKNVLHKRP  198
            KD   + S+   E   H +V+ VM P LG ++VD+G+ ++  VSR+FLE V +++   RP
Sbjct  68   KDWPAVASSSNEEELRHVYVRDVMRPLLGEDYVDSGVCVIVPVSRKFLEDVSQHIRANRP  127

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFIIESNAV  21
             WR + A L+    ++L + DH++FP +  + +   + +EIKPK G+LP S  I   N V
Sbjct  128  AWRAEEADLDFSSKNVLAVCDHTLFPGLANESDSPTLSIEIKPKWGYLPQSDAISTENHV  187

Query  20   KRRITR  3
            K+ ++R
Sbjct  188  KKVVSR  193



>ref|XP_002992945.1| hypothetical protein SELMODRAFT_136205 [Selaginella moellendorffii]
 gb|EFJ06034.1| hypothetical protein SELMODRAFT_136205 [Selaginella moellendorffii]
Length=451

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 111/186 (60%), Gaps = 10/186 (5%)
 Frame = -3

Query  542  AMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENG---HPGLTVHEIHLW  372
            A +W Y+GEGA N+VL YRG   +  G +LRI+K P      ENG    P L+  E +LW
Sbjct  12   AGDWRYKGEGASNVVLDYRGSDSQLLGTVLRIRKAPLR----ENGGGCAPVLSDLERNLW  67

Query  371  KDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHIL--VSREFLEAVEKNVLHKRP  198
            KD   + S+   E   H +V+ VM P LG ++VD+G+ ++  VSR+FLE V +++   RP
Sbjct  68   KDWPAVASSSNEEELRHVYVRDVMRPLLGEDYVDSGVCVIVPVSRKFLEDVSQHIRANRP  127

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-CICVEIKPKCGFLPASKFIIESNAV  21
             WR + A L+    ++L + DH++FP +  + +   + +EIKPK G+LP S  I   N V
Sbjct  128  AWRAEEADLDFSSKNVLAVCDHTLFPGLANESDSPTLSIEIKPKWGYLPQSDAISTENHV  187

Query  20   KRRITR  3
            K+ ++R
Sbjct  188  KKVVSR  193



>ref|XP_008795958.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X5 [Phoenix 
dactylifera]
 ref|XP_008795959.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X5 [Phoenix 
dactylifera]
Length=373

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = -3

Query  317  FVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMS  138
            +++ VM   LGP+++D  I + V REFLE+++KNV  +RP WR+DAA+++ L DS  L+S
Sbjct  4    YIKYVMSHMLGPKYIDDMIRVTVCREFLESIKKNVHDQRPAWRIDAAEVDALCDSAFLIS  63

Query  137  DHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            DHS+F   TP+ +LC+ VEIKPKCGFLP+S+FI ++NA+K+ +TR
Sbjct  64   DHSLFTG-TPRVDLCVAVEIKPKCGFLPSSEFITKANAIKKSVTR  107



>ref|XP_006341967.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Solanum tuberosum]
Length=372

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -3

Query  281  EHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKE  102
            EH D  IHI V+REFLE V+ NVL +RP+WRVDAA +N L DS+LL+SDHS+FP    K+
Sbjct  30   EHPDF-IHIPVTREFLETVDNNVLCQRPSWRVDAAMVNPLCDSVLLISDHSLFPRGALKK  88

Query  101  ELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            + CI VEIKPKCGFLP S+FI   N++KR +TR
Sbjct  89   DFCISVEIKPKCGFLPLSEFIASENSIKRSVTR  121


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRF  468
            MA+VL A DA EW YRGEGA+NLVL+Y G  P F
Sbjct  1    MAMVLQANDAREWCYRGEGAVNLVLAYSGEHPDF  34



>gb|KDO84622.1| hypothetical protein CISIN_1g0134841mg, partial [Citrus sinensis]
 gb|KDO84623.1| hypothetical protein CISIN_1g0134841mg, partial [Citrus sinensis]
 gb|KDO84624.1| hypothetical protein CISIN_1g0134841mg, partial [Citrus sinensis]
Length=334

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  257  ILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEI  78
            + V+REFLE+V+KNV  +RP WRVDAA + +  DS+LLMSDH++FP     EE C+ VEI
Sbjct  3    VRVTREFLESVQKNVTGQRPAWRVDAADIKIPCDSVLLMSDHTLFPQGILGEEPCLAVEI  62

Query  77   KPKCGFLPASKFIIESNAVKRRITR  3
            KPKCGFLP S+FI E NA+KR +TR
Sbjct  63   KPKCGFLPISRFIAEENAIKRSVTR  87



>gb|KDO84619.1| hypothetical protein CISIN_1g0134842mg, partial [Citrus sinensis]
 gb|KDO84620.1| hypothetical protein CISIN_1g0134842mg, partial [Citrus sinensis]
Length=108

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYE------NG  408
            M VVLD  DA +W YRGEGA NLVL+Y G +P F GK+LRI K   NG   E      NG
Sbjct  1    MDVVLDQNDAADWIYRGEGAANLVLAYAGSSPAFVGKVLRIPKAWRNGKPEESLAQCVNG  60

Query  407  HPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAG  264
                  HE  LW D ++L+S+ ++E  E  +V+++M P LGP+++DAG
Sbjct  61   GSVFGKHEQLLWGDNQELLSSSSKETMEQMYVEKIMSPLLGPKYIDAG  108



>dbj|BAB10637.1| unnamed protein product [Arabidopsis thaliana]
Length=351

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (67%), Gaps = 3/106 (3%)
 Frame = -3

Query  569  MAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGH---PG  399
            M ++L+ KDA +W YRGEG  NLVL+Y G +P F GK++RIQK   N    +N +     
Sbjct  1    MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNANGVVSV  60

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGI  261
            LT  E HLW++  +L+S+P +E+ E  +V+ V+ P LGP+HVDAGI
Sbjct  61   LTSDEQHLWRENNELISSPNKEVLEQRYVKNVIIPLLGPKHVDAGI  106



>emb|CDY38844.1| BnaC08g20180D [Brassica napus]
Length=349

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -3

Query  263  IHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICV  84
            + +LV++EFLE+VE  V  +RP+WR DAA ++  R+S+LLM D ++F H   +++ C+ V
Sbjct  1    MRLLVAKEFLESVENIVTSQRPSWRADAASVDTNRNSVLLMDDLTLFAHGRVEDKPCLSV  60

Query  83   EIKPKCGFLPASKFIIESNAVKRRITR  3
            EIKPKCGFLP+S FI E N +K+ ITR
Sbjct  61   EIKPKCGFLPSSSFIAEENVIKKSITR  87



>ref|XP_004353085.1| inositol 1,3,4,5,6pentakisphosphate 2-kinase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR23557.1| inositol 1,3,4,5,6pentakisphosphate 2-kinase [Acanthamoeba castellanii 
str. Neff]
Length=526

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 97/194 (50%), Gaps = 18/194 (9%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPR--FAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD-  366
            +W Y+GEGA +LVLSY G  P     G++LR++K   NG +   G  G   H +H+  D 
Sbjct  50   QWRYKGEGAAHLVLSYAGGNPTSPLKGQVLRVEKRFKNGEDGGKGPQG--SHALHIPADG  107

Query  365  ----VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
                    V     E+ E+ FV  VM P +GP +V  G+ I+++  FL A+   V   RP
Sbjct  108  LMWFQGTPVHVENHELKEYAFVHNVMRPLIGPSYVHPGVPIVMTPAFLGALGAGVEQSRP  167

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL---------CICVEIKPKCGFLPASK  45
              R    ++++      LM D S+ PH  P  +           ICVEIKPK GFLP S 
Sbjct  168  ELRRKDTEIDVDSKFAFLMPDLSLLPHAAPAADADATDGRVAPIICVEIKPKWGFLPYSP  227

Query  44   FIIESNAVKRRITR  3
             I   +++K R+ R
Sbjct  228  LIRAPHSIKTRVCR  241



>gb|AFW59738.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Zea mays]
Length=372

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  263  IHILVSREFLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICV  84
            + + VSR+FLE VEKNVL  RP  RV+A+ ++   D+ LL++DHS+F    PK   CI V
Sbjct  37   VRVRVSRDFLELVEKNVLSSRPAGRVNASSIDNTADAALLIADHSLFSG-NPKGSSCIAV  95

Query  83   EIKPKCGFLPASKFIIESNAVKRRITR  3
            EIK KCGFLP+S++I E N +K+++TR
Sbjct  96   EIKAKCGFLPSSEYISEDNTIKKQVTR  122



>ref|XP_004349251.1| hypothetical protein CAOG_02501 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW44476.1| hypothetical protein CAOG_02501 [Capsaspora owczarzaki ATCC 30864]
Length=456

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 93/191 (49%), Gaps = 38/191 (20%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIA---PRFAGKILRIQKVPTNGCEYENGHPGLTVH  387
            + A  A +WSYRGEGA N+V+S+ G     P   GK+LRI+K P                
Sbjct  1    MQALRAEDWSYRGEGAANIVVSFTGDQASNPELEGKVLRIRKSP----------------  44

Query  386  EIHLWKDVKDLVSAPTREIAEHFFVQQ-------VMCPFLGPEHVDAGIHILVSREFLEA  228
                       V AP+ E  + F  +Q       ++ P LG E+V+AG  + ++  FL+ 
Sbjct  45   -----------VVAPS-EPRQTFSTEQNYAYLTRLIAPLLGDEYVNAGQLVPLAATFLQD  92

Query  227  VEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPAS  48
            +++ +  +RP  RV AA+L+    +  L+ D       +  +    CVEIKPK GFLP S
Sbjct  93   LDQRIAAERPAKRVQAARLDCAGSAAQLLRDVGRPFIQSHDQSDTFCVEIKPKWGFLPTS  152

Query  47   KFIIESNAVKR  15
             FI  SNA  +
Sbjct  153  SFIHPSNATAK  163



>gb|AFW59739.1| hypothetical protein ZEAMMB73_223578 [Zea mays]
Length=121

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
             M  VL A DA +W Y+GEGA NL+LSY G +P   GK+LR++K+  N  +        +
Sbjct  2    EMDGVLQAADAKDWVYKGEGAANLILSYTGSSPSMLGKVLRLKKILKNKSQRAPSCIVFS  61

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGI  261
             HE  LW  + +LV +  ++     +   VM   LG  HVD G+
Sbjct  62   SHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGV  105



>ref|XP_002507536.1| inositol-pentakisphosphate 2-kinase [Micromonas sp. RCC299]
 gb|ACO68794.1| inositol-pentakisphosphate 2-kinase [Micromonas sp. RCC299]
Length=498

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 83/180 (46%), Gaps = 14/180 (8%)
 Frame = -3

Query  575  PRMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVP--------TNGCE  420
            PR A+ +    A +W Y  EG   +V+ YRG  P   GK+LR++K          T   +
Sbjct  4    PRHALTI----ASDWHYMAEGGSRVVMCYRGPDPSLVGKVLRVRKRAKDRPLQNLTKTVD  59

Query  419  YENGHPGLTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSRE  240
            YE  H    + ++ LW +   L      E+AE  F  +++ PFL     D G+ I V   
Sbjct  60   YEQNHRH-DLTDLELWVEFFSLERQDQDELAE-IFSDKLLRPFLSRNQTDTGVRIRVDAS  117

Query  239  FLEAVEKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGF  60
            FL  V  ++   RP  R + + +++   S +++ +H             I +EIKPKCGF
Sbjct  118  FLTQVATSIASFRPAKRRELSVVDVKSRSAVIVQNHRNIVKGDYSTAQVISLEIKPKCGF  177



>ref|XP_005832271.1| hypothetical protein GUITHDRAFT_108933 [Guillardia theta CCMP2712]
 gb|EKX45291.1| hypothetical protein GUITHDRAFT_108933 [Guillardia theta CCMP2712]
Length=420

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 92/196 (47%), Gaps = 38/196 (19%)
 Frame = -3

Query  566  AVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVH  387
            A +L A +A EW YRGEG++NLV++Y G      GK+LR++K P +  E           
Sbjct  8    ACLLTAAEAREWRYRGEGSMNLVMAYIGDKEGLQGKVLRLRKAPIDSDE-----------  56

Query  386  EIHLWKDVKDLVSAPTREIAEHF-FVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVL  210
                        S     I E + F+Q+     L    +  G+ +LVSR+FL +V+ +  
Sbjct  57   ------------SFKCASIEESYAFLQRQQFSKLDGSCLPRGLLVLVSRDFLASVKSSCH  104

Query  209  HKRPTWRVDAAKLNLLRDSILLMSDHSIFPHV--TPKEELC-----ICVEIKPKCGFLPA  51
              RP  R       L RD  L      + P +   PKE L      + +EIKPKCG LP 
Sbjct  105  GLRPAHR-------LTRDLDLTARSGWLLPDLVSVPKELLVGSKVFLGIEIKPKCGTLPD  157

Query  50   SKFIIESNAVKRRITR  3
             K +  + A+K +++R
Sbjct  158  RKLLSSATAIKAQVSR  173



>ref|XP_003294485.1| hypothetical protein DICPUDRAFT_43505 [Dictyostelium purpureum]
 gb|EGC28988.1| hypothetical protein DICPUDRAFT_43505 [Dictyostelium purpureum]
Length=482

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 53/190 (28%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRG-IAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKD  357
            W+Y+ EGA+N+VLSY G       G +LR++K    G   E         EI L+     
Sbjct  21   WTYKSEGAMNVVLSYTGPFNENLNGLVLRVKKQSNGGSNLE--------KEIELFN----  68

Query  356  LVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR----  189
                         FV +VM P LG ++V  G  I ++++FLE ++  +  +RP  R    
Sbjct  69   -------------FVSKVMTPLLGEKYVFCGSMINITQDFLEKLDSLIFKQRPITRSTIR  115

Query  188  ----------------VDAAKLNLLRDSIL-------LMSDHSIFPHVTPKEELCICVEI  78
                            +D+  +++  DSIL       L S+     H +  +E  IC+EI
Sbjct  116  LDTKLPVAFLIMDLTKLDSFNISIDHDSILRSPVSHRLTSEQYQKQHPSHDKEKVICIEI  175

Query  77   KPKCGFLPAS  48
            KPK GFLP++
Sbjct  176  KPKWGFLPSN  185



>ref|XP_010765158.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Notothenia coriiceps]
Length=500

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 89/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  EW Y GEG  +LV+S+  ++      +LR+ K P    E    +P  TV +  
Sbjct  3    LDKMDENEWRYHGEGNKSLVVSHVQLS-----IVLRLLKYPAEDSE----NPPQTVEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ V+++V           F   VM   LG + V +G  + +  EF+  +   V H+RP
Sbjct  53   -FRQVQNIVD----------FSSNVMSCLLGEKFVHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP SK +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPTLHQPTHTPTLCIEIKPKCGFLPYSKHV--SQDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_010743867.1| PREDICTED: LOW QUALITY PROTEIN: inositol-pentakisphosphate 2-kinase 
[Larimichthys crocea]
Length=490

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            +D  +  +W Y GEG  +LVLS+  ++     ++LR+ K P    E    +P  TV +  
Sbjct  3    VDKMEEKDWKYHGEGNKSLVLSHVQLS-----RVLRLLKYPAEDSE----NPPQTVEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -FRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIRVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+SK +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPVLHQPTHTPPLCIEIKPKCGFLPSSKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_004351454.1| hypothetical protein DFA_10812 [Dictyostelium fasciculatum]
 gb|EGG14938.1| hypothetical protein DFA_10812 [Dictyostelium fasciculatum]
Length=384

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 90/198 (45%), Gaps = 47/198 (24%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYR-------------GIAPRFAGKILRIQKVPTNGCEYENGHPGL  396
            +WSY+GEGA N+V+ Y                     GK+LR++K        +      
Sbjct  25   DWSYKGEGACNIVVYYNPQPSSSSSSSSSSSYHNYLKGKVLRLKK--------KVSSLSP  76

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T        D KD           + FVQ VM P +G ++V++G+ + + ++F+  +   
Sbjct  77   TSTSTSPSTDDKD-----------YRFVQNVMQPLIGSKYVNSGVRVSIDKQFINELNAI  125

Query  215  VLHKRPTWRV------DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLP  54
            +L  RP  R+      +     L+RD  L+ +  ++ P         ICVEIKPKCGF+ 
Sbjct  126  ILGSRPQHRIHHQLDDEMTSAILIRDISLIHTADALLP--------SICVEIKPKCGFIS  177

Query  53   ASKFIIESN-AVKRRITR  3
             SK+I + N  +K+ + R
Sbjct  178  TSKYISKQNIELKQHVCR  195



>gb|KFH73726.1| hypothetical protein MVEG_00940 [Mortierella verticillata NRRL 
6337]
Length=467

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 85/184 (46%), Gaps = 26/184 (14%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRGIAPRFAGKILRIQKV----PTNGCEYENGHPGLTVHEIHLWKD  366
            W YR EG  NLVL Y G  P +A  +LR++K      TN  E                 D
Sbjct  13   WRYRAEGNANLVLQYVGPNPAYATTVLRLRKAERPDATNASE----------------SD  56

Query  365  VKDLVSAP-TRE--IAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPT  195
            ++  V  P TR    +E  F  QV+   LG E+V+  I + + +EF++ +   +   RP 
Sbjct  57   LRASVPGPATRNNISSESQFASQVIGRLLGQEYVEQLIAVQIPQEFIQELAVAIEPSRPV  116

Query  194  WRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKR  15
             R     ++  +    L  DH+ F  +T  E   + VEIKPK GFL  S F+ +   +K+
Sbjct  117  SRRQKG-IDHSQKVGFLALDHTRF--ITSTEHPSVSVEIKPKWGFLTNSDFVRKDQDIKK  173

Query  14   RITR  3
            R  R
Sbjct  174  RKCR  177



>ref|XP_008318919.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Cynoglossus semilaevis]
Length=501

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 89/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            +D  D  +W Y GEG  +LV+S+  ++     ++LR+ K P    E    +P  T  +  
Sbjct  3    VDKMDENDWKYHGEGNKSLVVSHVQLS-----RVLRLLKYPAEDSE----NPPQTPEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG E + +G  + +  EF+  +   V H RP
Sbjct  53   -FRQLQNIVD----------FCSNVMSRLLGEEFIHSGEVVKLPLEFVRQLSIKVQHHRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+SK +  S  VK
Sbjct  102  VWRCDKV-MDIYSGCALCLPNLTSPLLHQPTHTPPLCIEIKPKCGFLPSSKLV--SKEVK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_008289491.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Stegastes partitus]
Length=492

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 89/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+  ++     ++LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQLS-----RVLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -FRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPGIHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_005469745.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Oreochromis niloticus]
Length=503

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQ-HPR----VLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -YRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_005469746.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Oreochromis niloticus]
Length=488

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQ-HPR----VLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -YRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_006783025.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Neolamprologus 
brichardi]
Length=488

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQ-HPR----VLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -YRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_005917853.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Haplochromis 
burtoni]
Length=488

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQ-HPR----VLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -YRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_005749523.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Pundamilia 
nyererei]
Length=488

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQ-HPR----VLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -YRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_004547453.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Maylandia 
zebra]
Length=488

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQ-HPR----VLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   V H+RP
Sbjct  53   -YRQIQNIVD----------FSSNVMSSLLGEKFIHSGEVVKLPLEFVRQLSIKVQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQPTHTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             ++ R
Sbjct  159  TKVCR  163



>ref|XP_008406493.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Poecilia reticulata]
Length=496

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 87/185 (47%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+         ++LR+ K P    E    +P  T  +  
Sbjct  3    LDRMDENDWKYHGEGNKSLVVSHVQHC-----RVLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + V +G  + +  EF+  +   + H+RP
Sbjct  53   -FRQIQNIVD----------FTSNVMSCLLGEKFVHSGEVVRLPLEFVRQLSIKIQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPTLHQPTPTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             R+ R
Sbjct  159  TRVCR  163



>ref|XP_007575013.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Poecilia formosa]
Length=496

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 87/185 (47%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+         ++LR+ K P    E    +P  T  +  
Sbjct  3    LDRMDENDWKYHGEGNKSLVVSHVQHC-----RVLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + V +G  + +  EF+  +   + H+RP
Sbjct  53   -FRQIQNIVD----------FTSNVMSCLLGEKFVHSGEVVRLPLEFVRQLSIKIQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPTLHQPTPTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             R+ R
Sbjct  159  TRVCR  163



>ref|XP_002671419.1| predicted protein [Naegleria gruberi]
 gb|EFC38675.1| predicted protein [Naegleria gruberi]
Length=478

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 88/181 (49%), Gaps = 15/181 (8%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D+ EW Y+ EG  N++L Y G  PRF G++LR++K P +    E      T+ E++   +
Sbjct  8    DSSEWHYKCEGLGNVILGYCGNNPRFVGRVLRVRKCPRS----ELTSNKSTMDEMYSKSE  63

Query  365  ----VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
                 +D ++   R++    F     C       VDAG  I +SREFL  ++  +   RP
Sbjct  64   GIISREDYLTIYVRDVIGSLF---STCYPNNSGLVDAGETISLSREFLREMKSKIDLVRP  120

Query  197  TWRVDAA-KLNLLRDSILLMSDHSIFPHVTPK---EELCICVEIKPKCGFLPASKFIIES  30
            T  ++     ++  D  +LM D +     T K   ++   CVE KPK G +  S+FI + 
Sbjct  121  TQMLEYKLDFDINADCGMLMRDFTYNRKHTQKTNSDDATFCVEFKPKWGMICRSEFIKDE  180

Query  29   N  27
            N
Sbjct  181  N  181



>ref|XP_006631161.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Lepisosteus 
oculatus]
Length=490

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 88/186 (47%), Gaps = 25/186 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            +D  D  EW Y GEG  +LV+S+         ++LR  K P    E EN  P  T  E  
Sbjct  3    VDKMDENEWKYHGEGNKSLVISHVQ-----HSQVLRFLKYPAE--EIEN--PRQTSEEA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F + VM PFLG ++V  G  + +  +F+  +   V  KRP
Sbjct  53   -FQQIQNIVD----------FSKNVMKPFLGEKYVHHGEAVKLPLDFVRQLSSKVQQKRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC-ICVEIKPKCGFLPASKFIIESNAV  21
              R D   ++      L + + +  P     E    +C+EIKPKCGFLP S+ +  +  +
Sbjct  102  ESRCDKM-MDTFSGYALCLPNLTKLPDCHFSENRSPLCIEIKPKCGFLPFSRHV--TKEI  158

Query  20   KRRITR  3
            K ++ R
Sbjct  159  KHKVCR  164



>ref|XP_005813640.1| PREDICTED: LOW QUALITY PROTEIN: inositol-pentakisphosphate 2-kinase-like 
[Xiphophorus maculatus]
Length=528

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 87/185 (47%), Gaps = 24/185 (13%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+         ++LR+ K P    E    +P  T  +  
Sbjct  3    LDRMDENDWKYHGEGNKSLVVSHVQHC-----RVLRLLKYPAEDSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   V+   LG + V +G  + +  EF+  +   + H+RP
Sbjct  53   -FRQIQNIVD----------FTSNVISCLLGEKFVHSGEVVRLPLEFVRQLSIKIQHQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
             WR D   +++     L + + +      P     +C+EIKPKCGFLP+ K +  S  +K
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPTLHQPTPTPPLCIEIKPKCGFLPSPKHV--SKDIK  158

Query  17   RRITR  3
             R+ R
Sbjct  159  TRVCR  163



>ref|XP_003973068.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Takifugu 
rubripes]
Length=493

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 91/194 (47%), Gaps = 42/194 (22%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  NLV+++  ++     ++LR+ K P    E    +P  +  +  
Sbjct  3    LDKMDENDWVYHGEGNKNLVVAHVKLS-----RVLRLLKYPAEDSE----NPPQSAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + V +G  + +  EF+  +   V H+RP
Sbjct  53   -FRQIQNIVD----------FSSNVMSILLGEKFVHSGEVVKLPLEFVRQLSIKVQHERP  101

Query  197  TWRVD---------AAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASK  45
             WR D         A  L  L   +L +S H      TP     +CVEIKPK GFLP+SK
Sbjct  102  GWRCDKVIDIYSGCALSLPNLTYPVLHLSTH------TPP----LCVEIKPKWGFLPSSK  151

Query  44   FIIESNAVKRRITR  3
             +  S  +K ++ R
Sbjct  152  HV--SKDIKSKVCR  163



>emb|CDQ90148.1| unnamed protein product [Oncorhynchus mykiss]
Length=200

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 88/193 (46%), Gaps = 38/193 (20%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S    A     ++LR+ K  T   + EN H         
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSNVQHA-----RVLRLLKYSTE--DAENSHKTTE----Q  51

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           + Q VM P LG + V  G  + +  +F+  +   V  +RP
Sbjct  52   AFRHIQNIVD----------YSQNVMKPLLGEKFVHDGEAVKLPLDFVRQLSLKVQQERP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC--------ICVEIKPKCGFLPASKF  42
              R D   ++      L +      P++T     C        +C+EIKPKCGFLP+S+ 
Sbjct  102  ESRCDKV-MDTFSGCALCL------PNLTQLSSCCCCREHRPPLCIEIKPKCGFLPSSRH  154

Query  41   IIESNAVKRRITR  3
            +  +  +K+++ R
Sbjct  155  V--TKEIKKQVCR  165



>gb|ESA22216.1| hypothetical protein GLOINDRAFT_91521 [Rhizophagus irregularis 
DAOM 181602]
Length=457

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 90/193 (47%), Gaps = 33/193 (17%)
 Frame = -3

Query  578  IPRMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG  399
            + R+  + +  +   W ++ EG  N+ LSY G   RF+  +LR++K              
Sbjct  1    MARVETIPELYNTTLWKFKAEGNANITLSYVGENARFSATVLRLRK--------------  46

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
                      +  D +  P  +   + +   +M P +G ++V   I + V  EFL+A+ K
Sbjct  47   ---------DNQLDTIIDP--QYFTYSYANFIMKPLIGDKYVGESILLEVQPEFLKALSK  95

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFP-HVTPKEELCICVEIKPKCGFLPASKF  42
            +VL  R   R     ++  +   +L  DH++FP +++P     + VE+KPK  FLP+S F
Sbjct  96   SVLKIRSNKRT-QKDIDHNQKYAILTPDHTVFPSNISP----TLSVELKPKWAFLPSSPF  150

Query  41   IIESNAVKRRITR  3
            I   N VK +  R
Sbjct  151  I--ENFVKFQSCR  161



>gb|EXX69950.1| hypothetical protein RirG_091860 [Rhizophagus irregularis DAOM 
197198w]
Length=454

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 90/193 (47%), Gaps = 33/193 (17%)
 Frame = -3

Query  578  IPRMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPG  399
            + R+  + +  +   W ++ EG  N+ LSY G   RF+  +LR++K              
Sbjct  1    MARVETIPELYNTTLWKFKAEGNANITLSYVGENARFSATVLRLRK--------------  46

Query  398  LTVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEK  219
                      +  D +  P  +   + +   +M P +G ++V   I + V  EFL+A+ K
Sbjct  47   ---------DNQLDTIIDP--QYFTYSYANFIMKPLIGDKYVGESILLEVQPEFLKALSK  95

Query  218  NVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFP-HVTPKEELCICVEIKPKCGFLPASKF  42
            +VL  R   R     ++  +   +L  DH++FP +++P     + VE+KPK  FLP+S F
Sbjct  96   SVLKIRSNKRT-QKDIDHNQKYAILTPDHTVFPSNISP----TLSVELKPKWAFLPSSPF  150

Query  41   IIESNAVKRRITR  3
            I   N VK +  R
Sbjct  151  I--ENFVKFQSCR  161



>emb|CAF89733.1| unnamed protein product [Tetraodon nigroviridis]
Length=475

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 85/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  EW Y GEG  NLV+++  ++     ++LR+ K P    E     P +      
Sbjct  3    LDKMDENEWKYHGEGNKNLVVAHVKLS-----RVLRLLKYPAKDSE---NPPQMAERAFR  54

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
              +++ D             F   VM   LG + V +G  + +  EF+  +   V  +RP
Sbjct  55   QIQNIVD-------------FSSNVMSVLLGEKFVHSGEVVKLPLEFVRRLSIKVQDERP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHS-----IFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
             WR D   +++     L + + +     +  H  P     +CVEIKPK GFLP+SK +  
Sbjct  102  GWRCDKV-IDIYSGCALALPNLTYPILHLSAHAPP-----LCVEIKPKWGFLPSSKHV--  153

Query  32   SNAVKRRITR  3
            S  +K R+ R
Sbjct  154  SKDIKSRVCR  163



>gb|AAY79345.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Danio rerio]
Length=483

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 80/185 (43%), Gaps = 41/185 (22%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  ++V+S+         ++LR+ KVP+                  
Sbjct  3    LDKMDENDWKYHGEGNKSIVVSHLRHC-----QVLRLLKVPSED----------------  41

Query  377  LWKDVKDLVSAPTREIAEHF---------FVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
                     SA TR+ AE           + + VM P LG ++V +G  + +  +FL  +
Sbjct  42   ---------SAHTRQTAEQTLRHILNIMDYSKHVMKPLLGEKYVHSGEVVRLPLDFLRQM  92

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFP-HVTPKEELCICVEIKPKCGFLPAS  48
               V  +RP  R D   ++      L + D +  P H        ICVEIKPKCGFLP S
Sbjct  93   SLKVQQERPELRCDKV-MDTFSGCGLCLPDLTQLPLHHLRDHRPPICVEIKPKCGFLPFS  151

Query  47   KFIIE  33
            + + +
Sbjct  152  RHMTK  156



>sp|Q4JL91.3|IPPK_DANRE RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=InsP5 2-kinase [Danio 
rerio]
Length=483

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 80/185 (43%), Gaps = 41/185 (22%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  ++V+S+         ++LR+ KVP+                  
Sbjct  3    LDKMDENDWKYHGEGNKSIVVSHLRHC-----QVLRLLKVPSED----------------  41

Query  377  LWKDVKDLVSAPTREIAEHF---------FVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
                     SA TR+ AE           + + VM P LG ++V +G  + +  +FL  +
Sbjct  42   ---------SAHTRQTAEQTLRHILNIMDYSKHVMKPLLGEKYVHSGEVVRLPLDFLRQM  92

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFP-HVTPKEELCICVEIKPKCGFLPAS  48
               V  +RP  R D   ++      L + D +  P H        ICVEIKPKCGFLP S
Sbjct  93   SLKVQQERPELRCDKV-MDTFSGCGLCLPDLTQLPLHHLRDHRPPICVEIKPKCGFLPFS  151

Query  47   KFIIE  33
            + + +
Sbjct  152  RHMTK  156



>ref|NP_001014346.1| inositol-pentakisphosphate 2-kinase [Danio rerio]
 gb|AAH91783.1| Inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Danio rerio]
 gb|AAI65752.1| Ippk protein [Danio rerio]
Length=483

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 80/185 (43%), Gaps = 41/185 (22%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  ++V+S+         ++LR+ KVP+                  
Sbjct  3    LDKMDENDWKYHGEGNKSIVVSHLRHC-----QVLRLLKVPSED----------------  41

Query  377  LWKDVKDLVSAPTREIAEHF---------FVQQVMCPFLGPEHVDAGIHILVSREFLEAV  225
                     SA TR+ AE           + + VM P LG ++V +G  + +  +FL  +
Sbjct  42   ---------SAHTRQTAEQTLRHILNIMDYSKHVMKPLLGEKYVHSGEVVGLPLDFLRQM  92

Query  224  EKNVLHKRPTWRVDAAKLNLLRDSILLMSDHSIFP-HVTPKEELCICVEIKPKCGFLPAS  48
               V  +RP  R D   ++      L + D +  P H        ICVEIKPKCGFLP S
Sbjct  93   SLEVQQERPELRCDKV-MDTFSGCGLCLPDLTQLPLHHLRDHRPPICVEIKPKCGFLPFS  151

Query  47   KFIIE  33
            + + +
Sbjct  152  RHMTK  156



>ref|XP_636779.1| hypothetical protein DDB_G0288351 [Dictyostelium discoideum AX4]
 gb|EAL63272.1| hypothetical protein DDB_G0288351 [Dictyostelium discoideum AX4]
Length=519

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 79/203 (39%), Gaps = 71/203 (35%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRGIAPR---FAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDV  363
            W Y+GEGA+N+VLSY G  PR     G +LR++K+   G + E                 
Sbjct  16   WVYKGEGAMNIVLSYNG--PRNEKLDGLVLRVKKLSNGGSDLE-----------------  56

Query  362  KDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVD  183
                    +EI  + FV  VM P LG ++V  G  I V+ +FL  ++  + + RP  R  
Sbjct  57   --------KEIGLYNFVSNVMSPLLGDKYVFPGSMINVTSDFLVKLDNLIFNYRPIKR-S  107

Query  182  AAKLNLLRDSILLMSDHSIFPHVTPKE---------------------------------  102
              +L+    +  L+ D +   + TP +                                 
Sbjct  108  TIRLDTNLTTAFLIMDLTRLDNNTPNQIEYLHHHNDNDNNNDNNDNNNNDNNDNNNNNNN  167

Query  101  -------ELCICVEIKPKCGFLP  54
                      IC+EIKPK  FLP
Sbjct  168  EIGNNKFSKVICIEIKPKWAFLP  190



>ref|XP_010873338.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Esox 
lucius]
Length=499

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 38/193 (20%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+   A     ++LR+ K  T   + EN H         
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQHA-----RVLRLLKYSTE--DDENSHKTTE----Q  51

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           + + VM P LG + V  G  + +  +F+  +   V  +RP
Sbjct  52   AFRHIQNIVD----------YSKNVMKPLLGEKFVHNGEAVKLPIDFVRQLSLKVQRERP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC--------ICVEIKPKCGFLPASKF  42
              R D   ++      L +      P++T     C        +C+EIKPKCGFLP+S+ 
Sbjct  102  ESRCDKV-MDTFSGCALCL------PNLTQLSSCCCFGQHRPPLCIEIKPKCGFLPSSRH  154

Query  41   IIESNAVKRRITR  3
            +  +  +K ++ R
Sbjct  155  V--TKEIKSKVCR  165



>emb|CDP17915.1| unnamed protein product [Coffea canephora]
Length=236

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  113  TPKEELCICVEIKPKCGFLPASKFIIESNAVKRRITR  3
            T KEE  +CVEIKPKCGFLP SKFI E NA+KR +TR
Sbjct  29   TLKEEYSLCVEIKPKCGFLPTSKFIDEGNAMKRSVTR  65



>ref|XP_010873347.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Esox 
lucius]
Length=498

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 38/193 (20%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            LD  D  +W Y GEG  +LV+S+   A     ++LR+ K  T   + EN H         
Sbjct  3    LDKMDENDWKYHGEGNKSLVVSHVQHA-----RVLRLLKYSTE--DDENSHKTTE----Q  51

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           + + VM P LG + V  G  + +  +F+  +   V  +RP
Sbjct  52   AFRHIQNIVD----------YSKNVMKPLLGEKFVHNGEAVKLPIDFVRQLSLKVQRERP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC--------ICVEIKPKCGFLPASKF  42
              R D   ++      L +      P++T     C        +C+EIKPKCGFLP+S+ 
Sbjct  102  ESRCDKV-MDTFSGCALCL------PNLTQLSSCCCFGQHRPPLCIEIKPKCGFLPSSRH  154

Query  41   IIESNAVKRRITR  3
            +  +  +K ++ R
Sbjct  155  V--TKEIKSKVCR  165



>ref|XP_004086208.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Oryzias 
latipes]
Length=505

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 88/189 (47%), Gaps = 32/189 (17%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            +D  D  +W Y GEG  +LV+ +    PR    +LR+ K P    E    +P  T  +  
Sbjct  3    VDKMDENDWKYHGEGNKSLVVCHVQF-PR----VLRLLKYPAADSE----NPPQTAEQA-  52

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
             ++ ++++V           F   VM   LG + + +G  + +  EF+  +   +  +RP
Sbjct  53   -FRQIQNIVD----------FSSNVMSSMLGDKFIHSGEVVKLPLEFVRQLSIKIQQQRP  101

Query  197  TWRVDAAKLNLLRDSILLMSDHSI----FPHVTPKEELCICVEIKPKCGFLPASKFIIES  30
             WR D   +++     L + + +        +TP     +C+EIKPKCGFLP+ K +  S
Sbjct  102  AWRCDKV-MDIYSGCALCLPNLTSPALHQATLTPP----LCIEIKPKCGFLPSPKHV--S  154

Query  29   NAVKRRITR  3
              +K ++ R
Sbjct  155  KDIKAKVCR  163



>emb|CBN74385.1| conserved unknown protein [Ectocarpus siliculosus]
Length=519

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 84/195 (43%), Gaps = 27/195 (14%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENG-HPGLTVHEIHLWKDVK  360
            +WSY  EG  +++L Y G  P  +G+ILRI K      + E G  P      + +     
Sbjct  17   DWSYLAEGGFHIILRYDGEDPVLSGRILRIGKKALGHQKEEGGKEPAGPAAAVVV-----  71

Query  359  DLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV--  186
                 P    A   F + V+ P LG ++V  G  + +SRE +  +  ++ H RP  R+  
Sbjct  72   -----PDEAGARRKFERGVLIPLLGEQYVQPGDAVTLSREDIWKIHLSIDHLRPEGRIKK  126

Query  185  ------DAAKLNLLRDSILLM--SDHSIFPHVTPKEE-----LCICVEIKPKCGFLPASK  45
                   A +L   + +  L   S  S     +P E+     + I VEIKPK   +P   
Sbjct  127  DNGDWSSACQLEPDKTAFWLKLPSAPSTAGPASPTEDRKKKGIVIAVEIKPKGATMPVGT  186

Query  44   FI-IESNAVKRRITR  3
             +   +N +K R+ R
Sbjct  187  LVPPGNNRLKYRVAR  201



>ref|XP_003055988.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59364.1| predicted protein [Micromonas pusilla CCMP1545]
Length=512

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 8/165 (5%)
 Frame = -3

Query  542  AMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPT--NGCEYENGHPGLTVHEIHLWK  369
            A EW +  EG+ ++VL Y G  P+ A KILR++KV      C  +N    L V +  LW 
Sbjct  23   ASEWQFLAEGSAHVVLRYCGRNPKLAFKILRLRKVDNLHLACHKDNIVERLQVTDKLLWS  82

Query  368  DVKDLVSA--PTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPT  195
                L S    + E +E  +V  ++ P +G         I +  +FL A    +   R  
Sbjct  83   CHSRLSSTKVTSAEFSEE-YVDSILRPLVGDNLTYPSDSINIDVDFLSATAVAIAPMRDL  141

Query  194  WRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC---ICVEIKPK  69
             RV  ++++      +L  +H++FP  +     C     VE+KPK
Sbjct  142  CRVRNSEIDFQAKFAVLHQNHNLFPGSSALRAACRPTFSVELKPK  186



>ref|XP_007428725.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Python bivittatus]
Length=488

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 81/181 (45%), Gaps = 30/181 (17%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+S+R         +LR  K P N     N  P    H  HL   
Sbjct  7    DENEWRYHGEGNKSLVVSHRQHCI-----VLRFLKFPPN----RNKTPEEIAH--HLQNI  55

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            V              +F + +M  F G ++V  G  + +  +F++ +   +  +RP  R 
Sbjct  56   V--------------YFGKHIMKHFFGEKYVHHGEVVQLPLDFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D   ++ L    L + + +    V  + +LCI  EIKPKCGFLP S  +  S  +K ++ 
Sbjct  102  DK-DMDTLSGYALCLPNLTRLHSVEHRPKLCI--EIKPKCGFLPFSSHV--SQEIKYKVC  156

Query  5    R  3
            R
Sbjct  157  R  157



>ref|XP_009089470.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Serinus canaria]
Length=499

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 27/182 (15%)
 Frame = -3

Query  548  KDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWK  369
            KD  EW Y GEG  +LV+S+     R    +LR  K P N    +N  P   +H +    
Sbjct  15   KDENEWKYHGEGNQSLVVSH---CQRCV--VLRFLKSPPN----QNKTPEEILHHLQNIV  65

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            D                F + VM  F G  +V  G  I +  +F+  +   +  +RP  R
Sbjct  66   D----------------FGKHVMKQFFGENYVHHGEIIQLPLDFVRQLCLKIQPERPECR  109

Query  188  VDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRI  9
             D     L   ++ L +   + P    +    +C+EIKPKCGF+P S  +  S  +K ++
Sbjct  110  CDKDMDTLSSYAMCLPNLTRLQPFRFAEHRPILCIEIKPKCGFIPFSSHV--SQEIKHKV  167

Query  8    TR  3
             R
Sbjct  168  CR  169



>ref|XP_003468284.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Cavia porcellus]
Length=489

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 85/188 (45%), Gaps = 41/188 (22%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++D+V           F + VM  FLG   V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQDIVD----------FGRNVMKEFLGENCVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCI-------CVEIKPKCGFLPASKFIIESN  27
            D       +D   L       P++T  +  CI       CVEIKPKCGF+P S  +  ++
Sbjct  102  D-------KDLDTLSGYAMCLPNLTRLQTYCIAEHRPILCVEIKPKCGFIPFSSSV--TH  152

Query  26   AVKRRITR  3
             +K ++ R
Sbjct  153  EMKHKVCR  160



>ref|XP_003795089.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Otolemur garnettii]
Length=581

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 89/198 (45%), Gaps = 41/198 (21%)
 Frame = -3

Query  575  PRMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGL  396
            PR  +     D  EW Y GEG  +LV+++   A R    +LR  K P N  +        
Sbjct  87   PRWGMEEGKMDENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------  133

Query  395  TVHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKN  216
            T  EI  ++ ++++V           F + VM  FLG  +V  G  + +  EF++ +   
Sbjct  134  TSEEI--FQHLQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLK  181

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELC-------ICVEIKPKCGFL  57
            +  +RP  R D       +D   L       P++T  +  C       +CVEIKPKCGF+
Sbjct  182  IQSERPESRCD-------KDLDTLSGYAMCLPNLTRLQTYCFAEHRPILCVEIKPKCGFI  234

Query  56   PASKFIIESNAVKRRITR  3
            P S  +  ++ +K ++ R
Sbjct  235  PFSSDV--THEMKHKVCR  250



>ref|XP_005856254.1| inositol-pentakisphosphate 2-kinase-like protein, partial [Nannochloropsis 
gaditana CCMP526]
 gb|EKU20110.1| inositol-pentakisphosphate 2-kinase-like protein, partial [Nannochloropsis 
gaditana CCMP526]
Length=211

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 80/188 (43%), Gaps = 38/188 (20%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKD  357
            EW Y  EG ++++L+YRG   RF   +LR+ KV   G                     K 
Sbjct  19   EWVYLAEGNLHVLLAYRGQCARFRDHVLRLLKVRHGG--------------------EKK  58

Query  356  LVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV---  186
             +  P +   E  +V+ V+ P LG ++++ G  + V+  FL  V   ++  RP  R    
Sbjct  59   ALYDPRQ---ERHYVEHVVGPVLGHQYLETGTSLTVTPSFLNEVAIQIMPHRPARRAVYD  115

Query  185  ---DAAKLNLLRDSILLMSDHSIFPHVT----PKEELCICVEIKPKCGFLPASKFIIESN  27
                A  +  LRD   L       PH T    P  +L +  EIKPK G+   S+ +  + 
Sbjct  116  LDKTACTVECLRD---LTRFFPPMPHATLTAPPTCQLTL--EIKPKAGYHSRSRLVPPAR  170

Query  26   AVKRRITR  3
              K + +R
Sbjct  171  RFKFQESR  178



>ref|XP_002193083.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Taeniopygia guttata]
Length=491

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 79/185 (43%), Gaps = 27/185 (15%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            ++  D  EW Y GEG  +LV+S+     R    +LR  K P N    +N  P   +H + 
Sbjct  3    VEKMDENEWKYHGEGNQSLVVSH---CQRCV--VLRFLKSPPN----QNKTPEEILHHLQ  53

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
               D                F + VM  F G  +V  G  I +  +F+  +   +  +RP
Sbjct  54   NIVD----------------FGKHVMKQFFGENYVHHGEIIQLPLDFVRQLCLKIQPERP  97

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVK  18
              R D     L   ++ L +   + P    +    +C+EIKPKCGF+P S  +  S  +K
Sbjct  98   ECRCDKDMDTLSGYAMCLPNLTRLQPFRLAEHRPILCIEIKPKCGFIPFSSHV--SQEIK  155

Query  17   RRITR  3
             ++ R
Sbjct  156  HKVCR  160



>ref|XP_005320928.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Ictidomys tridecemlineatus]
Length=489

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 86/181 (48%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S ++  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSYV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_002927737.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Ailuropoda 
melanoleuca]
 gb|EFB19524.1| hypothetical protein PANDA_017551 [Ailuropoda melanoleuca]
Length=491

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 82/181 (45%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P          P        +++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFP----------PSRKKTSEEIFQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FSKNVMKEFLGENYVHCGEVVQLPLDFVQQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++  KRR+ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYHFAEHRPILCVEIKPKCGFIPLSGDV--THEAKRRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>gb|EWM22690.1| inositol-pentakisphosphate 2-kinase-like protein [Nannochloropsis 
gaditana]
Length=555

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 79/188 (42%), Gaps = 38/188 (20%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKD  357
            EW Y  EG ++++L+YRG   RF   +LR+ KV   G             E     D + 
Sbjct  19   EWVYLAEGNLHVLLAYRGQCARFRDHVLRLLKVRHGG-------------EKKALYDPRQ  65

Query  356  LVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV---  186
                      E  +V+ V+ P LG ++++ G  + V+  FL  V   ++  RP  R    
Sbjct  66   ----------ERHYVEHVVGPVLGHQYLETGTSLTVTPSFLNEVAIQIMPHRPARRAVYD  115

Query  185  ---DAAKLNLLRDSILLMSDHSIFPHVT----PKEELCICVEIKPKCGFLPASKFIIESN  27
                A  +  LRD   L       PH T    P  +L +  EIKPK G+   S+ +  + 
Sbjct  116  LDKTACTVECLRD---LTRFFPPMPHATLTAPPTCQLTL--EIKPKAGYHSRSRLVPPAR  170

Query  26   AVKRRITR  3
              K + +R
Sbjct  171  RFKFQESR  178



>gb|EFA81684.1| hypothetical protein PPL_05678 [Polysphondylium pallidum PN500]
Length=502

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 83/195 (43%), Gaps = 61/195 (31%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRGI-----APRF-------AGKILRIQKVPTNGCEYENGHPGLTV  390
            W Y+GEGA N+VLSY G      A  F        GK+LR++K    G            
Sbjct  14   WCYKGEGACNIVLSYVGTDITNRAEYFNSLNYINVGKVLRLRKFGVGG------------  61

Query  389  HEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAG---IHILVS---------  246
                   D  DL          + F+  VM P +G ++V  G   +++L+S         
Sbjct  62   ------DDDSDL--------KNNSFLLNVMLPLIGSKYVYPGVLFVYLLISWFNNKLLQT  107

Query  245  -----REFLEAVEKNVLHKRPTWRVDAAKLNL--LRDSILLMSDHSIFPHVTPKEELCIC  87
                 R+FL  +++ + + RPT R +  +LN+   R  ++L         V       I 
Sbjct  108  VIQLNRDFLSQLDEQIYNDRPTHRRN-NRLNIECKRGLLILDLTLLTTGGVGGTS---IS  163

Query  86   VEIKPKCGFLPASKF  42
            VEIKPKCGF+  SK+
Sbjct  164  VEIKPKCGFVTQSKY  178



>ref|XP_005408970.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Chinchilla 
lanigera]
Length=511

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 84/181 (46%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++D+V           F + VM  FLG   V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQDIVD----------FGKNVMKEFLGENCVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRIAEHRPILCVEIKPKCGFIPFSSSV--THGMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_004647610.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Octodon degus]
Length=489

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 83/188 (44%), Gaps = 41/188 (22%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI   + 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--LQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++D+V           F + VM  F G   V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQDIVD----------FGKNVMKEFFGENCVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCI-------CVEIKPKCGFLPASKFIIESN  27
            D       +D   L       P++T  +  CI       CVEIKPKCGF+P S  +  ++
Sbjct  102  D-------KDLDTLSGYAMCLPNLTRLQTYCIAEHRPILCVEIKPKCGFIPFSSSV--TH  152

Query  26   AVKRRITR  3
             +K ++ R
Sbjct  153  EMKHKVCR  160



>ref|XP_009492418.1| hypothetical protein H696_00295 [Fonticula alba]
 gb|KCV72717.1| hypothetical protein H696_00295 [Fonticula alba]
Length=578

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 81/197 (41%), Gaps = 46/197 (23%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRG---IAP--RFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWK  369
            W Y GEGA ++ L++     + P   FAGK+LR+ K   +       HPG + +     +
Sbjct  21   WRYVGEGAAHVALAFTASPDVGPFASFAGKVLRLPKRAAD-------HPG-SANPGQEAR  72

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            D++ L            FV +++ P +G +++   + I  + EF   V   +   RP  R
Sbjct  73   DLQKLA-----------FVGEIIAPLIGAQYIQQSVPIRTTPEFRRQVAAAIRPLRPAAR  121

Query  188  VDAAKL-------NLLRDS--------------ILLMSDHSIFPH-VTPKEELCICVEIK  75
            +  + L        L  D                 L  D ++ P    P     +  E+K
Sbjct  122  LSGSTLPPGINPLELPGDDDPDLGPCGLSSVTMATLYDDLTLLPDSCCPGGGSTLAFEVK  181

Query  74   PKCGFLPASKFIIESNA  24
            PK GF+PAS F+  + A
Sbjct  182  PKWGFMPASPFVASAAA  198



>ref|XP_005408971.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Chinchilla 
lanigera]
Length=489

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 84/181 (46%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++D+V           F + VM  FLG   V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQDIVD----------FGKNVMKEFLGENCVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRIAEHRPILCVEIKPKCGFIPFSSSV--THGMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|NP_001280251.1| inositol-pentakisphosphate 2-kinase [Gallus gallus]
Length=491

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 81/187 (43%), Gaps = 31/187 (17%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            ++  D  EW Y GEG  +LV+S+     R    +LR  K P N    +N  P   +H + 
Sbjct  3    VEKMDENEWKYHGEGNQSLVVSH---CQRCV--VLRFLKFPPN----QNKTPEEILHHLQ  53

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
               D                F + VM  F G  +V  G  + +  +F+  +   +  +RP
Sbjct  54   NIVD----------------FGKHVMKQFFGENYVHHGEIVQLPLDFVRQLCLKIQPERP  97

Query  197  TWRVDAAKLNLLRDSILL--MSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNA  24
              R D     L   ++ L  ++    +  V P+  LCI  EIKPKCGF+P S  +  S  
Sbjct  98   ESRCDKDMDTLSGYAMCLPNLTRLQTYRFVEPRPILCI--EIKPKCGFIPFSSHV--SQE  153

Query  23   VKRRITR  3
            +K ++ R
Sbjct  154  IKHKVCR  160



>ref|XP_002820003.2| PREDICTED: inositol-pentakisphosphate 2-kinase [Pongo abelii]
Length=491

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  +K 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FKH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_004652359.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Jaculus jaculus]
Length=489

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 79/186 (42%), Gaps = 37/186 (20%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N                     
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNR--------------------  41

Query  365  VKDLVSAPTREIAEHF-----FVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKR  201
                    + EI EH      F + VM  FLG  +V  G  + +  EF++ +   +  +R
Sbjct  42   -----KKTSEEIFEHLQNIVDFGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSER  96

Query  200  PTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAV  21
            P  R D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +
Sbjct  97   PESRCDKDLDTLSGYAMCLPNLTRLQTYHFAEHRPILCVEIKPKCGFIPFSSDV--THEM  154

Query  20   KRRITR  3
            K R+ R
Sbjct  155  KHRVCR  160



>gb|EDL98114.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Rattus norvegicus]
Length=489

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 81/188 (43%), Gaps = 41/188 (22%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EWSY GEG  +LV+++   A R    +LR  K P N                     
Sbjct  7    DENEWSYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNK--------------------  41

Query  365  VKDLVSAPTREIAEHF-----FVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKR  201
                    + EI +H      F + VM  FLG  +V  G  + +  EF++ +   +  +R
Sbjct  42   -----KKTSEEILQHLQNIVDFGKNVMKDFLGENYVHCGEVVQLPLEFVKQLCLKIQCER  96

Query  200  PTWRVDAAKLNLLRDSILL--MSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            P  R D     L   ++ L  ++    FP    +  L  CVEIKPKCGF+P S  +  ++
Sbjct  97   PESRCDKDLDTLSGYAMCLPNLTRLQTFPFAEHRPIL--CVEIKPKCGFIPFSNGV--TH  152

Query  26   AVKRRITR  3
             +K ++ R
Sbjct  153  EMKHKVCR  160



>gb|ELR51986.1| Inositol-pentakisphosphate 2-kinase [Bos mutus]
Length=484

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 86/181 (48%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLDFVKQLCLKIQCERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P+S  +  ++ +K R+ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYQFAERRPILCVEIKPKCGFIPSSSDV--THELKHRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_004898275.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Heterocephalus 
glaber]
 ref|XP_004870138.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Heterocephalus 
glaber]
 gb|EHB11566.1| Inositol-pentakisphosphate 2-kinase [Heterocephalus glaber]
Length=489

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 84/181 (46%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++D+V           F + VM  FLG   V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQDIVD----------FGKNVMKEFLGENCVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKELDTLSGYAMCLPNLTRLQTYRIAEHRPILCVEIKPKCGFIPFSSSV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_005901898.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Bos mutus]
Length=492

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 86/181 (48%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLDFVKQLCLKIQCERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P+S  +  ++ +K R+ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYQFAERRPILCVEIKPKCGFIPSSSDV--THELKHRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|NP_001008556.1| inositol-pentakisphosphate 2-kinase [Rattus norvegicus]
 sp|Q5PXE9.1|IPPK_RAT RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=InsP5 2-kinase; Short=rIPK1 
[Rattus norvegicus]
 gb|AAV76010.1| inositol polyphosphate kinase 1 [Rattus norvegicus]
Length=489

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 81/188 (43%), Gaps = 41/188 (22%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EWSY GEG  +LV+++   A R    +LR  K P N                     
Sbjct  7    DENEWSYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNK--------------------  41

Query  365  VKDLVSAPTREIAEHF-----FVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKR  201
                    + EI +H      F + VM  FLG  +V  G  + +  EF++ +   +  +R
Sbjct  42   -----KKTSEEILQHLQNIVDFGKNVMKDFLGENYVHCGEVVQLPLEFVKQLCLKIQCER  96

Query  200  PTWRVDAAKLNLLRDSILL--MSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESN  27
            P  R D     L   ++ L  ++    FP    +  L  CVEIKPKCGF+P S  +  ++
Sbjct  97   PESRCDKDLDTLSGYAMCLPNLTRLQTFPFAEHRPIL--CVEIKPKCGFIPFSNGV--TH  152

Query  26   AVKRRITR  3
             +K ++ R
Sbjct  153  EMKHKVCR  160



>ref|XP_002951880.1| hypothetical protein VOLCADRAFT_105293 [Volvox carteri f. nagariensis]
 gb|EFJ46985.1| hypothetical protein VOLCADRAFT_105293 [Volvox carteri f. nagariensis]
Length=583

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 66/166 (40%), Gaps = 30/166 (18%)
 Frame = -3

Query  536  EWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKD  357
            +W  RG+GA N+V  Y G  P+  G +LR++K         + H    V  I LW  +  
Sbjct  4    KWQLRGQGAANVVFGYCGDDPKLRGYVLRVRK--------PSAHVASDVDRI-LWDGILH  54

Query  356  LVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAA  177
              S       E  +V  +M P LG E+V  G+   +  E  E +        P       
Sbjct  55   SASDTYDIQYELEYVANIMAPLLGHEYVFPGVPTPLPLELREVLGSGAGSHLPA------  108

Query  176  KLNLLRDSILLMSDHSIF-----PHVTPKEELCICVEIKPKCGFLP  54
                     LL+ DH+ F     P  T      IC+EIKPK G  P
Sbjct  109  ---------LLLPDHTTFHSKAAPGYTAVGP-AICLEIKPKWGLDP  144



>gb|ELV14098.1| Inositol-pentakisphosphate 2-kinase [Tupaia chinensis]
Length=493

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMREFLGENYVHCGEVVQLPLEFVKQLCVKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRVAEHRPTLCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_005987157.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Latimeria chalumnae]
Length=468

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 77/191 (40%), Gaps = 37/191 (19%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            L+  D  EW Y GEG  +LV+S+         ++LR  K P    E             H
Sbjct  3    LEKMDENEWKYHGEGNKSLVVSHVQ-----HCQVLRFLKFPMELVESNQASEAFC----H  53

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
            L   V               F + +M P LG  +V  G  + +  +F+  +   +  +RP
Sbjct  54   LQNIVD--------------FGKHIMKPLLGESYVHYGEVVQLPLDFVPRLFLKIQSERP  99

Query  197  TWRVDAAKLNL------LRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFII  36
              R +     L      L +   L + H I    T      +C+EIKPKCGFLP S  + 
Sbjct  100  ESRCNKIMDTLSGYALCLPNLTRLQTCHFIETQPT------LCIEIKPKCGFLPFSSHV-  152

Query  35   ESNAVKRRITR  3
             S  +KRR+ R
Sbjct  153  -SKEIKRRVCR  162



>ref|XP_005851212.1| hypothetical protein CHLNCDRAFT_137903 [Chlorella variabilis]
 gb|EFN59110.1| hypothetical protein CHLNCDRAFT_137903 [Chlorella variabilis]
Length=576

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 79/197 (40%), Gaps = 24/197 (12%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKDL  354
            WS++GEG  N V +Y G  P   GK+LR++K P    + E       V    L       
Sbjct  11   WSFKGEGNANWVFAYAGSLPLLVGKVLRVRK-PRPPQDAEQAALEEAVWAPVLGPSTAAT  69

Query  353  VSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFL--------------EAVEKN  216
             +A      E  +VQQ++ P LG  HV     +  S  FL                ++  
Sbjct  70   NAAGAAAAREQAYVQQLLAPLLGQHHVPHQEPVQTSPSFLRRLLVYSGCLPSGGNGLDFA  129

Query  215  VLHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL----CICVEIKPKCGFLPAS  48
                     V     +L+ D + L+SD S  P   P         +C+E+KPKCGF+   
Sbjct  130  AAAAAEKSEVAPGVASLMPD-VTLLSDSS--PTAAPGSGAALSPAVCIELKPKCGFIGGG  186

Query  47   KFII--ESNAVKRRITR  3
               +  ++  +KR  +R
Sbjct  187  CATVHPDNRPIKRSRSR  203



>ref|XP_010834294.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X3 [Bison 
bison bison]
Length=491

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 86/181 (48%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLDFVKQLCLKIQCERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P+S  +  ++ +K R+ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYQFAERRPILCVEIKPKCGFIPSSSDV--THELKHRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_007967932.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Chlorocebus sabaeus]
Length=491

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  I +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVIQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_003217705.2| PREDICTED: inositol-pentakisphosphate 2-kinase [Anolis carolinensis]
Length=546

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 80/181 (44%), Gaps = 30/181 (17%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+S+R         +LR  K   N     N  P    H  HL   
Sbjct  65   DENEWRYHGEGNKSLVVSHRQRCV-----VLRFLKFLPN----RNKTPEEIFH--HLQNI  113

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            V              +F + +M  F G +++  G  + +S +F++ +   +  +RP  R 
Sbjct  114  V--------------YFGKHIMKQFFGEKYIHHGEVVQLSLDFVKQLCLKIQSERPESRC  159

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D   ++ L    + + + +    V  +  LCI  EIKPKCGFLP S  +  S  +K ++ 
Sbjct  160  DK-NMDALSGYAMCLPNLTRLHFVEHRPILCI--EIKPKCGFLPFSSHV--SQEIKYKVC  214

Query  5    R  3
            R
Sbjct  215  R  215



>ref|XP_001103030.2| PREDICTED: inositol-pentakisphosphate 2-kinase [Macaca mulatta]
Length=513

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 88/190 (46%), Gaps = 27/190 (14%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
            R+ +     D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T
Sbjct  20   RLGMEEGKMDENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------T  66

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              EI  ++ ++++V           F + VM  FLG  +V  G  + +  EF++ +   +
Sbjct  67   SEEI--FQHLQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKI  114

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
              +RP  R D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  
Sbjct  115  QSERPESRCDKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--  172

Query  32   SNAVKRRITR  3
            ++ +K ++ R
Sbjct  173  THEMKHKVCR  182



>ref|XP_001623620.1| predicted protein [Nematostella vectensis]
 gb|EDO31520.1| predicted protein [Nematostella vectensis]
Length=484

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 72/171 (42%), Gaps = 28/171 (16%)
 Frame = -3

Query  548  KDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWK  369
            +D   W YRGEG   +V+ YRG        +LR++K   NG                   
Sbjct  21   EDRSSWFYRGEGNDTMVVGYRG-----QNVVLRLKKA-NNG-------------------  55

Query  368  DVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWR  189
            DVK  V    R      F ++V  P +   +V  G  + +S +FL  ++      RP  R
Sbjct  56   DVKK-VQGFDRISNSLEFAKRVFSPLMDGFYVSVGKVVALSEQFLADIDAICRADRPCAR  114

Query  188  VDAAKLNLLRDSILLMSDHSIFPHVTP-KEELCICVEIKPKCGFLPASKFI  39
            +  + ++      +LM D    P  +   +E    +EIKPKCGFLP S  I
Sbjct  115  LHKS-VDTGYTHGVLMRDLCFLPESSDYGKEPTFSIEIKPKCGFLPTSPHI  164



>ref|XP_005971608.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Pantholops hodgsonii]
Length=489

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLDFVKQLCLKIQCERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ VK R+ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYQFAERRPILCVEIKPKCGFIPFSSDV--THDVKHRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_010834292.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Bison 
bison bison]
Length=426

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N           T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNR--------KKTSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLDFVKQLCLKIQCERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P+S  +  ++ +K R+ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYQFAERRPILCVEIKPKCGFIPSSSDV--THELKHRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_009187460.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Papio 
anubis]
Length=448

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_004393629.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Odobenus rosmarus 
divergens]
Length=491

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P          P        +++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFP----------PSRKKTSEEIFQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG   V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FSKNVMKEFLGENSVHCGEVVQLPLDFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D         ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ VKRR+ 
Sbjct  102  DKDLDTFSGYALCLPNLARLQTYRFAEHRPILCVEIKPKCGFIPFSGDV--THEVKRRVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_006161538.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Tupaia chinensis]
Length=641

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWRYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMREFLGENYVHCGEVVQLPLEFVKQLCVKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRVAEHRPTLCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_010608886.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Fukomys 
damarensis]
 gb|KFO20765.1| Inositol-pentakisphosphate 2-kinase [Fukomys damarensis]
Length=489

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 84/181 (46%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---ARRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++D+V           F + VM  FLG   V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQDIVD----------FGKNVMKEFLGENCVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKELDTLSGYAMCLPNLTRLQTYRITEHRPILCVEIKPKCGFIPFSSSV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_003260534.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Nomascus leucogenys]
Length=578

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 88/190 (46%), Gaps = 27/190 (14%)
 Frame = -3

Query  572  RMAVVLDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLT  393
            R+ +     D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T
Sbjct  85   RLGMEEGKMDENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------T  131

Query  392  VHEIHLWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNV  213
              EI  ++ ++++V           F + VM  FLG  +V  G  + +  EF++ +   +
Sbjct  132  SEEI--FQHLQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKI  179

Query  212  LHKRPTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIE  33
              +RP  R D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  
Sbjct  180  QSERPESRCDKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--  237

Query  32   SNAVKRRITR  3
            ++ +K ++ R
Sbjct  238  THEMKHKVCR  247



>ref|XP_541331.3| PREDICTED: inositol-pentakisphosphate 2-kinase [Canis lupus familiaris]
Length=489

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 82/181 (45%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P          P        +++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFP----------PSRKKTSEEIFEH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  +F++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FSKNVMREFLGESYVHCGEVVQLPLDFVKQLCVKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  ++  + VK ++ 
Sbjct  102  DKDLDTLSGYALCLPNLARLQTYCFAEHRPILCVEIKPKCGFIPFSSDVM--HEVKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_003912033.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Papio 
anubis]
 gb|EHH24276.1| Inositol-pentakisphosphate 2-kinase [Macaca mulatta]
 gb|EHH50026.1| Inositol-pentakisphosphate 2-kinase [Macaca fascicularis]
Length=491

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_001146962.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Pan troglodytes]
 ref|XP_004048311.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Gorilla gorilla 
gorilla]
Length=491

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_005582306.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Macaca fascicularis]
Length=491

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_003807884.2| PREDICTED: inositol-pentakisphosphate 2-kinase [Pan paniscus]
Length=486

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  2    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  46

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  47   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  96

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  97   DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  154

Query  5    R  3
            R
Sbjct  155  R  155



>gb|EFA10622.1| hypothetical protein TcasGA2_TC016259 [Tribolium castaneum]
Length=189

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (46%), Gaps = 17/166 (10%)
 Frame = -3

Query  533  WSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKDVKDL  354
            W YRGEG  N+VLS          KILRI+K              +T  +I  W      
Sbjct  15   WVYRGEGNCNVVLSLPN-----ERKILRIRKTKRTTSLLSWLLNWIT--DILYWY----C  63

Query  353  VSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRVDAAK  174
             +A   E+ +  F ++++ P +G   V     + +SR+ ++ +E  + H+RP +R + + 
Sbjct  64   GNALNEELRDLTFYKKIIRPLIGINFVCDAEQVFLSRKQIKVLEDELAHQRPGYRKNKS-  122

Query  173  LNLLRDSILLMSDHSIFP---HVTPKEELCICVEIKPKCGFLPASK  45
              L      L  D+++ P   +  P       +EIKPK G++P S+
Sbjct  123  --LQYGRAALFDDYALLPDEFYPFPLSNNTYAIEIKPKQGWIPFSE  166



>ref|XP_005066372.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Mesocricetus 
auratus]
Length=489

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 80/186 (43%), Gaps = 37/186 (20%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N                     
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCI--VLRFLKFPPNK--------------------  41

Query  365  VKDLVSAPTREIAEHF-----FVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKR  201
                    + EI +H      F + VM  FLG  +V  G  + +  EF++ +   +  +R
Sbjct  42   -----KKTSEEILQHLQNIVDFGKNVMKDFLGENYVHCGEVVQLPLEFVKQLCLKIQCER  96

Query  200  PTWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAV  21
            P  R D     L   ++ L +   +  + + +    +CVEIKPKCGF+P S  +  ++ +
Sbjct  97   PESRCDKDLDTLSGYAMCLPNLTRLQTYHSAEHRPILCVEIKPKCGFIPFSNDV--THEM  154

Query  20   KRRITR  3
            K ++ R
Sbjct  155  KHKVCR  160



>ref|XP_010373400.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Rhinopithecus 
roxellana]
Length=448

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFVEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_006717298.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Homo 
sapiens]
Length=324

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_003938248.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Saimiri 
boliviensis boliviensis]
Length=491

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHCGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYHFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



>ref|XP_005522267.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Pseudopodoces 
humilis]
Length=491

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 79/192 (41%), Gaps = 41/192 (21%)
 Frame = -3

Query  557  LDAKDAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIH  378
            ++  D  EW Y GEG  +LV+S+     R    +LR  K P N    +N  P   +H + 
Sbjct  3    VEKMDENEWKYHGEGNQSLVVSH---CQRCV--VLRFLKSPPN----QNKTPEEILHHLQ  53

Query  377  LWKDVKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRP  198
               D                F + VM  F G  +V  G  I +  +F+  +   +  +RP
Sbjct  54   NIVD----------------FGKHVMKQFFGENYVHHGEIIQLPLDFVRQLCLKIQPERP  97

Query  197  TWRVDAAKLNLLRDSILLMSDHSIFPHVTPKEEL-------CICVEIKPKCGFLPASKFI  39
              R D       +D   L       P++T  +          +C+EIKPKCGF+P S  +
Sbjct  98   ECRCD-------KDMDTLSGYAMCLPNLTRLQTFRFAEHRPILCIEIKPKCGFIPFSSHV  150

Query  38   IESNAVKRRITR  3
              S  +K ++ R
Sbjct  151  --SQEIKHKVCR  160



>ref|NP_073592.1| inositol-pentakisphosphate 2-kinase [Homo sapiens]
 sp|Q9H8X2.1|IPPK_HUMAN RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=IPK1 
homolog; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: Full=Ins(1,3,4,5,6)P5 2-kinase; 
Short=InsP5 2-kinase [Homo sapiens]
 gb|AAK69692.1|AF351202_1 C9orf12 [Homo sapiens]
 gb|AAM75353.1|AF520811_1 inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Homo sapiens]
 dbj|BAB14476.1| unnamed protein product [Homo sapiens]
 gb|AAH26154.1| Inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Homo sapiens]
 gb|EAW62826.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Homo sapiens]
 gb|AIC52150.1| IPPK, partial [synthetic construct]
Length=491

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  545  DAMEWSYRGEGAINLVLSYRGIAPRFAGKILRIQKVPTNGCEYENGHPGLTVHEIHLWKD  366
            D  EW Y GEG  +LV+++   A R    +LR  K P N  +        T  EI  ++ 
Sbjct  7    DENEWGYHGEGNKSLVVAH---AQRCV--VLRFLKFPPNRKK--------TSEEI--FQH  51

Query  365  VKDLVSAPTREIAEHFFVQQVMCPFLGPEHVDAGIHILVSREFLEAVEKNVLHKRPTWRV  186
            ++++V           F + VM  FLG  +V  G  + +  EF++ +   +  +RP  R 
Sbjct  52   LQNIVD----------FGKNVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRC  101

Query  185  DAAKLNLLRDSILLMSDHSIFPHVTPKEELCICVEIKPKCGFLPASKFIIESNAVKRRIT  6
            D     L   ++ L +   +  +   +    +CVEIKPKCGF+P S  +  ++ +K ++ 
Sbjct  102  DKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDV--THEMKHKVC  159

Query  5    R  3
            R
Sbjct  160  R  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1235160523400